Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Smik_5.22na 1ON62862831710.0
YEL065W (SIT1)na 1ON62862829450.0
Skud_5.24na 1ON62762829350.0
Suva_5.2na 1ON62762728450.0
TPHA0M00120singletonON61958821260.0
NDAI0I02650na 1ON63857921270.0
NCAS0D02350na 1ON63456621080.0
Kpol_358.4na 1ON61756120810.0
SAKL0C12122gna 2ON61160420440.0
TDEL0G04740singletonON60157819770.0
Kwal_23.5241na 2ON59156019670.0
KLTH0A01562gna 2ON61557018990.0
Kwal_23.4853na 3ON60356017700.0
KLTH0G09504gna 3ON62457917620.0
Kpol_416.6singletonON59755116530.0
NCAS0A11500singletonON61457815530.0
Kpol_416.5singletonON60755215350.0
Kpol_513.33singletonON62655614890.0
TPHA0G03780singletonON61259914720.0
TDEL0B00140singletonON63261014540.0
NDAI0A02050singletonON61759214450.0
TPHA0B00180singletonON63361114120.0
SAKL0G06600gsingletonON62953113810.0
CAGL0E04092gna 4ON64558213461e-178
KAFR0D00930singletonON61456213411e-178
Suva_8.12na 4ON63357513421e-178
KAFR0C02660singletonON59155813291e-177
Skud_8.3na 4ON63157813231e-175
KNAG0J02980singletonON63654313201e-175
Smik_8.1na 4ON62757813101e-173
YHL040C (ARN1)na 4ON62757513051e-173
TBLA0C01040singletonON66955012951e-170
NDAI0H00140na 4ON63260612891e-170
KAFR0I01560singletonON63260212791e-169
KLTH0D00506gsingletonON61654512511e-165
ZYRO0G07414gsingletonON70754912441e-162
SAKL0G03300gsingletonON61658112241e-161
TPHA0K02330singletonON63157412261e-161
KLLA0C19272gsingletonON62355512081e-158
KLLA0A10439gsingletonON63463211931e-156
SAKL0F00792gsingletonON61755511711e-153
Kwal_56.22298singletonON61060211671e-152
KLTH0D18150gsingletonON60759611651e-152
TDEL0H00130singletonON62154511531e-150
KLLA0C00220gsingletonON62456611181e-144
Kwal_23.2794singletonON61956511151e-144
KLTH0A07964gsingletonON61954811021e-142
Kwal_34.15711na 4ON61860310951e-141
SAKL0F00110gsingletonON62055310951e-141
SAKL0E00132gsingletonON62055310901e-140
KLTH0D00110gsingletonON62056210881e-140
KLTH0B10450gsingletonON62056210881e-140
YHL047C (ARN2)singletonON62056910751e-138
TBLA0F00470singletonON73255810631e-135
NCAS0I00110na 4ON45244610141e-131
Skud_18.6singletonON61059410281e-131
KLLA0E14609gsingletonON6395589701e-122
Kwal_14.722singletonON6115659611e-121
YKR106W (GEX2)singletonON6155369601e-121
YCL073C (GEX1)singletonON6155369581e-121
KLTH0B00110gsingletonON6276109511e-119
KLLA0D19945gsingletonON6446409091e-113
KLTH0G00198gna 4ON4584397951e-98
Smik_11.370singletonON4404417442e-91
YOL158C (ENB1)singletonON6065566804e-80
Smik_21.4singletonON6055545896e-67
TDEL0H01600singletonON6046195661e-63
Suva_26.1singletonON5344865541e-62
Skud_6.14singletonON6366224821e-51
Smik_6.22singletonON6366004741e-50
Suva_10.9singletonON6375704742e-50
TDEL0A03210singletonON5844973485e-34
NCAS0I00100singletonON1631312681e-26
Smik_11.369singletonON1681212559e-25
Smik_17.11singletonON5443471635e-11
Skud_16.503singletonON5433811582e-10
KLTH0C10120gsingletonON6513771539e-10
YPR198W (SGE1)singletonON5433471474e-09
Skud_7.560na 5ON6423811466e-09
Smik_16.81na 5ON6253861377e-08
KNAG0K01020singletonON5993841377e-08
NCAS0C03460na 5ON6303871351e-07
KLTH0B00132gsingletonON5683611242e-06
KLTH0C10142gsingletonON5733791234e-06
SAKL0A08228gsingletonON5693801191e-05
SAKL0A00726gsingletonON5982471191e-05
Kwal_26.9616singletonON5623761181e-05
KLTH0D16962gsingletonON5712591127e-05
Kwal_56.237548.272ON5892101127e-05
TDEL0G03260singletonON6124431118e-05
TDEL0F039908.272ON6312941111e-04
Smik_13.2722.473ON5611521092e-04
KLLA0A04631g8.272ON5791201073e-04
Kpol_543.448.272ON6432841064e-04
ZYRO0C01430g8.272ON5902891054e-04
NDAI0H022002.473ON5711651047e-04
Skud_14.406na 6ON5642011020.001
Suva_13.2652.473ON5611521020.001
YNR072W (HXT17)singletonON5641631010.001
KLTH0G13464g8.272ON5933201010.001
YEL069C (HXT13)na 7ON5641631010.002
Skud_13.2442.473ON5621231000.002
YKR105C (VBA5)singletonON5823791000.002
SAKL0C05588gsingletonON6772501000.002
AGR076C8.272ON686145990.002
TBLA0F030408.272ON906141980.004
YJR158W (HXT16)singletonON567163980.004
YMR088C (VBA1)2.473ON562123980.004
YDL245C (HXT15)singletonON567163970.004
SAKL0F00198gsingletonON537362970.004
Smik_14.401na 6ON636163960.005
CAGL0J01375g2.473ON564388960.005
Smik_6.20singletonON569197960.006
Skud_6.12singletonON470197960.006
KLTH0B00594gsingletonON618367960.006
Smik_10.8singletonON569197960.006
Smik_5.19na 7ON567163950.007
TBLA0A03450singletonON573165950.007
Suva_15.2915.396ON592128950.008
YJL214W (HXT8)singletonON569196940.009
SAKL0H16808g8.272ON657179940.009
Skud_4.5singletonON573163940.011
Smik_25.4singletonON315197920.011
YGR224W (AZR1)na 5ON613340930.013
KLTH0B10142gsingletonON568360930.013
SAKL0B12716gsingletonON632363920.016
AFL207C5.394ON539185920.018
Skud_7.620singletonON468197910.019
TBLA0B029408.858ON661170910.021
Skud_18.3singletonON590375910.024
Ecym_42988.272ON678122910.024
SAKL0D00814g8.858ON570192910.025
KAFR0F04080singletonON549189900.026
KAFR0F02800singletonON551189900.027
KAFR0E02030singletonON548189890.035
Kpol_541.168.843ON52862890.039
KLLA0D19941gsingletonON611367890.043
NCAS0B002908.843ON54271880.044
Skud_8.1575.395ON592182880.046
NDAI0E002108.858ON613150880.047
TPHA0L015708.521ON45564880.047
Ecym_13888.858ON572173880.052
TBLA0E01970singletonON578165880.055
TBLA0A03480singletonON574168870.063
TBLA0D032708.843ON55073870.073
TBLA0A03460singletonON568229860.081
TBLA0B00840singletonON63779860.082
TPHA0G031502.473ON600235860.091
NCAS0A078102.473ON568163850.10
TBLA0D05800singletonON574160850.11
TBLA0D03280singletonON58073850.12
ZYRO0G21868gna 8ON620108840.14
Kwal_14.1585na 8ON570147840.14
NCAS0C002708.858ON570145830.19
Skud_13.188.858ON585100830.20
Suva_13.208.858ON584100830.20
Skud_18.5singletonOFF5351730.22
TBLA0A03470singletonON57879820.24
Smik_13.118.858ON586100820.26
ZYRO0A00902g8.858ON604221820.27
ZYRO0A00330gsingletonON576291820.28
SAKL0C02178gsingletonON565231820.29
AFR343C3.84ON571109820.29
NDAI0D05010singletonON574192820.30
SAKL0C00154gsingletonON571170810.32
Ecym_5319singletonON530266810.35
TDEL0E02290singletonON571187810.36
NDAI0G015203.23ON53093800.40
NDAI0D05020singletonON57376800.44
TPHA0A017508.272ON636282800.48
Kwal_14.854na 9ON570202790.55
Kwal_26.6669singletonON590166790.55
CAGL0B02079gna 5ON624386790.61
KLTH0D05434g2.473ON576131790.63
ABL040W2.473ON567104790.68
TBLA0A033905.394ON57461790.68
KAFR0B039408.843ON54772790.69
CAGL0A01826g5.396ON588189780.71
SAKL0E02992g2.473ON570168780.71
NDAI0C017405.396ON60788780.76
Suva_12.263singletonON487201770.90
Suva_15.419singletonON588201770.95
TBLA0A01250singletonON50367770.96
AFL205C5.395ON54676770.98
TBLA0A01240singletonON56961771.0
KLTH0E02750g5.395ON567125771.1
NDAI0K002808.858ON57199771.1
TBLA0A03500singletonON573103771.2
NDAI0F01940singletonON551104761.2
KNAG0J002608.843ON55058761.3
YML123C (PHO84)8.858ON58798761.3
Kwal_26.6686singletonON56968761.3
TBLA0B10150singletonON571185761.3
KNAG0C051905.395ON564166761.4
KNAG0E025602.473ON57893761.4
TDEL0H04480na 10ON57037761.5
Kwal_26.77552.473ON559119761.5
Kwal_55.19582singletonON56768761.5
KAFR0D00750singletonON55791761.5
NCAS0B002208.858ON625100751.7
KLTH0H05456gna 8ON568121751.7
ZYRO0C00374gna 10ON56460751.7
TPHA0I003808.858ON578102751.8
TBLA0F01600singletonON567195751.9
TBLA0A03430singletonON56479742.1
ZYRO0G21890gsingletonON576109742.2
NDAI0B03060singletonON59871742.3
Kwal_14.728singletonON568360742.3
CAGL0B02475g8.858ON580102742.3
Suva_4.2singletonON57050742.4
CAGL0D02640gsingletonON564101742.7
CAGL0D02662gsingletonON564101742.7
YCL069W (VBA3)singletonON458335732.7
Kpol_1053.243.84ON620165742.7
Kpol_1003.112.241ON581121732.8
KAFR0G00160singletonON636149732.9
Kwal_56.22285singletonON56767733.2
KLTH0B00330gsingletonON566123733.3
KLLA0F17776gna 11ON553113733.3
TDEL0A024902.473ON554102733.5
KAFR0A029108.858ON586100733.5
Kpol_541.208.858ON568100733.6
SAKL0E08778g2.241ON600113723.8
TDEL0E00200singletonON568104723.9
KNAG0C052505.394ON564166724.2
TBLA0A03700singletonON57234724.3
KLLA0E09021gna 10ON56674724.3
Kpol_1014.213.23ON53276724.4
Kwal_55.200645.396ON238100704.5
KAFR0G037303.500ON14430684.7
Kpol_467.242.473ON37043715.0
TDEL0B002708.858ON58197715.3
TBLA0E038002.242ON608129715.5
KAFR0D00740singletonON56875706.6
TBLA0A03400singletonON57468706.9
Suva_13.4678.843ON543141707.5
KNAG0A037908.521ON45561707.6
YOL156W (HXT11)singletonON56768707.7
YJL219W (HXT9)singletonON56768707.8
NDAI0K004008.843ON55370708.1
AFR322C3.503ON592124699.1
TBLA0A03440singletonON50392699.2
TPHA0C047908.843ON55672699.4
TDEL0E023105.394ON567161699.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Smik_5.22
         (628 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Smik_5.22 Chr5 (30048..31934) [1887 bp, 628 aa] {ON} YEL065W (REAL)  1226   0.0  
YEL065W Chr5 (27657..29543) [1887 bp, 628 aa] {ON}  SIT1Ferrioxa...  1139   0.0  
Skud_5.24 Chr5 (26839..28722) [1884 bp, 627 aa] {ON} YEL065W (REAL)  1135   0.0  
Suva_5.2 Chr5 (3340..5223) [1884 bp, 627 aa] {ON} YEL065W (REAL)     1100   0.0  
TPHA0M00120 Chr13 (23458..25317) [1860 bp, 619 aa] {ON}               823   0.0  
NDAI0I02650 Chr9 (617474..619390) [1917 bp, 638 aa] {ON}              823   0.0  
NCAS0D02350 Chr4 (439325..441229) [1905 bp, 634 aa] {ON}              816   0.0  
Kpol_358.4 s358 complement(9458..11311) [1854 bp, 617 aa] {ON} c...   806   0.0  
SAKL0C12122g Chr3 (1086281..1088116) [1836 bp, 611 aa] {ON} simi...   791   0.0  
TDEL0G04740 Chr7 complement(865319..867124) [1806 bp, 601 aa] {O...   766   0.0  
Kwal_23.5241 s23 (1071768..1073543) [1776 bp, 591 aa] {ON} YEL06...   762   0.0  
KLTH0A01562g Chr1 complement(138389..140236) [1848 bp, 615 aa] {...   736   0.0  
Kwal_23.4853 s23 complement(895045..896856) [1812 bp, 603 aa] {O...   686   0.0  
KLTH0G09504g Chr7 complement(792202..794076) [1875 bp, 624 aa] {...   683   0.0  
Kpol_416.6 s416 (26742..28535) [1794 bp, 597 aa] {ON} (26742..28...   641   0.0  
NCAS0A11500 Chr1 complement(2274436..2276280) [1845 bp, 614 aa] ...   602   0.0  
Kpol_416.5 s416 (23208..25031) [1824 bp, 607 aa] {ON} (23208..25...   595   0.0  
Kpol_513.33 s513 complement(95274..97154) [1881 bp, 626 aa] {ON}...   578   0.0  
TPHA0G03780 Chr7 complement(800134..801972) [1839 bp, 612 aa] {O...   571   0.0  
TDEL0B00140 Chr2 (25633..27531) [1899 bp, 632 aa] {ON}                564   0.0  
NDAI0A02050 Chr1 complement(456678..458531) [1854 bp, 617 aa] {O...   561   0.0  
TPHA0B00180 Chr2 complement(29722..31623) [1902 bp, 633 aa] {ON}      548   0.0  
SAKL0G06600g Chr7 complement(549492..551381) [1890 bp, 629 aa] {...   536   0.0  
CAGL0E04092g Chr5 (394380..396317) [1938 bp, 645 aa] {ON} simila...   523   e-178
KAFR0D00930 Chr4 complement(195566..197410) [1845 bp, 614 aa] {O...   521   e-178
Suva_8.12 Chr8 complement(20611..22512) [1902 bp, 633 aa] {ON} Y...   521   e-178
KAFR0C02660 Chr3 (516832..518607) [1776 bp, 591 aa] {ON}              516   e-177
Skud_8.3 Chr8 complement(7094..8989) [1896 bp, 631 aa] {ON} YHL0...   514   e-175
KNAG0J02980 Chr10 (571855..573765) [1911 bp, 636 aa] {ON}             513   e-175
Smik_8.1 Chr8 complement(2797..4680) [1884 bp, 627 aa] {ON} YHL0...   509   e-173
YHL040C Chr8 complement(19088..20971) [1884 bp, 627 aa] {ON}  AR...   507   e-173
TBLA0C01040 Chr3 (208261..210270) [2010 bp, 669 aa] {ON}              503   e-170
NDAI0H00140 Chr8 complement(10247..12145) [1899 bp, 632 aa] {ON}      501   e-170
KAFR0I01560 Chr9 (328940..330838) [1899 bp, 632 aa] {ON}  YHL040C     497   e-169
KLTH0D00506g Chr4 (47320..49170) [1851 bp, 616 aa] {ON} similar ...   486   e-165
ZYRO0G07414g Chr7 complement(583978..586101) [2124 bp, 707 aa] {...   483   e-162
SAKL0G03300g Chr7 (268199..270049) [1851 bp, 616 aa] {ON} simila...   476   e-161
TPHA0K02330 Chr11 (506158..508053) [1896 bp, 631 aa] {ON}             476   e-161
KLLA0C19272g Chr3 complement(1717903..1719774) [1872 bp, 623 aa]...   469   e-158
KLLA0A10439g Chr1 complement(913342..915246) [1905 bp, 634 aa] {...   464   e-156
SAKL0F00792g Chr6 (70444..72297) [1854 bp, 617 aa] {ON} similar ...   455   e-153
Kwal_56.22298 s56 (31819..33651) [1833 bp, 610 aa] {ON} YHL040C ...   454   e-152
KLTH0D18150g Chr4 complement(1502817..1504640) [1824 bp, 607 aa]...   453   e-152
TDEL0H00130 Chr8 complement(10267..12132) [1866 bp, 621 aa] {ON}      448   e-150
KLLA0C00220g Chr3 (13632..15506) [1875 bp, 624 aa] {ON} similar ...   435   e-144
Kwal_23.2794 s23 (15194..17053) [1860 bp, 619 aa] {ON} YHL047C (...   434   e-144
KLTH0A07964g Chr1 complement(670591..672450) [1860 bp, 619 aa] {...   429   e-142
Kwal_34.15711 s34 (21213..23069) [1857 bp, 618 aa] {ON} YHL047C ...   426   e-141
SAKL0F00110g Chr6 (1456..3318) [1863 bp, 620 aa] {ON} similar to...   426   e-141
SAKL0E00132g Chr5 (3269..5131) [1863 bp, 620 aa] {ON} similar to...   424   e-140
KLTH0D00110g Chr4 (796..2658) [1863 bp, 620 aa] {ON} similar to ...   423   e-140
KLTH0B10450g Chr2 complement(885429..887291) [1863 bp, 620 aa] {...   423   e-140
YHL047C Chr8 complement(8351..10213) [1863 bp, 620 aa] {ON}  ARN...   418   e-138
TBLA0F00470 Chr6 (123691..125889) [2199 bp, 732 aa] {ON}              414   e-135
NCAS0I00110 Chr9 complement(5312..6670) [1359 bp, 452 aa] {ON}        395   e-131
Skud_18.6 Chr18 (14597..16429) [1833 bp, 610 aa] {ON} YCL073C (R...   400   e-131
KLLA0E14609g Chr5 (1302073..1303992) [1920 bp, 639 aa] {ON} simi...   378   e-122
Kwal_14.722 s14 (9019..10854) [1836 bp, 611 aa] {ON} YCL073C - H...   374   e-121
YKR106W Chr11 (661442..663289) [1848 bp, 615 aa] {ON}  GEX2Proto...   374   e-121
YCL073C Chr3 complement(6479..8326) [1848 bp, 615 aa] {ON}  GEX1...   373   e-121
KLTH0B00110g Chr2 complement(1655..3538) [1884 bp, 627 aa] {ON} ...   370   e-119
KLLA0D19945g Chr4 (1701681..1703615) [1935 bp, 644 aa] {ON} simi...   354   e-113
KLTH0G00198g Chr7 (5908..7284) [1377 bp, 458 aa] {ON} similar to...   310   1e-98
Smik_11.370 Chr11 (653235..654554) [1320 bp, 440 aa] {ON} YKR106...   291   2e-91
YOL158C Chr15 complement(19491..21311) [1821 bp, 606 aa] {ON}  E...   266   4e-80
Smik_21.4 Chr21 (1261..3078) [1818 bp, 605 aa] {ON} YOL158C (REAL)    231   6e-67
TDEL0H01600 Chr8 complement(273692..275506) [1815 bp, 604 aa] {O...   222   1e-63
Suva_26.1 Chr26 (1..1602) [1602 bp, 534 aa] {ON} YOL158C (REAL)       218   1e-62
Skud_6.14 Chr6 complement(19547..21457) [1911 bp, 636 aa] {ON} Y...   190   1e-51
Smik_6.22 Chr6 complement(31536..33446) [1911 bp, 636 aa] {ON} Y...   187   1e-50
Suva_10.9 Chr10 complement(12679..14592) [1914 bp, 637 aa] {ON} ...   187   2e-50
TDEL0A03210 Chr1 (574153..575907) [1755 bp, 584 aa] {ON}              138   5e-34
NCAS0I00100 Chr9 complement(4805..5296) [492 bp, 163 aa] {ON}         107   1e-26
Smik_11.369 Chr11 (652600..653106) [507 bp, 168 aa] {ON} YKR106W...   102   9e-25
Smik_17.11 Chr17 complement(8582..10216) [1635 bp, 544 aa] {ON} ...    67   5e-11
Skud_16.503 Chr16 (880571..882202) [1632 bp, 543 aa] {ON} YPR198...    65   2e-10
KLTH0C10120g Chr3 (839780..841735) [1956 bp, 651 aa] {ON} simila...    64   9e-10
YPR198W Chr16 (934034..935665) [1632 bp, 543 aa] {ON}  SGE1Plasm...    61   4e-09
Skud_7.560 Chr7 (917668..919596) [1929 bp, 642 aa] {ON} YGR224W ...    61   6e-09
Smik_16.81 Chr16 complement(152022..153515,153516..153899) [1878...    57   7e-08
KNAG0K01020 Chr11 complement(198213..200012) [1800 bp, 599 aa] {...    57   7e-08
NCAS0C03460 Chr3 complement(690089..691981) [1893 bp, 630 aa] {O...    57   1e-07
KLTH0B00132g Chr2 (4664..6370) [1707 bp, 568 aa] {ON} similar to...    52   2e-06
KLTH0C10142g Chr3 (842371..844092) [1722 bp, 573 aa] {ON} simila...    52   4e-06
SAKL0A08228g Chr1 complement(732518..734227) [1710 bp, 569 aa] {...    50   1e-05
SAKL0A00726g Chr1 (82164..83960) [1797 bp, 598 aa] {ON} similar ...    50   1e-05
Kwal_26.9616 s26 (1294683..1296371) [1689 bp, 562 aa] {ON} YPR19...    50   1e-05
KLTH0D16962g Chr4 (1399514..1401229) [1716 bp, 571 aa] {ON} simi...    48   7e-05
Kwal_56.23754 s56 complement(690851..692620) [1770 bp, 589 aa] {...    48   7e-05
TDEL0G03260 Chr7 (605429..607267) [1839 bp, 612 aa] {ON}               47   8e-05
TDEL0F03990 Chr6 (740471..742366) [1896 bp, 631 aa] {ON} Anc_8.2...    47   1e-04
Smik_13.272 Chr13 complement(427283..428968) [1686 bp, 561 aa] {...    47   2e-04
KLLA0A04631g Chr1 complement(415070..416809) [1740 bp, 579 aa] {...    46   3e-04
Kpol_543.44 s543 (96992..98923) [1932 bp, 643 aa] {ON} (96992..9...    45   4e-04
ZYRO0C01430g Chr3 complement(101140..102912) [1773 bp, 590 aa] {...    45   4e-04
NDAI0H02200 Chr8 complement(536385..538100) [1716 bp, 571 aa] {O...    45   7e-04
Skud_14.406 Chr14 (740510..742204) [1695 bp, 564 aa] {ON} YNR072...    44   0.001
Suva_13.265 Chr13 complement(424929..426614) [1686 bp, 561 aa] {...    44   0.001
YNR072W Chr14 (772657..774351) [1695 bp, 564 aa] {ON}  HXT17Hexo...    44   0.001
KLTH0G13464g Chr7 complement(1154304..1156085) [1782 bp, 593 aa]...    44   0.001
YEL069C Chr5 complement(21537..23231) [1695 bp, 564 aa] {ON}  HX...    44   0.002
Skud_13.244 Chr13 complement(417271..418959) [1689 bp, 562 aa] {...    43   0.002
YKR105C Chr11 complement(658716..660464) [1749 bp, 582 aa] {ON} ...    43   0.002
SAKL0C05588g Chr3 (527748..529781) [2034 bp, 677 aa] {ON} simila...    43   0.002
AGR076C Chr7 complement(871564..873624) [2061 bp, 686 aa] {ON} S...    43   0.002
TBLA0F03040 Chr6 complement(735352..738072) [2721 bp, 906 aa] {O...    42   0.004
YJR158W Chr10 (732440..734143) [1704 bp, 567 aa] {ON}  HXT16Prot...    42   0.004
YMR088C Chr13 complement(443414..445102) [1689 bp, 562 aa] {ON} ...    42   0.004
YDL245C Chr4 complement(11657..13360) [1704 bp, 567 aa] {ON}  HX...    42   0.004
SAKL0F00198g Chr6 complement(10713..12326) [1614 bp, 537 aa] {ON...    42   0.004
Smik_14.401 Chr14 (716260..718170) [1911 bp, 636 aa] {ON} YNR072...    42   0.005
CAGL0J01375g Chr10 (127843..129537) [1695 bp, 564 aa] {ON} simil...    42   0.005
Smik_6.20 Chr6 (28923..30632) [1710 bp, 569 aa] {ON} YJL219W (REAL)    42   0.006
Skud_6.12 Chr6 (17593..18687,18791..19108) [1413 bp, 470 aa] {ON...    42   0.006
KLTH0B00594g Chr2 (64332..66188) [1857 bp, 618 aa] {ON} similar ...    42   0.006
Smik_10.8 Chr10 (9814..11523) [1710 bp, 569 aa] {ON} YJL214W (REAL)    42   0.006
Smik_5.19 Chr5 complement(25102..26805) [1704 bp, 567 aa] {ON} Y...    41   0.007
TBLA0A03450 Chr1 complement(836248..837969) [1722 bp, 573 aa] {O...    41   0.007
Suva_15.291 Chr15 complement(497138..498916) [1779 bp, 592 aa] {...    41   0.008
YJL214W Chr10 (26887..28596) [1710 bp, 569 aa] {ON}  HXT8Protein...    41   0.009
SAKL0H16808g Chr8 complement(1477137..1479110) [1974 bp, 657 aa]...    41   0.009
Skud_4.5 Chr4 complement(9302..11023) [1722 bp, 573 aa] {ON} YJR...    41   0.011
Smik_25.4 Chr25 (8471..9415) [945 bp, 315 aa] {ON} YJL214W (REAL)      40   0.011
YGR224W Chr7 (942806..944647) [1842 bp, 613 aa] {ON}  AZR1Plasma...    40   0.013
KLTH0B10142g Chr2 complement(847376..849082) [1707 bp, 568 aa] {...    40   0.013
SAKL0B12716g Chr2 (1101141..1103039) [1899 bp, 632 aa] {ON} simi...    40   0.016
AFL207C Chr6 complement(44349..45968) [1620 bp, 539 aa] {ON} Unc...    40   0.018
Skud_7.620 Chr7 complement(1041205..1041522,1041626..1042714) [1...    40   0.019
TBLA0B02940 Chr2 (677253..679238) [1986 bp, 661 aa] {ON} Anc_8.8...    40   0.021
Skud_18.3 Chr18 complement(10782..12554) [1773 bp, 590 aa] {ON} ...    40   0.024
Ecym_4298 Chr4 complement(636605..638641) [2037 bp, 678 aa] {ON}...    40   0.024
SAKL0D00814g Chr4 complement(63086..64798) [1713 bp, 570 aa] {ON...    40   0.025
KAFR0F04080 Chr6 complement(795772..797421) [1650 bp, 549 aa] {O...    39   0.026
KAFR0F02800 Chr6 (556502..558157) [1656 bp, 551 aa] {ON}               39   0.027
KAFR0E02030 Chr5 (404370..406016) [1647 bp, 548 aa] {ON}               39   0.035
Kpol_541.16 s541 complement(43396..44982) [1587 bp, 528 aa] {ON}...    39   0.039
KLLA0D19941g Chr4 complement(1698889..1700724) [1836 bp, 611 aa]...    39   0.043
NCAS0B00290 Chr2 (33760..35388) [1629 bp, 542 aa] {ON} Anc_8.843       39   0.044
Skud_8.157 Chr8 complement(268495..270273) [1779 bp, 592 aa] {ON...    39   0.046
NDAI0E00210 Chr5 complement(19177..21018) [1842 bp, 613 aa] {ON}...    39   0.047
TPHA0L01570 Chr12 complement(333218..334585) [1368 bp, 455 aa] {...    39   0.047
Ecym_1388 Chr1 complement(806312..808030) [1719 bp, 572 aa] {ON}...    39   0.052
TBLA0E01970 Chr5 complement(478901..480637) [1737 bp, 578 aa] {O...    39   0.055
TBLA0A03480 Chr1 (859635..861359) [1725 bp, 574 aa] {ON}               38   0.063
TBLA0D03270 Chr4 complement(813041..814693) [1653 bp, 550 aa] {O...    38   0.073
TBLA0A03460 Chr1 complement(845685..847391) [1707 bp, 568 aa] {ON}     38   0.081
TBLA0B00840 Chr2 complement(188743..190656) [1914 bp, 637 aa] {O...    38   0.082
TPHA0G03150 Chr7 (670343..672145) [1803 bp, 600 aa] {ON} Anc_2.4...    38   0.091
NCAS0A07810 Chr1 complement(1554541..1556247) [1707 bp, 568 aa] ...    37   0.10 
TBLA0D05800 Chr4 complement(1435290..1437014) [1725 bp, 574 aa] ...    37   0.11 
TBLA0D03280 Chr4 complement(815937..817679) [1743 bp, 580 aa] {O...    37   0.12 
ZYRO0G21868g Chr7 complement(1799212..1801074) [1863 bp, 620 aa]...    37   0.14 
Kwal_14.1585 s14 (377103..378815) [1713 bp, 570 aa] {ON} YMR088C...    37   0.14 
NCAS0C00270 Chr3 complement(34958..36670) [1713 bp, 570 aa] {ON}...    37   0.19 
Skud_13.18 Chr13 complement(23890..25647) [1758 bp, 585 aa] {ON}...    37   0.20 
Suva_13.20 Chr13 complement(24012..25766) [1755 bp, 584 aa] {ON}...    37   0.20 
Skud_18.5 Chr18 (13411..13461,13465..13500,13504..13575) [159 bp...    33   0.22 
TBLA0A03470 Chr1 complement(849164..850900) [1737 bp, 578 aa] {ON}     36   0.24 
Smik_13.11 Chr13 complement(20464..22224) [1761 bp, 586 aa] {ON}...    36   0.26 
ZYRO0A00902g Chr1 complement(64264..66078) [1815 bp, 604 aa] {ON...    36   0.27 
ZYRO0A00330g Chr1 (19597..21327) [1731 bp, 576 aa] {ON} similar ...    36   0.28 
SAKL0C02178g Chr3 complement(191542..193239) [1698 bp, 565 aa] {...    36   0.29 
AFR343C Chr6 complement(1060723..1062438) [1716 bp, 571 aa] {ON}...    36   0.29 
NDAI0D05010 Chr4 complement(1193201..1194925) [1725 bp, 574 aa] ...    36   0.30 
SAKL0C00154g Chr3 complement(4145..5860) [1716 bp, 571 aa] {ON} ...    36   0.32 
Ecym_5319 Chr5 complement(643494..645086) [1593 bp, 530 aa] {ON}...    36   0.35 
TDEL0E02290 Chr5 (441643..443358) [1716 bp, 571 aa] {ON} Anc_5.3...    36   0.36 
NDAI0G01520 Chr7 complement(336365..337957) [1593 bp, 530 aa] {O...    35   0.40 
NDAI0D05020 Chr4 complement(1197075..1198796) [1722 bp, 573 aa] ...    35   0.44 
TPHA0A01750 Chr1 complement(354061..355971) [1911 bp, 636 aa] {O...    35   0.48 
Kwal_14.854 s14 complement(82977..84689) [1713 bp, 570 aa] {ON} ...    35   0.55 
Kwal_26.6669 s26 complement(14202..15974) [1773 bp, 590 aa] {ON}...    35   0.55 
CAGL0B02079g Chr2 complement(191736..193610) [1875 bp, 624 aa] {...    35   0.61 
KLTH0D05434g Chr4 (486319..488049) [1731 bp, 576 aa] {ON} simila...    35   0.63 
ABL040W Chr2 (321534..323237) [1704 bp, 567 aa] {ON} Syntenic ho...    35   0.68 
TBLA0A03390 Chr1 complement(806095..807819) [1725 bp, 574 aa] {O...    35   0.68 
KAFR0B03940 Chr2 complement(820954..822597) [1644 bp, 547 aa] {O...    35   0.69 
CAGL0A01826g Chr1 complement(184013..185779) [1767 bp, 588 aa] {...    35   0.71 
SAKL0E02992g Chr5 complement(243652..245364) [1713 bp, 570 aa] {...    35   0.71 
NDAI0C01740 Chr3 (378218..380041) [1824 bp, 607 aa] {ON}               35   0.76 
Suva_12.263 Chr12 (430196..431659) [1464 bp, 487 aa] {ON} YNR072...    34   0.90 
Suva_15.419 Chr15 (740086..741852) [1767 bp, 588 aa] {ON} YLR081...    34   0.95 
TBLA0A01250 Chr1 (294923..296434) [1512 bp, 503 aa] {ON}               34   0.96 
AFL205C Chr6 complement(49039..50679) [1641 bp, 546 aa] {ON} Syn...    34   0.98 
TBLA0A01240 Chr1 complement(289083..290792) [1710 bp, 569 aa] {O...    34   1.0  
KLTH0E02750g Chr5 (248224..249927) [1704 bp, 567 aa] {ON} highly...    34   1.1  
NDAI0K00280 Chr11 complement(51303..53018) [1716 bp, 571 aa] {ON...    34   1.1  
TBLA0A03500 Chr1 complement(863154..864875) [1722 bp, 573 aa] {O...    34   1.2  
NDAI0F01940 Chr6 (471792..473447) [1656 bp, 551 aa] {ON}               34   1.2  
KNAG0J00260 Chr10 (37950..39602) [1653 bp, 550 aa] {ON} Anc_8.84...    34   1.3  
YML123C Chr13 complement(24037..25800) [1764 bp, 587 aa] {ON}  P...    34   1.3  
Kwal_26.6686 s26 complement(23884..25593) [1710 bp, 569 aa] {ON}...    34   1.3  
TBLA0B10150 Chr2 (2445764..2447479) [1716 bp, 571 aa] {ON}             34   1.3  
KNAG0C05190 Chr3 (1014564..1016258) [1695 bp, 564 aa] {ON}             34   1.4  
KNAG0E02560 Chr5 (506517..508253) [1737 bp, 578 aa] {ON} Anc_2.4...    34   1.4  
TDEL0H04480 Chr8 complement(774396..776108) [1713 bp, 570 aa] {O...    34   1.5  
Kwal_26.7755 s26 (500034..501713) [1680 bp, 559 aa] {ON} YMR088C...    34   1.5  
Kwal_55.19582 s55 (35002..36705) [1704 bp, 567 aa] {ON} YNR072W ...    34   1.5  
KAFR0D00750 Chr4 complement(150046..151719) [1674 bp, 557 aa] {O...    34   1.5  
NCAS0B00220 Chr2 complement(20530..22407) [1878 bp, 625 aa] {ON}...    33   1.7  
KLTH0H05456g Chr8 (484160..485866) [1707 bp, 568 aa] {ON} simila...    33   1.7  
ZYRO0C00374g Chr3 (23229..24923) [1695 bp, 564 aa] {ON} similar ...    33   1.7  
TPHA0I00380 Chr9 (72432..74168) [1737 bp, 578 aa] {ON} Anc_8.858...    33   1.8  
TBLA0F01600 Chr6 complement(399573..401276) [1704 bp, 567 aa] {O...    33   1.9  
TBLA0A03430 Chr1 complement(827449..829143) [1695 bp, 564 aa] {O...    33   2.1  
ZYRO0G21890g Chr7 complement(1801391..1803121) [1731 bp, 576 aa]...    33   2.2  
NDAI0B03060 Chr2 complement(775021..776817) [1797 bp, 598 aa] {O...    33   2.3  
Kwal_14.728 s14 complement(11659..13365) [1707 bp, 568 aa] {ON} ...    33   2.3  
CAGL0B02475g Chr2 (236029..237771) [1743 bp, 580 aa] {ON} highly...    33   2.3  
Suva_4.2 Chr4 (4514..6226) [1713 bp, 570 aa] {ON} YDR497C (REAL)       33   2.4  
CAGL0D02640g Chr4 (274285..275979) [1695 bp, 564 aa] {ON} highly...    33   2.7  
CAGL0D02662g Chr4 complement(278099..279793) [1695 bp, 564 aa] {...    33   2.7  
YCL069W Chr3 (9706..11082) [1377 bp, 458 aa] {ON}  VBA3Permease ...    33   2.7  
Kpol_1053.24 s1053 (36161..38023) [1863 bp, 620 aa] {ON} (36161....    33   2.7  
Kpol_1003.11 s1003 (33230..34975) [1746 bp, 581 aa] {ON} (33230....    33   2.8  
KAFR0G00160 Chr7 (51436..53346) [1911 bp, 636 aa] {ON}                 33   2.9  
Kwal_56.22285 s56 (26966..28669) [1704 bp, 567 aa] {ON} YNR072W ...    33   3.2  
KLTH0B00330g Chr2 (29891..31591) [1701 bp, 566 aa] {ON} highly s...    33   3.3  
KLLA0F17776g Chr6 complement(1627198..1628859) [1662 bp, 553 aa]...    33   3.3  
TDEL0A02490 Chr1 (446429..448093) [1665 bp, 554 aa] {ON} Anc_2.4...    33   3.5  
KAFR0A02910 Chr1 (605168..606928) [1761 bp, 586 aa] {ON} Anc_8.8...    33   3.5  
Kpol_541.20 s541 (55476..57182) [1707 bp, 568 aa] {ON} (55476..5...    33   3.6  
SAKL0E08778g Chr5 complement(716961..718763) [1803 bp, 600 aa] {...    32   3.8  
TDEL0E00200 Chr5 complement(25701..27407) [1707 bp, 568 aa] {ON}       32   3.9  
KNAG0C05250 Chr3 (1024201..1025895) [1695 bp, 564 aa] {ON}             32   4.2  
TBLA0A03700 Chr1 (925610..927328) [1719 bp, 572 aa] {ON}               32   4.3  
KLLA0E09021g Chr5 (804915..806615) [1701 bp, 566 aa] {ON} unipro...    32   4.3  
Kpol_1014.21 s1014 (34471..36069) [1599 bp, 532 aa] {ON} (34471....    32   4.4  
Kwal_55.20064 s55 (235602..236315) [714 bp, 238 aa] {ON} YHR094C...    32   4.5  
KAFR0G03730 Chr7 (766728..766738,766802..767225) [435 bp, 144 aa...    31   4.7  
Kpol_467.24 s467 (55523..56632) [1110 bp, 370 aa] {ON} (55523..5...    32   5.0  
TDEL0B00270 Chr2 (51265..53010) [1746 bp, 581 aa] {ON} Anc_8.858...    32   5.3  
TBLA0E03800 Chr5 (956468..958294) [1827 bp, 608 aa] {ON} Anc_2.2...    32   5.5  
KAFR0D00740 Chr4 complement(142941..144647) [1707 bp, 568 aa] {O...    32   6.6  
TBLA0A03400 Chr1 complement(810961..812685) [1725 bp, 574 aa] {O...    32   6.9  
Suva_13.467 Chr13 complement(807375..809006) [1632 bp, 543 aa] {...    32   7.5  
KNAG0A03790 Chr1 (496954..498321) [1368 bp, 455 aa] {ON} Anc_8.5...    32   7.6  
YOL156W Chr15 (25273..26976) [1704 bp, 567 aa] {ON}  HXT11Putati...    32   7.7  
YJL219W Chr10 (19497..21200) [1704 bp, 567 aa] {ON}  HXT9Putativ...    32   7.8  
NDAI0K00400 Chr11 (90040..91701) [1662 bp, 553 aa] {ON}                32   8.1  
AFR322C Chr6 complement(1017689..1019467) [1779 bp, 592 aa] {ON}...    31   9.1  
TBLA0A03440 Chr1 complement(832040..833551) [1512 bp, 503 aa] {O...    31   9.2  
TPHA0C04790 Chr3 complement(1033653..1035323) [1671 bp, 556 aa] ...    31   9.4  
TDEL0E02310 Chr5 (450790..452493) [1704 bp, 567 aa] {ON} Anc_5.3...    31   9.5  

