Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Smik_5.256.17ON61561527080.0
YEL062W (NPR2)6.17ON61561523120.0
Skud_5.276.17ON61561523070.0
Suva_5.56.17ON61962022560.0
ZYRO0C07876g6.17ON68169314290.0
TDEL0G045206.17ON67949713521e-179
CAGL0L13288g6.17ON64666413131e-174
Kpol_1045.726.17ON69559312651e-166
NDAI0D008606.17ON66667012131e-158
SAKL0E01100g6.17ON71034810851e-139
TBLA0G010106.17ON71036510771e-137
Kwal_56.224116.17ON68935310621e-135
KLLA0D01067g6.17ON66033810571e-135
KNAG0M011406.17ON59435610511e-135
Ecym_30216.17ON67435610551e-135
TPHA0J003106.17ON67536910541e-134
NCAS0H008706.17ON61235810471e-134
KLTH0C11308g6.17ON69035410511e-134
KAFR0L003806.17ON54035210201e-131
ACR009W6.17ON68036010101e-128
Skud_15.1596.28ON37973790.49
YOL003C (PFA4)6.28ON37850761.0
Suva_15.1726.28ON39870761.2
KLTH0G07018g5.272ON820102733.6
SAKL0H21450g4.93ON37494697.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Smik_5.25
         (615 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Smik_5.25 Chr5 (36761..38452,38453..38605) [1845 bp, 615 aa] {ON...  1047   0.0  
YEL062W Chr5 (34407..36254) [1848 bp, 615 aa] {ON}  NPR2Subunit ...   895   0.0  
Skud_5.27 Chr5 (33530..35377) [1848 bp, 615 aa] {ON} YEL062W (REAL)   893   0.0  
Suva_5.5 Chr5 (10147..12006) [1860 bp, 619 aa] {ON} YEL062W (REAL)    873   0.0  
ZYRO0C07876g Chr3 (598500..600545) [2046 bp, 681 aa] {ON} simila...   555   0.0  
TDEL0G04520 Chr7 (822826..824865) [2040 bp, 679 aa] {ON} Anc_6.1...   525   e-179
CAGL0L13288g Chr12 complement(1420781..1422721) [1941 bp, 646 aa...   510   e-174
Kpol_1045.72 s1045 (167094..169181) [2088 bp, 695 aa] {ON} (1670...   491   e-166
NDAI0D00860 Chr4 (193625..195625) [2001 bp, 666 aa] {ON} Anc_6.1...   471   e-158
SAKL0E01100g Chr5 complement(83492..85624) [2133 bp, 710 aa] {ON...   422   e-139
TBLA0G01010 Chr7 complement(253690..255822) [2133 bp, 710 aa] {O...   419   e-137
Kwal_56.22411 s56 complement(115007..117076) [2070 bp, 689 aa] {...   413   e-135
KLLA0D01067g Chr4 complement(94114..96096) [1983 bp, 660 aa] {ON...   411   e-135
KNAG0M01140 Chr13 complement(204691..206475) [1785 bp, 594 aa] {...   409   e-135
Ecym_3021 Chr3 complement(40454..42478) [2025 bp, 674 aa] {ON} s...   410   e-135
TPHA0J00310 Chr10 complement(68890..70917) [2028 bp, 675 aa] {ON...   410   e-134
NCAS0H00870 Chr8 (158877..160715) [1839 bp, 612 aa] {ON} Anc_6.1...   407   e-134
KLTH0C11308g Chr3 (929710..931782) [2073 bp, 690 aa] {ON} simila...   409   e-134
KAFR0L00380 Chr12 complement(69525..71147) [1623 bp, 540 aa] {ON...   397   e-131
ACR009W Chr3 (371964..374006) [2043 bp, 680 aa] {ON} Syntenic ho...   393   e-128
Skud_15.159 Chr15 complement(281485..282624) [1140 bp, 379 aa] {...    35   0.49 
YOL003C Chr15 complement(321858..322994) [1137 bp, 378 aa] {ON} ...    34   1.0  
Suva_15.172 Chr15 complement(296325..297521) [1197 bp, 398 aa] {...    34   1.2  
KLTH0G07018g Chr7 (559864..562326) [2463 bp, 820 aa] {ON} simila...    33   3.6  
SAKL0H21450g Chr8 complement(1877976..1879100) [1125 bp, 374 aa]...    31   7.9  

>Smik_5.25 Chr5 (36761..38452,38453..38605) [1845 bp, 615 aa] {ON}
           YEL062W (REAL)
          Length = 615

 Score = 1047 bits (2708), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 529/615 (86%), Positives = 529/615 (86%)

Query: 1   MLSYFQGFVPIHTIFYSVFHPTEGSKIKYEFPPNNLKNHGINFNTIKNYIIPKPVLCHKL 60
           MLSYFQGFVPIHTIFYSVFHPTEGSKIKYEFPPNNLKNHGINFNTIKNYIIPKPVLCHKL
Sbjct: 1   MLSYFQGFVPIHTIFYSVFHPTEGSKIKYEFPPNNLKNHGINFNTIKNYIIPKPVLCHKL 60

Query: 61  ITFKYGTYRIVCYPVTINSPIYARXXXXXXXXXXXPYDCETSPYEPAITRLGKMFKVLEE 120
           ITFKYGTYRIVCYPVTINSPIYAR           PYDCETSPYEPAITRLGKMFKVLEE
Sbjct: 61  ITFKYGTYRIVCYPVTINSPIYARNFFSFNFVFVFPYDCETSPYEPAITRLGKMFKVLEE 120

Query: 121 QNQLLSKSEKDPVFFDLKALENSTIAPSTACXXXXXXXXXXXXXXXXXXDKDAKDLRNSR 180
           QNQLLSKSEKDPVFFDLKALENSTIAPSTAC                  DKDAKDLRNSR
Sbjct: 121 QNQLLSKSEKDPVFFDLKALENSTIAPSTACPPATSNTSSNTTPTHPTSDKDAKDLRNSR 180

Query: 181 YNDLVKDFELPESTFSIQDLLMRIFQDLNNYSECLIPIDEGNAVDIKIFPLLRPPTTCVS 240
           YNDLVKDFELPESTFSIQDLLMRIFQDLNNYSECLIPIDEGNAVDIKIFPLLRPPTTCVS
Sbjct: 181 YNDLVKDFELPESTFSIQDLLMRIFQDLNNYSECLIPIDEGNAVDIKIFPLLRPPTTCVS 240

Query: 241 LEDVPLSSVNLEKIIDVNWDPTMMNIVPYIDGLNSIAKISKLSNSDPSLVIECIRHLIYY 300
           LEDVPLSSVNLEKIIDVNWDPTMMNIVPYIDGLNSIAKISKLSNSDPSLVIECIRHLIYY
Sbjct: 241 LEDVPLSSVNLEKIIDVNWDPTMMNIVPYIDGLNSIAKISKLSNSDPSLVIECIRHLIYY 300

Query: 301 KCVTLSDIFQFSNIYAPSSSIRNFLTDPLMANDCQYYVTFPEVSKISSLPLNKNLTSGDL 360
           KCVTLSDIFQFSNIYAPSSSIRNFLTDPLMANDCQYYVTFPEVSKISSLPLNKNLTSGDL
Sbjct: 301 KCVTLSDIFQFSNIYAPSSSIRNFLTDPLMANDCQYYVTFPEVSKISSLPLNKNLTSGDL 360

Query: 361 DXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAYRDWRQSQTSCXXX 420
           D                                            AYRDWRQSQTSC   
Sbjct: 361 DSPSFSVRRKSKSSSIPSNPGSRTTSFSSTSKVSQNSSINSSFSSAYRDWRQSQTSCSSS 420

Query: 421 XXXXXXXXXXFLPTRSCLFDLYRSLSQGQTLKAWYESKYMIIKDNNIDIRRFITFGLEKR 480
                     FLPTRSCLFDLYRSLSQGQTLKAWYESKYMIIKDNNIDIRRFITFGLEKR
Sbjct: 421 NIHISNNRNRFLPTRSCLFDLYRSLSQGQTLKAWYESKYMIIKDNNIDIRRFITFGLEKR 480

Query: 481 IIYRSYSYPVMLSVGPRETKETAPIIAKDSPNESNSSEKKYHEHSFSIIRSKNAVLFNNI 540
           IIYRSYSYPVMLSVGPRETKETAPIIAKDSPNESNSSEKKYHEHSFSIIRSKNAVLFNNI
Sbjct: 481 IIYRSYSYPVMLSVGPRETKETAPIIAKDSPNESNSSEKKYHEHSFSIIRSKNAVLFNNI 540

Query: 541 KSGRPSKVSFDMQKASSLITGESTIPKLSDDEERILEESVRSAENFDKICVLLGKPKLEV 600
           KSGRPSKVSFDMQKASSLITGESTIPKLSDDEERILEESVRSAENFDKICVLLGKPKLEV
Sbjct: 541 KSGRPSKVSFDMQKASSLITGESTIPKLSDDEERILEESVRSAENFDKICVLLGKPKLEV 600

Query: 601 ENYLNELGEFKIINS 615
           ENYLNELGEFKIINS
Sbjct: 601 ENYLNELGEFKIINS 615

>YEL062W Chr5 (34407..36254) [1848 bp, 615 aa] {ON}  NPR2Subunit of
           SEA (Seh1-associated), Npr2/3, and Iml1p complexes;
           Npr2/3 complex mediates downregulation of TORC1 activity
           upon amino acid limitation; SEA complex is a
           coatomer-related complex that associates dynamically
           with the vacuole; Iml1p complex (Iml1p-Npr2p-Npr3p) is
           required for non-nitrogen-starvation (NNS)-induced
           autophagy; Iml1p interacts primarily with phosphorylated
           Npr2p; homolog of human NPRL2; target of Grr1p; required
           for growth on urea and proline
          Length = 615

 Score =  895 bits (2312), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 449/615 (73%), Positives = 480/615 (78%)

Query: 1   MLSYFQGFVPIHTIFYSVFHPTEGSKIKYEFPPNNLKNHGINFNTIKNYIIPKPVLCHKL 60
           MLSYFQGFVPIHTIFYSVFHPTEGSKIKYEFPPNNLKNHGINFNT KNYIIPKP+LCHKL
Sbjct: 1   MLSYFQGFVPIHTIFYSVFHPTEGSKIKYEFPPNNLKNHGINFNTFKNYIIPKPILCHKL 60

Query: 61  ITFKYGTYRIVCYPVTINSPIYARXXXXXXXXXXXPYDCETSPYEPAITRLGKMFKVLEE 120
           ITFKYGTYRIVCYPVTINSPIYAR           PYDCETSPYEPAITRLGKMFKVLEE
Sbjct: 61  ITFKYGTYRIVCYPVTINSPIYARNFFSFNFVFVFPYDCETSPYEPAITRLGKMFKVLEE 120

Query: 121 QNQLLSKSEKDPVFFDLKALENSTIAPSTACXXXXXXXXXXXXXXXXXXDKDAKDLRNSR 180
           QNQLLSKSE+DPVFFDLK LENST  PSTA                   +KD KD+R+SR
Sbjct: 121 QNQLLSKSERDPVFFDLKVLENSTTTPSTAGPSSTPNPSSNTTPTHPTSEKDTKDMRSSR 180

Query: 181 YNDLVKDFELPESTFSIQDLLMRIFQDLNNYSECLIPIDEGNAVDIKIFPLLRPPTTCVS 240
           Y+DL+KD  LP+S FSIQDLLMRIFQDLNNYSECLIPIDEGNAVDIKIFPLLRPPTTCVS
Sbjct: 181 YSDLIKDLGLPQSAFSIQDLLMRIFQDLNNYSECLIPIDEGNAVDIKIFPLLRPPTTCVS 240

Query: 241 LEDVPLSSVNLEKIIDVNWDPTMMNIVPYIDGLNSIAKISKLSNSDPSLVIECIRHLIYY 300
           LEDVPLSSVNL+KIIDVNWDPTMM+IVPYIDGLNSIAKISKLSNSDP LVIECIRHLIYY
Sbjct: 241 LEDVPLSSVNLKKIIDVNWDPTMMSIVPYIDGLNSIAKISKLSNSDPGLVIECIRHLIYY 300

Query: 301 KCVTLSDIFQFSNIYAPSSSIRNFLTDPLMANDCQYYVTFPEVSKISSLPLNKNLTSGDL 360
           KCVTLSDIFQFSNIYAPSS IRNFLTDPLMA+DCQ YVTFPEVSKIS+LPLNK+L SGD 
Sbjct: 301 KCVTLSDIFQFSNIYAPSSLIRNFLTDPLMASDCQSYVTFPEVSKISNLPLNKSLGSGDQ 360

Query: 361 DXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAYRDWRQSQTSCXXX 420
           D                                             Y+DWRQSQTSC   
Sbjct: 361 DSPSFSVRRKSKSSSIPSNPDSRTTSFSSTSRVSQNSSLNSSFSSIYKDWRQSQTSCSSS 420

Query: 421 XXXXXXXXXXFLPTRSCLFDLYRSLSQGQTLKAWYESKYMIIKDNNIDIRRFITFGLEKR 480
                     FLPTRSCLFDLYRSLSQGQTLK WYESKYMI+K+NNIDIRRFITFGLEKR
Sbjct: 421 NIHVINNRNRFLPTRSCLFDLYRSLSQGQTLKTWYESKYMILKENNIDIRRFITFGLEKR 480

Query: 481 IIYRSYSYPVMLSVGPRETKETAPIIAKDSPNESNSSEKKYHEHSFSIIRSKNAVLFNNI 540
           IIYR YS+PVM++ G RE KE  PII KD  N     EK+ H H  S   S+N     N+
Sbjct: 481 IIYRCYSFPVMINAGSREPKEMTPIITKDLVNNDKLLEKRNHNHLLSATGSRNTAQSGNL 540

Query: 541 KSGRPSKVSFDMQKASSLITGESTIPKLSDDEERILEESVRSAENFDKICVLLGKPKLEV 600
           K  RPSKVSF+MQ+ SSL TG+ST+PKLSD+EE ILEES+R+AE FDKICVLL KPKLEV
Sbjct: 541 KPERPSKVSFEMQRVSSLATGKSTMPKLSDEEEGILEESIRNAETFDKICVLLSKPKLEV 600

Query: 601 ENYLNELGEFKIINS 615
           E+YLNELGEFK+INS
Sbjct: 601 ESYLNELGEFKVINS 615

>Skud_5.27 Chr5 (33530..35377) [1848 bp, 615 aa] {ON} YEL062W (REAL)
          Length = 615

 Score =  893 bits (2307), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 449/615 (73%), Positives = 483/615 (78%)

Query: 1   MLSYFQGFVPIHTIFYSVFHPTEGSKIKYEFPPNNLKNHGINFNTIKNYIIPKPVLCHKL 60
           M SYFQGFVPIHTIFYSVFHPTEGSKIKYEFPPNNLKNHGINFNTIKNYIIPKP+LCHKL
Sbjct: 1   MQSYFQGFVPIHTIFYSVFHPTEGSKIKYEFPPNNLKNHGINFNTIKNYIIPKPILCHKL 60

Query: 61  ITFKYGTYRIVCYPVTINSPIYARXXXXXXXXXXXPYDCETSPYEPAITRLGKMFKVLEE 120
           ITFKYGTYRIVCYPVTINSPIYAR           PYDCETSPYEPAITRLGKMFKVLEE
Sbjct: 61  ITFKYGTYRIVCYPVTINSPIYARNFFSFNFVFVFPYDCETSPYEPAITRLGKMFKVLEE 120

Query: 121 QNQLLSKSEKDPVFFDLKALENSTIAPSTACXXXXXXXXXXXXXXXXXXDKDAKDLRNSR 180
           QNQLLSKSEKD VFFDLKALENSTI PSTA                   DKDAKDLR+SR
Sbjct: 121 QNQLLSKSEKDAVFFDLKALENSTITPSTAGAPTTSNPSSNTTPTYPTSDKDAKDLRSSR 180

Query: 181 YNDLVKDFELPESTFSIQDLLMRIFQDLNNYSECLIPIDEGNAVDIKIFPLLRPPTTCVS 240
           YNDL KD  LPES+FSIQDLLMRIFQDLNNYSECLIPIDEGNAVDIKIFPLLRPPTTCVS
Sbjct: 181 YNDLTKDLGLPESSFSIQDLLMRIFQDLNNYSECLIPIDEGNAVDIKIFPLLRPPTTCVS 240

Query: 241 LEDVPLSSVNLEKIIDVNWDPTMMNIVPYIDGLNSIAKISKLSNSDPSLVIECIRHLIYY 300
           LEDVPLSSVNL+KIIDVNWDPTMM+IVPYIDGLNSIAKISKLS SDPSLVIECIRHLIYY
Sbjct: 241 LEDVPLSSVNLKKIIDVNWDPTMMSIVPYIDGLNSIAKISKLSRSDPSLVIECIRHLIYY 300

Query: 301 KCVTLSDIFQFSNIYAPSSSIRNFLTDPLMANDCQYYVTFPEVSKISSLPLNKNLTSGDL 360
           KCVTLSDIFQFSNIYAPSS IR FLTD LMA+DCQ YV FPE+SK+SSLPL+KNL S D 
Sbjct: 301 KCVTLSDIFQFSNIYAPSSLIRTFLTDQLMASDCQSYVAFPEISKMSSLPLSKNLDSADR 360

Query: 361 DXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAYRDWRQSQTSCXXX 420
           D                                              +DWRQSQTS    
Sbjct: 361 DSPSLFVRRKSKSSSIPSNPDSRTTSFSSNSKVSQNSSLNSSFSSVCKDWRQSQTSLSSS 420

Query: 421 XXXXXXXXXXFLPTRSCLFDLYRSLSQGQTLKAWYESKYMIIKDNNIDIRRFITFGLEKR 480
                     FLPTRSCLFDLYRSLSQG+TLK+WYESK+ I+K+NNID+RRFITFGLE+R
Sbjct: 421 NLRANDNRNRFLPTRSCLFDLYRSLSQGRTLKSWYESKHAILKENNIDVRRFITFGLERR 480

Query: 481 IIYRSYSYPVMLSVGPRETKETAPIIAKDSPNESNSSEKKYHEHSFSIIRSKNAVLFNNI 540
           IIYR YS+PVML+V  RE KE   +I KDS N+  S +KK  + SFS++ SKN+   NN+
Sbjct: 481 IIYRCYSFPVMLNVDSRERKEMTRMILKDSLNDDRSLKKKNQDASFSVVGSKNSGQPNNV 540

Query: 541 KSGRPSKVSFDMQKASSLITGESTIPKLSDDEERILEESVRSAENFDKICVLLGKPKLEV 600
           KS RPSKVSF+MQ+A SL TGE+TIPKLSD+EERILE S+RSAE+FD ICVLL K KLEV
Sbjct: 541 KSERPSKVSFEMQRAGSLATGEATIPKLSDEEERILENSIRSAESFDNICVLLSKSKLEV 600

Query: 601 ENYLNELGEFKIINS 615
           ENYLNELGEFK+INS
Sbjct: 601 ENYLNELGEFKVINS 615

>Suva_5.5 Chr5 (10147..12006) [1860 bp, 619 aa] {ON} YEL062W (REAL)
          Length = 619

 Score =  873 bits (2256), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 438/620 (70%), Positives = 482/620 (77%), Gaps = 6/620 (0%)

Query: 1   MLSYFQGFVPIHTIFYSVFHPTEGSKIKYEFPPNNLKNHGINFNTIKNYIIPKPVLCHKL 60
           M SYFQGFVPIHTIFYSVFHPTEGSKIKYEFPPNNLK+HGINFNTIKNYIIPKP+LCHKL
Sbjct: 1   MQSYFQGFVPIHTIFYSVFHPTEGSKIKYEFPPNNLKSHGINFNTIKNYIIPKPILCHKL 60

Query: 61  ITFKYGTYRIVCYPVTINSPIYARXXXXXXXXXXXPYDCETSPYEPAITRLGKMFKVLEE 120
           ITFKYGTYRIVCYPVTINSPIYAR           PYDCETSPYEPAITRLGKMFKVLEE
Sbjct: 61  ITFKYGTYRIVCYPVTINSPIYARNFFSFNFVFVFPYDCETSPYEPAITRLGKMFKVLEE 120

Query: 121 QNQLLSKSEKDPVFFDLKALENSTIAPSTACXXXXXXXXXXXXXXXXXXDKDAKDLRNSR 180
           QNQLLSKSE+DPVFFDLKA+ENS + PSTA                   DKDAKDLR++R
Sbjct: 121 QNQLLSKSERDPVFFDLKAIENSLLTPSTAGPPATSNPSSNTTPTHPTSDKDAKDLRSNR 180

Query: 181 -----YNDLVKDFELPESTFSIQDLLMRIFQDLNNYSECLIPIDEGNAVDIKIFPLLRPP 235
                YND++KD  LPESTFSIQDLLMRIFQDLNNYSECLIPID+GNAVDIKIFPLLRPP
Sbjct: 181 FNGEKYNDIIKDLGLPESTFSIQDLLMRIFQDLNNYSECLIPIDDGNAVDIKIFPLLRPP 240

Query: 236 TTCVSLEDVPLSSVNLEKIIDVNWDPTMMNIVPYIDGLNSIAKISKLSNSDPSLVIECIR 295
           TTCVSLEDVPLSSVNL+KIIDVNWDPTMM IVPYIDGLNSIAKISK S+SDPSLVIECIR
Sbjct: 241 TTCVSLEDVPLSSVNLKKIIDVNWDPTMMGIVPYIDGLNSIAKISKFSHSDPSLVIECIR 300

Query: 296 HLIYYKCVTLSDIFQFSNIYAPSSSIRNFLTDPLMANDCQYYVTFPEVSKISSLPLNKNL 355
           HLIYYKCVTLSDIFQFSNIYAPSS IRNFLTDPLMA DCQ YVTFPE+SK+S+LPLNKN 
Sbjct: 301 HLIYYKCVTLSDIFQFSNIYAPSSLIRNFLTDPLMATDCQSYVTFPEISKLSNLPLNKNF 360

Query: 356 TSGDLDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAYRDWRQSQT 415
            S D D                                              +DWRQSQT
Sbjct: 361 DSVDQDLTSFSVRRKSKSSSVPSNPNSRTTSFSSTSKVSQNSSLNSSFSSVSKDWRQSQT 420

Query: 416 SCXXXXXXXXXXXXXFLPTRSCLFDLYRSLSQGQTLKAWYESKYMIIKDNNIDIRRFITF 475
           SC             FLPTRSCLFDLYRSLSQGQTLK+WYE K+  +K+NNIDIRRFITF
Sbjct: 421 SCSSTNTHAISKRNQFLPTRSCLFDLYRSLSQGQTLKSWYELKFTTLKENNIDIRRFITF 480

Query: 476 GLEKRIIYRSYSYPVMLSVGPRETKETAPIIAKDSPNESNSSEKKYHEHSFSIIRSKNAV 535
           GLE+ IIYR YS+PVM+ VG R+TKE  P+  K+  NE NS +K+ + HS S+  SK+  
Sbjct: 481 GLERSIIYRCYSFPVMIHVGSRDTKEMTPVATKEPSNEDNSLKKRDYNHSLSVTGSKSTT 540

Query: 536 LFNNIKSGRPSKVSFDMQKASSLITGESTIPKLSDDEERILEESVRSAENFDKICVLLGK 595
              N+KS RPSKVSF+MQ+A+SL TG++ IPKLSD+E++ILE+S+RSAENFDKICVLLGK
Sbjct: 541 Q-TNVKSERPSKVSFEMQRANSLATGKNKIPKLSDEEKKILEKSIRSAENFDKICVLLGK 599

Query: 596 PKLEVENYLNELGEFKIINS 615
            K EVENYL+ELGEFK+INS
Sbjct: 600 SKQEVENYLSELGEFKVINS 619

>ZYRO0C07876g Chr3 (598500..600545) [2046 bp, 681 aa] {ON} similar
           to uniprot|P39923 Saccharomyces cerevisiae YEL062W NPR2
           Regulator of nitrogen permeases transcription is induced
           in response to proline and urea contains two PEST
           sequences
          Length = 681

 Score =  555 bits (1429), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 310/693 (44%), Positives = 402/693 (58%), Gaps = 104/693 (15%)

Query: 1   MLSYFQGFVPIHTIFYSVFHPTEGSKIKYEFPPNNLKNHGINFNTIKNYIIPKPVLCHKL 60
           M   F+GFVPIHT+FY+VFHPT+G++++YE+PP NL+ + INF+ IKNYIIPKP LCHKL
Sbjct: 15  MTDQFEGFVPIHTLFYAVFHPTKGTQVRYEYPPGNLEYNNINFDAIKNYIIPKPQLCHKL 74

Query: 61  ITFKYGTYRIVCYPVTINSPIYARXXXXXXXXXXXPYDCETSPYEPAITRLGKMFKVLEE 120
           +T KY  YRIVCYPVT+NSP YAR           PYDCETS YEPAI RLGKMF+VLEE
Sbjct: 75  LTLKYKGYRIVCYPVTVNSPYYARNFFSFNFVFVFPYDCETSSYEPAIARLGKMFRVLEE 134

Query: 121 QNQLLSKSEKDPVFFDLKALENSTIAPSTACXXXXXXXXXXXXXXXXXXDKDAKDLRNS- 179
           QNQ+LSK+E DP++FD K  +N+T                         +K  K L  S 
Sbjct: 135 QNQILSKAENDPIYFDFKLADNTT-----------------EQDGKLNAEKSFKGLTKSQ 177