>Smik_5.22 Chr5 (30048..31934) [1887 bp, 628 aa] {ON} YEL065W (REAL)
          Length = 628

 Score = 1226 bits (3171), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 602/628 (95%), Positives = 602/628 (95%)

Query: 1   MDPATANHALPEDFTEDVVPDILEKEVGAIVDVNPTLTTSSPAPSYIELIDPGVYNIEIY 60
           MDPATANHALPEDFTEDVVPDILEKEVGAIVDVNPTLTTSSPAPSYIELIDPGVYNIEIY
Sbjct: 1   MDPATANHALPEDFTEDVVPDILEKEVGAIVDVNPTLTTSSPAPSYIELIDPGVYNIEIY 60

Query: 61  AEMYSRPLYRVALFFSLFLIAYAYGLDGNIRYTFQAYATSSYSQHSLLSTVNCIKTVIAA 120
           AEMYSRPLYRVALFFSLFLIAYAYGLDGNIRYTFQAYATSSYSQHSLLSTVNCIKTVIAA
Sbjct: 61  AEMYSRPLYRVALFFSLFLIAYAYGLDGNIRYTFQAYATSSYSQHSLLSTVNCIKTVIAA 120

Query: 121 VGQIFFARLSDIFGRFSIMIVSVIFYSVGTIIESQAVNITRFAVGGCFYQLGLTGIILIL 180
           VGQIFFARLSDIFGRFSIMIVSVIFYSVGTIIESQAVNITRFAVGGCFYQLGLTGIILIL
Sbjct: 121 VGQIFFARLSDIFGRFSIMIVSVIFYSVGTIIESQAVNITRFAVGGCFYQLGLTGIILIL 180

Query: 181 EVIASDFSNLNWRLLALFIPALPFIINTWISGDVTSAIGTNWKWGIGMWAFILPLACIPL 240
           EVIASDFSNLNWRLLALFIPALPFIINTWISGDVTSAIGTNWKWGIGMWAFILPLACIPL
Sbjct: 181 EVIASDFSNLNWRLLALFIPALPFIINTWISGDVTSAIGTNWKWGIGMWAFILPLACIPL 240

Query: 241 GICMLHMRYLARKHAKDRLKPEFEALNKLKWKSFCIDIAFWKLDIIGMLLITVFFGCVLV 300
           GICMLHMRYLARKHAKDRLKPEFEALNKLKWKSFCIDIAFWKLDIIGMLLITVFFGCVLV
Sbjct: 241 GICMLHMRYLARKHAKDRLKPEFEALNKLKWKSFCIDIAFWKLDIIGMLLITVFFGCVLV 300

Query: 301 PFTLAGGLKEEWKSAHIIVPEVIGWVVVLPLYMLWEMKYSRHPLTPWDLIKDRGXXXXXX 360
           PFTLAGGLKEEWKSAHIIVPEVIGWVVVLPLYMLWEMKYSRHPLTPWDLIKDRG      
Sbjct: 301 PFTLAGGLKEEWKSAHIIVPEVIGWVVVLPLYMLWEMKYSRHPLTPWDLIKDRGIFFALL 360

Query: 361 XXXXXXXXWYMQGDYMYTVLVVAVHESIKSATRITSLYSFVSVIVGTILGFILIKVRRTK 420
                   WYMQGDYMYTVLVVAVHESIKSATRITSLYSFVSVIVGTILGFILIKVRRTK
Sbjct: 361 IAFFINFNWYMQGDYMYTVLVVAVHESIKSATRITSLYSFVSVIVGTILGFILIKVRRTK 420

Query: 421 PFIIFGISCWIVSFGLLVHYRGDSGAHSGIIGSLCLLGFGAGSFTYVTQASIQASAKTHA 480
           PFIIFGISCWIVSFGLLVHYRGDSGAHSGIIGSLCLLGFGAGSFTYVTQASIQASAKTHA
Sbjct: 421 PFIIFGISCWIVSFGLLVHYRGDSGAHSGIIGSLCLLGFGAGSFTYVTQASIQASAKTHA 480

Query: 481 RMAVVTSLYLATYNIXXXXXXXXXXXXWTNILPKEISKRISDPTLAAQAYSAPFTFITTY 540
           RMAVVTSLYLATYNI            WTNILPKEISKRISDPTLAAQAYSAPFTFITTY
Sbjct: 481 RMAVVTSLYLATYNIGSAFGSSVSGAVWTNILPKEISKRISDPTLAAQAYSAPFTFITTY 540

Query: 541 TWGTPERIALVMSYRYVQKILCIIGLVFCFPLLGCAFMLRNHELTDSIALEGNDHLKSKD 600
           TWGTPERIALVMSYRYVQKILCIIGLVFCFPLLGCAFMLRNHELTDSIALEGNDHLKSKD
Sbjct: 541 TWGTPERIALVMSYRYVQKILCIIGLVFCFPLLGCAFMLRNHELTDSIALEGNDHLKSKD 600

Query: 601 SFETEEKQESFLKSMIFTRFTRSEDKRN 628
           SFETEEKQESFLKSMIFTRFTRSEDKRN
Sbjct: 601 SFETEEKQESFLKSMIFTRFTRSEDKRN 628

>YEL065W Chr5 (27657..29543) [1887 bp, 628 aa] {ON}
           SIT1Ferrioxamine B transporter, member of the ARN family
           of transporters that specifically recognize
           siderophore-iron chelates; transcription is induced
           during iron deprivation and diauxic shift; potentially
           phosphorylated by Cdc28p
          Length = 628

 Score = 1139 bits (2945), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 564/628 (89%), Positives = 587/628 (93%)

Query: 1   MDPATANHALPEDFTEDVVPDILEKEVGAIVDVNPTLTTSSPAPSYIELIDPGVYNIEIY 60
           MDP  ANH LPE+F E VVP++LEKEVGA VDV PTLTTSSPAPSYIELIDPGV+NIEIY
Sbjct: 1   MDPGIANHTLPEEFEEVVVPEMLEKEVGAKVDVKPTLTTSSPAPSYIELIDPGVHNIEIY 60

Query: 61  AEMYSRPLYRVALFFSLFLIAYAYGLDGNIRYTFQAYATSSYSQHSLLSTVNCIKTVIAA 120
           AEMY+RP+YRVALFFSLFLIAYAYGLDGNIRYTFQAYATSSYSQHSLLSTVNCIKTVIAA
Sbjct: 61  AEMYNRPIYRVALFFSLFLIAYAYGLDGNIRYTFQAYATSSYSQHSLLSTVNCIKTVIAA 120

Query: 121 VGQIFFARLSDIFGRFSIMIVSVIFYSVGTIIESQAVNITRFAVGGCFYQLGLTGIILIL 180
           VGQIFFARLSDIFGRFSIMIVS+IFYS+GTIIESQAVNITRFAVGGCFYQLGLTGIILIL
Sbjct: 121 VGQIFFARLSDIFGRFSIMIVSIIFYSMGTIIESQAVNITRFAVGGCFYQLGLTGIILIL 180

Query: 181 EVIASDFSNLNWRLLALFIPALPFIINTWISGDVTSAIGTNWKWGIGMWAFILPLACIPL 240
           EVIASDFSNLNWRLLALFIPALPFIINTWISG+VTSAI  NWKWGIGMWAFILPLACIPL
Sbjct: 181 EVIASDFSNLNWRLLALFIPALPFIINTWISGNVTSAIDANWKWGIGMWAFILPLACIPL 240

Query: 241 GICMLHMRYLARKHAKDRLKPEFEALNKLKWKSFCIDIAFWKLDIIGMLLITVFFGCVLV 300
           GICMLHMRYLARKHAKDRLKPEFEALNKLKWKSFCIDIAFWKLDIIGMLLITVFFGCVLV
Sbjct: 241 GICMLHMRYLARKHAKDRLKPEFEALNKLKWKSFCIDIAFWKLDIIGMLLITVFFGCVLV 300

Query: 301 PFTLAGGLKEEWKSAHIIVPEVIGWVVVLPLYMLWEMKYSRHPLTPWDLIKDRGXXXXXX 360
           PFTLAGGLKEEWK+AHIIVPEVIGWVVVLPLYMLWE+KYSRHPLTPWDLI+DRG      
Sbjct: 301 PFTLAGGLKEEWKTAHIIVPEVIGWVVVLPLYMLWEIKYSRHPLTPWDLIQDRGIFFALL 360

Query: 361 XXXXXXXXWYMQGDYMYTVLVVAVHESIKSATRITSLYSFVSVIVGTILGFILIKVRRTK 420
                   WYMQGDYMYTVLVVAVHESIKSATRITSLYSFVSVIVGTILGFILIKVRRTK
Sbjct: 361 IAFFINFNWYMQGDYMYTVLVVAVHESIKSATRITSLYSFVSVIVGTILGFILIKVRRTK 420