Query: 180 -----RYNDLVKDFELPESTFSIQDLLMRIFQDLNNYSECLIPIDEGNAVDIKIFPLLRP 234
                +YN+++KD E  +S FS+QDL+MRIFQDLNNYSECLIPIDEGNAVDIKIFPL  P
Sbjct: 178 GMALAKYNEIMKDLESEKSDFSVQDLVMRIFQDLNNYSECLIPIDEGNAVDIKIFPLKTP 237

Query: 235 PTTCVSLEDVPLSSVNLEKIIDVNWDPTMMNIVPYIDGLNSIAKISKLSNSDPSLVIECI 294
           P +C+S+EDVP+S+VNL+ IIDVNWDPTM+ IVPYIDGLNSI+KI+KLS+SD SLV+EC+
Sbjct: 238 PNSCISIEDVPISTVNLKTIIDVNWDPTMLKIVPYIDGLNSISKIAKLSDSDVSLVLECV 297

Query: 295 RHLIYYKCVTLSDIFQFSNIYAPSSSIRNFLTDPLMANDCQYYVTFPEVSKISSLPLNKN 354
           +HL+YY CV L+DIFQFSNIYAP+S IR FLTDP +A++CQ +VT    S +S +P  + 
Sbjct: 298 KHLVYYNCVILADIFQFSNIYAPTSLIRQFLTDPTLASECQSHVTLAGHSSLSEMPFER- 356

Query: 355 LTSGDLDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAYRDWRQSQ 414
           L   DLD                                             YR  ++SQ
Sbjct: 357 LRKFDLD--------DMDQSKNQESGSRTTSMSSKSDSKSKRPFFYSAPRNPYRFNQRSQ 408

Query: 415 TSCXXXXXXXXXXXXXFLPTRSCLFDLYRSLSQGQTLKAWYESKYMIIKDNNIDIRRFIT 474
           +S               LPT++CLFDLYR+LSQG T++ WY   Y  IK N+ID+RRFIT
Sbjct: 409 SSFSSTNTNVTHDLARHLPTKACLFDLYRTLSQGVTVREWYNLNYQTIKKNDIDVRRFIT 468

Query: 475 FGLEKRIIYRSYSYPVMLSVG------PRETKETAPIIAKDSPNESNSSEKKY------- 521
           FG+ K +IYR +S+PVM  +          T      + K    + N +E KY       
Sbjct: 469 FGVIKGLIYRCFSFPVMKKMSIFDLAHKLHTAGNLNQVTKKGKGQKNLAESKYVFSTSDM 528

Query: 522 -------HEHSFS------IIRSKNAVLFNNIKSG------------------------- 543
                     +FS      ++R+    L N  + G                         
Sbjct: 529 KLGEGSKMHQNFSVDIADEVLRNVYKKLSNTNEPGSRDDYPLSRIYREESHVSLSALSGD 588

Query: 544 ------RPSKVS---FDM------------QKASSLITGESTIPKLSDDEERILEESVRS 582
                 +P +VS   FDM            QK  +     + + +  ++++ IL ES+ +
Sbjct: 589 NVSHPKKPERVSKVAFDMNKDDPVPYSLSQQKGKNKEREAAKLDRAKNNQKIILLESIAA 648

Query: 583 AENFDKICVLLGKPKLEVENYLNELGEFKIINS 615
           A+  DKICV L KP+ EVE  L+ELG++KIINS
Sbjct: 649 ADCLDKICVKLEKPRHEVEELLHELGDYKIINS 681

>TDEL0G04520 Chr7 (822826..824865) [2040 bp, 679 aa] {ON} Anc_6.17
           YEL062W
          Length = 679

 Score =  525 bits (1352), Expect = e-179,   Method: Compositional matrix adjust.
 Identities = 258/497 (51%), Positives = 322/497 (64%), Gaps = 23/497 (4%)

Query: 1   MLSYFQGFVPIHTIFYSVFHPTEGSKIKYEFPPNNLKNHGINFNTIKNYIIPKPVLCHKL 60
           M   F+GF+PIHTIFY+VFHPTEG+K++YEFPP NL++H INF+ IKNYIIPKP LCHKL
Sbjct: 1   MGDQFEGFIPIHTIFYAVFHPTEGTKVRYEFPPGNLESHNINFDAIKNYIIPKPQLCHKL 60

Query: 61  ITFKYGTYRIVCYPVTINSPIYARXXXXXXXXXXXPYDCETSPYEPAITRLGKMFKVLEE 120
           +T KY  YRI  YPVT+NSPIYAR           PYDC+TSPYEPAI RLGKMFKVLEE
Sbjct: 61  LTLKYKNYRIASYPVTVNSPIYARNFFSFNFVFVFPYDCQTSPYEPAIARLGKMFKVLEE 120

Query: 121 QNQLLSKSEKDPVFFDLKALENSTIAPSTACXXXXXXXXXXXXXXXXXXDKDAKDLRNS- 179
           QN +LSK+EKDP+F+  K +E                            +K + +L  S 
Sbjct: 121 QNLILSKAEKDPIFYHFKQVE-----------------IKDDQDAKSKPEKGSHNLSKSQ 163

Query: 180 -----RYNDLVKDFELPESTFSIQDLLMRIFQDLNNYSECLIPIDEGNAVDIKIFPLLRP 234
                +Y+ ++ D E  +STFS++DL++R++QDLNNYSECLIPIDEGNAVDIKIFP++ P
Sbjct: 164 AYASEKYHKIMTDIESADSTFSLKDLVLRVYQDLNNYSECLIPIDEGNAVDIKIFPMMTP 223

Query: 235 PTTCVSLEDVPLSSVNLEKIIDVNWDPTMMNIVPYIDGLNSIAKISKLSNSDPSLVIECI 294
           P + +S+EDVP+S+VNL K+IDVNWDPTM+ IVPYI+GLNSI+KI+KLS SDP LVIECI
Sbjct: 224 PNSNISIEDVPVSTVNLNKVIDVNWDPTMLKIVPYINGLNSISKIAKLSVSDPGLVIECI 283

Query: 295 RHLIYYKCVTLSDIFQFSNIYAPSSSIRNFLTDPLMANDCQYYVTFPEVSKISSLPLNKN 354
           +HLIYY CV L+DIFQFSNIYAP+SS+R FLTD +++ +CQ YV   E S +  LP  + 
Sbjct: 284 KHLIYYNCVLLADIFQFSNIYAPTSSLRTFLTDSVLSTECQSYVVCEEDSTLPRLPFKRV 343

Query: 355 LTSGDLDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAYRDWRQSQ 414
             S                                                 YR  + SQ
Sbjct: 344 NHSATESVDHELADSHRSQRTSGSRTTSMSSNGKFFPSSNNEMPALISEESLYRTGKHSQ 403

Query: 415 TSCXXXXXXXXXXXXXFLPTRSCLFDLYRSLSQGQTLKAWYESKYMIIKDNNIDIRRFIT 474
           +S              +LPT+SCLFDLYRSLSQG +L+ WY   Y  I+ N ID+RRFIT
Sbjct: 404 SSFSSNNTNPSNMLARYLPTKSCLFDLYRSLSQGTSLREWYGVHYGTIRANRIDVRRFIT 463

Query: 475 FGLEKRIIYRSYSYPVM 491
           FG+   +IYR YSYP+M
Sbjct: 464 FGVINGLIYRCYSYPIM 480

 Score = 57.0 bits (136), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 45/120 (37%), Positives = 61/120 (50%), Gaps = 18/120 (15%)

Query: 511 PNESNSSEKKYHEHSFSIIRSKNAVLFNNI----KSGRPSKVSFDMQKASSLITG--EST 564
           PN ++   + Y E S   +   +    NNI     S RPSKVSFD Q+    I+    S+
Sbjct: 563 PNSADPIARLYRERSLGSLADGST---NNIYRLQNSDRPSKVSFDKQQEIGHISKGMSSS 619

Query: 565 IPKLSDDEERILE---------ESVRSAENFDKICVLLGKPKLEVENYLNELGEFKIINS 615
             K+  DEE  LE         ESV +A++ D ICV L   + +VE  +  LGE+KIINS
Sbjct: 620 NDKVKMDEEAKLERRERDLILLESVEAADSLDTICVKLEMSRYDVEALIQNLGEYKIINS 679

>CAGL0L13288g Chr12 complement(1420781..1422721) [1941 bp, 646 aa]
           {ON} similar to uniprot|P39923 Saccharomyces cerevisiae
           YEL062w nitrogen permease regulator
          Length = 646

 Score =  510 bits (1313), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 293/664 (44%), Positives = 390/664 (58%), Gaps = 69/664 (10%)

Query: 1   MLSYFQGFVPIHTIFYSVFHPTEGSKIKYEFPPNNLKNHGINFNTIKNYIIPKPVLCHKL 60
           M S F+GFV IH+IFYS FHPTEGSK+K++FPP +L+N GINF++IKNY+IPK  LCH+L
Sbjct: 1   MASQFEGFVDIHSIFYSTFHPTEGSKVKFDFPPRSLENSGINFDSIKNYVIPKRALCHRL 60

Query: 61  ITFKYGTYRIVCYPVTINSPIYARXXXXXXXXXXXPYDCETSPYEPAITRLGKMFKVLEE 120
           ITFKYG YRI CYPVT+NS IYAR           P++CETSPYEPAI RLGKMF+VLE 
Sbjct: 61  ITFKYGNYRIACYPVTVNSSIYARNFFSFNFVFVFPFNCETSPYEPAIERLGKMFRVLEI 120

Query: 121 QNQLLSKSEKDPVFFDLK-ALENSTIAPSTACXXXXXXXXXXXXXXXXXXDKDAKDLRNS 179
           QNQ+LSKSE D + F+LK A +N  I   ++                    KD  +    
Sbjct: 121 QNQILSKSENDTIMFNLKSADKNFNIDNDSS----NYILGDDISSIMTTQQKDKYE---- 172

Query: 180 RYNDLVKDFELPESTFSIQDLLMRIFQDLNNYSECLIPIDEGNAVDIKIFPLLRPPTTCV 239
           R N+++ + +   S F+I DLLMR++QDLN YSECLIPID+GNAVDIK+FPLL PPT  +
Sbjct: 173 RLNNIISNIKKKPSNFTISDLLMRLYQDLNTYSECLIPIDDGNAVDIKLFPLLTPPTPYI 232

Query: 240 SLEDVPLSSVNLEKIIDVNWDPTMMNIVPYIDGLNSIAKISKLSNSDPSLVIECIRHLIY 299
           S+E VP+S VNL KI+DVNWDP M+ I+PYI+G+N+I +IS+LS+++ SLVIECIRHL+Y
Sbjct: 233 SIEHVPISLVNLFKIVDVNWDPIMLTIIPYINGINNIYRISQLSHNEESLVIECIRHLVY 292

Query: 300 YKCVTLSDIFQFSNIYAPSSSIRNFLTDPLMANDCQYYVTFPEVSKISSLPL-----NKN 354
           Y+C+ L+DIF+FSN+YAP+SS+R FL DP MA +CQ YV  P  SK++ L L       +
Sbjct: 293 YRCIVLTDIFEFSNVYAPTSSLRLFLLDPNMATECQSYVMLPINSKMNDLSLYPHHGKHS 352

Query: 355 LTSGDLDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAYRDWRQSQ 414
             +GD+                                              Y++ +QS+
Sbjct: 353 AFNGDIGSRNNSVSTSLYSFNGNDSRPQSRSSSVDQSQTNF-----------YKNKKQSE 401

Query: 415 TSCXXXXXXXXXXXXXFLPTRSCLFDLYRSLSQGQTLKAWYESKYMIIKDNNIDIRRFIT 474
           +S               LPTRS LFDLYRSLSQG TLK WY   + II+DN ID+RRFIT
Sbjct: 402 SSISTGNSNNGQNIHKHLPTRSLLFDLYRSLSQGITLKEWYMQNHKIIRDNRIDVRRFIT 461

Query: 475 FGLEKRIIYRSYSYPV---------------------MLSVGPRETKETAPIIAKDS--- 510
           FG+ +RIIYR  +Y V                     M ++   ++     + A ++   
Sbjct: 462 FGVLRRIIYRCETYSVINSTDHLQNLWKLNELENPISMENISKLQSNHIDSLAADEALMN 521

Query: 511 ---------PNESNSSEKKYHEHSFSIIRSKNAVLFNNIKSG-RPSKVSFD--------M 552
                    P++           SFS+  +   +  +  K   R SKVSF+         
Sbjct: 522 AYKKLSLKVPSKGALKSHNTSHSSFSLTPTAPEMENSQAKRNKRLSKVSFEALPEDRNGF 581

Query: 553 QKASSLIT--GESTIPKLSDDEERILEESVRSAENFDKICVLLGKPKLEVENYLNELGEF 610
           +  S++ T   E+T  KLS  + RI+ +++  AE  DKICVLL  P+  V N L+ELGE 
Sbjct: 582 RWGSNIKTPIQETTWKKLSKMQRRIMLKALADAETLDKICVLLEMPRQNVVNILHELGEL 641

Query: 611 KIIN 614
           K+IN
Sbjct: 642 KLIN 645

>Kpol_1045.72 s1045 (167094..169181) [2088 bp, 695 aa] {ON}
           (167096..169183) [2088 nt, 696 aa]
          Length = 695

 Score =  491 bits (1265), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 270/593 (45%), Positives = 353/593 (59%), Gaps = 19/593 (3%)

Query: 5   FQGFVPIHTIFYSVFHPTEGSKIKYEFPPNNLKNHGINFNTIKNYIIPKPVLCHKLITFK 64
           F GF PIHTIFYSVFHPTEG K+ Y+FPPNNL N+ INF++I++Y+IPKP LC+KL+T K
Sbjct: 4   FDGFEPIHTIFYSVFHPTEGPKVCYQFPPNNLDNYSINFDSIRSYVIPKPQLCNKLLTLK 63

Query: 65  YGTYRIVCYPVTINSPIYARXXXXXXXXXXXPYDCETSPYEPAITRLGKMFKVLEEQNQL 124
           YG YRI+ YP+TIN  IYAR           PY+C+TSPYE  I +LGKMF+VLEEQ+Q 
Sbjct: 64  YGNYRIIGYPITINCSIYARNNFSFNLVFVFPYECKTSPYESVIVKLGKMFRVLEEQSQF 123

Query: 125 LSKSEKDPVFFDLKAL------ENSTIAPSTACXXXXXXXXXXXXXXXXXXDKDAKDLRN 178
           LSK+EKD  +FD KA+      ++S + P                             +N
Sbjct: 124 LSKAEKDLAYFDFKAILHSSLDQDSKLKPEKDSSGNNNGNSNNSNNDQSNSANATDSKKN 183

Query: 179 S-----RYNDLVKDFELPESTFSIQDLLMRIFQDLNNYSECLIPIDEGNAVDIKIFPLLR 233
           S     +Y ++ +     ES FSIQD +MR++QDLNNYSECLIPID GNAVDIK+FPLLR
Sbjct: 184 SSYLFEKYKEIQEFVSNDESDFSIQDFIMRLYQDLNNYSECLIPIDAGNAVDIKLFPLLR 243

Query: 234 PPTTCVSLEDVPLSSVNLEKIIDVNWDPTMMNIVPYIDGLNSIAKISKLSNSDPSLVIEC 293
           PP   +S+EDVP+S VNL++IIDVNWDPTM+ IVP+IDG+NSIAKI+KLS+SD  LVIEC
Sbjct: 244 PPPATISIEDVPISRVNLKEIIDVNWDPTMLKIVPHIDGVNSIAKIAKLSDSDTVLVIEC 303

Query: 294 IRHLIYYKCVTLSDIFQFSNIYAPSSSIRNFLTDPLMANDCQYYVTFPEVSKISSLPLNK 353
           I+H IYY CV +SDIFQFSNIYAP+S +RNFLTDPLMA +CQ YVT PE S +  LPL +
Sbjct: 304 IKHFIYYGCVVISDIFQFSNIYAPTSLLRNFLTDPLMATECQTYVTVPESSTLHQLPL-E 362

Query: 354 NLTSGDLDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAYRDWRQS 413
           +L+   LD                                             Y +  +S
Sbjct: 363 SLSKLKLD-SDGSDSQNLRKSKNGIDSRAASFVSSRGASSHNENSSLYSRSDLYLNRHRS 421

Query: 414 QTSCXXXXXXXXXXXXXFLPTRSCLFDLYRSLSQGQTLKAWYESKYMIIKDNNIDIRRFI 473
           ++S               LPTRS LFDLYRSLSQG TLK WY+  +  I++N IDIR+FI
Sbjct: 422 ESSISSQNTNDLNGNVKQLPTRSTLFDLYRSLSQGVTLKEWYKENFFEIRNNGIDIRKFI 481

Query: 474 TFGLEKRIIYRSYSYPVMLSVGPRETKETAPIIAKDSPNESNSSEKKYHEH-SFSIIRSK 532
            FG+   ++YR  S+PV  +    E  +      KD  N   + + K  +  S  I  + 
Sbjct: 482 IFGIINGLLYRCQSFPV--TANFEEINKVKKF--KDIQNRKETRKDKLQKQLSQDIFSTS 537

Query: 533 NAVLFNNIKSGRPSKV-SFDMQKASSLITGESTIPKLSDDEERILEESVRSAE 584
           +  +  ++ SGR  ++ + D+  A S++        L  +EE     ++ S E
Sbjct: 538 DIKVGEDLISGRNRRIQTLDLDIADSVLKNVYKKLTLKTEEENSSNRALNSQE 590

 Score = 59.3 bits (142), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 39/86 (45%), Positives = 52/86 (60%), Gaps = 13/86 (15%)

Query: 541 KSGRPSKVSF----DMQKASSLITGEST-------IPKLSDDEERILEESVRSAENFDKI 589
           + G  SKVSF    +MQ ++S  +G+ T       + KL    E+IL E++ S EN DKI
Sbjct: 612 RPGTLSKVSFQQNSNMQYSAS--SGDVTENEDINNLEKLRKQNEQILLEALESTENLDKI 669

Query: 590 CVLLGKPKLEVENYLNELGEFKIINS 615
           CVLL KP+ EVE  L  L +FK+INS
Sbjct: 670 CVLLEKPRSEVEEMLKHLVDFKVINS 695

>NDAI0D00860 Chr4 (193625..195625) [2001 bp, 666 aa] {ON} Anc_6.17
           YEL062W
          Length = 666

 Score =  471 bits (1213), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 275/670 (41%), Positives = 376/670 (56%), Gaps = 71/670 (10%)

Query: 2   LSYFQGFVPIHTIFYSVFHPTEGSKIKYEFPPNNLKNHGINFNTIKNYIIPKPVLCHKLI 61
           +++F+GF+PIHTIFYS+FHPTEG+K++YEFPP+NL    I+F+ IKNYIIPK  LC+KL+
Sbjct: 10  INHFEGFMPIHTIFYSIFHPTEGTKVRYEFPPSNLAASDIHFDAIKNYIIPKKQLCNKLL 69

Query: 62  TFKYGTYRIVCYPVTINSPIYARXXXXXXXXXXXPYDCETSPYEPAITRLGKMFKVLEEQ 121
           TFKY  YRIV YP+TINS  YAR           PYDCETSPYEPAI RLGKMFKVLEEQ
Sbjct: 70  TFKYANYRIVSYPITINSDFYARNFFSFNFVFVFPYDCETSPYEPAIARLGKMFKVLEEQ 129

Query: 122 NQLLSKSEKDPVFF--DLKALENSTIAPSTACXXXXXXXXXXXXXXXXXXDKDAKDLRN- 178
           NQ+LSK+E DP++F  D    + + I P+                      +  +   N 
Sbjct: 130 NQILSKAENDPIYFKSDYTPYQPTLIIPTNNDNDGKRNKKLMKKENTIFSTRQQRSNSNR 189

Query: 179 ---------------------SRYNDLVKDFELPESTFSIQDLLMRIFQDLNNYSECLIP 217
                                    + ++ +    S  S+QDL+MRI+QDLNNYSECLIP
Sbjct: 190 ILEENSNSNSNSNSNSNGNENDNNYNTIEQYLNNNSRISVQDLIMRIYQDLNNYSECLIP 249

Query: 218 IDEGNAVDIKIFPLLRPP-TTCVSLEDVPLSSVNLEKIIDVNWDPTMMNIVPYIDGLNSI 276
           ID+GN VDIKIFPLL+PP    +S+EDVP+S V+L KI DVNWDPTM+ ++P+I+G+N I
Sbjct: 250 IDDGNNVDIKIFPLLKPPPANSLSIEDVPMSLVDLTKITDVNWDPTMLKLIPFINGINDI 309

Query: 277 AKISKLSNSDPSLVIECIRHLIYYKCVTLSDIFQFSNIYAPSSSIRNFLTDPLMANDCQY 336
           +KISKLSNS P LVIECI+HLIYY CV ++DIFQFSN Y+ +S I  FLTDP MA  CQ 
Sbjct: 310 SKISKLSNSSPMLVIECIKHLIYYNCVIITDIFQFSNTYSTTSLISTFLTDPNMATLCQN 369

Query: 337 YVTFPEVSKISSLPLNKNLTSGDLDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 396
           YV          LPL   LT                                        
Sbjct: 370 YVV---------LPLGSKLT-----RLPFHIETETSVQSSSAYRHHHNRHEKTPSFGSSI 415

Query: 397 XXXXXXXXXAYRDWRQSQTSCXXXXXXXXXX--XXXFLPTRSCLFDLYRSLSQGQTLKAW 454
                    +  D +QS+TS                 LPT+  LF+LYRSL+Q   LK W
Sbjct: 416 TSNNGRSSFSADDRKQSETSLNSSNDPSNSNLISTAHLPTKMSLFELYRSLNQRTDLKNW 475

Query: 455 YESKYMIIKDNNIDIRRFITFGLEKRIIYRSYSYPVMLS---VGPRETKETAPIIAKDSP 511
           Y+  Y  I +NNIDIR+FI FG+ K +IYR +SYP++++     P   K T+P ++    
Sbjct: 476 YKLNYTTIIENNIDIRKFIKFGIIKGLIYRCHSYPIVITPVVSAPESAKSTSPFVSSSGI 535

Query: 512 NESNSSEKKY-------------HEHSFSIIRSKNAVL---FNNIKSGR-PSKVSF---- 550
           + S  S++               H  S  +  +++ ++   +  ++ G+  SKVSF    
Sbjct: 536 SSSVDSKQHTQKGPISRFPGLGSHVPSSGVRDTRDKLMKSFYEKLEKGKNHSKVSFSDKI 595

Query: 551 ------DMQKASSLITGESTIPKLSDDEERILEESVRSAENFDKICVLLGKPKLEVENYL 604
                 +   A+S    + +  +L+  +  IL +S+ + +N DKICV LG+P+ ++E +L
Sbjct: 596 AFQNDENDHSATSSDNDDKSKSQLTLKQRNILLDSISNMDNMDKICVKLGRPRSQIEEWL 655

Query: 605 NELGEFKIIN 614
           +E G++K+IN
Sbjct: 656 SEFGDYKVIN 665

>SAKL0E01100g Chr5 complement(83492..85624) [2133 bp, 710 aa] {ON}
           similar to uniprot|P39923 Saccharomyces cerevisiae
           YEL062W NPR2 Regulator of nitrogen permeases
           transcription is induced in response to proline and urea
           contains two PEST sequences
          Length = 710

 Score =  422 bits (1085), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 200/348 (57%), Positives = 260/348 (74%), Gaps = 9/348 (2%)

Query: 1   MLSYFQGFVPIHTIFYSVFHPTEGSKIKYEFPPNNLKNHGINFNTIKNYIIPKPVLCHKL 60
           M S+F GFVPIHT+FYSVFHPTEG+K++Y+FPP NL+N+ INF+TIKNY+IPKP LC+KL
Sbjct: 1   MSSHFDGFVPIHTVFYSVFHPTEGTKVRYQFPPTNLENNDINFDTIKNYVIPKPQLCNKL 60

Query: 61  ITFKYGTYRIVCYPVTINSPIYARXXXXXXXXXXXPYDCETSPYEPAITRLGKMFKVLEE 120
           +TFKYG YR+ CYPV +N+  YAR           PY+C TSPYEPA+ RLGKMF+VLEE
Sbjct: 61  LTFKYGPYRLACYPVNVNASYYARNSFNFNFVFVFPYNCATSPYEPAVARLGKMFRVLEE 120

Query: 121 QNQLLSKSEKDPVFFDLKALENSTIAPSTACXXXXXXXXXXXXXXXXXXD-KDAKDLRN- 178
           Q+Q+LSK+E DPV+F LK+ E+ST + S                     + +D+K+    
Sbjct: 121 QSQILSKAENDPVYFHLKSQESSTNSSSHPVDQGGSDRPKDTEQGTGLNNSQDSKEQGKI 180

Query: 179 -------SRYNDLVKDFELPESTFSIQDLLMRIFQDLNNYSECLIPIDEGNAVDIKIFPL 231
                   +Y++++ D E  +   SI+DL+ +++QDLNNYSEC IPID GN+VDIK+FPL
Sbjct: 181 EGQGAAIEKYHEIMDDLEKGKKRLSIEDLITKLYQDLNNYSECFIPIDSGNSVDIKLFPL 240