Query: 421 PFIIFGISCWIVSFGLLVHYRGDSGAHSGIIGSLCLLGFGAGSFTYVTQASIQASAKTHA 480
           PFIIFGISCWIVSFGLLVHYRGDSGAHSGIIGSLCLLGFGAGSFTYVTQASIQASAKTHA
Sbjct: 421 PFIIFGISCWIVSFGLLVHYRGDSGAHSGIIGSLCLLGFGAGSFTYVTQASIQASAKTHA 480

Query: 481 RMAVVTSLYLATYNIXXXXXXXXXXXXWTNILPKEISKRISDPTLAAQAYSAPFTFITTY 540
           RMAVVTSLYLATYNI            WTNILPKEISKRISDPTLAAQAY +PFTFITTY
Sbjct: 481 RMAVVTSLYLATYNIGSAFGSSVSGAVWTNILPKEISKRISDPTLAAQAYGSPFTFITTY 540

Query: 541 TWGTPERIALVMSYRYVQKILCIIGLVFCFPLLGCAFMLRNHELTDSIALEGNDHLKSKD 600
           TWGTPERIALVMSYRYVQKILCIIGLVFCFPLLGCAFMLRNH+LTDSIALEGNDHL+SK+
Sbjct: 541 TWGTPERIALVMSYRYVQKILCIIGLVFCFPLLGCAFMLRNHKLTDSIALEGNDHLESKN 600

Query: 601 SFETEEKQESFLKSMIFTRFTRSEDKRN 628
           +FE EEK+ESFLK+  FT FT S+D+++
Sbjct: 601 TFEIEEKEESFLKNKFFTHFTSSKDRKD 628

>Skud_5.24 Chr5 (26839..28722) [1884 bp, 627 aa] {ON} YEL065W (REAL)
          Length = 627

 Score = 1135 bits (2935), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 548/628 (87%), Positives = 583/628 (92%), Gaps = 1/628 (0%)

Query: 1   MDPATANHALPEDFTEDVVPDILEKEVGAIVDVNPTLTTSSPAPSYIELIDPGVYNIEIY 60
           MDP+TA+ ALPE+FTED+VP+I EKE G  VDVNPTLT SSPAPSYIELIDPGV+NIEIY
Sbjct: 1   MDPSTASRALPEEFTEDIVPEIPEKEAGTTVDVNPTLTISSPAPSYIELIDPGVHNIEIY 60

Query: 61  AEMYSRPLYRVALFFSLFLIAYAYGLDGNIRYTFQAYATSSYSQHSLLSTVNCIKTVIAA 120
           AE+Y+RPLYRVALFFSLFLIAYAYGLDGNIRYTFQAYATSSYSQHSLLSTVNCIKTVIAA
Sbjct: 61  AEIYNRPLYRVALFFSLFLIAYAYGLDGNIRYTFQAYATSSYSQHSLLSTVNCIKTVIAA 120

Query: 121 VGQIFFARLSDIFGRFSIMIVSVIFYSVGTIIESQAVNITRFAVGGCFYQLGLTGIILIL 180
           VGQIFFARLSDIFGRFSI+++SVIFY +GT+IESQAVNITRFAVGGCFYQLGLTGIILIL
Sbjct: 121 VGQIFFARLSDIFGRFSILVISVIFYIMGTVIESQAVNITRFAVGGCFYQLGLTGIILIL 180

Query: 181 EVIASDFSNLNWRLLALFIPALPFIINTWISGDVTSAIGTNWKWGIGMWAFILPLACIPL 240
           EVIASDFSNLNWRLLALFIPALPFIINTWISG+VTSAIGTNWKWGIGMWAFILPLACIPL
Sbjct: 181 EVIASDFSNLNWRLLALFIPALPFIINTWISGNVTSAIGTNWKWGIGMWAFILPLACIPL 240

Query: 241 GICMLHMRYLARKHAKDRLKPEFEALNKLKWKSFCIDIAFWKLDIIGMLLITVFFGCVLV 300
           G+CMLHMRYLARKHAKDRLKPEFEALNKLKWKSFCIDIAFWKLDIIGMLLIT FFGCVLV
Sbjct: 241 GLCMLHMRYLARKHAKDRLKPEFEALNKLKWKSFCIDIAFWKLDIIGMLLITAFFGCVLV 300

Query: 301 PFTLAGGLKEEWKSAHIIVPEVIGWVVVLPLYMLWEMKYSRHPLTPWDLIKDRGXXXXXX 360
           PFTLAGGLKEEW++AHIIVPEVIGWVV LPLYMLWEMKYSRHPLTPWDLIKDRG      
Sbjct: 301 PFTLAGGLKEEWRTAHIIVPEVIGWVVALPLYMLWEMKYSRHPLTPWDLIKDRGIFFALL 360

Query: 361 XXXXXXXXWYMQGDYMYTVLVVAVHESIKSATRITSLYSFVSVIVGTILGFILIKVRRTK 420
                   WYMQGDYMYTVL+VAVHESIKSATRITSLYSFVSVIVGTILGFILIKVRRTK
Sbjct: 361 IAFFINFNWYMQGDYMYTVLIVAVHESIKSATRITSLYSFVSVIVGTILGFILIKVRRTK 420

Query: 421 PFIIFGISCWIVSFGLLVHYRGDSGAHSGIIGSLCLLGFGAGSFTYVTQASIQASAKTHA 480
           PFI+FGISCWIVSFGLLVHYRGDSGAH+GIIGSLCLLGFGAGSFTYVTQASIQASAKTHA
Sbjct: 421 PFILFGISCWIVSFGLLVHYRGDSGAHAGIIGSLCLLGFGAGSFTYVTQASIQASAKTHA 480

Query: 481 RMAVVTSLYLATYNIXXXXXXXXXXXXWTNILPKEISKRISDPTLAAQAYSAPFTFITTY 540
           RMA+VTSLYLATYNI            WTNILP+EISKRISDPTLAAQAY +PFTFI TY
Sbjct: 481 RMAIVTSLYLATYNIGSAFGSSVSGAVWTNILPREISKRISDPTLAAQAYGSPFTFIITY 540

Query: 541 TWGTPERIALVMSYRYVQKILCIIGLVFCFPLLGCAFMLRNHELTDSIALEGNDHLKSKD 600
           TWGTPERIALVMSYRYVQKILCIIGLVFCFPLLGCA MLRNH+LTDSIALEG+D+L+SKD
Sbjct: 541 TWGTPERIALVMSYRYVQKILCIIGLVFCFPLLGCALMLRNHKLTDSIALEGSDYLESKD 600

Query: 601 SFETEEKQESFLKSMIFTRFTRSEDKRN 628
           +FE +EK+E+FLKS   ++FT  ++K N
Sbjct: 601 AFEPKEKEETFLKSKFLSQFT-GKNKEN 627

>Suva_5.2 Chr5 (3340..5223) [1884 bp, 627 aa] {ON} YEL065W (REAL)
          Length = 627

 Score = 1100 bits (2845), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 531/627 (84%), Positives = 563/627 (89%)

Query: 1   MDPATANHALPEDFTEDVVPDILEKEVGAIVDVNPTLTTSSPAPSYIELIDPGVYNIEIY 60
           MDPATAN ALPE+FTE VVP+ILEKEVG      P LTTSSPAPSYIELIDPGV NIEIY
Sbjct: 1   MDPATANRALPEEFTEVVVPEILEKEVGTTTAAGPALTTSSPAPSYIELIDPGVRNIEIY 60

Query: 61  AEMYSRPLYRVALFFSLFLIAYAYGLDGNIRYTFQAYATSSYSQHSLLSTVNCIKTVIAA 120
           AE YSRPLYR  LFFS+FLIAYAYGLDG IRYTFQAYATSSYSQHSLLSTVNCIKTVIAA
Sbjct: 61  AEQYSRPLYRAGLFFSIFLIAYAYGLDGGIRYTFQAYATSSYSQHSLLSTVNCIKTVIAA 120

Query: 121 VGQIFFARLSDIFGRFSIMIVSVIFYSVGTIIESQAVNITRFAVGGCFYQLGLTGIILIL 180
           VGQIFFARLSDIFGRFSI+++SVIFYSVGTIIESQAV ITRFAVGGCFYQLGLTG+ILIL
Sbjct: 121 VGQIFFARLSDIFGRFSILVISVIFYSVGTIIESQAVTITRFAVGGCFYQLGLTGVILIL 180

Query: 181 EVIASDFSNLNWRLLALFIPALPFIINTWISGDVTSAIGTNWKWGIGMWAFILPLACIPL 240
           EVIASDFSNLNWRLLALF+PALPFI+NTWISGDVTSAIGTNWKWGIGMWAFILPLACIPL
Sbjct: 181 EVIASDFSNLNWRLLALFVPALPFIVNTWISGDVTSAIGTNWKWGIGMWAFILPLACIPL 240

Query: 241 GICMLHMRYLARKHAKDRLKPEFEALNKLKWKSFCIDIAFWKLDIIGMLLITVFFGCVLV 300
           G+CMLHMRYLARKHAKD+L+PEFE LN L WKSF IDI FWKLD+IG+LL+T FFGCVLV
Sbjct: 241 GLCMLHMRYLARKHAKDKLRPEFETLNNLDWKSFSIDIVFWKLDLIGLLLVTAFFGCVLV 300

Query: 301 PFTLAGGLKEEWKSAHIIVPEVIGWVVVLPLYMLWEMKYSRHPLTPWDLIKDRGXXXXXX 360
           PFTLAGGLKEEWK+AHIIVPEVIGWVV LPLYM+WE+KYSRHPLTPWDLIKDRG      
Sbjct: 301 PFTLAGGLKEEWKAAHIIVPEVIGWVVALPLYMVWEVKYSRHPLTPWDLIKDRGVLFALF 360

Query: 361 XXXXXXXXWYMQGDYMYTVLVVAVHESIKSATRITSLYSFVSVIVGTILGFILIKVRRTK 420
                   WYMQGDYMYTVLVVAVHESIKSATRIT+LYSFVSVIVGTILGFILIKVRRTK
Sbjct: 361 IAFFINFNWYMQGDYMYTVLVVAVHESIKSATRITALYSFVSVIVGTILGFILIKVRRTK 420

Query: 421 PFIIFGISCWIVSFGLLVHYRGDSGAHSGIIGSLCLLGFGAGSFTYVTQASIQASAKTHA 480
           PFI+FGISCWIVSFGLLVHYRGDSGAH+GIIGSLCLLGFGAGSFTYVTQASIQASA THA
Sbjct: 421 PFILFGISCWIVSFGLLVHYRGDSGAHAGIIGSLCLLGFGAGSFTYVTQASIQASAGTHA 480

Query: 481 RMAVVTSLYLATYNIXXXXXXXXXXXXWTNILPKEISKRISDPTLAAQAYSAPFTFITTY 540
           RMA+VTSLYLATYNI            WTNILPKEISKRISDPTLAA+AY +PFTFITTY
Sbjct: 481 RMAIVTSLYLATYNIGSAFGSSVSGAVWTNILPKEISKRISDPTLAAEAYGSPFTFITTY 540

Query: 541 TWGTPERIALVMSYRYVQKILCIIGLVFCFPLLGCAFMLRNHELTDSIALEGNDHLKSKD 600
           TWGTPERIALVMSYRYVQKILCIIGLVFCFPLLGCA MLRNH+LTDSIALEGNDHL+SK+
Sbjct: 541 TWGTPERIALVMSYRYVQKILCIIGLVFCFPLLGCACMLRNHKLTDSIALEGNDHLESKN 600

Query: 601 SFETEEKQESFLKSMIFTRFTRSEDKR 627
             E  EK+E+ L++    +FT  E K 
Sbjct: 601 DNEIVEKEETSLRTRFLAQFTSKEKKN 627

>TPHA0M00120 Chr13 (23458..25317) [1860 bp, 619 aa] {ON} 
          Length = 619

 Score =  823 bits (2126), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 384/588 (65%), Positives = 473/588 (80%), Gaps = 2/588 (0%)

Query: 24  EKEVGAIVDVNPTLTTSSPAPSYIEL-IDPGVYNIEIYAEMYSRPLYRVALFFSLFLIAY 82
           + E+   +D+ P LT  S +    E  +D GV+NIE+YAE YS P++R ALFFS+FL+AY
Sbjct: 23  DAEMQKDLDIEPKLTAVSSSSDDAESHVDAGVHNIEVYAEQYSSPIHRFALFFSIFLVAY 82

Query: 83  AYGLDGNIRYTFQAYATSSYSQHSLLSTVNCIKTVIAAVGQIFFARLSDIFGRFSIMIVS 142
           AYGLDG +RYT+Q+YATSSY+QHSLLSTVNCI TVIAA GQI +AR SDIFGR +I+++ 
Sbjct: 83  AYGLDGQVRYTYQSYATSSYAQHSLLSTVNCITTVIAAAGQICYARASDIFGRMTILVIG 142

Query: 143 VIFYSVGTIIESQAVNITRFAVGGCFYQLGLTGIILILEVIASDFSNLNWRLLALFIPAL 202
           VIFYS+GTIIESQA N++RFA G CFYQLG TGI+L LEVIA+DFSNLNWRLLA F+PAL
Sbjct: 143 VIFYSMGTIIESQATNVSRFAAGSCFYQLGYTGIVLTLEVIAADFSNLNWRLLASFVPAL 202

Query: 203 PFIINTWISGDVTSAIGTNWKWGIGMWAFILPLACIPLGICMLHMRYLARKHAKDRLKPE 262
           PFIINTWISG+VTSA+  NWKWGIGMWAFILPL+ IPLG C+LHMRYLA+K+A DRL  E
Sbjct: 203 PFIINTWISGNVTSAVNGNWKWGIGMWAFILPLSAIPLGCCLLHMRYLAKKNAGDRLLKE 262

Query: 263 FEALNKLKWKSFCIDIAFWKLDIIGMLLITVFFGCVLVPFTLAGGLKEEWKSAHIIVPEV 322
              +  L WK F ++I FW+LD IG+L++ V FGC+L+PFTLAGGL+ EW++AHIIVPEV
Sbjct: 263 ASLIGTLGWKKFIVEILFWRLDFIGLLMLCVTFGCILIPFTLAGGLQSEWQTAHIIVPEV 322

Query: 323 IGWVVVLPLYMLWEMKYSRHPLTPWDLIKDRGXXXXXXXXXXXXXXWYMQGDYMYTVLVV 382
           IGW + LPL++LWE+K+SRHPLTPW LIKDRG              WYMQGDYMYTVL+V
Sbjct: 323 IGWCLALPLFLLWEIKFSRHPLTPWALIKDRGIIFAIFIAFHINFCWYMQGDYMYTVLIV 382

Query: 383 AVHESIKSATRITSLYSFVSVIVGTILGFILIKVRRTKPFIIFGISCWIVSFGLLVHYRG 442
           +VHES+KSATRITSLYSFVSVI GTILG  + K+RRTKPFI+FG+ CW ++FGLLVHYRG
Sbjct: 383 SVHESVKSATRITSLYSFVSVITGTILGMFITKIRRTKPFIVFGVVCWFIAFGLLVHYRG 442

Query: 443 DSGAHSGIIGSLCLLGFGAGSFTYVTQASIQASAKTHARMAVVTSLYLATYNIXXXXXXX 502
           D+ +HSGIIGSLCLLGFGAG FTY TQASIQASAK+H++MAV+T+LYLATYNI       
Sbjct: 443 DNNSHSGIIGSLCLLGFGAGFFTYTTQASIQASAKSHSKMAVITALYLATYNIGSSVGAA 502

Query: 503 XXXXXWTNILPKEISKRISDPTLAAQAYSAPFTFITTYTWGTPERIALVMSYRYVQKILC 562
                WTNILPKEISKR+++ TLAA AYS+P++FI  YTWGTPER A+V++YRY Q+ILC
Sbjct: 503 VSGAIWTNILPKEISKRLNNETLAALAYSSPYSFIIDYTWGTPERDAVVLAYRYTQRILC 562

Query: 563 IIGLVFCFPLLGCAFMLRNHELTDSIALEGNDHLKSKDSFETEEKQES 610
           I+GL FC  LL  A  LRNH+L  S++++  +  K ++  +   K+++
Sbjct: 563 IVGLCFCTTLLISALFLRNHKLVSSVSID-KEQTKVEEVSDITSKEKA 609

>NDAI0I02650 Chr9 (617474..619390) [1917 bp, 638 aa] {ON} 
          Length = 638

 Score =  823 bits (2127), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 394/579 (68%), Positives = 459/579 (79%), Gaps = 1/579 (0%)

Query: 38  TTSSPAPSYIELIDPGVYNIEIYAEMYSRPLYRVALFFSLFLIAYAYGLDGNIRYTFQAY 97
           +T   + S I + D GV NIE+YAE Y +P YRV LFFSLFL+AYAYGLDGNIRYT+QAY
Sbjct: 25  STDISSGSEISIKDAGVQNIEVYAEQYKKPYYRVLLFFSLFLVAYAYGLDGNIRYTYQAY 84

Query: 98  ATSSYSQHSLLSTVNCIKTVIAAVGQIFFARLSDIFGRFSIMIVSVIFYSVGTIIESQAV 157
           ATSSYSQHSLLSTVNCIKTVIAA GQI+FAR SDIFGR +++I++++FY VGTIIESQA 
Sbjct: 85  ATSSYSQHSLLSTVNCIKTVIAAAGQIWFARASDIFGRLTMLIIAILFYVVGTIIESQAT 144

Query: 158 NITRFAVGGCFYQLGLTGIILILEVIASDFSNLNWRLLALFIPALPFIINTWISGDVTSA 217
           N+ RF  GGCFYQ+G TG +LI+EVIA+DFSNLNWRLLALF+PALPFIINTWISGDVTSA
Sbjct: 145 NVARFTAGGCFYQVGYTGAMLIVEVIATDFSNLNWRLLALFVPALPFIINTWISGDVTSA 204

Query: 218 IGTNWKWGIGMWAFILPLACIPLGICMLHMRYLARKHAKDRLKPEFEALNKLKWKS-FCI 276
           +G +WKWGIGMWAFI PLACIPLG CMLHMRYLA K++KD+L          +WK  F I
Sbjct: 205 VGGDWKWGIGMWAFIFPLACIPLGCCMLHMRYLANKNSKDKLAKHVMVPKDKEWKRYFFI 264

Query: 277 DIAFWKLDIIGMLLITVFFGCVLVPFTLAGGLKEEWKSAHIIVPEVIGWVVVLPLYMLWE 336
           D+ FWKLD+IG+LL+  FFGCVLVPFTLAGG+  EWK+AHIIVPEVIGWVV LPLY+LWE
Sbjct: 265 DVLFWKLDMIGLLLMVCFFGCVLVPFTLAGGMNSEWKTAHIIVPEVIGWVVCLPLYILWE 324

Query: 337 MKYSRHPLTPWDLIKDRGXXXXXXXXXXXXXXWYMQGDYMYTVLVVAVHESIKSATRITS 396
           MK+S+HPLTPW L+KDRG              WYMQGDYMYTVLVVAVHES+KSATRITS
Sbjct: 325 MKFSKHPLTPWALLKDRGVFSALIIATMINFCWYMQGDYMYTVLVVAVHESVKSATRITS 384

Query: 397 LYSFVSVIVGTILGFILIKVRRTKPFIIFGISCWIVSFGLLVHYRGDSGAHSGIIGSLCL 456
           LYSFVSV+ GT LG +LIKVRRTKPFIIFGIS W V+FGLL+ YRGDS +H+GIIGSLCL
Sbjct: 385 LYSFVSVLTGTGLGLVLIKVRRTKPFIIFGISMWFVAFGLLIRYRGDSASHAGIIGSLCL 444

Query: 457 LGFGAGSFTYVTQASIQASAKTHARMAVVTSLYLATYNIXXXXXXXXXXXXWTNILPKEI 516
           LGFGAG FTY TQASIQA+ ++H ++AV+T+LYLA YNI            WTN+LP  I
Sbjct: 445 LGFGAGFFTYTTQASIQATTRSHQKLAVITALYLAAYNIGSGLGSAVSGAVWTNVLPDRI 504

Query: 517 SKRISDPTLAAQAYSAPFTFITTYTWGTPERIALVMSYRYVQKILCIIGLVFCFPLLGCA 576
           SK I++ TLAA+AY +PFTFI T TWGTP+R+A+V +YR VQKILCIIGL FC PLL  A
Sbjct: 505 SKAIANQTLAAEAYGSPFTFIITNTWGTPDRMAVVKAYRDVQKILCIIGLCFCIPLLCAA 564

Query: 577 FMLRNHELTDSIALEGNDHLKSKDSFETEEKQESFLKSM 615
             LRNH L D +AL   D    K+     +    F+ S+
Sbjct: 565 LFLRNHRLEDVVALNELDEKNVKEDDPVVDFLAKFIPSL 603

>NCAS0D02350 Chr4 (439325..441229) [1905 bp, 634 aa] {ON} 
          Length = 634

 Score =  816 bits (2108), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 390/566 (68%), Positives = 452/566 (79%), Gaps = 4/566 (0%)

Query: 51  DPGVYNIEIYAEMYSRPLYRVALFFSLFLIAYAYGLDGNIRYTFQAYATSSYSQHSLLST 110
           D GV NIEIYAE Y  P  R  LFFSLFL+AYAYGLDGNIRYTFQA ATSSYS+HSLLST
Sbjct: 47  DAGVNNIEIYAEQYQNPFLRAMLFFSLFLVAYAYGLDGNIRYTFQALATSSYSEHSLLST 106

Query: 111 VNCIKTVIAAVGQIFFARLSDIFGRFSIMIVSVIFYSVGTIIESQAVNITRFAVGGCFYQ 170
           VNCIKTVIAA GQI+FAR SDIFGR +I+ VS+IFY +GT+IESQA N+ RF  GGCFYQ
Sbjct: 107 VNCIKTVIAAAGQIWFARASDIFGRLTILGVSIIFYIIGTVIESQATNVARFTAGGCFYQ 166

Query: 171 LGLTGIILILEVIASDFSNLNWRLLALFIPALPFIINTWISGDVTSAIGTNWKWGIGMWA 230
           LG TG +LI+E+IA+DFSNLNWRLLALFIPALPFIINTWISGDVT+A+  NWKWGIGMWA
Sbjct: 167 LGYTGAMLIIEIIATDFSNLNWRLLALFIPALPFIINTWISGDVTAAVNGNWKWGIGMWA 226

Query: 231 FILPLACIPLGICMLHMRYLARKHAKDRLKPEFEALNKLKWKSFCIDIAFWKLDIIGMLL 290
           FI PLACIPL  CMLHMRYLA K+AKDRL P F     +  K + ID+ FW+LD+IG+LL
Sbjct: 227 FIFPLACIPLACCMLHMRYLAHKNAKDRLMPSFTIPKDVSRKEYFIDVFFWRLDMIGLLL 286

Query: 291 ITVFFGCVLVPFTLAGGLKEEWKSAHIIVPEVIGWVVVLPLYMLWEMKYSRHPLTPWDLI 350
           I  FFGCVL+PFTLAGG+KE+W++AHIIVPEVIGW V LPLY+LWE+K+SRHPLTPW+L+
Sbjct: 287 IVCFFGCVLIPFTLAGGMKEQWRTAHIIVPEVIGWCVALPLYILWEIKFSRHPLTPWELL 346

Query: 351 KDRGXXXXXXXXXXXXXXWYMQGDYMYTVLVVAVHESIKSATRITSLYSFVSVIVGTILG 410
           KDRG              WYMQGDYMYTVL+VAVHES+K+ATRITSLYSFVSVI GTILG
Sbjct: 347 KDRGVYSALIIAFLINFCWYMQGDYMYTVLIVAVHESVKAATRITSLYSFVSVITGTILG 406

Query: 411 FILIKVRRTKPFIIFGISCWIVSFGLLVHYRGDSGAHSGIIGSLCLLGFGAGSFTYVTQA 470
             L+K+RRTKPFI+FGI  W +SFGLL+HYRGDSGAH+GIIGSLCLLGF AG FTY TQ 
Sbjct: 407 LFLVKLRRTKPFILFGICGWFISFGLLIHYRGDSGAHAGIIGSLCLLGFCAGFFTYTTQT 466

Query: 471 SIQASAKTHARMAVVTSLYLATYNIXXXXXXXXXXXXWTNILPKEISKRISDPTLAAQAY 530
           SIQA+ ++HA+MAV+T+LYLA YNI            WTN+LP  IS+ IS+ TLAA+AY
Sbjct: 467 SIQATTRSHAKMAVITALYLACYNIGSSFGAAVSGGVWTNVLPDRISRGISNQTLAAEAY 526