Query: 232 LRPPTTCVSLEDVPLSSVNLEKIIDVNWDPTMMNIVPYIDGLNSIAKISKLSNSDPSLVI 291
           L PP +C+S EDVP+S+VNL K+IDVNWDPTM+ IVP+I+G+NSIAKI+K S+SD  LVI
Sbjct: 241 LAPPNSCLSFEDVPISTVNLAKLIDVNWDPTMLKIVPFINGVNSIAKIAKFSSSDTDLVI 300

Query: 292 ECIRHLIYYKCVTLSDIFQFSNIYAPSSSIRNFLTDPLMANDCQYYVT 339
           EC++HLIYY CV L+DIFQFSNIYA +S I  FLTDP +A++CQ YVT
Sbjct: 301 ECVKHLIYYNCVVLADIFQFSNIYASTSLISEFLTDPTLASECQTYVT 348

 Score =  100 bits (250), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 43/72 (59%), Positives = 58/72 (80%)

Query: 431 FLPTRSCLFDLYRSLSQGQTLKAWYESKYMIIKDNNIDIRRFITFGLEKRIIYRSYSYPV 490
            LPT+SCLFDLYRSL QG+T+K WY+  + II+DN+ID+RRFITFG+ + +IYR Y+YPV
Sbjct: 440 LLPTKSCLFDLYRSLHQGETVKEWYKINFEIIRDNHIDVRRFITFGIVRGLIYRCYAYPV 499

Query: 491 MLSVGPRETKET 502
           M ++G  E  +T
Sbjct: 500 MKNLGALEMLKT 511

 Score = 47.4 bits (111), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 25/53 (47%), Positives = 34/53 (64%)

Query: 563 STIPKLSDDEERILEESVRSAENFDKICVLLGKPKLEVENYLNELGEFKIINS 615
           S + K    EE +L +SV+S + FDKIC+ L K + EVE  L E+G + IINS
Sbjct: 658 SNLLKEKRHEEFLLLKSVKSVDTFDKICMRLEKDREEVEQLLKEMGHYNIINS 710

>TBLA0G01010 Chr7 complement(253690..255822) [2133 bp, 710 aa] {ON}
           Anc_6.17 YEL062W
          Length = 710

 Score =  419 bits (1077), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 209/365 (57%), Positives = 259/365 (70%), Gaps = 15/365 (4%)

Query: 1   MLSYFQGFVPIHTIFYSVFHPTEGSKIKYEFPPNNLKNHGINFNTIKNYIIPKPVLCHKL 60
           M+ +F+GFVPIHT+FYS+FHPTEG+K++YEFPP NL+ + INF+TIKNYIIPKP LCHKL
Sbjct: 1   MIDHFEGFVPIHTVFYSIFHPTEGTKVRYEFPPGNLQTYNINFDTIKNYIIPKPQLCHKL 60

Query: 61  ITFKYGTYRIVCYPVTINSPIYARXXXXXXXXXXXPYDCETSPYEPAITRLGKMFKVLEE 120
           +T KYG YR+V YPVTINS +YAR           P +CETSPYEP I RLGKMF+VLEE
Sbjct: 61  LTLKYGDYRLVSYPVTINSSLYARNFFSFNFVFVFPINCETSPYEPIIARLGKMFRVLEE 120

Query: 121 QNQLLSKSEKDPVFFD----LKALENSTIAPSTACXXXXXXXXXXXXXXXXXXDKDAKDL 176
           QNQLLS++E D V+FD    L + E  +I                         K   DL
Sbjct: 121 QNQLLSRAENDSVYFDNSHSLLSSEQDSIM-----HQDKNTSILGFSRKRFSFSKRPTDL 175

Query: 177 RNSRYNDLVKDFELPESTFSIQDLLMRIFQDLNNYSECLIPIDEGNAVDIKIFPLLRPPT 236
             S Y D         S FS+QDL+MRIFQDLNNYSECLIPIDEGN+VDIKIFP + PP+
Sbjct: 176 SLSEYPD-----NESGSNFSVQDLIMRIFQDLNNYSECLIPIDEGNSVDIKIFPSMVPPS 230

Query: 237 TCVSLEDVPLSSVNLEKIIDVNWDPTMMNIVPYIDGLNSIAKISKLSNSDPSLVIECIRH 296
             +S EDVP++ V+L  ++DVNWDPTM+ IVP+ID +NSI++I+ LSNSD   V+ECIRH
Sbjct: 231 ISISYEDVPVAMVDLSHVMDVNWDPTMLKIVPFIDSINSISRIAALSNSDVDFVVECIRH 290

Query: 297 LIYYKCVTLSDIFQFSNIYAPSSSIRNFLTDPLMANDCQYYVTFPEVSKISSLPLNKNLT 356
           L+YY+ V LSDIFQF+NIYAP+S +R+FLTD  +A DCQ YV  P+ S    LPL K++ 
Sbjct: 291 LVYYQLVILSDIFQFTNIYAPTSRLRDFLTDINLATDCQTYVCLPKNSNFGKLPLEKSIN 350

Query: 357 SGDLD 361
           + DLD
Sbjct: 351 T-DLD 354

 Score = 92.0 bits (227), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 43/89 (48%), Positives = 56/89 (62%)

Query: 431 FLPTRSCLFDLYRSLSQGQTLKAWYESKYMIIKDNNIDIRRFITFGLEKRIIYRSYSYPV 490
           +LPT+SCLFDLYRSLSQG  L  WY   Y +I  N IDIRRFITFGL + ++YR Y+ P+
Sbjct: 405 YLPTKSCLFDLYRSLSQGTVLHDWYNEHYSLIHFNKIDIRRFITFGLVRGLLYRCYAIPI 464

Query: 491 MLSVGPRETKETAPIIAKDSPNESNSSEK 519
           M + G  +   +       +P  SN  +K
Sbjct: 465 MKNAGIFDILSSLTTSQSSNPYHSNGDDK 493

 Score = 51.6 bits (122), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 23/42 (54%), Positives = 32/42 (76%)

Query: 573 ERILEESVRSAENFDKICVLLGKPKLEVENYLNELGEFKIIN 614
            R+L ES+R A+N DKIC+ L KP+ EVE  L+E+G++ IIN
Sbjct: 668 RRLLLESLREADNMDKICIKLQKPRKEVEELLSEIGDYVIIN 709

>Kwal_56.22411 s56 complement(115007..117076) [2070 bp, 689 aa] {ON}
           YEL062W (NPR2) - Non-membrane-embedded, PEST
           sequence-containing protein [contig 185] FULL
          Length = 689

 Score =  413 bits (1062), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 190/353 (53%), Positives = 251/353 (71%), Gaps = 3/353 (0%)

Query: 1   MLSYFQGFVPIHTIFYSVFHPTEGSKIKYEFPPNNLKNHGINFNTIKNYIIPKPVLCHKL 60
           M  +F GFVP+H I Y++FHPTEG+K++++FPP  L+   I F+TIKNY+IPKP LC+KL
Sbjct: 1   MSGHFDGFVPVHCILYTIFHPTEGTKVRHQFPPGCLEASDITFDTIKNYVIPKPQLCNKL 60

Query: 61  ITFKYGTYRIVCYPVTINSPIYARXXXXXXXXXXXPYDCETSPYEPAITRLGKMFKVLEE 120
           +TFKYG++R+VCYPV + +P YAR           PYDC TSPYE AI RLGKMF VLEE
Sbjct: 61  LTFKYGSFRLVCYPVNVIAPYYARNSFSFDFVFVFPYDCATSPYESAIARLGKMFTVLEE 120

Query: 121 QNQLLSKSEKDPVFFDLKALENSTIAPSTACXXXXXXXXXXXXXXXXXXDKDAKDLRNSR 180
           Q+Q+LSK+E   V+F LK  ++      T                      ++      +
Sbjct: 121 QSQILSKAENSHVYFQLKTRDSHK---HTNQEPVNDNELQGTLKNNEASQSESHGYAFEK 177

Query: 181 YNDLVKDFELPESTFSIQDLLMRIFQDLNNYSECLIPIDEGNAVDIKIFPLLRPPTTCVS 240
           Y++++KD   P    S++DL+ +I++DLNNYSECLIPID GNAVDIK+FPLL PP++C+S
Sbjct: 178 YHEILKDLNGPNKRISVEDLITKIYRDLNNYSECLIPIDSGNAVDIKLFPLLSPPSSCLS 237

Query: 241 LEDVPLSSVNLEKIIDVNWDPTMMNIVPYIDGLNSIAKISKLSNSDPSLVIECIRHLIYY 300
            EDVP+ +VNL K+IDVNWDPTM+ IVPYI+G NSIAK++KLS+SD +LV+ECIRHL+YY
Sbjct: 238 FEDVPMPTVNLAKLIDVNWDPTMLKIVPYINGTNSIAKVAKLSDSDCNLVVECIRHLLYY 297

Query: 301 KCVTLSDIFQFSNIYAPSSSIRNFLTDPLMANDCQYYVTFPEVSKISSLPLNK 353
            CV L+DIFQF NIYAP+S +  FLT+P +A +CQ YVT  E + IS LP  +
Sbjct: 298 NCVILADIFQFQNIYAPTSELSRFLTNPALATECQIYVTLDESTHISDLPFER 350

 Score = 90.9 bits (224), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 40/84 (47%), Positives = 57/84 (67%)

Query: 431 FLPTRSCLFDLYRSLSQGQTLKAWYESKYMIIKDNNIDIRRFITFGLEKRIIYRSYSYPV 490
           F  ++SCLFD+YRSLSQGQT+K WY++ +  I+   ID+RRFITFG+   ++YR YS+P+
Sbjct: 428 FFTSKSCLFDMYRSLSQGQTVKEWYKTHFEKIRAARIDVRRFITFGVIHGLLYRCYSFPI 487

Query: 491 MLSVGPRETKETAPIIAKDSPNES 514
           M +VG  E  +   +   DS  E 
Sbjct: 488 MKNVGYLEVVKALGLSDGDSSTEG 511

 Score = 50.1 bits (118), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 27/74 (36%), Positives = 45/74 (60%), Gaps = 7/74 (9%)

Query: 548 VSFDMQKASSLITGE----STIPKLSDD---EERILEESVRSAENFDKICVLLGKPKLEV 600
           V+FD+++  +  T E      + +L +D   +E +L +SVR  ENFDKIC  LG+ + EV
Sbjct: 615 VAFDVRRLVNSATAEDRKKGEVMRLEEDKRKDELLLLKSVRDVENFDKICTRLGRDREEV 674

Query: 601 ENYLNELGEFKIIN 614
           E  L +LG + +++
Sbjct: 675 EKMLEDLGPYNVVH 688

>KLLA0D01067g Chr4 complement(94114..96096) [1983 bp, 660 aa] {ON}
           similar to uniprot|P39923 Saccharomyces cerevisiae
           YEL062W NPR2 Regulator of nitrogen permeases
           transcription is induced in response to proline and urea
           contains two PEST sequences
          Length = 660

 Score =  411 bits (1057), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 193/338 (57%), Positives = 251/338 (74%), Gaps = 9/338 (2%)

Query: 1   MLSYFQGFVPIHTIFYSVFHPTEGSKIKYEFPPNNLKNHGINFNTIKNYIIPKPVLCHKL 60
           M S F GFVPIHT+FY++FHPTEGSK++++FPPN+L+N  I+F+TIKNYIIPKP LC+KL
Sbjct: 1   MTSTFDGFVPIHTVFYTLFHPTEGSKVRFQFPPNSLENGKIDFDTIKNYIIPKPQLCNKL 60

Query: 61  ITFKYGTYRIVCYPVTINSPIYARXXXXXXXXXXXPYDCETSPYEPAITRLGKMFKVLEE 120
           +TFKYG YRIVCYPV +N+  YAR           PYDC TSPYEPAI RLGKMFKVLEE
Sbjct: 61  LTFKYGEYRIVCYPVNVNARYYARNSFNFNFVFVFPYDCATSPYEPAIARLGKMFKVLEE 120

Query: 121 QNQLLSKSEKDPVFFDLKALENSTIAPSTACXXXXXXXXXXXXXXXXXXDKDAKDLRNSR 180
           Q+Q+LSKSE++PV+F LK+ +++    ST                    D  +      +
Sbjct: 121 QSQILSKSEQNPVYFQLKSNDSNAADQSTEMGSITISEHT---------DIKSTGDDGEK 171

Query: 181 YNDLVKDFELPESTFSIQDLLMRIFQDLNNYSECLIPIDEGNAVDIKIFPLLRPPTTCVS 240
           Y +++K+    + +  I+DLLM++F DLNNYSECLIPIDEGN++DIK+FP+  PP++ +S
Sbjct: 172 YLEIIKELAKNQKSLIIEDLLMKLFLDLNNYSECLIPIDEGNSIDIKLFPVRTPPSSNIS 231