Query: 531 SAPFTFITTYTWGTPERIALVMSYRYVQKILCIIGLVFCFPLLGCAFMLRNHELTDSIAL 590
            +PFTFI TYTW T ER A+V +YR  QKILCIIGLVFC PLL  A MLR+H+L D +AL
Sbjct: 527 GSPFTFIITYTWETAERQAVVKAYRETQKILCIIGLVFCVPLLMAALMLRDHKLEDVVAL 586

Query: 591 EGNDHLKSKDSFETEEKQESFLKSMI 616
           +      S+   E ++   +FLK  I
Sbjct: 587 DQ----MSEKVVEDDDPIFAFLKKCI 608

>Kpol_358.4 s358 complement(9458..11311) [1854 bp, 617 aa] {ON}
           complement(9458..11311) [1854 nt, 618 aa]
          Length = 617

 Score =  806 bits (2081), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 379/561 (67%), Positives = 452/561 (80%), Gaps = 3/561 (0%)

Query: 51  DPGVYNIEIYAEMYSRPLYRVALFFSLFLIAYAYGLDGNIRYTFQAYATSSYSQHSLLST 110
           D GV NIE+YAE YS P+YRV LFFSLFL+AYAYGLDG++RYT+QA ATSSYSQHSLLST
Sbjct: 55  DAGVNNIEVYAEQYSSPIYRVMLFFSLFLVAYAYGLDGSVRYTYQAQATSSYSQHSLLST 114

Query: 111 VNCIKTVIAAVGQIFFARLSDIFGRFSIMIVSVIFYSVGTIIESQAVNITRFAVGGCFYQ 170
           VN I TVIAA GQI +AR SDIFGR +I+I+ ++FY+VGTIIESQA N+TRFAVG CFYQ
Sbjct: 115 VNAITTVIAAAGQICYARASDIFGRMTILIIGLVFYAVGTIIESQATNVTRFAVGSCFYQ 174

Query: 171 LGLTGIILILEVIASDFSNLNWRLLALFIPALPFIINTWISGDVTSAIGTNWKWGIGMWA 230
           LG TG+IL LE+IA DFSNLNWRL A F+PALPFIINTWISG+V+ A+G +WKWGIGMWA
Sbjct: 175 LGYTGVILSLELIAMDFSNLNWRLFASFVPALPFIINTWISGNVSGAVGQHWKWGIGMWA 234

Query: 231 FILPLACIPLGICMLHMRYLARKHAKDRLKPEFEALNKLKWKSFCIDIAFWKLDIIGMLL 290
           FI+PL+ IPLG C+LHMR+LA K+AKDRLK EF     + W ++ +D+  WKLD IG+LL
Sbjct: 235 FIVPLSAIPLGCCLLHMRWLAHKNAKDRLKSEFRTYRDMGWFAYIVDVFLWKLDFIGLLL 294

Query: 291 ITVFFGCVLVPFTLAGGLKEEWKSAHIIVPEVIGWVVVLPLYMLWEMKYSRHPLTPWDLI 350
           +   FGC+LVPFTLAGGL+++WK+AHIIVPEVIGW V LP+++LWE+K+S+ PLTPW LI
Sbjct: 295 LCATFGCILVPFTLAGGLQDKWKTAHIIVPEVIGWCVALPIFLLWEIKFSKVPLTPWALI 354

Query: 351 KDRGXXXXXXXXXXXXXXWYMQGDYMYTVLVVAVHESIKSATRITSLYSFVSVIVGTILG 410
           KDRG              WYMQGDYMYTVL+V+V+ESIKSATRITSLYSFVSVI GT+LG
Sbjct: 355 KDRGIFFALVIAFHINFIWYMQGDYMYTVLIVSVNESIKSATRITSLYSFVSVITGTLLG 414

Query: 411 FILIKVRRTKPFIIFGISCWIVSFGLLVHYRGDSGAHSGIIGSLCLLGFGAGSFTYVTQA 470
            ++IKVRRTKPFIIFG+SCW ++FGLLVHYRG S +HSGI+GSLCLLGFGAG FTY TQA
Sbjct: 415 LVIIKVRRTKPFIIFGVSCWFIAFGLLVHYRGSSSSHSGIVGSLCLLGFGAGFFTYTTQA 474

Query: 471 SIQASAKTHARMAVVTSLYLATYNIXXXXXXXXXXXXWTNILPKEISKRISDPTLAAQAY 530
           SIQAS K H++MAV+T+LYLA YNI            WTN+LPK+ISKRI++ TLAA+AY
Sbjct: 475 SIQASVKYHSKMAVITALYLAMYNIGSAVGAAVSGAIWTNVLPKQISKRIANETLAAEAY 534

Query: 531 SAPFTFITTYTWGTPERIALVMSYRYVQKILCIIGLVFCFPLLGCAFMLRNHELTDSIA- 589
            +PFTFI TYTW TPER A+V+SYRY QKILCI+GL FC  LLG A  LRNH+L   +A 
Sbjct: 535 GSPFTFILTYTWDTPERQAVVVSYRYTQKILCIVGLCFCSTLLGAALFLRNHKLESVVAL 594

Query: 590 --LEGNDHLKSKDSFETEEKQ 608
             LE   +   + SF   +K 
Sbjct: 595 SELENTPNSDEQGSFADNDKN 615

>SAKL0C12122g Chr3 (1086281..1088116) [1836 bp, 611 aa] {ON} similar
           to uniprot|P39980 Saccharomyces cerevisiae YEL065W SIT1
           Ferrioxamine B transporter member of the ARN family of
           transporters that specifically recognize
           siderophore-iron chelates transcription is induced
           during iron deprivation and diauxic shift potentially
           phosphorylated by Cdc28p
          Length = 611

 Score =  791 bits (2044), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 393/604 (65%), Positives = 465/604 (76%), Gaps = 8/604 (1%)

Query: 32  DVNPTLTTSSPAPSYIELI--------DPGVYNIEIYAEMYSRPLYRVALFFSLFLIAYA 83
           D+  T+T  S AP     I        D GV+NIEIYA+ Y  P YRVALFFS+FL+AYA
Sbjct: 5   DIKKTVTEGSVAPKDTWSIKTSDSKGKDAGVHNIEIYADQYKSPYYRVALFFSIFLVAYA 64

Query: 84  YGLDGNIRYTFQAYATSSYSQHSLLSTVNCIKTVIAAVGQIFFARLSDIFGRFSIMIVSV 143
           YGLDGNIRYTFQAYATSSYSQHSL+STVNCIKTVIAA GQI FAR SD+FGR SI+I++V
Sbjct: 65  YGLDGNIRYTFQAYATSSYSQHSLISTVNCIKTVIAAAGQICFARASDVFGRLSILIIAV 124

Query: 144 IFYSVGTIIESQAVNITRFAVGGCFYQLGLTGIILILEVIASDFSNLNWRLLALFIPALP 203
           +FY VGT+IESQA N++RFA G CFYQLGLTGIILILEVI  DFSNLNWRL+A F+PALP
Sbjct: 125 LFYVVGTVIESQATNVSRFAAGACFYQLGLTGIILILEVIVMDFSNLNWRLVASFVPALP 184

Query: 204 FIINTWISGDVTSAIGTNWKWGIGMWAFILPLACIPLGICMLHMRYLARKHAKDRLKPEF 263
           FIINTWISGDVTSAIGTNW+WGI MWAFILPL+CIPL  CMLHMRYLA K+A + L  EF
Sbjct: 185 FIINTWISGDVTSAIGTNWEWGIAMWAFILPLSCIPLVCCMLHMRYLAHKNAPENLMSEF 244

Query: 264 EALNKLKWKSFCIDIAFWKLDIIGMLLITVFFGCVLVPFTLAGGLKEEWKSAHIIVPEVI 323
           +   ++ W  + ++I FWKLD +G+LL+ V FG VL+PFTLAGGL+ +WKSA IIVPEV+
Sbjct: 245 KLYKQMPWSEYLVEIFFWKLDFLGLLLLCVSFGLVLIPFTLAGGLQTKWKSASIIVPEVL 304

Query: 324 GWVVVLPLYMLWEMKYSRHPLTPWDLIKDRGXXXXXXXXXXXXXXWYMQGDYMYTVLVVA 383
           GW + LPL++LWE KY+R+PLTPWDLIKDRG              WYMQGDYMYTVL+VA
Sbjct: 305 GWCLALPLFLLWEGKYARNPLTPWDLIKDRGIFSALIIAFLINFIWYMQGDYMYTVLIVA 364

Query: 384 VHESIKSATRITSLYSFVSVIVGTILGFILIKVRRTKPFIIFGISCWIVSFGLLVHYRGD 443
           VHESIKSATRI SLYSFVSVI GT+LGF+++KVRRTKPFI+FG+ CW +SFGLLVHYRGD
Sbjct: 365 VHESIKSATRIVSLYSFVSVITGTLLGFVIVKVRRTKPFILFGVCCWFLSFGLLVHYRGD 424

Query: 444 SGAHSGIIGSLCLLGFGAGSFTYVTQASIQASAKTHARMAVVTSLYLATYNIXXXXXXXX 503
           SGAH+GI+GSLCLLGFGAG FTY TQASIQAS  +H  MAV+T+LYLATYNI        
Sbjct: 425 SGAHAGIVGSLCLLGFGAGFFTYTTQASIQASTGSHQNMAVITALYLATYNIGSAVGNAV 484

Query: 504 XXXXWTNILPKEISKRISDPTLAAQAYSAPFTFITTYTWGTPERIALVMSYRYVQKILCI 563
               WTN+LP+++SKR+SDP +A+ AY +PFTFI TYTW T ER A+V +YR+VQKILC 
Sbjct: 485 SGAIWTNVLPQQLSKRLSDPEMASAAYGSPFTFIITYTWETLERQAVVHAYRHVQKILCT 544

Query: 564 IGLVFCFPLLGCAFMLRNHELTDSIALEGNDHLKSKDSFETEEKQESFLKSMIFTRFTRS 623
           +G+ FC PL+  A +LRNH+L   +AL+  D     D  E       F  S      T  
Sbjct: 545 VGVCFCVPLVLAALLLRNHKLESVVALDDLDEKNRVDDNENGNFLTKFFPSSRSNGETEV 604

Query: 624 EDKR 627
            ++R
Sbjct: 605 RERR 608

>TDEL0G04740 Chr7 complement(865319..867124) [1806 bp, 601 aa] {ON} 
          Length = 601

 Score =  766 bits (1977), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 377/578 (65%), Positives = 449/578 (77%), Gaps = 5/578 (0%)

Query: 48  ELIDPGVYNIEIYAEMYSRPLYRVALFFSLFLIAYAYGLDGNIRYTFQAYATSSYSQHSL 107
           E  D GV+NIE++   Y    YR+ LFFS+FLI+YAYGLD NIRYT Q YAT+SYSQHSL
Sbjct: 29  EEKDAGVHNIEVFTAQYDHIGYRLMLFFSIFLISYAYGLDQNIRYTLQTYATNSYSQHSL 88

Query: 108 LSTVNCIKTVIAAVGQIFFARLSDIFGRFSIMIVSVIFYSVGTIIESQAVNITRFAVGGC 167
           L+TVNCI  VIAA GQ+ FAR +DIFGRF+++IV+VIFY +GTIIESQA N++RFA G C
Sbjct: 89  LATVNCIIAVIAAPGQVCFARAADIFGRFTVLIVAVIFYVMGTIIESQATNVSRFAAGAC 148

Query: 168 FYQLGLTGIILILEVIASDFSNLNWRLLALFIPALPFIINTWISGDVTSAIGTNWKWGIG 227
           FY+LG+TG++L++EVIA DFSNLNWRLLA F+PALPFIINTWISG+V +AIGTNWKWGIG
Sbjct: 149 FYRLGITGLMLMMEVIAMDFSNLNWRLLASFVPALPFIINTWISGNVLTAIGTNWKWGIG 208

Query: 228 MWAFILPLACIPLGICMLHMRYLARKHAKDRLKPEFEALNKLKWKSFCIDIAFWKLDIIG 287
           MWAFILPL+CIPLG CMLHMRYLA K+AKD+L+ EF+    + W  + +++ FW+LD  G
Sbjct: 209 MWAFILPLSCIPLGFCMLHMRYLAHKNAKDQLRSEFKLFKTMSWYEYIVEVFFWRLDFPG 268

Query: 288 MLLITVFFGCVLVPFTLAGGLKEEWKSAHIIVPEVIGWVVVLPLYMLWEMKYSRHPLTPW 347
           ++LI V FGC+L+PFTL GGL E+WK+A IIVPEVIGWVV LPLYM+WE KY+RHPLTPW
Sbjct: 269 LILICVTFGCILIPFTLGGGLNEKWKTAGIIVPEVIGWVVALPLYMIWESKYARHPLTPW 328

Query: 348 DLIKDRGXXXXXXXXXXXXXXWYMQGDYMYTVLVVAVHESIKSATRITSLYSFVSVIVGT 407
            LIKDRG              WYMQGDYM+TVL VAV+ES  SA RITSLYSFVSVI GT
Sbjct: 329 KLIKDRGIFSALIIAFHINFIWYMQGDYMFTVLRVAVNESNSSAQRITSLYSFVSVITGT 388

Query: 408 ILGFILIKVRRTKPFIIFGISCWIVSFGLLVHYRGDSGAHSGIIGSLCLLGFGAGSFTYV 467
           +LG +++KVRRTK FI+FGI CW +SFGLLVH+RGDS +HSGIIGSLCL+GFGAG FTY 
Sbjct: 389 LLGLVIVKVRRTKKFILFGIVCWFISFGLLVHFRGDSSSHSGIIGSLCLMGFGAGFFTYT 448

Query: 468 TQASIQASAKTHARMAVVTSLYLATYNIXXXXXXXXXXXXWTNILPKEISKRISDPTLAA 527
           TQASIQAS K H  +AV+TSLYLATYNI            WTN+LPKEI KR++D TL  
Sbjct: 449 TQASIQASTKHHENLAVITSLYLATYNIGSAVGAAVSGAIWTNVLPKEIGKRLNDATLTQ 508

Query: 528 QAYSAPFTFITTYTWGTPERIALVMSYRYVQKILCIIGLVFCFPLLGCAFMLRNHELTDS 587
           QAY  P TFI TYTW T ER A+V++YRY QK+LCI+GL FC PLL  AF+LR+H L D 
Sbjct: 509 QAYLEPLTFILTYTWETIERQAVVLAYRYTQKVLCIVGLCFCAPLLFSAFLLRDHRLGDV 568

Query: 588 IALEGNDHLKSKDSFETEEKQESFLKSMIFTRFTRSED 625
           IALE    L  K+  E EE  + + K   F R  + ED
Sbjct: 569 IALE---DLDEKNLAEDEESGKFWGKYFRFAR--KHED 601

>Kwal_23.5241 s23 (1071768..1073543) [1776 bp, 591 aa] {ON} YEL065W
           (SIT1) - Ferrioxamine B permease [contig 8] FULL
          Length = 591

 Score =  762 bits (1967), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 354/560 (63%), Positives = 434/560 (77%)

Query: 51  DPGVYNIEIYAEMYSRPLYRVALFFSLFLIAYAYGLDGNIRYTFQAYATSSYSQHSLLST 110
           D GV NIE+YA+ YS   YR+ LFFSLFL+AYAYGLDG +RY FQAYAT+SY  HSLLST
Sbjct: 24  DAGVNNIEVYADQYSHIGYRILLFFSLFLVAYAYGLDGMVRYNFQAYATNSYGSHSLLST 83

Query: 111 VNCIKTVIAAVGQIFFARLSDIFGRFSIMIVSVIFYSVGTIIESQAVNITRFAVGGCFYQ 170
           VNCIK VIAA GQ+ FAR +DIFGR SI+IVS++FY VGTII+SQA  ++++A G C YQ
Sbjct: 84  VNCIKAVIAAAGQLCFARAADIFGRISIIIVSILFYVVGTIIDSQATTVSKYAAGACIYQ 143

Query: 171 LGLTGIILILEVIASDFSNLNWRLLALFIPALPFIINTWISGDVTSAIGTNWKWGIGMWA 230
           LG TGIILILE+IA DFSNLNWRLLA F+PA+PFIINTWISGDV SA+G NWKWGIGMWA
Sbjct: 144 LGYTGIILILEIIAMDFSNLNWRLLASFVPAIPFIINTWISGDVVSAVGANWKWGIGMWA 203

Query: 231 FILPLACIPLGICMLHMRYLARKHAKDRLKPEFEALNKLKWKSFCIDIAFWKLDIIGMLL 290
           FI PL+ +PL  CM HMRYLAR+ A DRL  E      + W ++  ++ FW+LD +G+++
Sbjct: 204 FIFPLSALPLLGCMFHMRYLARRRASDRLVTEVSLYKHMSWSTYLTEVFFWRLDAVGLIM 263

Query: 291 ITVFFGCVLVPFTLAGGLKEEWKSAHIIVPEVIGWVVVLPLYMLWEMKYSRHPLTPWDLI 350
           + V FGC+L+PFTLAG LK++W++A IIVPEVIGW V LPL++LWEMK+++HPL PW++I
Sbjct: 264 VCVVFGCILIPFTLAGSLKDKWQTAEIIVPEVIGWCVALPLFLLWEMKFAKHPLVPWNVI 323

Query: 351 KDRGXXXXXXXXXXXXXXWYMQGDYMYTVLVVAVHESIKSATRITSLYSFVSVIVGTILG 410
           KDRG              WYMQG +MYTVL++AV+ES+KSATRITSLYSFVSV+ G  LG
Sbjct: 324 KDRGIWSALIIAIHINFIWYMQGSFMYTVLIIAVNESVKSATRITSLYSFVSVLTGLGLG 383

Query: 411 FILIKVRRTKPFIIFGISCWIVSFGLLVHYRGDSGAHSGIIGSLCLLGFGAGSFTYVTQA 470
           F++  +R+TK FI+FGI CW+VSFGLL+HYRGDS +HSGIIG+ CLLGFGAG FTY TQ 
Sbjct: 384 FVIAYIRKTKKFIMFGIGCWVVSFGLLIHYRGDSSSHSGIIGAQCLLGFGAGFFTYTTQT 443

Query: 471 SIQASAKTHARMAVVTSLYLATYNIXXXXXXXXXXXXWTNILPKEISKRISDPTLAAQAY 530
           SIQASAKTH  MAV+T+LYL+ YNI            WTNILP+E+ KRI+DPT  A AY
Sbjct: 444 SIQASAKTHQDMAVITALYLSFYNIGSALGSSVSGAIWTNILPRELRKRITDPTTYALAY 503

Query: 531 SAPFTFITTYTWGTPERIALVMSYRYVQKILCIIGLVFCFPLLGCAFMLRNHELTDSIAL 590
            +PFTFI TY WGTPER A+V SY+YVQK+LC++G+ FC  L+  A  LR+H L DS+AL
Sbjct: 504 GSPFTFIITYVWGTPEREAVVKSYQYVQKLLCVVGICFCATLIASALFLRDHRLGDSVAL 563

Query: 591 EGNDHLKSKDSFETEEKQES 610
           E  D   S +S    E Q+S
Sbjct: 564 EDEDEKFSINSDAEGELQDS 583

>KLTH0A01562g Chr1 complement(138389..140236) [1848 bp, 615 aa] {ON}
           similar to uniprot|P39980 Saccharomyces cerevisiae
           YEL065W SIT1 Ferrioxamine B transporter member of the
           ARN family of transporters that specifically recognize
           siderophore-iron chelates transcription is induced
           during iron deprivation and diauxic shift potentially
           phosphorylated by Cdc28p
          Length = 615

 Score =  736 bits (1899), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 353/570 (61%), Positives = 431/570 (75%)

Query: 51  DPGVYNIEIYAEMYSRPLYRVALFFSLFLIAYAYGLDGNIRYTFQAYATSSYSQHSLLST 110
           D GV NIE+YA  YS   YRVALFFSLFL+AYAYGLDG +R + QAYATSSY  HSLL+T
Sbjct: 44  DAGVNNIEVYAAQYSHFAYRVALFFSLFLVAYAYGLDGMVRSSLQAYATSSYGSHSLLAT 103

Query: 111 VNCIKTVIAAVGQIFFARLSDIFGRFSIMIVSVIFYSVGTIIESQAVNITRFAVGGCFYQ 170
           +NC+K VIAA GQI FAR SDIFGR +I+ ++V+ Y+VGTII+SQA NITR+A G C YQ
Sbjct: 104 INCVKAVIAAAGQICFARASDIFGRMTILALAVVLYAVGTIIDSQATNITRYAAGACIYQ 163

Query: 171 LGLTGIILILEVIASDFSNLNWRLLALFIPALPFIINTWISGDVTSAIGTNWKWGIGMWA 230
           LG TGIILILE+IA DFSNLNWRL+A F+PALPFIINTWISG+   A+G NWKWGIGMWA
Sbjct: 164 LGYTGIILILEIIAMDFSNLNWRLMASFVPALPFIINTWISGNALEALGMNWKWGIGMWA 223

Query: 231 FILPLACIPLGICMLHMRYLARKHAKDRLKPEFEALNKLKWKSFCIDIAFWKLDIIGMLL 290
           FI+PL+C+PL  C+LHMR+LA K+AKD+L+ E      + W  + +++ FW+LD++G+LL
Sbjct: 224 FIVPLSCVPLFACILHMRFLAHKNAKDQLESEVLLYKHMPWSQYLVEVFFWRLDLLGLLL 283

Query: 291 ITVFFGCVLVPFTLAGGLKEEWKSAHIIVPEVIGWVVVLPLYMLWEMKYSRHPLTPWDLI 350
           + V FGC+LVPFTLAG L+ +WK A IIVPEVIGW V LPL++LWE KYSRHPL PW L+
Sbjct: 284 VCVVFGCILVPFTLAGSLQSKWKRAEIIVPEVIGWCVALPLFLLWEGKYSRHPLVPWSLV 343

Query: 351 KDRGXXXXXXXXXXXXXXWYMQGDYMYTVLVVAVHESIKSATRITSLYSFVSVIVGTILG 410
           KDRG              WYMQGDYMYTVL+VAV+E+ KSA RITSLYSFVSVI G +LG
Sbjct: 344 KDRGIWSALIIAIHINFVWYMQGDYMYTVLMVAVNETAKSAARITSLYSFVSVITGFLLG 403

Query: 411 FILIKVRRTKPFIIFGISCWIVSFGLLVHYRGDSGAHSGIIGSLCLLGFGAGSFTYVTQA 470
            +++  RRTK FI+FGI+CW V+FGLLVHYRGDS +HSGI+GSLCLLGFGAG FTY TQ 
Sbjct: 404 GVIVYARRTKKFILFGIACWFVAFGLLVHYRGDSSSHSGIVGSLCLLGFGAGFFTYTTQT 463

Query: 471 SIQASAKTHARMAVVTSLYLATYNIXXXXXXXXXXXXWTNILPKEISKRISDPTLAAQAY 530
           SIQAS K+H  MAV+T+LYL+ YNI            WTNILP+E+ KRI+D      AY
Sbjct: 464 SIQASTKSHQDMAVITALYLSHYNIGSALGASISGAIWTNILPRELRKRITDVATYTLAY 523

Query: 531 SAPFTFITTYTWGTPERIALVMSYRYVQKILCIIGLVFCFPLLGCAFMLRNHELTDSIAL 590
            +PF FI  Y WGTPER+ +V +YR VQ+IL I+GL FC  LL  AF LR+H L +++AL
Sbjct: 524 GSPFVFIEEYLWGTPERMEVVAAYRVVQRILSIVGLCFCVTLLLSAFFLRDHRLENAVAL 583

Query: 591 EGNDHLKSKDSFETEEKQESFLKSMIFTRF 620
           E  D   S+ S E E + E   ++  F R+
Sbjct: 584 EDVDEKSSRKSDELEARIEDNTETKGFERY 613

>Kwal_23.4853 s23 complement(895045..896856) [1812 bp, 603 aa] {ON}
           YEL065W (SIT1) - Ferrioxamine B permease [contig 5] FULL
          Length = 603

 Score =  686 bits (1770), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 322/560 (57%), Positives = 412/560 (73%), Gaps = 11/560 (1%)

Query: 51  DPGVYNIEIYAEMYSRPLYRVALFFSLFLIAYAYGLDGNIRYTFQAYATSSYSQHSLLST 110
           D GV NI++YA+ Y+   YRVALFFSLFL+AY+Y LDG +R   + YAT SY  HSLLST
Sbjct: 27  DAGVKNIKVYADQYNNVFYRVALFFSLFLVAYSYRLDGLVRGKLETYATDSYGHHSLLST 86

Query: 111 VNCIKTVIAAVGQIFFARLSDIFGRFSIMIVSVIFYSVGTIIESQAVNITRFAVGGCFYQ 170
           VNCIKTVI A G I +AR SDIFGR +++ ++V+ Y VGTI+E Q+  +++FA G   +Q
Sbjct: 87  VNCIKTVIGAAGLIAYARASDIFGRMTMLAIAVLLYVVGTIVECQSNTVSKFATGASIFQ 146

Query: 171 LGLTGIILILEVIASDFSNLNWRLLALFIPALPFIINTWISGDVTSAIGTNWKWGIGMWA 230
           LG  GI+L+L+VIA DFS LNWR++AL++PALP IINTW+SGD+  AI  NWKWGIGMWA
Sbjct: 147 LGKAGIVLLLQVIAMDFSTLNWRMVALYVPALPIIINTWVSGDIIKAINGNWKWGIGMWA 206

Query: 231 FILPLACIPLGICMLHMRYLARKHAKDRLKPEFEALNKLKWKSFCIDIAFWKLDIIGMLL 290
           FILPLAC+PL  C++HMRYLA K+ KD+L  E+E      W ++  ++ FW+LDI+G++L
Sbjct: 207 FILPLACLPLFGCLIHMRYLAHKNCKDQLVNEWELYKNTSWPAYLKEVFFWRLDILGLIL 266

Query: 291 ITVFFGCVLVPFTLAGGLKEEWKSAHIIVPEVIGWVVVLPLYMLWEMKYSRHPLTPWDLI 350
           IT   GCVL+PFTLAGGL ++WKSAHIIVPEVIGW V  PL++LWE KY+RHPLTPW L+
Sbjct: 267 ITAGLGCVLIPFTLAGGLSDKWKSAHIIVPEVIGWCVAFPLFVLWEKKYARHPLTPWRLL 326

Query: 351 KDRGXXXXXXXXXXXXXXWYMQGDYMYTVLVVAVHESIKSATRITSLYSFVSVIVGTILG 410
           KDRG               YMQ DYMYTVLVVAV+ES+KSA RIT+L++FV++I GT+LG
Sbjct: 327 KDRGVISAIIIGFHIHFVVYMQADYMYTVLVVAVNESVKSAQRITTLFNFVTIITGTLLG 386

Query: 411 FILIKVRRTKPFIIFGISCWIVSFGLLVHYRGDSGAHSGIIGSLCLLGFGAGSFTYVTQA 470
           F++  V+RTK FI+FGI  W V+FGLL+ YRGDS +HSGI+G+LCLLGFG G F Y TQ 
Sbjct: 387 FVIAYVKRTKKFILFGICIWFVAFGLLIRYRGDSSSHSGIVGALCLLGFGGGFFNYATQV 446

Query: 471 SIQASAKTHARMAVVTSLYLATYNIXXXXXXXXXXXXWTNILPKEISKRISDPTLAAQAY 530
           S+ AS  +H  MAV+TSLYLA+YN+            WTN+LPK++ KRISD ++A  AY
Sbjct: 447 SLHASTSSHQDMAVITSLYLASYNVGSAVASAVAGAIWTNVLPKQLHKRISDASIANIAY 506

Query: 531 SAPFTFITTYTWGTPERIALVMSYRYVQKILCIIGLVFCFPLLGCAFMLRNHELTDSIAL 590
           S+PF FI  Y WG+PERIA++ +Y+ VQKILC +GL FC  LL  A  LR+ +L   +AL
Sbjct: 507 SSPFKFIKKYKWGSPERIAVMQAYQVVQKILCTVGLCFCVTLLVAALFLRDKKLESVVAL 566

Query: 591 EGNDHLKSKDSFETEEKQES 610
           E           + EEK+ S
Sbjct: 567 E-----------DAEEKEPS 575

>KLTH0G09504g Chr7 complement(792202..794076) [1875 bp, 624 aa] {ON}
           similar to uniprot|P39980 Saccharomyces cerevisiae
           YEL065W SIT1 Ferrioxamine B transporter member of the
           ARN family of transporters that specifically recognize
           siderophore-iron chelates transcription is induced
           during iron deprivation and diauxic shift potentially
           phosphorylated by Cdc28p
          Length = 624

 Score =  683 bits (1762), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 321/579 (55%), Positives = 419/579 (72%), Gaps = 1/579 (0%)

Query: 51  DPGVYNIEIYAEMYSRPLYRVALFFSLFLIAYAYGLDGNIRYTFQAYATSSYSQHSLLST 110
           D GV NIE+YA  Y    YRVALFFSLFLIAYAY LDG +R   +AYAT SY  HSLLST
Sbjct: 36  DVGVKNIEVYAAQYDHVAYRVALFFSLFLIAYAYRLDGLVRSKLEAYATDSYGNHSLLST 95

Query: 111 VNCIKTVIAAVGQIFFARLSDIFGRFSIMIVSVIFYSVGTIIESQAVNITRFAVGGCFYQ 170
           VNCIKTV+AA G + +AR SD+FGR  ++ +S++   VGTI+E Q+  +++FA G C YQ
Sbjct: 96  VNCIKTVMAAGGMVAYARASDMFGRMEMLAISIVLVVVGTIVECQSDTVSKFATGACLYQ 155

Query: 171 LGLTGIILILEVIASDFSNLNWRLLALFIPALPFIINTWISGDVTSAIGTNWKWGIGMWA 230
           LG  G+ LIL+VIA DFSNLNWR++AL++PALP IINTW+SGDV SAIG++W+WGIGMWA
Sbjct: 156 LGKAGLALILQVIAVDFSNLNWRMVALYVPALPTIINTWVSGDVISAIGSDWEWGIGMWA 215

Query: 231 FILPLACIPLGICMLHMRYLARKHAKDRLKPEFEALNKLKWKSFCIDIAFWKLDIIGMLL 290
           FI+PL+CIPL  C++HMRYLA KHA ++L  + +  +   W  + I++ FW+LD +G++L
Sbjct: 216 FIIPLSCIPLFCCLVHMRYLAHKHAPEQLGKQRQLYSMASWSEYLIEVFFWRLDSVGLIL 275

Query: 291 ITVFFGCVLVPFTLAGGLKEEWKSAHIIVPEVIGWVVVLPLYMLWEMKYSRHPLTPWDLI 350
           +    GCVLVPFTLAGGL ++W++A IIVPEVIGW V LPL++LWE K++R PLTP  ++
Sbjct: 276 VVGALGCVLVPFTLAGGLSDKWRTAQIIVPEVIGWCVALPLFVLWEAKFARFPLTPRSVL 335

Query: 351 KDRGXXXXXXXXXXXXXXWYMQGDYMYTVLVVAVHESIKSATRITSLYSFVSVIVGTILG 410
           KDRG               YMQ DYMYTVLV+AVHES+K+A RIT+L++FVS+I GT+LG
Sbjct: 336 KDRGVIAALVIAFHIHFCVYMQADYMYTVLVIAVHESVKAAQRITTLFNFVSIITGTLLG 395

Query: 411 FILIKVRRTKPFIIFGISCWIVSFGLLVHYRGDSGAHSGIIGSLCLLGFGAGSFTYVTQA 470
           F+++ V+RTK FI+FG+  W V+FGLLVH+RGD  +HSGIIG+LCLLGFG G F Y  Q 
Sbjct: 396 FVIVYVKRTKKFILFGVCVWFVAFGLLVHFRGDESSHSGIIGALCLLGFGGGFFNYSAQV 455

Query: 471 SIQASAKTHARMAVVTSLYLATYNIXXXXXXXXXXXXWTNILPKEISKRISDPTLAAQAY 530
           S+QAS   H  +AVVTSLYLA YNI            WTN+LPKE++KRI++  +A  AY
Sbjct: 456 SMQASTAAHQDLAVVTSLYLACYNIGSAFASAISGAIWTNVLPKELNKRITEKQVATLAY 515

Query: 531 SAPFTFITTYTWGTPERIALVMSYRYVQKILCIIGLVFCFPLLGCAFMLRNHELTDSIAL 590
           S+PF FI  Y WGTP+R+A+V +Y+ VQ+ILCI+ L FC  LL  AF+LR+ +L++ +AL
Sbjct: 516 SSPFKFIIKYKWGTPQRVAVVHAYQKVQRILCIVPLCFCVTLLIAAFLLRDKKLSEVVAL 575

Query: 591 EGNDHLKSKDSFETEEKQESF-LKSMIFTRFTRSEDKRN 628
              +H  S+ +  T +   S  L S        SE   N
Sbjct: 576 GELEHGHSESASSTGDAGASHELSSTENELHNESEKSSN 614

>Kpol_416.6 s416 (26742..28535) [1794 bp, 597 aa] {ON}
           (26742..28535) [1794 nt, 598 aa]
          Length = 597

 Score =  641 bits (1653), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 298/551 (54%), Positives = 397/551 (72%), Gaps = 1/551 (0%)

Query: 53  GVYNIEIYAEMYSRPLYRVALFFSLFLIAYAYGLDGNIRYTFQAYATSSYSQHSLLSTVN 112
           GVYN E+YA+ YS P  R  +F  LF I YAYGLD  +R  +Q  ATSSY QHSLLSTVN
Sbjct: 47  GVYNSEVYAKYYSSPTRRSIVFLCLFFICYAYGLDNKLRSPYQTLATSSYKQHSLLSTVN 106

Query: 113 CIKTVIAAVGQIFFARLSDIFGRFSIMIVSVIFYSVGTIIESQAVNITRFAVGGCFYQLG 172
            IK+VI+A GQI+FAR SD+FGR +I+IV+V+FY VGTI+ESQAV++++FA G C +QLG
Sbjct: 107 AIKSVISAAGQIWFARASDLFGRGTILIVAVMFYVVGTIVESQAVDVSKFAAGACLFQLG 166

Query: 173 LTGIILILEVIASDFSNLNWRLLALFIPALPFIINTWISGDVTSAIGTNWKWGIGMWAFI 232
             G++++++++ SDFSNLNWR+ A+  P LP +INTW+SGD+ SA+  NWKWGIGMWAFI
Sbjct: 167 YDGVVMMVQILVSDFSNLNWRVTAVAFPVLPNVINTWVSGDIASAVDENWKWGIGMWAFI 226

Query: 233 LPLACIPLGICMLHMRYLARKHAKDRLKPEFEALNKLKWKSFCIDIAFWKLDIIGMLLIT 292
            PL+CIP GI +LHM+YLARK+  D LK  F+    + WK +  +I  WKLD IG+LL  
Sbjct: 227 FPLSCIPFGILLLHMKYLARKN-NDTLKSSFDKPEDITWKQYLTEIFLWKLDFIGLLLAV 285

Query: 293 VFFGCVLVPFTLAGGLKEEWKSAHIIVPEVIGWVVVLPLYMLWEMKYSRHPLTPWDLIKD 352
            FFG VLVPFTLAGGL ++WK+A IIVPEV+GWVV  P ++ WE+K++++PLTPW  +KD
Sbjct: 286 AFFGLVLVPFTLAGGLNKKWKTARIIVPEVLGWVVAFPAFLTWEIKFAKYPLTPWKTVKD 345

Query: 353 RGXXXXXXXXXXXXXXWYMQGDYMYTVLVVAVHESIKSATRITSLYSFVSVIVGTILGFI 412
           RG              +YMQ  YMYT+L+VAV+++ KSATRI SL++FV+ + GT+LG +
Sbjct: 346 RGVFSALIIAIFLQTAFYMQKTYMYTILLVAVNQTKKSATRINSLFTFVTALSGTLLGLV 405

Query: 413 LIKVRRTKPFIIFGISCWIVSFGLLVHYRGDSGAHSGIIGSLCLLGFGAGSFTYVTQASI 472
           ++KVRRTK FI FGI+ W +SFGLL  Y G + A++GII +LCLLGFG G   Y T+AS+
Sbjct: 406 IVKVRRTKEFIFFGIAVWFLSFGLLERYTGGTNAYAGIIAALCLLGFGNGFIKYPTKASM 465

Query: 473 QASAKTHARMAVVTSLYLATYNIXXXXXXXXXXXXWTNILPKEISKRISDPTLAAQAYSA 532
           QASA TH  MA++TSL++A   I            WTN+LP +I K +++ TLA  AY++
Sbjct: 466 QASALTHEMMAIITSLFMAISTIGTSVGSSVAGAIWTNVLPDKIEKGLNNSTLANFAYNS 525

Query: 533 PFTFITTYTWGTPERIALVMSYRYVQKILCIIGLVFCFPLLGCAFMLRNHELTDSIALEG 592
           P  FI  Y W +PER  +V +Y++V+KIL I+GL F  PLLG AF+LRN  L D++AL+ 
Sbjct: 526 PTKFILQYNWESPERQIVVNAYKHVEKILIIVGLCFLVPLLGGAFLLRNQRLEDAVALDK 585

Query: 593 NDHLKSKDSFE 603
            +    K   E
Sbjct: 586 VEPKNEKKEME 596

>NCAS0A11500 Chr1 complement(2274436..2276280) [1845 bp, 614 aa]
           {ON} 
          Length = 614

 Score =  602 bits (1553), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 295/578 (51%), Positives = 397/578 (68%), Gaps = 6/578 (1%)

Query: 30  IVDVNPTLTTSSPAPSYIELIDPGVYNIEIYAEMYSRPLYRVALFFSLFLIAYAYGLDGN 89
           I +++ +  +S+    YIE  + GV+N EIY + YS P+ R+ +F SLFLIA+AYGLD +
Sbjct: 36  INELSSSAASSTIGSEYIE--NSGVHNAEIYCKYYSHPIKRIMVFSSLFLIAFAYGLDNS 93

Query: 90  IRYTFQAYATSSYSQHSLLSTVNCIKTVIAAVGQIFFARLSDIFGRFSIMIVSVIFYSVG 149
           +R T+Q  ATSSYSQHSLLSTV CIK VI+A  Q++FAR +D+FGR +I+ +S+IFY +G
Sbjct: 94  VRTTYQTMATSSYSQHSLLSTVTCIKKVISAAAQLWFARSADMFGRPTILTISIIFYVIG 153

Query: 150 TIIESQAVNITRFAVGGCFYQLGLTGIILILEVIASDFSNLNWRLLALFIPALPFIINTW 209
           TIIE +A +++R+A G C + LG  GI+L+ E+  +DFSNLNWR+ A     LP +I TW
Sbjct: 154 TIIECRAFDVSRYAAGACIFSLGHAGIVLVSELYVADFSNLNWRVTAAAAQVLPNVITTW 213

Query: 210 ISGDVTSAIGTNWKWGIGMWAFILPLACIPLGICMLHMRYLARKHAKDRLKPEFEALNKL 269
           ISG++T AI  NW+WGIGMWAFI PL+C+PL IC++HMRYLARK+  + LK  F+  N +
Sbjct: 214 ISGNITGAIDKNWEWGIGMWAFIFPLSCVPLIICIIHMRYLARKN-NENLKVVFQKPNYM 272

Query: 270 KWKSFCIDIAFWKLDIIGMLLITVFFGCVLVPFTLAGGLKEEWKSAHIIVPEVIGWVVVL 329
            WK +CIDI FWKLDIIG++L+  FF  +LVPFTLAG L   WKS  IIVPEV+GWV+ +
Sbjct: 273 TWKEYCIDIFFWKLDIIGLILLVAFFSLILVPFTLAGSLT--WKSPKIIVPEVLGWVLAI 330

Query: 330 PLYMLWEMKYSRHPLTPWDLIKDRGXXXXXXXXXXXXXXWYMQGDYMYTVLVVAVHESIK 389
           PLY++WE+KY+R+PLTPW+ IKDRG              +YMQ  YM TVL+VAV +S K
Sbjct: 331 PLYLIWELKYARYPLTPWNSIKDRGIWAPLIINLFQEFAYYMQNTYMLTVLLVAVGQSKK 390

Query: 390 SATRITSLYSFVSVIVGTILGFILIKVRRTKPFIIFGISCWIVSFGLLVHYRGDSGAHSG 449
           SATRI   YSFV V+    LGF++ KVRRTK FI  GI  W V+FGLL HY G  GA +G
Sbjct: 391 SATRIIKFYSFVGVLTAFFLGFVVAKVRRTKEFIALGIGIWFVAFGLLEHYEGGLGARAG 450

Query: 450 IIGSLCLLGFGAGSFTYVTQASIQASAKTHARMAVVTSLYLATYNIXXXXXXXXXXXXWT 509
           II ++C+LGFG G   +  +ASIQA+A +HA M + TSL+ A  +I            W+
Sbjct: 451 IIAAICILGFGNGFLKFPCRASIQAAANSHAMMGIATSLFQAVGSIGTAFGSAVAGGIWS 510

Query: 510 NILPKEISKRIS-DPTLAAQAYSAPFTFITTYTWGTPERIALVMSYRYVQKILCIIGLVF 568
           N+LP EI+KRI+ + TLA  AY +P  FI  Y W T ER A+V +Y+ V++++ I+GL  
Sbjct: 511 NVLPGEINKRITNNSTLATYAYGSPTKFIKQYGWETTERQAVVSAYKVVERLMAIVGLCL 570

Query: 569 CFPLLGCAFMLRNHELTDSIALEGNDHLKSKDSFETEE 606
             P+L  +  LRN  L D ++ +  D    + S + EE
Sbjct: 571 LVPMLVASIFLRNRRLEDVVSFDKLDETFDEKSTDDEE 608

>Kpol_416.5 s416 (23208..25031) [1824 bp, 607 aa] {ON}
           (23208..25031) [1824 nt, 608 aa]
          Length = 607

 Score =  595 bits (1535), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 288/552 (52%), Positives = 394/552 (71%), Gaps = 1/552 (0%)

Query: 53  GVYNIEIYAEMYSRPLYRVALFFSLFLIAYAYGLDGNIRYTFQAYATSSYSQHSLLSTVN 112
           GV+N+EIYA+ YS P+ R  +FFSLF IAYAYGLD ++R T+Q  ATSSY+QHSLLSTV+
Sbjct: 43  GVHNVEIYAKYYSTPVKRFLIFFSLFTIAYAYGLDNSVRGTYQTLATSSYNQHSLLSTVS 102

Query: 113 CIKTVIAAVGQIFFARLSDIFGRFSIMIVSVIFYSVGTIIESQAVNITRFAVGGCFYQLG 172
           CIK VI+A  QI+FAR +D+FGR +I+++S++FY VGT++ESQAV++++FA G C Y +G
Sbjct: 103 CIKAVISAAAQIWFARSADMFGRTTILMISIVFYVVGTVVESQAVDVSKFAAGACLYAVG 162

Query: 173 LTGIILILEVIASDFSNLNWRLLALFIPALPFIINTWISGDVTSAIGTNWKWGIGMWAFI 232
            + I+L  EV  +DFSNLNWR+ A   P LP +INTWISGD+T+AI  NWKWGIGMWAFI
Sbjct: 163 HSAIVLFSEVYVADFSNLNWRVTAAAAPLLPNVINTWISGDITAAIDENWKWGIGMWAFI 222

Query: 233 LPLACIPLGICMLHMRYLARKHAKDRLKPEFEALNKLKWKSFCIDIAFWKLDIIGMLLIT 292
            PL+CIP+G C+LHM+YLA+K+ KD LK  F+      W  + +D+ FWKLD++G+LL+ 
Sbjct: 223 FPLSCIPMGACILHMKYLAKKN-KDDLKVAFKKPEHYTWSQYLVDVFFWKLDLVGLLLLV 281

Query: 293 VFFGCVLVPFTLAGGLKEEWKSAHIIVPEVIGWVVVLPLYMLWEMKYSRHPLTPWDLIKD 352
             FG +L+PFTLAGG ++ W +A IIVPEV+GW   LPL+++WE+K++R+PLTP D +K+
Sbjct: 282 AIFGMILIPFTLAGGEEKVWSTARIIVPEVLGWAFALPLFLVWEIKFARYPLTPKDALKN 341

Query: 353 RGXXXXXXXXXXXXXXWYMQGDYMYTVLVVAVHESIKSATRITSLYSFVSVIVGTILGFI 412
           RG              + MQ  Y+YTVL+VAV ES KSATRI  L+SFVSVI G + GF+
Sbjct: 342 RGIVSALVLVLFLQFAYQMQSTYLYTVLLVAVDESKKSATRINKLFSFVSVITGFLSGFV 401

Query: 413 LIKVRRTKPFIIFGISCWIVSFGLLVHYRGDSGAHSGIIGSLCLLGFGAGSFTYVTQASI 472
           + KVRRTK FI FGI  W +SFGL++ Y G   +H GII + C+LGFG G   +  +ASI
Sbjct: 402 VAKVRRTKEFIFFGIGVWFISFGLMIRYTGGLDSHVGIIVARCILGFGNGFLKFPARASI 461

Query: 473 QASAKTHARMAVVTSLYLATYNIXXXXXXXXXXXXWTNILPKEISKRISDPTLAAQAYSA 532
           QASA +H  MAV+TSL+LA  +I            WTN+LP +IS+ I++ TLA  AY +
Sbjct: 462 QASAYSHEMMAVMTSLFLAVSSIGSAFGDAVAGSIWTNVLPGKISEGITNETLADYAYGS 521

Query: 533 PFTFITTYTWGTPERIALVMSYRYVQKILCIIGLVFCFPLLGCAFMLRNHELTDSIALEG 592
           P  FI  Y W TPER A+V +Y+ + ++L I+G+    PLL  AF L+N  L D ++ + 
Sbjct: 522 PTKFILKYKWDTPERQAVVEAYKVIGRLLNIVGICLLVPLLISAFFLKNRRLEDVVSFDK 581

Query: 593 NDHLKSKDSFET 604
            D + S+++ ++
Sbjct: 582 FDKMNSENAEDS 593

>Kpol_513.33 s513 complement(95274..97154) [1881 bp, 626 aa] {ON}
           complement(95274..97154) [1881 nt, 627 aa]
          Length = 626

 Score =  578 bits (1489), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 279/556 (50%), Positives = 376/556 (67%), Gaps = 1/556 (0%)

Query: 53  GVYNIEIYAEMYSRPLYRVALFFSLFLIAYAYGLDGNIRYTFQAYATSSYSQHSLLSTVN 112
             +N  IY + YS PL    L+FSLFL+AYAY L  ++R T+Q  ATSSYS+HSLL+TV 
Sbjct: 38  AAHNARIYVKYYSTPLRVTILYFSLFLLAYAYNLHKDVRGTYQTLATSSYSKHSLLATVQ 97

Query: 113 CIKTVIAAVGQIFFARLSDIFGRFSIMIVSVIFYSVGTIIESQAVNITRFAVGGCFYQLG 172
           CI  VI+A GQI++AR SDIFGR  I+I+S++FY +GT+IESQA +I+++A G C Y LG
Sbjct: 98  CINQVISAAGQIWYARASDIFGRTPILILSILFYFIGTLIESQATDISKYAAGSCIYALG 157

Query: 173 LTGIILILEVIASDFSNLNWRLLALFIPALPFIINTWISGDVTSAIGTNWKWGIGMWAFI 232
             G +L+ +V+ SD+S L WRL++  +  LP IINTW+ G++T  +G  W+WG GMWAFI
Sbjct: 158 YAGSVLVTQVLVSDYSTLKWRLVSSTVLFLPNIINTWVGGNITEDVGNRWQWGFGMWAFI 217

Query: 233 LPLACIPLGICMLHMRYLARKHAKDRLKPEFEALNKLKWKSFCIDIAFWKLDIIGMLLIT 292
            PLA IPL  C+ HM+YLA K+ +D +K        + W     DI FWKLD++G++L+ 
Sbjct: 218 FPLASIPLLCCLAHMKYLAIKNKED-VKLTISKPRSISWARHLYDIFFWKLDMLGLILLV 276

Query: 293 VFFGCVLVPFTLAGGLKEEWKSAHIIVPEVIGWVVVLPLYMLWEMKYSRHPLTPWDLIKD 352
            FF  +LVP TLA GL E W SA  IVPEV+GW + LPL++ WE+K++ +P+TP DLIKD
Sbjct: 277 AFFALILVPLTLAKGLHEGWGSAKFIVPEVLGWALALPLFLTWELKFASNPITPLDLIKD 336