Query: 241 LEDVPLSSVNLEKIIDVNWDPTMMNIVPYIDGLNSIAKISKLSNSDPSLVIECIRHLIYY 300
           +EDVP++ VNL  IIDVNWDPTM+ IVPYI+G+NS+A+I+  + SD  LV ECI+HL+YY
Sbjct: 232 VEDVPIAVVNLSDIIDVNWDPTMVKIVPYINGINSVAQIAVSARSDVELVQECIKHLMYY 291

Query: 301 KCVTLSDIFQFSNIYAPSSSIRNFLTDPLMANDCQYYV 338
            CV LSDIFQFSNIYAP+S I NFLT+P +A  CQ +V
Sbjct: 292 NCVILSDIFQFSNIYAPTSEIHNFLTNPAVAKACQLFV 329

 Score =  114 bits (286), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 86/244 (35%), Positives = 119/244 (48%), Gaps = 61/244 (25%)

Query: 432 LPTRSCLFDLYRSLSQGQTLKAWYESKYMIIKDNNIDIRRFITFGLEKRIIYRSYSYPVM 491
           LPTRSCLFDLY+SLSQG+T+K WY+  + II+DN ID+R+ I FG+ +R+IYR  SYP++
Sbjct: 418 LPTRSCLFDLYKSLSQGKTVKDWYKQNFEIIRDNRIDVRKLIMFGITRRLIYRVNSYPIV 477

Query: 492 LSVGPRE------TKE---------------TAPIIAKDSPNESNSSEK--------KYH 522
            +VG  +      +KE                A I   D+  E N S+K        K  
Sbjct: 478 KNVGTWDILKSLVSKEPKTHYGSGSSKNIFSAADIKVVDTKEEGNQSDKLDAADELLKSL 537

Query: 523 EHSFSIIR------SKNAVLFNNIKSGRP--------------SKVSFDMQKASSLITGE 562
               S+ +      SK A  +++  S                  KVSFD   A    T  
Sbjct: 538 YQKLSLKQDVPNTMSKFARYYDDSPSNNAFTESTSRKSSSGSHQKVSFDFGTAGQQKT-V 596

Query: 563 STIPKLSDDEER-----------ILEESVRSAENFDKICVLLGKPKLEVENYLNELGEFK 611
           + +P L D E+            IL ES+ +AE FDK+C  L K + EVE  L +LG + 
Sbjct: 597 TEVPDLGDGEKVEVWKKKKEEELILLESLSNAETFDKVCTKLKKSRHEVELLLKDLGHYN 656

Query: 612 IINS 615
           I+NS
Sbjct: 657 IVNS 660

>KNAG0M01140 Chr13 complement(204691..206475) [1785 bp, 594 aa] {ON}
           Anc_6.17 YEL062W
          Length = 594

 Score =  409 bits (1051), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 202/356 (56%), Positives = 255/356 (71%), Gaps = 19/356 (5%)

Query: 1   MLSYFQGFVPIHTIFYSVFHPTEGSKIKYEFPPNNLKNHGINFNTIKNYIIPKPVLCHKL 60
           M+S F+GFVPIHT+FY++FHPTEGSK+ Y+FPP NL+++ INF+ IKNYIIPKP LCH+L
Sbjct: 1   MMSKFEGFVPIHTLFYTIFHPTEGSKVCYQFPPGNLQHYDINFDAIKNYIIPKPQLCHRL 60

Query: 61  ITFKYGTYRIVCYPVTINSPIYARXXXXXXXXXXXPYDCETSPYEPAITRLGKMFKVLEE 120
           +T KYG YRIV YPV + S  YAR           PY+C TSPYEPAITRLGKMF+VLEE
Sbjct: 61  LTMKYGNYRIVSYPVAVQSSSYARNYFRFNFVFVFPYECATSPYEPAITRLGKMFRVLEE 120

Query: 121 QNQLLSKSEKDPVFFDLKALENSTIAPSTACXXXXXXXXXXXXXXXXXXDKDAKDLRNSR 180
           Q+Q+LS++E+D   F    L       ++A                   DK  +      
Sbjct: 121 QSQVLSRAERDDSLFKGDKLPFDN---NSAKNQAPLTHALISKTKSFSPDKKTEG----- 172

Query: 181 YNDLVKDFELPESTFSIQDLLMRIFQDLNNYSECLIPIDEGNAVDIKIFPLLRPPTTC-V 239
                 D  L     S+QDL+MRI+QDLNNYSECLIPIDEGNA+DIKIFPL+ PPT+  +
Sbjct: 173 ------DIHL----ISVQDLIMRIYQDLNNYSECLIPIDEGNAIDIKIFPLINPPTSVHL 222

Query: 240 SLEDVPLSSVNLEKIIDVNWDPTMMNIVPYIDGLNSIAKISKLSNSDPSLVIECIRHLIY 299
           S+EDVP+  V L+KIID+NWDPTM++I+P+I+G+NSI  I++LS+SDP LVIECI+HLIY
Sbjct: 223 SIEDVPMLVVKLKKIIDLNWDPTMVSILPFINGVNSILNIARLSDSDPELVIECIKHLIY 282

Query: 300 YKCVTLSDIFQFSNIYAPSSSIRNFLTDPLMANDCQYYVTFPEVSKISSLPLNKNL 355
           YKCV ++DIFQFSNIYAPSS I  FLTDP MA DCQ YVT P+ S++  +PL  ++
Sbjct: 283 YKCVIITDIFQFSNIYAPSSLINEFLTDPTMAYDCQEYVTLPKSSRLIHMPLQTSV 338

 Score =  116 bits (291), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 77/200 (38%), Positives = 117/200 (58%), Gaps = 25/200 (12%)

Query: 431 FLPTRSCLFDLYRSLSQGQTLKAWYESKYMIIKDNNIDIRRFITFGLEKRIIYRSYSYPV 490
           + PTR  LFDLYRSLSQG TL+ WY + +  I+ N ID+R+FI FG  K+IIYR  SYPV
Sbjct: 403 YYPTRMVLFDLYRSLSQGITLEKWYTTNFTTIRSNYIDVRKFIQFGTIKKIIYRVLSYPV 462

Query: 491 MLSVGPRETKETAPIIAKDSPNESNSSEKKYHEH----SFSIIRSKNA-VLFNNIKSGRP 545
           +        K    IIAK    +S  +EK  H      S S I+  +   LFN++ + R 
Sbjct: 463 L-------EKRRNSIIAKQM-GKSKMAEKAPHSKNAFFSTSDIKFDDGDRLFNSLYA-RF 513

Query: 546 SKVSFDMQKASS-------LITGESTIPK----LSDDEERILEESVRSAENFDKICVLLG 594
           SKVSF+ ++ ++        + G +   K    L+ +E+  L  ++ + E+FDKICV LG
Sbjct: 514 SKVSFEKRRENARERKSFDAVGGTNGADKETMILTKEEKLQLLGALDNLESFDKICVQLG 573

Query: 595 KPKLEVENYLNELGEFKIIN 614
           + ++E+ N + ++GE+++IN
Sbjct: 574 RSRVEIANLIADIGEYRVIN 593

>Ecym_3021 Chr3 complement(40454..42478) [2025 bp, 674 aa] {ON}
           similar to Ashbya gossypii ACR009W
          Length = 674

 Score =  410 bits (1055), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 192/356 (53%), Positives = 260/356 (73%), Gaps = 14/356 (3%)

Query: 1   MLSYFQGFVPIHTIFYSVFHPTEGSKIKYEFPPNNLKNHGINFNTIKNYIIPKPVLCHKL 60
           M ++F GFVPIH+IFYS+FHPTEG+K++++FPP++L+N GI+F+TIKNY+IPKP LC+KL
Sbjct: 1   MSNHFDGFVPIHSIFYSLFHPTEGTKVRFQFPPDSLENSGISFDTIKNYVIPKPQLCNKL 60

Query: 61  ITFKYGTYRIVCYPVTINSPIYARXXXXXXXXXXXPYDCETSPYEPAITRLGKMFKVLEE 120
           +TFKYG+YR+VCYPV IN+  YAR           PYD  TSPYEPAI RLGKMF+VLEE
Sbjct: 61  LTFKYGSYRLVCYPVNINASYYARNSFSFDFVFVFPYDSATSPYEPAIGRLGKMFRVLEE 120

Query: 121 QNQLLSKSEKDPVFF-----DLKALENSTIAPSTACXXXXXXXXXXXXXXXXXXDKDAKD 175
           Q+Q+LSK E+DP+++     D+KA++ ++  P +                    +K    
Sbjct: 121 QSQVLSKIERDPIYYHLKTQDVKAVDQNSEEPESKNNPQNCNDKIRRGHHEHAFEK---- 176

Query: 176 LRNSRYNDLVKDFELPESTFSIQDLLMRIFQDLNNYSECLIPIDEGNAVDIKIFPLLRPP 235
                Y++++K   + E   SI+DL+ ++++DLNNYSECLIP+D GNA+DIK+FPLL PP
Sbjct: 177 -----YHEIMKHIAMNEKQLSIEDLITKLYEDLNNYSECLIPMDSGNAIDIKLFPLLAPP 231

Query: 236 TTCVSLEDVPLSSVNLEKIIDVNWDPTMMNIVPYIDGLNSIAKISKLSNSDPSLVIECIR 295
            +C S+EDVP++ +NL   +DVNWDPTM+ IVPYI+G+NSIAKISK S+SD  LV+EC++
Sbjct: 232 NSCFSVEDVPIAKLNLIDWVDVNWDPTMVKIVPYINGINSIAKISKYSDSDVGLVMECVK 291

Query: 296 HLIYYKCVTLSDIFQFSNIYAPSSSIRNFLTDPLMANDCQYYVTFPEVSKISSLPL 351
           HLIYY CV L D+FQFSNIYAP+S +  FLTDP +A +CQ YV   E S++  LP 
Sbjct: 292 HLIYYDCVVLVDMFQFSNIYAPTSQLSEFLTDPSIARECQLYVISSEDSELHQLPF 347

 Score =  102 bits (253), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 43/64 (67%), Positives = 54/64 (84%)

Query: 432 LPTRSCLFDLYRSLSQGQTLKAWYESKYMIIKDNNIDIRRFITFGLEKRIIYRSYSYPVM 491
           LPTRSCLFDLYRSLSQGQT+K WY+  + +I+ N ID+RRFITFG+ +++IYR YSYPV 
Sbjct: 426 LPTRSCLFDLYRSLSQGQTMKDWYKMNFEVIRKNRIDVRRFITFGVFRKLIYRCYSYPVA 485

Query: 492 LSVG 495
            S+G
Sbjct: 486 KSIG 489

 Score = 38.1 bits (87), Expect = 0.067,   Method: Compositional matrix adjust.
 Identities = 28/77 (36%), Positives = 41/77 (53%), Gaps = 7/77 (9%)

Query: 546 SKVSFDMQKASSLITGE-------STIPKLSDDEERILEESVRSAENFDKICVLLGKPKL 598
           +KV FDM+   S    E       ST  K    ++ +L +S+++ ++FDKI + L   K 
Sbjct: 598 AKVLFDMKDRLSNKDFEYRDQNAASTELKRKRQQQFLLLKSIKNVDSFDKIAIKLEINKQ 657

Query: 599 EVENYLNELGEFKIINS 615
           EVE  L   GE+ IINS
Sbjct: 658 EVEELLKATGEYNIINS 674

>TPHA0J00310 Chr10 complement(68890..70917) [2028 bp, 675 aa] {ON}
           Anc_6.17 YEL062W
          Length = 675

 Score =  410 bits (1054), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 207/369 (56%), Positives = 254/369 (68%), Gaps = 16/369 (4%)

Query: 1   MLSYFQGFVPIHTIFYSVFHPTEGSKIKYEFPPNNLKNHGINFNTIKNYIIPKPVLCHKL 60
           M + F GFVPIH IFYSVFHPTEG+K+ YEFPP+NL   GINF+ IKNY+IPKP LCHKL
Sbjct: 1   MNNSFDGFVPIHGIFYSVFHPTEGTKVSYEFPPSNLVKSGINFDAIKNYVIPKPQLCHKL 60

Query: 61  ITFKYGTYRIVCYPVTINSPIYARXXXXXXXXXXXPYDCETSPYEPAITRLGKMFKVLEE 120
           +T KY  YRIV YP+ INS +YAR           PY+CETSPYEP + RLGKMF  LE 
Sbjct: 61  LTLKYNNYRIVGYPIIINSSLYARNNFSFNLVFVFPYECETSPYEPVVERLGKMFCELEG 120

Query: 121 QNQLLSKSEKDPVFFDLKAL-------------ENSTIAPSTACXXXXXXXXXXXXXXXX 167
           Q Q LSK EKD  +FD K +             +N+ ++ + +                 
Sbjct: 121 QCQFLSKCEKDMAYFDFKLISNLIDQDKSNTEPDNNILSKTNSMILPTISNIDTTVGSTN 180