Query: 353 RGXXXXXXXXXXXXXXWYMQGDYMYTVLVVAVHESIKSATRITSLYSFVSVIVGTILGFI 412
           RG              + +   Y+YTVLVVAV+ES KSATRITSL++FVSV+    LGF+
Sbjct: 337 RGIYGGIGVSLFLEFVYDIGSTYLYTVLVVAVNESTKSATRITSLFTFVSVLTAFFLGFV 396

Query: 413 LIKVRRTKPFIIFGISCWIVSFGLLVHYRGDSGAHSGIIGSLCLLGFGAGSFTYVTQASI 472
           ++KVRRTK FIIFGI+ W +++GL  HYRG + +H+GII ++C+ GFG G   +  + S 
Sbjct: 397 VVKVRRTKEFIIFGIAMWYIAYGLFEHYRGGAESHAGIIAAVCVHGFGNGFIKFPVRVST 456

Query: 473 QASAKTHARMAVVTSLYLATYNIXXXXXXXXXXXXWTNILPKEISKRISDPTLAAQAYSA 532
           QASAKTH R+A+ TSLYLA  +I            WTNILP +I   I + TLA  AY +
Sbjct: 457 QASAKTHDRLAIATSLYLAAGDIGMAFGSATAGAMWTNILPAQIDMVIQNSTLAKIAYES 516

Query: 533 PFTFITTYTWGTPERIALVMSYRYVQKILCIIGLVFCFPLLGCAFMLRNHELTDSIALEG 592
           P  FI T+ W +PER ALV++YRY+Q++L I+ L    PLL  +F LRN  LTD++A E 
Sbjct: 517 PIKFIRTHKWDSPERQALVVAYRYIQRLLMIVALCLIIPLLLSSFFLRNRALTDTVAFEQ 576

Query: 593 NDHLKSKDSFETEEKQ 608
            D  K  DS + E  +
Sbjct: 577 TDIPKESDSSDLENSK 592

>TPHA0G03780 Chr7 complement(800134..801972) [1839 bp, 612 aa] {ON} 
          Length = 612

 Score =  571 bits (1472), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 289/599 (48%), Positives = 391/599 (65%), Gaps = 10/599 (1%)

Query: 24  EKEVGAIVDVNPTLTTSSP-----APSYIELIDPGVYNIEIYAEMYSRPLYRVALFFSLF 78
           E ++  I DV     T+       + S  E++ PGV+N +IY + Y+ P  R+ +FFSLF
Sbjct: 14  EDKISVISDVRSLKNTNDSEYTFTSDSENEVLSPGVHNAKIYGKYYTEPYQRIMIFFSLF 73

Query: 79  LIAYAYGLDGNIRYTFQAYATSSYSQHSLLSTVNCIKTVIAAVGQIFFARLSDIFGRFSI 138
           LI YAYGLD   R T+   ATSSY +HSL+STV CI  VI+A GQI+FAR SDIFGR  I
Sbjct: 74  LICYAYGLDKKTRTTYVTLATSSYKEHSLMSTVTCITKVISAAGQIWFARASDIFGRKLI 133

Query: 139 MIVSVIFYSVGTIIESQAVNITRFAVGGCFYQLGLTGIILILEVIASDFSNLNWRLLALF 198
             +SVIFY +GT+IESQA  I+R+A G C Y LG  GI+L  E+ A+DFSNLNWR++A  
Sbjct: 134 FGLSVIFYVIGTVIESQATEISRYAGGECLYGLGHAGIVLTTELYAADFSNLNWRVVAAA 193

Query: 199 IPALPFIINTWISGDVTSAIGTNWKWGIGMWAFILPLACIPLGICMLHMRYLARKHAKDR 258
            P LP IINTW+SG++T+ +  NWKWGIGMWAFI P++C+PL  C+LHMRY A+K+  + 
Sbjct: 194 APMLPNIINTWVSGNITADVDENWKWGIGMWAFIFPISCLPLIGCLLHMRYKAQKN-NEE 252

Query: 259 LKPEFEALNKLKWKSFCIDIAFWKLDIIGMLLITVFFGCVLVPFTLAGGLKEEWKSAHII 318
           LKP F   + + +K + +D+ FWK DIIG++L+   FG VLVP TLAGGL ++W  A II
Sbjct: 253 LKPVFVKPSNMSYKEYLVDVFFWKSDIIGLILLVGVFGLVLVPITLAGGLNKKWNEAQII 312

Query: 319 VPEVIGWVVVLPLYMLWEMKYSRHPLTPWDLIKDRGXXXXXXXXXXXXXXWYMQGDYMYT 378
           VPEV+GW + LPLY+ WE K++++P+   + ++D G              +YM   Y+ T
Sbjct: 313 VPEVLGWTLALPLYVFWENKFAKYPIIKLETVRDSGIWSALSISLFIDFCFYMHETYLVT 372

Query: 379 VLVVAVHESIKSATRITSLYSFVSVIVGTILGFILIKVRRTKPFIIFGISCWIVSFGLLV 438
            L+VAV+ES KSATRI SL +FV+VI G  LG  ++++RRTK  I+FG   W V+ GL +
Sbjct: 373 FLLVAVNESKKSATRINSLSTFVTVITGFFLGLAIVRIRRTKISIVFGTLVWFVAHGLFI 432

Query: 439 HYRGDSGAHSGIIGSLCLLGFGAGSFTYVTQASIQASAKTHARMAVVTSLYLATYNIXXX 498
            Y G   +HSG+IG++CLLGFG G   +  +ASIQ S  TH ++A+VTSL+LA  +I   
Sbjct: 433 EYNGGLRSHSGLIGAICLLGFGNGFIRFPVRASIQVSVGTHEKLAIVTSLFLAVGSIGTA 492

Query: 499 XXXXXXXXXWTNILPKEISKRISDPTLAAQAYSAPFTFITTYTWGTPERIALVMSYRYVQ 558
                    W+N+LP +I  RIS+ T+AA AYS+P TFI  Y WGT  R A+V +Y YV 
Sbjct: 493 IGSAVAGAIWSNVLPGQIESRISNATIAASAYSSPTTFIKKYKWGTEYRTAVVSAYGYVW 552

Query: 559 KILCIIGLVFCFPLLGCAFMLRNHELTDSIALEGNDHLKSKDSF-ETEEKQESFLKSMI 616
           KIL I GLV   PLL  A  LR+ +L   +A    D +   + + E E+ Q+   KS +
Sbjct: 553 KILNITGLVLVLPLLISALFLRDRKLESVLAF---DEVTDTEGYSENEKVQQKKHKSFM 608

>TDEL0B00140 Chr2 (25633..27531) [1899 bp, 632 aa] {ON} 
          Length = 632

 Score =  564 bits (1454), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 289/610 (47%), Positives = 401/610 (65%), Gaps = 18/610 (2%)

Query: 19  VPDILEKEVGAIVDVNPTLTTSSPAPSYIELIDPGVYNIEIYAEMYSRPLYRVALFFSLF 78
           VPD  E E   + D             YI+    GV NIE+Y + Y +P+Y+V L+FS+F
Sbjct: 40  VPDAYEHESDCVGD-----------KKYIK--GSGVINIELYKQQYHKPIYKVMLYFSIF 86

Query: 79  LIAYAYGLDGNIRYTFQAYATSSYSQHSLLSTVNCIKTVIAAVGQIFFARLSDIFGRFSI 138
           L+AY Y LD  +R+T+Q   TS +   + L TVNCIKTV+   GQ  FAR SDIFGR ++
Sbjct: 87  LVAYVYSLDSLVRFTYQYQTTSKFRDKNQLRTVNCIKTVMGTAGQFGFARCSDIFGRTTV 146

Query: 139 MIVSVIFYSVGTIIESQAVNITRFAVGGCFYQLGLTGIILILEVIASDFSNLNWRLLALF 198
           +  S+I Y +GTII+ +A +I++F+ G   YQLGL GI ++L VIASDFS+LNWRL A F
Sbjct: 147 LNFSIILYIIGTIIQCKATDISKFSAGTILYQLGLIGIQIMLGVIASDFSDLNWRLFASF 206

Query: 199 IPALPFIINTWISGDVTSAIGTNWKWGIGMWAFILPLACIPLGICMLHMRYLARKHAKDR 258
           +PALPF+IN WI G +T  IG  W+WGIGM+AFI+P ACIPL  C+LHMRYLA K+ + +
Sbjct: 207 VPALPFVINIWICGFITQLIGDRWQWGIGMFAFIMPCACIPLAFCLLHMRYLAYKNCRGK 266

Query: 259 LKPEFEALNKLKWKSFCIDIAFWKLDIIGMLLITVFFGCVLVPFTLAGGLKEEWKSAHII 318
           ++ EF     L ++ + +DI FW+LD++G  L+   FGC+L+P  LAGG    W++  II
Sbjct: 267 VQNEFRMYRVLTFRDYIVDIFFWRLDLVGFGLLCALFGCILIPLVLAGGSSNHWRNFRII 326

Query: 319 VPEVIGWVVVLPLYMLWEMKYSRHPLTPWDLIKDRGXXXXXXXXXXXXXXWYMQGDYMYT 378
           VPEV+GWVVVLP+++ WE K ++HPL  WD I+DRG              +++ GDY++T
Sbjct: 327 VPEVVGWVVVLPIFLTWEAKGAKHPLLTWDFIEDRGILAALIIAFYINFVYHLLGDYLFT 386

Query: 379 VLVVAVHESIKSATRITSLYSFVSVIVGTILGFILIKVRRTKPFIIFGISCWIVSFGLLV 438
           VL++ + +S+ ++TRITS YSFV +I GT++G ++I+ RRTKPFIIFGI CW ++ GLLV
Sbjct: 387 VLMITLDQSVLASTRITSSYSFVCIICGTLIGLVIIRARRTKPFIIFGIGCWFLALGLLV 446

Query: 439 HYRGDSGAHSGIIGSLCLLGFGAGSFTYVTQASIQASAKTHARMAVVTSLYLATYNIXXX 498
           H+ G+     G+ GSLCLLG GAG FTY TQASIQA+ KTHA+MAVVT+LYL+ Y+I   
Sbjct: 447 HFFGNRPFMPGVTGSLCLLGLGAGFFTYTTQASIQAAIKTHAKMAVVTALYLSIYSIGSA 506

Query: 499 XXXXXXXXXWTNILPKEISKRISDPTLAAQAYSAPFTFITTYTWGTPERIALVMSYRYVQ 558
                    WTN+LP++I  R  + + A  AY +P  FI    WG+P R  L  +Y YVQ
Sbjct: 507 VGSAISGAIWTNLLPRKIF-RTMNHSDATAAYDSPQLFILNNPWGSPARNGLNEAYSYVQ 565

Query: 559 KILCIIGLVFCFPLLGCAFMLRNHELTDSIALEGNDHLKSKDSFETEEKQESFLKSMIFT 618
           K+LC++ L FC PLL  A  LRNH+L  ++ALE  D  + K+    +E++   +  +   
Sbjct: 566 KMLCVVALCFCVPLLAAALFLRNHKLQSTVALENVDEKQVKE----DERRHDLICKIQDR 621

Query: 619 RFTRSEDKRN 628
           R  + E   +
Sbjct: 622 RRAKKEGNDD 631

>NDAI0A02050 Chr1 complement(456678..458531) [1854 bp, 617 aa] {ON} 
          Length = 617

 Score =  561 bits (1445), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 287/592 (48%), Positives = 383/592 (64%), Gaps = 15/592 (2%)

Query: 21  DILEKEVGAIVDVNPTLTTSSPAPSYIELIDPGVYNIEIYAEMYSRPLYRVALFFSLFLI 80
           +I E+E+ ++         SS   S I   D GV NIE+Y+E YS    R+  FFS+FL 
Sbjct: 19  EIHEQEIDSV---------SSTEESQINY-DTGVINIEVYSEYYSTTQRRLLFFFSIFLT 68

Query: 81  AYAYGLDGNIRYTFQAYATSSYSQHSLLSTVNCIKTVIAAVGQIFFARLSDIFGRFSIMI 140
            Y Y LD  +R TFQ  ATSSY  HSL+STV CI TVI+A GQI +AR +DIFGR S++ 
Sbjct: 69  TYCYTLDKRVRSTFQTEATSSYKNHSLMSTVTCITTVISAAGQIAYARAADIFGRTSLVF 128

Query: 141 VSVIFYSVGTIIESQAVNITRFAVGGCFYQLGLTGIILILEVIASDFSNLNWRLLALFIP 200
            ++ FY +GT++ESQA NITR+AVG CFY LG   I+L LEV+A+DFSNLN+R+LA   P
Sbjct: 129 TAIFFYVIGTVVESQATNITRYAVGACFYSLGHAAIVLALEVLAADFSNLNYRILASAAP 188

Query: 201 ALPFIINTWISGDVTSAIGTNWKWGIGMWAFILPLACIPLGICMLHMRYLAR-KHAKDRL 259
            LP +INTWISG++TS IG +W+WGIGMWA I P+ CIPL  C+ HMRYLA+ KH +  L
Sbjct: 189 MLPNVINTWISGNITSDIGDHWQWGIGMWAIIFPVCCIPLLFCLFHMRYLAQYKHNRREL 248

Query: 260 KPEFEALNKLKWKSFCIDIAFWKLDIIGMLLITVFFGCVLVPFTLAGGLKEEWKSAHIIV 319
           +        +    + ID+ FW+LDI+G+LL  +FF CVL+PFTLA    ++WKSA IIV
Sbjct: 249 RSFSTIPPNMTRMEYFIDVFFWRLDILGLLLGVIFFACVLIPFTLAAKATDKWKSASIIV 308

Query: 320 PEVIGWVVVLPLYMLWEMKYSRHPLTPWDLIKDRGXXXXXXXXXXXXXXWYMQGDYMYTV 379
           PEVIGW+V LPLY+ WE K+++ PLTPW+L+KDRG              +Y+Q  Y YTV
Sbjct: 309 PEVIGWLVALPLYIFWEWKFAKFPLTPWNLVKDRGVYGGLLIALFLDFAYYVQSTYKYTV 368

Query: 380 LVVAVHESIKSATRITSLYSFVSVIVGTILG-FILIKVRRTKPFIIFGISCWIVSFGLLV 438
           L+V+   ++ +ATR  ++++FV VI   +LG F+  K+RRTK FI FGIS +IVS GLL 
Sbjct: 369 LLVSFDTTVLAATRTNNMFTFVGVITANLLGIFVAKKLRRTKGFIFFGISMYIVSTGLLY 428

Query: 439 HYRGDSGAHSGIIGSLCLLGFGAGSFTYVTQASIQASAKTHARMAVVTSLYLATYNIXXX 498
            YR  + A  G I + CLLGFG G   +  +ASIQA+A TH  +A++TSL+LA  +I   
Sbjct: 429 RYRIGAHAKVGTIVACCLLGFGNGFLKFPARASIQAAAYTHKNLAIITSLFLALGSIGEG 488

Query: 499 XXXXXXXXXWTNILPKEISKRISDPTLAAQAYSAPFTFITTYTWGTPERIALVMSYRYVQ 558
                    W+N +  E+SK IS+ T  + AY +P  FI +Y W +PERI LV +Y +V 
Sbjct: 489 FGSSVAGAIWSNRMEVELSKYISNQTAVSLAYESPTKFIKSYKWESPERIGLVQAYSHVT 548

Query: 559 KILCIIGLVFCFPLLGCAFMLRNHELTDSIALEGNDHLKSKDSFETEEKQES 610
            IL I+ +  C PL   A +LR+ EL D +A E    L  +D    E+K E 
Sbjct: 549 NILYIVTICLCIPLYVFALLLRDRELADVVAFE---QLDGQDEIIQEKKTEE 597

>TPHA0B00180 Chr2 complement(29722..31623) [1902 bp, 633 aa] {ON} 
          Length = 633

 Score =  548 bits (1412), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 275/611 (45%), Positives = 391/611 (63%), Gaps = 9/611 (1%)

Query: 12  EDFTEDVVPDILEKEVGAIVDVNPTLTTSSPAPSYIELIDPGVYNIEIYAEMYSRPLYRV 71
           ED+   +   IL  +     + +  +TT+   P+   +   GVYN+EIYA+ Y+ P  + 
Sbjct: 22  EDY--QIRNKILSDKDATESNASEEITTNKLKPA---VSSTGVYNMEIYAKYYANPFQKF 76

Query: 72  ALFFSLFLIAYAYGLDGNIRYTFQAYATSSYSQHSLLSTVNCIKTVIAAVGQIFFARLSD 131
            ++FSLF+I YAYGLDGN+R T+Q  ATSS+++HSL STV CI  V ++ GQI+FAR SD
Sbjct: 77  LIYFSLFVIYYAYGLDGNVRPTYQTLATSSFNRHSLNSTVTCINRVTSSAGQIWFARASD 136

Query: 132 IFGRFSIMIVSVIFYSVGTIIESQAVNITRFAVGGCFYQLGLTGIILILEVIASDFSNLN 191
           IF R   M++S++FY VGTII SQA ++ ++AVG C Y +G  GI+L+ E+  +DFSNLN
Sbjct: 137 IFSREFSMVISILFYVVGTIISSQATSVAKYAVGACIYGIGHAGIVLLCEIYMADFSNLN 196

Query: 192 WRLLALFIPALPFIINTWISGDVTSAIGTNWKWGIGMWAFILPLACIPLGICMLHMRYLA 251
           WR++A   P LP IINTW+SG++TS +G+ W+WG+GMWA I P +CIPL +C+ HMRY+A
Sbjct: 197 WRVVAENAPMLPAIINTWVSGNITSDLGSKWQWGLGMWAIIFPASCIPLFVCIYHMRYMA 256

Query: 252 RKHAKDRLKPEFEALNKLKWKSFCIDIAFWKLDIIGMLLITVFFGCVLVPFTLAGGLKEE 311
           +K+  ++++  FE  +++ WK + IDI  WKLD IG++L+   F  +LVPFT +GGL  E
Sbjct: 257 KKN-NEKIRKIFEKPSEIAWKKYLIDIFIWKLDFIGLVLLVAVFALILVPFTTSGGLHRE 315

Query: 312 WKSAHIIVPEVIGWVVVLPLYMLWEMKYSRHPLTPWDLIKDRGXXXXXXXXXXXXXXWYM 371
           W SA+ IVPEV+GWVV LP++ +WE K+SR+P+   DLI DRG               Y+
Sbjct: 316 WNSANFIVPEVVGWVVALPIFSVWEWKFSRYPILRLDLISDRGIYSALSISFFIQFCLYV 375

Query: 372 QGDYMYTVLVVAVHESIKSATRITSLYSFVSVIVGTILGFILIKVRRTKPFIIFGISCWI 431
              Y+YT L+VAV ++ KS TRI SL SFV+VI    LG  ++K+RRT+ FI+ G   W 
Sbjct: 376 NDTYLYTFLLVAVDQTTKSGTRINSLMSFVNVITACCLGLFIVKIRRTQIFIVIGCVSWF 435

Query: 432 VSFGLLVHYRGDSGAHSGIIGSLCLLGFGAGSFTYVTQASIQASAKTHARMAVVTSLYLA 491
           V +GL VHY G  G+ SGII + CL GFG G      +AS+QAS+ +H  +A+VT+L+LA
Sbjct: 436 VVYGLYVHYNGGLGSRSGIITASCLSGFGYGFIKSPLKASLQASSNSHQNLAIVTALFLA 495

Query: 492 TYNIXXXXXXXXXXXXWTNILPKEISKRISDPTLAAQAYSAPFTFITTYTWGTPERIALV 551
             NI            W+N+LP  + K I + TLA  A+ +P  FI  Y W T  R  LV
Sbjct: 496 IGNIGTAFGAAVAGAIWSNLLPHRLEKSIGNVTLADSAFDSPIKFIKQYKWHTAVRQHLV 555

Query: 552 MSYRYVQKILCIIGLVFCFPLLGCAFMLRNHELTDSIALEGNDHLKSKDSFETEEKQESF 611
            SY  V +IL I+ LV   P+L  +F+LR+ +L++S+A +  D     D  E    Q+  
Sbjct: 556 SSYGSVWRILNIVCLVLVIPMLVSSFLLRDRKLSNSVAYDQRD-FSPTDCEEENIGQDR- 613

Query: 612 LKSMIFTRFTR 622
            +S I  R+ +
Sbjct: 614 -RSYIGDRYAK 623

>SAKL0G06600g Chr7 complement(549492..551381) [1890 bp, 629 aa] {ON}
           similar to uniprot|P39980 Saccharomyces cerevisiae
           YEL065W SIT1 Ferrioxamine B transporter member of the
           ARN family of transporters that specifically recognize
           siderophore-iron chelates transcription is induced
           during iron deprivation and diauxic shift potentially
           phosphorylated by Cdc28p
          Length = 629

 Score =  536 bits (1381), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 258/531 (48%), Positives = 358/531 (67%), Gaps = 4/531 (0%)

Query: 53  GVYNIEIYAEMYSRPLYRVALFFSLFLIAYAYGLDGNIRYTFQAYATSSYSQHSLLSTVN 112
           GV  +EI  + Y+    + A+FFSLFL+ + + LD  +R +  AYAT+SY QHSLLSTVN
Sbjct: 57  GVQKVEILNKQYNHLWGKSAIFFSLFLMGFVFRLDSMVRRSMNAYATNSYKQHSLLSTVN 116

Query: 113 CIKTVIAAVGQIFFARLSDIFGRFSIMIVSVIFYSVGTIIESQAVNITRFAVGGCFYQLG 172
            +++V AA G   ++RLSD+FGR  +++VSV+ Y  GTII +QA ++TR+A G   YQ G
Sbjct: 117 VVRSVAAACGLPLYSRLSDVFGRIELIVVSVLLYVAGTIICTQAYDVTRYAAGMILYQFG 176

Query: 173 LTGIILILEVIASDFSNLNWRLLALFIPALPFIINTWISGDVTSAIGTNWKW-GIGMWAF 231
           L G+ ++ +VIA+DFSNLNWR+    I A PFIINTW+SGD+  AIG NW W GIG+WA 
Sbjct: 177 LCGLAILFKVIAADFSNLNWRVFCTLISAAPFIINTWVSGDIVEAIGDNWSWPGIGVWAI 236

Query: 232 ILPLACIPLGICMLHMRYLARKHAK-DRLKPEFEALNKLKWKSFCIDIAFWKLDIIGMLL 290
            LP+A IPL +C +HM+YLA+K    ++L+       +L +K F +++ FWKLDI G+L 
Sbjct: 237 CLPVATIPLVLCFIHMQYLAKKSGDLNQLRGMQTEYKRLGFKKFVVEVFFWKLDIFGVLS 296

Query: 291 ITVFFGCVLVPFTLAGGLKEEWKSAHIIVPEVIGWVVVLPLYMLWEMKYSRHPLTPWDLI 350
           + +  G +L P TLAGG   EW++A +IVP ++G+  + P++  WE + + HP+ P D+ 
Sbjct: 297 LMIILGLILTPLTLAGGETAEWRTAKVIVPLILGFCWI-PVFAFWENRIATHPIAPTDMF 355

Query: 351 KDRGXXXXXXXXXXXXXXWYMQGDYMYTVLVVAVHESIKSATRITSLYSFVSVIVGTILG 410
           +DRG              WYMQGDY+YT+LVVA+HES+KSATRI SLYSF ++I G  +G
Sbjct: 356 RDRGVYCALGIGILIDFCWYMQGDYLYTILVVAIHESVKSATRINSLYSFSTIITGLCVG 415

Query: 411 FILIKVRRTKPFIIFGISCWIVSFGLLVHYRGDSGAHSGIIGSLCLLGFGAGSFTYVTQA 470
             + KVR+ K FI+FG+  W+V+FG+++ YRG S +H G+I S  LLGFG   FT+  QA
Sbjct: 416 LAISKVRKMKCFIVFGVCMWLVAFGIMIKYRGGSQSHGGMIASQVLLGFGGAFFTHPVQA 475

Query: 471 SIQASAKTHARMAVVTSLYLATYNIXXXXXXXXXXXXWTNILPKEISKRISDPTLAAQAY 530
           S+QA    H RMA +T+LY  +Y I            WT +LP EI KR ++ TLA  AY
Sbjct: 476 SLQAYVN-HERMATITTLYAISYYIGSAVGSSVSGAIWTQVLPNEIGKRFTNKTLARLAY 534

Query: 531 SAPFTFITTYTWGTPERIALVMSYRYVQKILCIIGLVFCFPLLGCAFMLRN 581
           SAP +FI  YTWGTP R+ LV +YR+VQK+L I+G+ FC P+LG A  LR+
Sbjct: 535 SAPLSFIKKYTWGTPLRMELVEAYRHVQKLLIIVGICFCVPILGFALFLRD 585

>CAGL0E04092g Chr5 (394380..396317) [1938 bp, 645 aa] {ON} similar
           to uniprot|P38731 Saccharomyces cerevisiae YHL040c ARN1
           or uniprot|P38724 Saccharomyces cerevisiae YHL047c TAF1
          Length = 645

 Score =  523 bits (1346), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 273/582 (46%), Positives = 372/582 (63%), Gaps = 13/582 (2%)

Query: 53  GVYNI-----EIYAEMYSRPLYRVALFFSLFLIAYAYGLDGNIRYTFQAYATSSYSQHSL 107
           GV NI     EI AE+Y +  Y   L F+ F+  Y YGLDGN RY +  YATSSY+QHSL
Sbjct: 69  GVKNIIIRKTEIMAEVYDKWYYHAILLFTAFVCGYGYGLDGNTRYIYTGYATSSYAQHSL 128

Query: 108 LSTVNCIKTVIAAVGQIFFARLSDIFGRFSIMIVSVIFYSVGTIIESQAVNITRFAVGGC 167
           LST+N I  VI+A  QI +ARLSD++GRF++  VS++ YSVGTII+SQA ++ R+A G  
Sbjct: 129 LSTINVINAVISAASQIVYARLSDVYGRFALFCVSIVLYSVGTIIQSQAYDVQRYAAGSI 188

Query: 168 FYQLGLTGIILILEVIASDFSNLNWRLLALFIPALPFIINTWISGDVTSAIG--TNWKWG 225
           FY  G  G+IL+L +I SDFS+L WRL+  F+P  PFIINTWISG+VTS      NW W 
Sbjct: 189 FYNTGYVGVILVLLLILSDFSSLRWRLVYQFVPTWPFIINTWISGNVTSRANPLKNWSWD 248

Query: 226 IGMWAFILPLACIPLGICMLHMRYLARKHAK-DRLKPEFEALNKLKWKSFCIDIAFWKLD 284
           IGMWAFI PL+C+PL   M+HM +LARK  +   L  E     K   K   +++ FWK+D
Sbjct: 249 IGMWAFIFPLSCVPLLCVMIHMWWLARKTEEWQELSKEKTFYQKHGLKDTIVEL-FWKID 307

Query: 285 IIGMLLITVFFGCVLVPFTLAGGLKEEWKSAHIIVPEVIGWVVVLPLYMLWEMKYSRHPL 344
            +G+ ++T+  GC+LVP TLAGG K +W ++H+I P V+G+V++ P+ +LWE K++R P+
Sbjct: 308 AMGVFIMTISLGCILVPLTLAGGTKSKWNNSHVIGPFVLGFVLI-PILVLWEYKFARDPI 366

Query: 345 TPWDLIKDRGXXXXXXXXXXXXXXWYMQGDYMYTVLVVAVHESIKSATRITSLYSFVSVI 404
            P+ L+KDRG              +YM  DY+YTVL+V V+ES+KSATRI+SL +FVS +
Sbjct: 367 IPYKLVKDRGVWASFAISFLIDFIYYMAADYLYTVLIVGVNESVKSATRISSLSTFVSTV 426

Query: 405 VGTILGFILIKVRRTKPFIIFGISCWIVSFGLLVHYRGDSGAHSGIIGSLCLLGFGAGSF 464
              I   ++ +  R KPFII G   W+++ GLL HYRG + +HSGIIG+LC+ G G   F
Sbjct: 427 GSPIFSLLITRFSRLKPFIICGCGLWMLAMGLLYHYRGGAESHSGIIGALCVWGVGTTLF 486

Query: 465 TYVTQASIQASAKTHARMAVVTSLYLATYNIXXXXXXXXXXXXWTNILPKEISKRISDPT 524
           TY    S+QA A +H  MA VT+L    Y I            WT  L K++ KR+ D  
Sbjct: 487 TYPVNVSVQA-ATSHEHMATVTALNYTFYRIGSAVGAAVSGAIWTQTLYKQLLKRVGDAA 545

Query: 525 LAAQAYSAPFTFITTYTWGTPERIALVMSYRYVQKILCIIGLVFCFPLLGCAFMLRNHEL 584
           LA +AY++P+ FI TYTW TPER A+V +YRYVQ++  I+ LVFC PLL  +  LR+  L
Sbjct: 546 LATEAYASPYKFIVTYTWDTPERQAVVQAYRYVQRLETIVALVFCAPLLIFSLCLRDARL 605

Query: 585 TDSIALEGNDHLKSKDSFETEEKQESFLKSMIFTRFTRSEDK 626
           TD +A +     +  D+ + +   E F  +   TRF R   +
Sbjct: 606 TDKVAHDNIAEGEYVDAKDDDPIYEWFKGAT--TRFRRKSKE 645

>KAFR0D00930 Chr4 complement(195566..197410) [1845 bp, 614 aa] {ON} 
          Length = 614

 Score =  521 bits (1341), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 261/562 (46%), Positives = 367/562 (65%), Gaps = 2/562 (0%)

Query: 51  DPGVYNIEIYAEMYSRPLYRVALFFSLFLIAYAYGLDGNIRYTFQAYATSSYSQHSLLST 110
           D GV NIEIYAE Y+    R   FF LFL+AYAYGLD  +R TF   ATSSY +H+L+ST
Sbjct: 47  DAGVRNIEIYAEYYTSKFSRFMYFFFLFLVAYAYGLDTRVRTTFATDATSSYKKHTLMST 106

Query: 111 VNCIKTVIAAVGQIFFARLSDIFGRFSIMIVSVIFYSVGTIIESQAVNITRFAVGGCFYQ 170
           V CIKT+I+A GQI FAR  DIFGR SI + S+I Y+VGTI+ESQA  I+++A G   Y 
Sbjct: 107 VTCIKTIISAAGQIGFARSCDIFGRTSIFVFSIILYAVGTIVESQATTISKYAGGVVLYS 166

Query: 171 LGLTGIILILEVIASDFSNLNWRLLALFIPALPFIINTWISGDVTSAIGTNWKWGIGMWA 230
           LG +GI+L+ EV+ +DFSNLNWR++A   P LP +INTWISG++ + +G +WKWGIG+WA
Sbjct: 167 LGHSGIVLVSEVLIADFSNLNWRVVAAAAPMLPNVINTWISGNIVADLGDHWKWGIGLWA 226

Query: 231 FILPLACIPLGICMLHMRYLAR-KHAKDRLKPEFEALNKLKWKSFCIDIAFWKLDIIGML 289
            + P+ CIPL   +LHM+YLA+ K  +  LK  +     +    + I+  FW++D++G++
Sbjct: 227 IVFPVCCIPLLFILLHMKYLAQYKDKRPELKRIWTLPKGMTKVQYLIETLFWRVDVVGLI 286

Query: 290 LITVFFGCVLVPFTLAGGLKEEWKSAHIIVPEVIGWVVVLPLYMLWEMKYSRHPLTPWDL 349
           L+   FG +L+PFTLA     +WK A  IVPEV+GW V LPLY +WE  ++R PLTP   
Sbjct: 287 LLAATFGLILIPFTLAEKKNYQWKKASYIVPEVLGWAVSLPLYCIWEKFFARFPLTPLAT 346

Query: 350 IKDRGXXXXXXXXXXXXXXWYMQGDYMYTVLVVAVHESIKSATRITSLYSFVSVIVGTIL 409
           +KDRG              +YMQ  Y+YTVL VA + +  +ATRI +LYSFV VI    L
Sbjct: 347 VKDRGIYGALLVSLFIDFVYYMQHTYLYTVLYVAFNNTTSAATRINNLYSFVGVITSFFL 406

Query: 410 GFILIKVRRTKPFIIFGISCWIVSFGLLVHYRGDSGAHSGIIGSLCLLGFGAGSFTYVTQ 469
           GF+++++++ K FI+FGI+ WI+++GL + YR    ++ G I ++C+LGFG G      +
Sbjct: 407 GFVVVRLKKVKKFILFGIAVWIIAYGLFIRYRTGQASYVGSIAAICVLGFGNGFLKIPAR 466

Query: 470 ASIQASAKTHARMAVVTSLYLATYNIXXXXXXXXXXXXWTNILPKEISKRISDPTLAAQA 529
           ASIQAS  +H +MAV+TSL+LA  +I            W N +  EI KR+S+ T AA A
Sbjct: 467 ASIQASVGSHQKMAVITSLFLALADIGEAFGSAVAGAIWGNRMEAEIYKRVSNTTAAALA 526

Query: 530 YSAPFTFITTYTWGTPERIALVMSYRYVQKILCIIGLVFCFPLLGCAFMLRNHELTDSIA 589
           Y +P  F+  Y WGT  R+ +V +YR V  IL ++G+  C PLL C+F+LR+ +L + I+
Sbjct: 527 YDSPTKFVKKYKWGTATRMEVVAAYREVTLILYVVGICLCVPLLLCSFLLRDRKLEEVIS 586

Query: 590 LE-GNDHLKSKDSFETEEKQES 610
            +    + +SKD    +E + S
Sbjct: 587 YDMMGSNSESKDEIIEKEIELS 608

>Suva_8.12 Chr8 complement(20611..22512) [1902 bp, 633 aa] {ON}
           YHL040C (REAL)
          Length = 633

 Score =  521 bits (1342), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 270/575 (46%), Positives = 373/575 (64%), Gaps = 14/575 (2%)

Query: 58  EIYAEMYSRPLYRVALFFSLFLIAYAYGLDGNIRYTFQAYATSSYSQHSLLSTVNCIKTV 117
           EI  E Y +  ++  L  S F+  Y YGLDGNIRY +  YATSSYS+HSLLST+N I  V
Sbjct: 67  EIIGEAYKKWYFQAILLISAFVCGYGYGLDGNIRYIYTGYATSSYSEHSLLSTINVINAV 126

Query: 118 IAAVGQIFFARLSDIFGRFSIMIVSVIFYSVGTIIESQAVNITRFAVGGCFYQLGLTGII 177
           ++A  QI +ARLSD+FGR  + I +VI Y VGTII+SQA ++ R+A G  FY  G  G+I
Sbjct: 127 VSAASQIIYARLSDVFGRLYLFISAVILYVVGTIIQSQAYDVQRYAAGSIFYNAGYVGVI 186

Query: 178 LILEVIASDFSNLNWRLLALFIPALPFIINTWISGDVTSAIG--TNWKWGIGMWAFILPL 235
           LIL +I SDFS+L WRLL  F P  PFIINTWI+G++TS      NW W IGMWAFI PL
Sbjct: 187 LILLIILSDFSSLKWRLLYQFAPTWPFIINTWIAGNITSKANPVENWSWDIGMWAFIFPL 246

Query: 236 ACIPLGICMLHMRYLARK----HAKDRLKPEFEALNKLKWKSFCIDIAFWKLDIIGMLLI 291
           +CIP+ +CMLHM+++ARK    HA    K  ++    +K     ++  FWKLD+IG+LL+
Sbjct: 247 SCIPIVLCMLHMQWIARKTPEWHALKDEKSYYQEHGFVK----VLEQLFWKLDVIGVLLM 302

Query: 292 TVFFGCVLVPFTLAGGLKEEWKSAHIIVPEVIGWVVVLPLYMLWEMKYSRHPLTPWDLIK 351
               GC+LVP TLAGG+K  W  + +I P V+G+V++ P+  +WE + +R P+ P+ L+K
Sbjct: 303 GCSLGCILVPLTLAGGVKTTWNDSRLIGPFVLGFVLI-PILWVWEYRVARDPIIPYKLVK 361

Query: 352 DRGXXXXXXXXXXXXXXWYMQGDYMYTVLVVAVHESIKSATRITSLYSFVSVIVGTILGF 411
           DRG              +YM  DY+YTV++VAV+ESIKSATRI++L SFVSV+     G 
Sbjct: 362 DRGVWSSMGISFLIDFIYYMAADYLYTVMLVAVNESIKSATRISTLSSFVSVVASPFFGL 421

Query: 412 ILIKVRRTKPFIIFGISCWIVSFGLLVHYRGDSGAHSGIIGSLCLLGFGAGSFTYVTQAS 471
           I+ +  R KPFI+FG   W+++ GLL  YRG   +HSGIIG+LC+ G G   FTY    S
Sbjct: 422 IMTRCTRLKPFIMFGCCLWMLAMGLLYRYRGGRESHSGIIGALCVWGLGTTLFTYPVTVS 481

Query: 472 IQASAKTHARMAVVTSLYLATYNIXXXXXXXXXXXXWTNILPKEISKRISDPTLAAQAYS 531
           +Q SA +H  +A VT+L    Y I            WT  L K+I KR+ D TLA  AY+
Sbjct: 482 VQ-SAVSHENLATVTALNYTLYRIGSAVGAAVSGAIWTQTLYKQILKRMGDVTLATAAYT 540

Query: 532 APFTFITTYTWGTPERIALVMSYRYVQKILCIIGLVFCFPLLGCAFMLRNHELTDSIALE 591
           +P+TFI TYTWGTP+R+ALV +Y+YVQ++  I+ LVFC PL+  +  LR+ +LTD++A+E
Sbjct: 541 SPYTFIETYTWGTPQRVALVNAYKYVQRLETIVALVFCAPLIAFSLCLRDPKLTDTVAVE 600

Query: 592 GNDHLKSKDSFETEEKQESFLKSMIFTRFTRSEDK 626
             +  +  D+ + +   + F K    ++F+ S+ +
Sbjct: 601 NIEEGEYVDTKDNDPILDWFKK--FTSKFSSSKKE 633

>KAFR0C02660 Chr3 (516832..518607) [1776 bp, 591 aa] {ON} 
          Length = 591

 Score =  516 bits (1329), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 246/558 (44%), Positives = 367/558 (65%), Gaps = 3/558 (0%)

Query: 51  DPGVYNIEIYAEMYSRPLYRVALFFSLFLIAYAYGLDGNIRYTFQAYATSSYSQHSLLST 110
           + GV NIEIY+E Y+ P+ R+ LF S+FL+ Y+Y LD  +R TF+  AT+S+S+HSL+S 
Sbjct: 36  NVGVTNIEIYSEFYNTPMKRIILFSSIFLVCYSYSLDSTLRKTFKTDATNSFSEHSLVSF 95

Query: 111 VNCIKTVIAAVGQIFFARLSDIFGRFSIMIVSVIFYSVGTIIESQAVNITRFAVGGCFYQ 170
           VNC   +++A+G++FFAR +DIFGR SI  + ++FY VGTII + +  I++FA G C Y 
Sbjct: 96  VNCFSAIVSAIGELFFARSADIFGRTSIFYICLVFYVVGTIIVATSKGISQFAAGYCIYS 155

Query: 171 LGLTGIILILEVIASDFSNLNWRLLALFIPALPFIINTWISGDVTSAIGTNWKWGIGMWA 230
            G +GI ++++++ SDFS+LNWRL+A  IP LP +IN W SG + S    NW+WGIGM+A
Sbjct: 156 FGESGIDMVMQLLVSDFSHLNWRLVAGVIPMLPNVINAWASGTIVSDFSDNWQWGIGMFA 215

Query: 231 FILPLACIPLGICMLHMRYLARKHAKDRLKPEFEALNKLKWKSFCIDIAFWKLDIIGMLL 290
            I+P+ACIPL +C+ HMRY+A+K+ K+ LK  + + N+L W  F  +  FW+LD++G++ 
Sbjct: 216 IIVPVACIPLAVCLFHMRYMAKKNKKNELKRPWHSNNELSWAQFIRETLFWRLDLVGLIT 275

Query: 291 ITVFFGCVLVPFTLAGGLKEEWKSAHIIVPEVIGWVVVLPLYMLWEMKYSRHPLTPWDLI 350
           +    GC+LVPFTL     ++W  A  IVPEVIGW V LPLY++WE  Y+++PLTP  LI
Sbjct: 276 LGASLGCILVPFTLTKKAGKKWAKASTIVPEVIGWAVGLPLYIVWEKFYAKYPLTPLRLI 335

Query: 351 KDRGXXXXXXXXXXXXXXWYMQGDYMYTVLVVAVHESIKSATRITSLYSFVSVIVGTILG 410
           +DRG              + M+ +YM TVL VA + +  +ATRI + Y FVSV+   ILG
Sbjct: 336 RDRGVYAALVAVFLYEFIYVMEANYMVTVLQVAFNNTSAAATRINNSYEFVSVLTAFILG 395

Query: 411 FILIKVRRTKPFIIFGISCWIVSFGLLVHYRGDSGAHSGIIGSLCLLGFGAGSFTYVTQA 470
           F ++ +R+TK  I+FG + + VS+GL + YRG  G ++G I +LC+ GF  G   Y T+ 
Sbjct: 396 FFVVFIRKTKRLILFGGTLFFVSYGLFIRYRGGHGCYAGSIAALCVFGFANGFIKYPTRT 455

Query: 471 SIQASAKTHARMAVVTSLYLATYNIXXXXXXXXXXXXWTNILPKEISKRISDPTLAAQAY 530
           S+QASA +H RMA++T+L+ A  ++            W+ ++P  +S RIS+  +AA+AY
Sbjct: 456 SLQASAGSHKRMAMITALFTAIGSVGKAMAAAIAGAIWSGLMPGALSSRISNSKVAAKAY 515

Query: 531 SAPFTFITTYTWGTPERIALVMSYRYVQKILCIIGLVFCFPLLGCAFMLRNHELTDSIAL 590
           S+P T I TY W +  R  ++ +YRYV K+L I+ +  C PLL  +F+LR+  L + +A 
Sbjct: 516 SSPLTVIKTYGWNSTIRNEMIEAYRYVTKVLYIVAICLCVPLLIASFLLRDRRLENKVAY 575

Query: 591 EGNDHLKSKDSFETEEKQ 608
           + +       S   EEK+
Sbjct: 576 DSDS---DDPSVLDEEKK 590

>Skud_8.3 Chr8 complement(7094..8989) [1896 bp, 631 aa] {ON} YHL040C
           (REAL)
          Length = 631

 Score =  514 bits (1323), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 270/578 (46%), Positives = 370/578 (64%), Gaps = 22/578 (3%)

Query: 58  EIYAEMYSRPLYRVALFFSLFLIAYAYGLDGNIRYTFQAYATSSYSQHSLLSTVNCIKTV 117
           EI    Y++   +  L FS F+  Y YGLDGNIRY +  YATSSYS+HSLLST+N I  V
Sbjct: 66  EIIGTAYNKWYLQAILLFSAFVCGYGYGLDGNIRYIYTGYATSSYSKHSLLSTINVINAV 125

Query: 118 IAAVGQIFFARLSDIFGRFSIMIVSVIFYSVGTIIESQAVNITRFAVGGCFYQLGLTGII 177
           ++A  QI +ARLSD+FGR  + I +VI Y VGTII+SQA ++ R+A G  FY  G  G+I
Sbjct: 126 VSAASQIIYARLSDVFGRLYLFISAVILYVVGTIIQSQAYDVQRYAAGAIFYNAGYVGVI 185

Query: 178 LILEVIASDFSNLNWRLLALFIPALPFIINTWISGDVTSAIG--TNWKWGIGMWAFILPL 235
           LIL +I SDFS+L WRLL  F P  PFIINTWI+G++TS      NW W +GMWAFI PL
Sbjct: 186 LILLIILSDFSSLKWRLLYQFAPTWPFIINTWIAGNITSRANPVVNWSWDVGMWAFIFPL 245

Query: 236 ACIPLGICMLHMRYLARKHAKDRLKPEFEALNKLKWKSF--------CIDIAFWKLDIIG 287
           +CIP+ +CMLHM++ A K       PE++ L     KS+         ++  FWKLD+IG
Sbjct: 246 SCIPIVLCMLHMQWRAGK------TPEWQELKGQ--KSYYQEHGLMKILEQLFWKLDVIG 297

Query: 288 MLLITVFFGCVLVPFTLAGGLKEEWKSAHIIVPEVIGWVVVLPLYMLWEMKYSRHPLTPW 347
           +LL+    GC+LVP TLAGG+K  W  + +I P V+G+V++ P+  +WE  Y+R P+ P+
Sbjct: 298 VLLMGCSLGCILVPLTLAGGVKTTWNDSRLIGPFVLGFVLI-PILWVWEYSYARDPILPY 356

Query: 348 DLIKDRGXXXXXXXXXXXXXXWYMQGDYMYTVLVVAVHESIKSATRITSLYSFVSVIVGT 407
            L+KDRG              +YM  DY+YTV++VAV+ESIKSATRI++L SFVSV+   
Sbjct: 357 KLVKDRGVWSSMGISFLIDFIYYMAADYLYTVMIVAVNESIKSATRISTLSSFVSVVASP 416

Query: 408 ILGFILIKVRRTKPFIIFGISCWIVSFGLLVHYRGDSGAHSGIIGSLCLLGFGAGSFTYV 467
             G ++ +  R KPFI+ G S W+++ GLL  +RG S +HSGIIG+LC+ G G   FTY 
Sbjct: 417 FFGLLMTRCTRLKPFIMSGCSLWMLAMGLLYRFRGGSESHSGIIGALCVWGVGTTLFTYP 476

Query: 468 TQASIQASAKTHARMAVVTSLYLATYNIXXXXXXXXXXXXWTNILPKEISKRISDPTLAA 527
              S+Q SA +H  +A VT+L    Y I            WT  L K+I KR+ D  LAA
Sbjct: 477 VTVSVQ-SAVSHENLATVTALNYTMYRIGSAVGSAVSGAIWTQTLYKQILKRMGDVALAA 535

Query: 528 QAYSAPFTFITTYTWGTPERIALVMSYRYVQKILCIIGLVFCFPLLGCAFMLRNHELTDS 587
            AY +P+ FI TYTWGTP+R+AL+ +Y+YVQ++  I+ LVFC PL+  +  LR+  LTD+
Sbjct: 536 SAYDSPYVFIETYTWGTPQRVALMGAYKYVQRLETIVALVFCVPLIALSLCLRDPRLTDT 595

Query: 588 IALEGNDHLKSKDSFETEEKQESFLKSMIFTRFTRSED 625
           +A+E     +  D+ +++   E F K  I ++FT  +D
Sbjct: 596 VAVENIKDGEYVDTKDSDPILEWFEK--IPSKFTSKQD 631

>KNAG0J02980 Chr10 (571855..573765) [1911 bp, 636 aa] {ON} 
          Length = 636

 Score =  513 bits (1320), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 260/543 (47%), Positives = 355/543 (65%), Gaps = 18/543 (3%)

Query: 58  EIYAEMYSRPLYRVALFFSLFLIAYAYGLDGNIRYTFQAYATSSYSQHSLLSTVNCIKTV 117
           E+ ++ Y +   +  L FS F+  Y YGLDGNIRY +  YATSSYS+HSLLST+N I  V
Sbjct: 67  ELLSKSYDKWYLQAILLFSAFVCGYGYGLDGNIRYIYTGYATSSYSEHSLLSTINVINAV 126

Query: 118 IAAVGQIFFARLSDIFGRFSIMIVSVIFYSVGTIIESQAVNITRFAVGGCFYQLGLTGII 177
           ++A  QI +ARLSDI+GR S+++V+++ Y+VGTII+ QA ++ R+A G  FY  G  G+I
Sbjct: 127 VSAASQIVYARLSDIYGRMSLLVVAIVLYAVGTIIQCQAYDVQRYAAGSIFYNAGYVGVI 186

Query: 178 LILEVIASDFSNLNWRLLALFIPALPFIINTWISGDVTSAIG--TNWKWGIGMWAFILPL 235
           LIL +I SDFS+L WRL   F+P  PFIINTWISG++T       +W W IGMWAFI PL
Sbjct: 187 LILLLILSDFSSLRWRLFYQFVPTWPFIINTWISGNITQKANPLKHWSWDIGMWAFIFPL 246

Query: 236 ACIPLGICMLHMRYLARKHAKDRLKPEFEALNKLK-------WKSFCIDIAFWKLDIIGM 288
           +C+P+  CM+HM      H + R  PE++ L   K       WK   +   FWKLD++G+
Sbjct: 247 SCVPILCCMIHM------HWRVRNDPEWKELQGEKTYFQIHGWK-VTLKTLFWKLDVVGV 299