Query: 168 XXDK-DAKDLRN--SRYNDLVKDFELPESTFSIQDLLMRIFQDLNNYSECLIPIDEGNAV 224
             DK ++K++    S+YN +    +  +   S+ D+LMR+FQDLN+YSEC IPID+GNA+
Sbjct: 181 TQDKANSKEVEYLFSKYNVIQNYIKNDKMQLSMNDILMRVFQDLNSYSECYIPIDDGNAI 240

Query: 225 DIKIFPLLRPPTTCVSLEDVPLSSVNLEKIIDVNWDPTMMNIVPYIDGLNSIAKISKLSN 284
           DIK+FP L PP   +S+EDVP+ +VNL KIIDVNWDPTM+ IVPYIDGLNSI KI+ LSN
Sbjct: 241 DIKLFPTLMPPIDSISVEDVPIPTVNLNKIIDVNWDPTMLKIVPYIDGLNSIFKIANLSN 300

Query: 285 SDPSLVIECIRHLIYYKCVTLSDIFQFSNIYAPSSSIRNFLTDPLMANDCQYYVTFPEVS 344
           SD  LVIECIRH +YY CV LSDIFQFSNIYAP+SSI +FLTDP +A +CQ YVT PE S
Sbjct: 301 SDAMLVIECIRHFVYYGCVILSDIFQFSNIYAPTSSITDFLTDPTLATECQIYVTSPEDS 360

Query: 345 KISSLPLNK 353
            +S+LP  K
Sbjct: 361 LLSALPFKK 369

 Score = 77.4 bits (189), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 80/228 (35%), Positives = 119/228 (52%), Gaps = 44/228 (19%)

Query: 431 FLPTRSCLFDLYRSLSQGQTLKAWYESKYMIIKDNNIDIRRFITFGLEKRIIYRSYSYPV 490
           +LPT+S LFDLYRSLSQG  L+ WY+  +  I+DN IDIRRFI FG+ KRIIYR +SYP+
Sbjct: 447 YLPTKSTLFDLYRSLSQGVKLEEWYQINFNSIRDNFIDIRRFIIFGIIKRIIYRCHSYPL 506

Query: 491 ------MLSVGPRETKETAPIIAKDSP-----NESNSSEKKYHEHSFSIIRSKNAVL--- 536
                    +   +  +  P I K+       N  ++S+ K+    ++  + K   L   
Sbjct: 507 PKNYEAFSKLNDLKNLQNGPKIVKNKSQSYTYNIFSTSDIKFGVDLYTDTKKKLHTLDVD 566

Query: 537 -----FNNI-----KSGR-----------PSKVSFDMQKASSLITG-------EST--IP 566
                 NN+      +GR           PSKV+F  Q   + + G       E+T    
Sbjct: 567 VADRVLNNVYKKLSTNGRPTTSINGQGQHPSKVAFKNQSYDNDLPGLMNNLGIEATKFSR 626

Query: 567 KLSDDEERILEESVRSAENFDKICVLLGKPKLEVENYLNELGEFKIIN 614
           +++ +++  L ++++SAEN D IC  L   + EVE  LNEL E++IIN
Sbjct: 627 EININDKIYLLDALQSAENLDNICSNLELSREEVETLLNELTEYRIIN 674

>NCAS0H00870 Chr8 (158877..160715) [1839 bp, 612 aa] {ON} Anc_6.17
           YEL062W
          Length = 612

 Score =  407 bits (1047), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 202/358 (56%), Positives = 258/358 (72%), Gaps = 16/358 (4%)

Query: 2   LSYFQGFVPIHTIFYSVFHPTEGSKIKYEFPPNNLKNHGINFNTIKNYIIPKPVLCHKLI 61
           L++F+GF+PIHTIFYS+FHPTEG+K+ YEFPP NL N  INF+TIKNYIIPK  LC++L+
Sbjct: 9   LNHFEGFMPIHTIFYSIFHPTEGTKVCYEFPPKNLSNFHINFDTIKNYIIPKNQLCNRLL 68

Query: 62  TFKYGTYRIVCYPVTINSPIYARXXXXXXXXXXXPYDCETSPYEPAITRLGKMFKVLEEQ 121
           TFKY  YRIV YP+TIN+P YAR           PY+CETSPYEP+I RLGKMFK+LEEQ
Sbjct: 69  TFKYENYRIVSYPITINAPYYARNFFSFNFVFVFPYECETSPYEPSIARLGKMFKILEEQ 128

Query: 122 NQLLSKSEKDPVFFD---LKALENSTIAPSTACXXXXXXXXXXXXXXXXXXDKDAKDLRN 178
           +Q+LSK+E DP++F    +     +TI P  +                   +    +   
Sbjct: 129 SQILSKAENDPIYFKSDYVPTEPTTTIIPQIS-----------PSHRNKRNNDHNDNNDG 177

Query: 179 SRY-NDLVKDFELPESTFSIQDLLMRIFQDLNNYSECLIPIDEGNAVDIKIFPLLR-PPT 236
           SR+  D   + E   + FS+QDL+MRI+QDLNNYSECLIPID+GN ++IK+FPLL+ PP 
Sbjct: 178 SRFETDFFGEEEDGVTKFSVQDLIMRIYQDLNNYSECLIPIDKGNDINIKVFPLLKPPPN 237

Query: 237 TCVSLEDVPLSSVNLEKIIDVNWDPTMMNIVPYIDGLNSIAKISKLSNSDPSLVIECIRH 296
             +SLEDVP+S +NL  +IDVNWDPTM+NIVPYI+G+N I+KI+KL+ +DP LVIECI+H
Sbjct: 238 HLISLEDVPMSLINLNNVIDVNWDPTMLNIVPYINGVNDISKIAKLTKADPLLVIECIKH 297

Query: 297 LIYYKCVTLSDIFQFSNIYAPSSSIRNFLTDPLMANDCQYYVTFPEVSKISSLPLNKN 354
           L+YY CV ++DIFQFSN+YAP+S I +FLTD  MA  CQ YV  P  SK+S LP   N
Sbjct: 298 LVYYNCVIITDIFQFSNVYAPTSLICSFLTDQEMATQCQNYVVLPIGSKLSHLPFENN 355

 Score =  125 bits (314), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 82/197 (41%), Positives = 115/197 (58%), Gaps = 15/197 (7%)

Query: 432 LPTRSCLFDLYRSLSQGQTLKAWYESKYMIIKDNNIDIRRFITFGLEKRIIYRSYSYPVM 491
           LPT++CLFDLYRSLS G TL++WY+S   II +NN+D+R+FI FG+ + +IYR +SYP+ 
Sbjct: 414 LPTKACLFDLYRSLSYGVTLRSWYQSNATIITENNVDVRKFIKFGIIRGLIYRCHSYPIP 473

Query: 492 L---SVGPRETKETAPIIAKDSPNESNSSEKKYHEHSFSIIRSKNAV--------LFNNI 540
               + G +  +    I A      S+ S  + +  S S   +  +         L  N+
Sbjct: 474 QRPSNEGIQRIERLNDIDAHRLQIRSSGSAARSNSGSGSGSSASPSSINVDGADELLKNV 533

Query: 541 --KSGRPSKVSF-DMQKASSLITGESTIPKLSDDEER-ILEESVRSAENFDKICVLLGKP 596
             K  R SKVSF D +K  S+ T E   P     EER +L +S+ S EN DKICV LGK 
Sbjct: 534 YKKLERHSKVSFMDKEKNESMKTDEKGRPSTMTKEERSVLLKSIESLENLDKICVKLGKS 593

Query: 597 KLEVENYLNELGEFKII 613
           + +VE +L+ELG +KII
Sbjct: 594 RQQVERWLDELGNYKII 610

>KLTH0C11308g Chr3 (929710..931782) [2073 bp, 690 aa] {ON} similar
           to uniprot|P39923 Saccharomyces cerevisiae YEL062W NPR2
           Regulator of nitrogen permeases transcription is induced
           in response to proline and urea contains two PEST
           sequences
          Length = 690

 Score =  409 bits (1051), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 190/354 (53%), Positives = 254/354 (71%), Gaps = 3/354 (0%)

Query: 1   MLSYFQGFVPIHTIFYSVFHPTEGSKIKYEFPPNNLKNHGINFNTIKNYIIPKPVLCHKL 60
           M  +F GFVP+H IFYSVFHPTEG+K++++FP   L+   I F+TIKNY+IPKP LC+KL
Sbjct: 1   MSGHFDGFVPVHGIFYSVFHPTEGTKVRHQFPSGCLELSDITFDTIKNYVIPKPQLCNKL 60

Query: 61  ITFKYGTYRIVCYPVTINSPIYARXXXXXXXXXXXPYDCETSPYEPAITRLGKMFKVLEE 120
           +TFKYG +R+VCYPV + +P YAR           PYDC TSPYEPAI RLGKMF VLEE
Sbjct: 61  LTFKYGPFRLVCYPVNVVAPYYARNSFSFDFVFVFPYDCATSPYEPAIERLGKMFTVLEE 120

Query: 121 QNQLLSKSEKDPVFFDLKALENSTIAPSTACXXXXXXXXXXXXXXXXXXDKDAKDLRNSR 180
           Q+Q+LSK+E   V+F LKA  N+    +T                    +       +++
Sbjct: 121 QSQILSKAENSSVYFQLKA-RNTQKHGNTETAKGTEQPSSLDIGEIAQPENQG--YASAK 177

Query: 181 YNDLVKDFELPESTFSIQDLLMRIFQDLNNYSECLIPIDEGNAVDIKIFPLLRPPTTCVS 240
           Y +++KD E P    +I DL+ +I++DLN+YSECLIPID GNAVDIK+FPLL PP++C S
Sbjct: 178 YYEILKDLEGPSKKIAIGDLITKIYRDLNDYSECLIPIDSGNAVDIKLFPLLSPPSSCFS 237

Query: 241 LEDVPLSSVNLEKIIDVNWDPTMMNIVPYIDGLNSIAKISKLSNSDPSLVIECIRHLIYY 300
           +EDVP+S+VNL K+IDVNWDPTM+ IVP+I+G+NSIAK++K S+SD +LV+ECI+HLIYY
Sbjct: 238 IEDVPISTVNLAKLIDVNWDPTMLKIVPHINGINSIAKVAKFSDSDVNLVVECIKHLIYY 297

Query: 301 KCVTLSDIFQFSNIYAPSSSIRNFLTDPLMANDCQYYVTFPEVSKISSLPLNKN 354
            CV L+DIFQFSNIYA ++ +  FLT+P +A +CQ YV + E + + +LP  + 
Sbjct: 298 NCVILTDIFQFSNIYASTNELSRFLTEPTLAAECQIYVAYNESAHLPNLPFERG 351

 Score = 90.5 bits (223), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 38/69 (55%), Positives = 54/69 (78%)

Query: 434 TRSCLFDLYRSLSQGQTLKAWYESKYMIIKDNNIDIRRFITFGLEKRIIYRSYSYPVMLS 493
           ++SCLFDLYRSL+QGQT++ WY++ +  I+   ID+RRFITFG+   +IYRSYSYPV+ +
Sbjct: 433 SKSCLFDLYRSLTQGQTIREWYKTHFEKIRAARIDVRRFITFGVLHGLIYRSYSYPVLRN 492

Query: 494 VGPRETKET 502
           +G  E+ E 
Sbjct: 493 IGFAESVEA 501

 Score = 56.6 bits (135), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 35/87 (40%), Positives = 54/87 (62%), Gaps = 11/87 (12%)

Query: 538 NNIKSGRPSKVSFDMQKASSLITGESTIPKLSD---------DEERILEESVRSAENFDK 588
           N++ S   +KV+FD++K  +L T  +   + S+         +EE IL +SVRS  NFDK
Sbjct: 606 NSMGSDIKNKVAFDVRK--TLATSSADERRRSEILRSIEEKRNEELILLKSVRSVHNFDK 663

Query: 589 ICVLLGKPKLEVENYLNELGEFKIINS 615
           IC LLGK +  VE+ L+ELG + +++S
Sbjct: 664 ICTLLGKDRERVESMLSELGPYNVLHS 690

>KAFR0L00380 Chr12 complement(69525..71147) [1623 bp, 540 aa] {ON}
           Anc_6.17 YEL062W
          Length = 540

 Score =  397 bits (1020), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 195/352 (55%), Positives = 249/352 (70%), Gaps = 48/352 (13%)

Query: 1   MLSYFQGFVPIHTIFYSVFHPTEGSKIKYEFPPNNLKNHGINFNTIKNYIIPKPVLCHKL 60
           M + F+GF PIHTIF+S+FHPTEGSK+ Y+FPP NL+ + INF++IKN++IPKP LCH+L
Sbjct: 1   MNTQFEGFEPIHTIFFSIFHPTEGSKVCYQFPPENLQAYNINFDSIKNFVIPKPQLCHRL 60

Query: 61  ITFKYGTYRIVCYPVTINSPIYARXXXXXXXXXXXPYDCETSPYEPAITRLGKMFKVLEE 120
           +T +Y  YR+V YPV ++S  YAR            YDC+T PYEPAI RLGKMFK LEE
Sbjct: 61  LTLEYKNYRLVSYPVNVSSSSYARNFFSFNFVFIFSYDCQTLPYEPAIERLGKMFKTLEE 120

Query: 121 QNQLLSKSEKDPVFFDLKALENSTIAPSTACXXXXXXXXXXXXXXXXXXDKDAKDLRNSR 180
           Q+Q+LSKS++   FF                                   KD +D+    
Sbjct: 121 QSQILSKSQRTSAFF-----------------------------------KDGEDV---- 141

Query: 181 YNDLVKDFELPESTFSIQDLLMRIFQDLNNYSECLIPIDEGNAVDIKIFPLLRPPTTC-V 239
                   +  ++ FSIQDLLMR++QDLNNYSECLIPIDEGN ++IKIFP+L+PPT+  +
Sbjct: 142 --------DFVDTKFSIQDLLMRLYQDLNNYSECLIPIDEGNEINIKIFPVLKPPTSVQI 193

Query: 240 SLEDVPLSSVNLEKIIDVNWDPTMMNIVPYIDGLNSIAKISKLSNSDPSLVIECIRHLIY 299
           S+EDVPLS VNL+KI+D+NWDPTM++I+P+IDG+NSI  IS LS+SDP+LVIECI+HLIY
Sbjct: 194 SIEDVPLSIVNLDKIVDLNWDPTMLSILPFIDGVNSITNISHLSDSDPNLVIECIKHLIY 253

Query: 300 YKCVTLSDIFQFSNIYAPSSSIRNFLTDPLMANDCQYYVTFPEVSKISSLPL 351
           Y CV ++DIFQFSNIYAPSS I NFL DP++A +CQ YV  P  SKI+ LPL
Sbjct: 254 YNCVIITDIFQFSNIYAPSSLINNFLRDPMIAFNCQSYVVLPPGSKINDLPL 305

 Score =  110 bits (275), Expect = 7e-25,   Method: Compositional matrix adjust.
 Identities = 70/190 (36%), Positives = 104/190 (54%), Gaps = 27/190 (14%)

Query: 432 LPTRSCLFDLYRSLSQGQTLKAWYESKYMIIKDNNIDIRRFITFGLEKRIIYRSYSYPVM 491
           LP++  LFDLYRSL+ G T++AWY+  +  IK+N+ID+R+FI FG+  +IIYR + YP+M
Sbjct: 372 LPSKCTLFDLYRSLNYGCTVEAWYKQNFSTIKENHIDVRKFIKFGVINKIIYRVHQYPIM 431

Query: 492 LSVGPRETKETAPIIAKDSPNESNSSEKKYHEHSFSIIRSKNAVLFN------NIKSGRP 545
                 E K     +  D  N+              I+ S + + F+      N    + 
Sbjct: 432 ------EHKTFKSPLLSDRQND-------------KIVLSTSDIKFDVGDRILNSIYNKL 472

Query: 546 SKVSFDMQKASSLITGESTIPKLSDDEERILEESVRSAENFDKICVLLGKPKLEVENYLN 605
           SKV+FD  K      G S    L + E+ IL  ++   E+FD+IC  LGK K EVE+ ++
Sbjct: 473 SKVTFDRDKKLESKIGNSR--NLGESEKNILFNALERHESFDRICSKLGKSKNEVESIIS 530

Query: 606 ELGEFKIINS 615
           E+GE+  INS
Sbjct: 531 EIGEYMTINS 540

>ACR009W Chr3 (371964..374006) [2043 bp, 680 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YEL062W (NPR2)
          Length = 680

 Score =  393 bits (1010), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 184/360 (51%), Positives = 249/360 (69%), Gaps = 10/360 (2%)

Query: 1   MLSYFQGFVPIHTIFYSVFHPTEGSKIKYEFPPNNLKNHGINFNTIKNYIIPKPVLCHKL 60
           M + F GFVPIH IFY++FHPTEG+K++++FP ++L+  GI F+TIKNY+IPK  LC+KL
Sbjct: 8   MPNKFDGFVPIHCIFYALFHPTEGTKVRFQFPSDSLEKSGIRFDTIKNYVIPKSQLCNKL 67

Query: 61  ITFKYGTYRIVCYPVTINSPIYARXXXXXXXXXXXPYDCETSPYEPAITRLGKMFKVLEE 120
           +TFK+G+YR+VCYPV I +P YAR           PYD  TSPYEPAI RL KM +VLEE
Sbjct: 68  VTFKFGSYRLVCYPVNIKAPYYARNSFSFNLVFVFPYDSATSPYEPAIARLAKMLRVLEE 127

Query: 121 QNQLLSKSEKDPVFFDLKALENSTIAPSTACXXXXXXXXXXXXXXXXXXDKDAKDLRNS- 179
           Q+Q+LSK E+DPV++ LK  E       T                    DK ++   N+ 
Sbjct: 128 QSQMLSKVERDPVYYQLKTGETKAAEQKTE--------ESDSKAKTHNLDKKSRAQHNAT 179

Query: 180 -RYNDLVKDFELPESTFSIQDLLMRIFQDLNNYSECLIPIDEGNAVDIKIFPLLRPPTTC 238
            +Y++++K     E    I+DL+ ++++DLNNYSECLIP+D GNA+DIK+FPLL PP +C
Sbjct: 180 TKYHEIMKHINSDEKNLYIEDLITKLYEDLNNYSECLIPMDSGNAIDIKLFPLLTPPNSC 239

Query: 239 VSLEDVPLSSVNLEKIIDVNWDPTMMNIVPYIDGLNSIAKISKLSNSDPSLVIECIRHLI 298
           +S EDVP++ VNL  ++DVNWDPTM+ IVP+I+G+NSIAKISK S+S   LV+ECI+HL+
Sbjct: 240 LSFEDVPIAKVNLMNLVDVNWDPTMLKIVPFINGINSIAKISKCSDSAVELVMECIKHLV 299

Query: 299 YYKCVTLSDIFQFSNIYAPSSSIRNFLTDPLMANDCQYYVTFPEVSKISSLPLNKNLTSG 358
           YY CV L D+FQFSNIYAP++ +R+FL D ++  +CQ YV   E  +I  LP       G
Sbjct: 300 YYDCVALVDMFQFSNIYAPTNLLRDFLFDFILPRECQVYVVSSEDCEIHRLPFESRPNGG 359

 Score = 95.5 bits (236), Expect = 8e-20,   Method: Compositional matrix adjust.
 Identities = 42/67 (62%), Positives = 51/67 (76%)

Query: 432 LPTRSCLFDLYRSLSQGQTLKAWYESKYMIIKDNNIDIRRFITFGLEKRIIYRSYSYPVM 491
           LPTR  LFDLYRSL+QGQTLK WY++ Y  I++N ID+RR I FG+  R+IYR YSYPV 
Sbjct: 429 LPTRRVLFDLYRSLTQGQTLKEWYKANYSAIRENQIDVRRLIIFGVFHRLIYRCYSYPVA 488

Query: 492 LSVGPRE 498
            S+G  E
Sbjct: 489 KSIGTLE 495

 Score = 40.8 bits (94), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 21/44 (47%), Positives = 29/44 (65%)

Query: 572 EERILEESVRSAENFDKICVLLGKPKLEVENYLNELGEFKIINS 615
           +E +L +SV+S ++FDKI V L   K EVE  L   GE+ I+NS
Sbjct: 637 QEFLLLQSVKSVDSFDKIAVRLEMNKHEVERLLKGTGEYNIVNS 680

>Skud_15.159 Chr15 complement(281485..282624) [1140 bp, 379 aa] {ON}
           YOL003C (REAL)
          Length = 379

 Score = 35.0 bits (79), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 24/73 (32%), Positives = 35/73 (47%), Gaps = 7/73 (9%)

Query: 534 AVLF-----NNIKSGRPSKVSFDMQKASSLITGESTIPKLSDDEERILEE--SVRSAENF 586
           A+LF     N I +GR    S+DM +  SL      IPKL D+  RI  E  S +   + 
Sbjct: 182 AILFLRCLSNQIINGRSQIESWDMDRLESLCDSGKLIPKLIDNTWRIYPEARSSQHERDA 241

Query: 587 DKICVLLGKPKLE 599
           DK+    G+ + +
Sbjct: 242 DKLLTQRGRARFD 254

>YOL003C Chr15 complement(321858..322994) [1137 bp, 378 aa] {ON}
           PFA4Palmitoyltransferase with autoacylation activity,
           required for palmitoylation of amino acid permeases
           containing a C-terminal Phe-Trp-Cys site; required for
           modification of Chs3p; member of the DHHC family of
           putative palmitoyltransferases
          Length = 378

 Score = 33.9 bits (76), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 26/50 (52%), Gaps = 1/50 (2%)

Query: 536 LFNNIKSGRPSKVSFDMQKASSLITGESTIPKLSDDEERILEESVRSAEN 585
           LFN I +GR    S+DM +  SL        KL D+  RI  ES RS +N
Sbjct: 189 LFNQILNGRSQIESWDMDRLESLFNSGRLTQKLIDNTWRIYPES-RSFQN 237

>Suva_15.172 Chr15 complement(296325..297521) [1197 bp, 398 aa] {ON}
           YOL003C (REAL)
          Length = 398

 Score = 33.9 bits (76), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 24/70 (34%), Positives = 35/70 (50%), Gaps = 1/70 (1%)

Query: 536 LFNNIKSGRPSKVSFDMQKASSLITGESTIPKLSDDEERILEESVRSAENFDKICVLLGK 595
           LFN I +GR    S+DM +  SL   +  I KL ++  RI  E+ RS +       LL +
Sbjct: 209 LFNQIINGRSQIESWDMDRLESLFDSQRLIKKLIENTWRIYPEA-RSPQLERDAEKLLTQ 267

Query: 596 PKLEVENYLN 605
            K+  E  +N
Sbjct: 268 HKIRFEEVVN 277

>KLTH0G07018g Chr7 (559864..562326) [2463 bp, 820 aa] {ON} similar
           to uniprot|P18962 Saccharomyces cerevisiae YHR028C
          Length = 820

 Score = 32.7 bits (73), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 28/102 (27%), Positives = 47/102 (46%), Gaps = 11/102 (10%)

Query: 233 RPPTTCVSLEDVPLSSVNLEKIIDVNWDPTMMNIVPYIDGLNSIAKISK--LSNSDPSLV 290
           R PT C  + +  L  V+ E + +  ++PT+   V +I GLNS ++     LS  + S V
Sbjct: 58  RLPTDCPQVTEDGLLKVSFENVRNFTFNPTLQ-TVQWIGGLNSPSEDMGLFLSVENGSYV 116

Query: 291 IECIRHLIYYKCVTLSDIFQFSNIYAPSSSIRNFLTDPLMAN 332
           I+ +    Y + +     F + N        +NF  D L A+
Sbjct: 117 IKSVYDQEYSRLLLKGKEFSYKN--------QNFTVDHLQAS 150

>SAKL0H21450g Chr8 complement(1877976..1879100) [1125 bp, 374 aa]
           {ON} some similarities with uniprot|P40356 Saccharomyces
           cerevisiae YGL025C PGD1 Subunit of the Mediator global
           transcriptional cofactor complex which is part of the
           RNA polymerase II holoenzyme and plays an essential role
           in basal and activated transcription direct target of
           the Cyc8p-Tup1p transcriptional corepressor
          Length = 374

 Score = 31.2 bits (69), Expect = 7.9,   Method: Compositional matrix adjust.
 Identities = 28/94 (29%), Positives = 43/94 (45%), Gaps = 7/94 (7%)

Query: 224 VDIKIFPLLRPPTTCVSLEDVPLSSVNLEKIIDVNWDPTMMNIVP----YIDGLNSIAKI 279
           + + I   L P TT   LED   S    ++ I      T  +I+P    + D LNS+AKI
Sbjct: 26  LSMGILESLSPKTTLSELEDKLSSDGAHKEAIQQQIATTQESILPIRLCFNDFLNSVAKI 85

Query: 280 SKLSNSDPS---LVIECIRHLIYYKCVTLSDIFQ 310
            ++ N  P    L+I      +Y +   LSD ++
Sbjct: 86  DQVDNKTPQERFLLIRSKLLEVYSRIQALSDDYE 119

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.136    0.400 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 60,117,802
Number of extensions: 2574991
Number of successful extensions: 8434
Number of sequences better than 10.0: 38
Number of HSP's gapped: 8692
Number of HSP's successfully gapped: 76
Length of query: 615
Length of database: 53,481,399
Length adjustment: 116
Effective length of query: 499
Effective length of database: 40,180,143
Effective search space: 20049891357
Effective search space used: 20049891357
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 69 (31.2 bits)