Query: 289 LLITVFFGCVLVPFTLAGGLKEEWKSAHIIVPEVIGWVVVLPLYMLWEMKYSRHPLTPWD 348
           LL+    GC+LVP TLAGG+  +W  ++II P V+G+V++ P++  WE +++ +PL P+ 
Sbjct: 300 LLMVACLGCILVPLTLAGGVSSKWNHSNIIGPFVLGFVLI-PIFSYWEARWATNPLVPYK 358

Query: 349 LIKDRGXXXXXXXXXXXXXXWYMQGDYMYTVLVVAVHESIKSATRITSLYSFVSVIVGTI 408
           L+KDRG              +YM  DY+YTVL+VAVHES+KSATRI+SL SFVS +   I
Sbjct: 359 LVKDRGVWAALGISFLIDFIFYMAVDYLYTVLIVAVHESVKSATRISSLSSFVSTVASPI 418

Query: 409 LGFILIKVRRTKPFIIFGISCWIVSFGLLVHYRGDSGAHSGIIGSLCLLGFGAGSFTYVT 468
           +   L +V R KP II G S W+++ GLL H+RG   +HSGIIG+LC+ G G   FTY  
Sbjct: 419 VALALTRVTRMKPVIIVGCSLWLLAMGLLYHFRGGRESHSGIIGALCVWGLGTTLFTYPV 478

Query: 469 QASIQASAKTHARMAVVTSLYLATYNIXXXXXXXXXXXXWTNILPKEISKRISDPTLAAQ 528
             S+QA A  H  MA VT+L    Y I            WT  L K++ KRI +  LA +
Sbjct: 479 TVSVQA-ATNHDNMATVTALNYTLYRIGSAVGAAVSGAIWTQTLYKQLLKRIGNSELATK 537

Query: 529 AYSAPFTFITTYTWGTPERIALVMSYRYVQKILCIIGLVFCFPLLGCAFMLRNHELTDSI 588
           AY++P+TFITTYTWGTPER A+V +YRYVQ++  I+ +VFC PL+  +  LR+ +LTD +
Sbjct: 538 AYASPYTFITTYTWGTPEREAMVQAYRYVQRLETIVAVVFCAPLIMFSLCLRDAKLTDEV 597

Query: 589 ALE 591
           A E
Sbjct: 598 AHE 600

>Smik_8.1 Chr8 complement(2797..4680) [1884 bp, 627 aa] {ON} YHL040C
           (REAL)
          Length = 627

 Score =  509 bits (1310), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 266/578 (46%), Positives = 368/578 (63%), Gaps = 14/578 (2%)

Query: 54  VYNIEIYAEMYSRPLYRVALFFSLFLIAYAYGLDGNIRYTFQAYATSSYSQHSLLSTVNC 113
           +   EI+   Y++   +V L  S F+  Y YGLDGNIRY +  YATSSYS+HSLLST+N 
Sbjct: 58  IQQTEIFGAAYNKWYLQVFLLLSAFICGYGYGLDGNIRYIYTGYATSSYSEHSLLSTINV 117

Query: 114 IKTVIAAVGQIFFARLSDIFGRFSIMIVSVIFYSVGTIIESQAVNITRFAVGGCFYQLGL 173
           I  V++A  QI +ARLSD+FGR  + I +VI Y VGTII+SQA ++ R+A G  FY  G 
Sbjct: 118 INAVVSAASQIIYARLSDVFGRLYLFISAVILYVVGTIIQSQAYDVQRYAAGAIFYNAGY 177

Query: 174 TGIILILEVIASDFSNLNWRLLALFIPALPFIINTWISGDVTSAIG--TNWKWGIGMWAF 231
            G+ILIL +I SDFS+L WRLL  F P  PFIINTWI+G++TS      NW W +GMWAF
Sbjct: 178 VGVILILLIILSDFSSLKWRLLYQFAPTWPFIINTWIAGNITSRANPVVNWSWDVGMWAF 237

Query: 232 ILPLACIPLGICMLHMRYLARK----HAKDRLKPEFEALNKLKWKSFCIDIAFWKLDIIG 287
           I PL+CIP+ +CMLHM++ A+K    H     K  ++    +K     I   FW LDIIG
Sbjct: 238 IFPLSCIPIVLCMLHMQWRAKKTPEWHTLKGQKSYYQEHGFIK----IIKQLFWMLDIIG 293

Query: 288 MLLITVFFGCVLVPFTLAGGLKEEWKSAHIIVPEVIGWVVVLPLYMLWEMKYSRHPLTPW 347
           +LL+    GC+LVP TLAGG+K  W  + +I P V+G+V++ P+  +WE +++R P+ P+
Sbjct: 294 VLLMGCSLGCILVPLTLAGGVKTTWNDSRLIGPFVLGFVLI-PVLWIWEYRFARDPILPY 352

Query: 348 DLIKDRGXXXXXXXXXXXXXXWYMQGDYMYTVLVVAVHESIKSATRITSLYSFVSVIVGT 407
            L+KDR               +YM  DY+YTV++VAV+ES+KSATRI++L SFVS +   
Sbjct: 353 KLVKDRAVWSSMGISFLIDFIYYMAADYLYTVMIVAVNESVKSATRISTLSSFVSTVASP 412

Query: 408 ILGFILIKVRRTKPFIIFGISCWIVSFGLLVHYRGDSGAHSGIIGSLCLLGFGAGSFTYV 467
               ++ +  R KPFI+FG S W+V+ GLL H+RG S +HSGIIG+L + G G   FTY 
Sbjct: 413 FFALLVTRCTRLKPFIMFGCSLWMVAMGLLYHFRGGSQSHSGIIGALGVWGVGTTLFTYP 472

Query: 468 TQASIQASAKTHARMAVVTSLYLATYNIXXXXXXXXXXXXWTNILPKEISKRISDPTLAA 527
              S+Q SA +H  MA VT+L    Y I            WT  L K+I KR+ D  LA 
Sbjct: 473 VTVSVQ-SAVSHENMATVTALNYTLYRIGSAVGSAVSGAIWTQTLYKQILKRMGDVALAT 531

Query: 528 QAYSAPFTFITTYTWGTPERIALVMSYRYVQKILCIIGLVFCFPLLGCAFMLRNHELTDS 587
            AY +P+TFI TYTWGTP+R+AL+ +Y+YVQ++  I+ LVFC PL+  +  LR+ +LT++
Sbjct: 532 AAYDSPYTFIETYTWGTPQRVALMNAYKYVQRLETIVALVFCVPLIALSLCLRDPKLTNA 591

Query: 588 IALEGNDHLKSKDSFETEEKQESFLKSMIFTRFTRSED 625
           +A+E  +  +  D+ + +   E F K  I ++FT   D
Sbjct: 592 VAVEYIEDGEYVDTKDNDPILEWFEK--IPSKFTSKRD 627

>YHL040C Chr8 complement(19088..20971) [1884 bp, 627 aa] {ON}
           ARN1Transporter, member of the ARN family of
           transporters that specifically recognize
           siderophore-iron chelates; responsible for uptake of
           iron bound to ferrirubin, ferrirhodin, and related
           siderophores
          Length = 627

 Score =  507 bits (1305), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 261/575 (45%), Positives = 363/575 (63%), Gaps = 15/575 (2%)

Query: 54  VYNIEIYAEMYSRPLYRVALFFSLFLIAYAYGLDGNIRYTFQAYATSSYSQHSLLSTVNC 113
           +   EI    Y++   +  L  S F+  Y YGLDGNIRY +  YATSSYS+HSLLST+N 
Sbjct: 58  IQQTEIIGSAYNKWYLQAILLLSAFICGYGYGLDGNIRYIYTGYATSSYSEHSLLSTINV 117

Query: 114 IKTVIAAVGQIFFARLSDIFGRFSIMIVSVIFYSVGTIIESQAVNITRFAVGGCFYQLGL 173
           I  V++A  QI +ARLSD+FGR  + I +VI Y VGTII+SQA ++ R+A G  FY  G 
Sbjct: 118 INAVVSAASQIIYARLSDVFGRLYLFISAVILYVVGTIIQSQAYDVQRYAAGAIFYNAGY 177

Query: 174 TGIILILEVIASDFSNLNWRLLALFIPALPFIINTWISGDVTSAIG--TNWKWGIGMWAF 231
            G+ILIL +I SDFS+L WRLL  F+P  PFIINTWI+G++TS      NW W +GMWAF
Sbjct: 178 VGVILILLIILSDFSSLKWRLLYQFVPTWPFIINTWIAGNITSRANPVVNWSWDVGMWAF 237

Query: 232 ILPLACIPLGICMLHMRYLARK----HAKDRLKPEFEALNKLKWKSFCIDIAFWKLDIIG 287
           I PL+C+P+ +CMLHM++ ARK    HA    K  ++    +K     +   FW LD++G
Sbjct: 238 IFPLSCVPIVLCMLHMQWRARKTPEWHALKGQKSYYQEHGFIK----ILKQLFWMLDVVG 293

Query: 288 MLLITVFFGCVLVPFTLAGGLKEEWKSAHIIVPEVIGWVVVLPLYMLWEMKYSRHPLTPW 347
           +LL+    GC+LVP TLAGG+K  W  + +I P V+G+V++ P+  +WE +++R P+ P+
Sbjct: 294 VLLMGCSLGCILVPLTLAGGVKTTWNDSRLIGPFVLGFVLI-PILWIWEYRFARDPILPY 352

Query: 348 DLIKDRGXXXXXXXXXXXXXXWYMQGDYMYTVLVVAVHESIKSATRITSLYSFVSVIVGT 407
            L+KDR               +YM  DY+YTV++VAV+ES+KSATRI +L SFVS +   
Sbjct: 353 RLVKDRAVWSSMGISFLIDFIYYMAADYLYTVMIVAVNESVKSATRIATLSSFVSTVASP 412

Query: 408 ILGFILIKVRRTKPFIIFGISCWIVSFGLLVHYRGDSGAHSGIIGSLCLLGFGAGSFTYV 467
               ++ +  R KPFI+FG + W+V+ GLL H+RG S +HSGIIG+LC+ G G   FTY 
Sbjct: 413 FFALLVTRCTRLKPFIMFGCALWMVAMGLLYHFRGGSQSHSGIIGALCVWGVGTTLFTYP 472

Query: 468 TQASIQASAKTHARMAVVTSLYLATYNIXXXXXXXXXXXXWTNILPKEISKRISDPTLAA 527
              S+Q SA +H  MA VT+L    Y I            WT  L K+I KR+ D  LA 
Sbjct: 473 VTVSVQ-SAVSHENMATVTALNYTLYRIGSAVGSAVSGAIWTQTLYKQILKRMGDVALAT 531

Query: 528 QAYSAPFTFITTYTWGTPERIALVMSYRYVQKILCIIGLVFCFPLLGCAFMLRNHELTDS 587
            AY +P+TFI TYTWGTP+R AL+ +Y+YVQ++  I+ LVFC PL+  +  LR+ +LTD+
Sbjct: 532 TAYESPYTFIETYTWGTPQRNALMNAYKYVQRLETIVALVFCVPLIAFSLCLRDPKLTDT 591

Query: 588 IA---LEGNDHLKSKDSFETEEKQESFLKSMIFTR 619
           +A   +E  +++ +KD+    +  E       F R
Sbjct: 592 VAVEYIEDGEYVDTKDNDPILDWFEKLPSKFTFKR 626

>TBLA0C01040 Chr3 (208261..210270) [2010 bp, 669 aa] {ON} 
          Length = 669

 Score =  503 bits (1295), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 260/550 (47%), Positives = 353/550 (64%), Gaps = 9/550 (1%)

Query: 58  EIYAEMYSRPLYRVALFFSLFLIAYAYGLDGNIRYTFQAYATSSYSQHSLLSTVNCIKTV 117
           EI   +Y +  Y V L FS F+  Y YGLDGNIRY +  YATSSY++HSLLST+N I  V
Sbjct: 100 EIMKSVYDKWYYHVILLFSAFVCGYGYGLDGNIRYIYTGYATSSYAEHSLLSTINVINAV 159

Query: 118 IAAVGQIFFARLSDIFGRFSIMIVSVIFYSVGTIIESQAVNITRFAVGGCFYQLGLTGII 177
            +A  QI +AR SD+FGR S+ IVSV+FY+VGTII+ QA ++ R+  G  FY +G  G+I
Sbjct: 160 ASAASQIVYARASDVFGRLSLFIVSVVFYAVGTIIQCQAYDVQRYCAGSFFYNIGYVGVI 219

Query: 178 LILEVIASDFSNLNWRLLALFIPALPFIINTWISGDVTSAIG--TNWKWGIGMWAFILPL 235
           L+L +I SDFS+L WRL   F P  P+IINTWISG++TSA     +W W IGMWAFI PL
Sbjct: 220 LVLLLILSDFSSLKWRLFYQFAPTWPYIINTWISGNITSAANPLKHWSWDIGMWAFIFPL 279

Query: 236 ACIPLGICMLHMRYLARKHAKDR-LKPEFEALNKLKWKSFCIDIAFWKLDIIGMLLITVF 294
           + IP+ +C++HMR++A K  + + LK E   + +  + S   D+ FW+LD+IG+LL+   
Sbjct: 280 SSIPIILCLIHMRWMASKTKEWKLLKQEKSYIQQHTFVSAITDL-FWRLDVIGVLLMGAS 338

Query: 295 FGCVLVPFTLAGGLKEEWKSAHIIVPEVIGWVVVLPLYMLWEMKYSRHPLTPWDLIKDRG 354
            GC+LVP TLAGG   +W   +II P  +G+V++ P++  WE K+S+ PL P  L+KDR 
Sbjct: 339 LGCILVPLTLAGGTSSKWNHGNIIAPFALGFVLI-PIFTFWEWKFSKSPLIPSKLVKDRA 397

Query: 355 XXXXXXXXXXXXXXWYMQGDYMYTVLVVAVHESIKSATRITSLYSFVSVIVGTILGFILI 414
                         +YM  DY+YTVL+V V+ES+KSATRI+SL SFVS +   I   ++ 
Sbjct: 398 VWSSMAISFLIDFIFYMAVDYLYTVLIVGVNESVKSATRISSLSSFVSTVGSPIFALLIT 457

Query: 415 KVRRTKPFIIFGISCWIVSFGLLVHYRGDSGAHSGIIGSLCLLGFGAGSFTYVTQASIQA 474
           +  R KPFI+ G + W++S GLL HYRG + +H+GII SLC+ G G   FTY    S+QA
Sbjct: 458 RFTRLKPFIVAGCALWMLSMGLLYHYRGGASSHNGIIASLCVWGVGTTLFTYPINVSVQA 517

Query: 475 SAKTHARMAVVTSLYLATYNIXXXXXXXXXXXXWTNILPKEISKRISDPTLAAQAYSAPF 534
            A +HA MA VT+L    Y I            WT  L K++ KR+ D TLA  AYS+P+
Sbjct: 518 -AVSHADMATVTALNYTMYRIGSAVGAAVSGAIWTQTLYKQLHKRMGDATLATAAYSSPY 576

Query: 535 TFITTYTWGTPERIALVMSYRYVQKILCIIGLVFCFPLLGCAFMLRNHELTDSIA---LE 591
           +FI  YTWGT  R  +V +YRYVQ++  I+ LVF  PLL  +  LR+  LTD++A   +E
Sbjct: 577 SFIVNYTWGTTVRDQMVEAYRYVQRLETIVALVFTVPLLLFSLTLRDARLTDNVASDDIE 636

Query: 592 GNDHLKSKDS 601
              H+   DS
Sbjct: 637 EGQHINKTDS 646

>NDAI0H00140 Chr8 complement(10247..12145) [1899 bp, 632 aa] {ON} 
          Length = 632

 Score =  501 bits (1289), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 268/606 (44%), Positives = 376/606 (62%), Gaps = 21/606 (3%)

Query: 32  DVNPTLTTSSPAPSYIELIDPGVYNIEIYAEMYSRPLYRVALFFSLFLIAYAYGLDGNIR 91
           + +  +T  SP P    +I       E+ A +Y +  Y V L  S F+  Y YGLDGNIR
Sbjct: 36  ETDDDITIRSPPPKKSLVIK----QTEVMASVYDKWYYHVVLLVSAFICGYGYGLDGNIR 91

Query: 92  YTFQAYATSSYSQHSLLSTVNCIKTVIAAVGQIFFARLSDIFGRFSIMIVSVIFYSVGTI 151
           Y +  YATSSY++HSLLSTV  I  V++A  QI ++RLSD FGRF + +++++ Y VGTI
Sbjct: 92  YIYTGYATSSYAEHSLLSTVTVINAVVSAASQIVYSRLSDFFGRFILFVIAIVLYVVGTI 151

Query: 152 IESQAVNITRFAVGGCFYQLGLTGIILILEVIASDFSNLNWRLLALFIPALPFIINTWIS 211
           I+SQA ++ R+A G  FY  G  G++LIL +I SDFS+L WRL   F P  PFIINTWIS
Sbjct: 152 IQSQAYDVQRYAAGAIFYNAGYVGVLLILLLILSDFSSLKWRLFYQFAPTWPFIINTWIS 211

Query: 212 GDVTSAIG--TNWKWGIGMWAFILPLACIPLGICMLHMRYLARKHAKDRLKPEFEALNKL 269
           G++T A     +W W +GMWAFI PL+CIP+ +CM+HM++ A K  + +   + ++  + 
Sbjct: 212 GNITLAANPLVHWSWDVGMWAFIFPLSCIPMLLCMIHMQWKASKTEEWKELKKEKSYYEK 271

Query: 270 KWKSFCIDIAFWKLDIIGMLLITVFFGCVLVPFTLAGGLKEEWKSAHIIVPEVIGWVVVL 329
                 +   FW+LDIIG+LL+  + GC+LVP TLAGG+K +W    II P V+G+V+V 
Sbjct: 272 HGLLLTLKELFWRLDIIGVLLMVAWLGCILVPLTLAGGVKSKWNDGRIIGPFVLGFVLV- 330

Query: 330 PLYMLWEMKYSRHPLTPWDLIKDRGXXXXXXXXXXXXXXWYMQGDYMYTVLVVAVHESIK 389
           P++  WE  ++R PL P+ LIKDRG              +YM  DY+YTVL+VAVHES+K
Sbjct: 331 PIFAAWEYFFARDPLIPYALIKDRGVWASMGISFLIDFIFYMASDYLYTVLIVAVHESVK 390

Query: 390 SATRITSLYSFVSVIVGTILGFILIKVRRTKPFIIFGISCWIVSFGLLVHYRGDSGAHSG 449
           SATRI+SL SFVS +       +L +  R KPFI+ G S W++S GLL H+RG   +HSG
Sbjct: 391 SATRISSLSSFVSTVASPFFALLLTRCSRLKPFIMVGCSLWMLSMGLLYHFRGGEQSHSG 450

Query: 450 IIGSLCLLGFGAGSFTYVTQASIQASAKTHARMAVVTSLYLATYNIXXXXXXXXXXXXWT 509
           IIG+LC+ G G   FTY    S+Q SA +H  MA VT++    Y +            WT
Sbjct: 451 IIGALCVWGIGTTLFTYPVNVSVQ-SATSHENMATVTAINYTCYRLGSAIGAAVSGAIWT 509

Query: 510 NILPKEISKRISD-------PTLAAQAYSAPFTFITTYTWGTPERIALVMSYRYVQKILC 562
             L  +I KR+++        T+A +AYS+P+TFIT YTWGTP R A+V SYRY+Q++  
Sbjct: 510 QKLYPDILKRVTEVVGATEAVTIATEAYSSPYTFITKYTWGTPVRDAVVESYRYIQRLET 569

Query: 563 IIGLVFCFPLLGCAFMLRNHELTDSIALEGNDHLKSKDSFETEEKQESF--LKSMIFTRF 620
           I+ LVFC PL+  +  LR+ +LTD IA   ++++K  +    E+    F  LK  +F R 
Sbjct: 570 IVALVFCVPLIIFSLCLRDAKLTDEIA---HENIKEGEYVSKEDSDVFFDWLKK-VFGRS 625

Query: 621 TRSEDK 626
            +S++ 
Sbjct: 626 KKSDED 631

>KAFR0I01560 Chr9 (328940..330838) [1899 bp, 632 aa] {ON}  YHL040C
          Length = 632

 Score =  497 bits (1279), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 260/602 (43%), Positives = 368/602 (61%), Gaps = 24/602 (3%)

Query: 22  ILEKEVGAIVDVNPTLTTSSPAPSYIELIDPGVYNI------------EIYAEMYSRPLY 69
           I+EK   AIV    +  +S   P     +D  + N+            EI +  Y++   
Sbjct: 10  IVEKNTAAIVS---SKKSSDEEPMDYNEVDEELQNVLQTNKSIVIKKAEIISASYAKWYE 66

Query: 70  RVALFFSLFLIAYAYGLDGNIRYTFQAYATSSYSQHSLLSTVNCIKTVIAAVGQIFFARL 129
           ++   F  FL  Y YGLD NIRY +  YATSSYS+HSLLSTV  I  V++A  QI +ARL
Sbjct: 67  KLIFLFCAFLCGYGYGLDSNIRYIYTGYATSSYSEHSLLSTVTVINAVVSAASQIVYARL 126

Query: 130 SDIFGRFSIMIVSVIFYSVGTIIESQAVNITRFAVGGCFYQLGLTGIILILEVIASDFSN 189
           SD FGRF + +V+++ YS+GTII+ QA ++ R+A G  FY  G  G+IL+L +I SD S 
Sbjct: 127 SDAFGRFRLFVVAIVLYSMGTIIQCQAYDVQRYAAGSIFYNAGYVGVILVLLLILSDMST 186

Query: 190 LNWRLLALFIPALPFIINTWISGDVTSAIG--TNWKWGIGMWAFILPLACIPLGICMLHM 247
           L WRL   F+P  P+IINTWISG++TSA     NW W +GMWAFI PL+C+P+  CM+HM
Sbjct: 187 LRWRLFYQFVPTWPYIINTWISGNITSAANPIENWSWDVGMWAFIFPLSCLPILACMIHM 246

Query: 248 RYLARKHAK-DRLKPEFEALNKLKWKSFCIDIAFWKLDIIGMLLITVFFGCVLVPFTLAG 306
           ++ ARK  +   LK +     +       + + FWK+DIIG+LL+    GC+LVP TLAG
Sbjct: 247 QWRARKTQEWKDLKTQKTYYQQHGLMKSLVSL-FWKIDIIGVLLMAASLGCILVPLTLAG 305

Query: 307 GLKEEWKSAHIIVPEVIGWVVVLPLYMLWEMKYSRHPLTPWDLIKDRGXXXXXXXXXXXX 366
           G   +W+ + II   V+G+V++ P++ +WE K++  P+ P+ L+KDRG            
Sbjct: 306 GTSSKWRDSRIIGVFVLGFVLI-PIFFIWEKKFATDPIVPYKLVKDRGVWASLGISFLID 364

Query: 367 XXWYMQGDYMYTVLVVAVHESIKSATRITSLYSFVSVIVGTILGFILIKVRRTKPFIIFG 426
             +YM  DY+YTVL+VAV+ES+ +ATRI+SLYSFVS +    +   L +  R KPFIIFG
Sbjct: 365 FIYYMAADYLYTVLIVAVNESVSAATRISSLYSFVSTVASPFVSLALTRFTRLKPFIIFG 424

Query: 427 ISCWIVSFGLLVHYRGDSGAHSGIIGSLCLLGFGAGSFTYVTQASIQASAKTHARMAVVT 486
              W ++ GLL H+RG + +HSGIIG LC+ G G+  FTY    S+QA A +H +MA V+
Sbjct: 425 CCLWFLAMGLLYHFRGGASSHSGIIGGLCVWGLGSTFFTYPVTVSVQA-AVSHEQMATVS 483

Query: 487 SLYLATYNIXXXXXXXXXXXXWTNILPKEISKRISDPTLAAQAYSAPFTFITTYTWGTPE 546
           +L    Y I            WT  L K++   + D TLA  AY +P+TFI TYTWGTPE
Sbjct: 484 ALNYTFYRIGSAVGAAVSGAIWTQKLYKKLLSLMGDATLATAAYGSPYTFIVTYTWGTPE 543

Query: 547 RIALVMSYRYVQKILCIIGLVFCFPLLGCAFMLRNHELTDSIALEGNDHLKSKDSFETEE 606
           R A+V +YRY+Q++  ++ LVFC PL+  +  LR+  LTD++A   +D + S +  +T+ 
Sbjct: 544 REAMVEAYRYIQRLETVVALVFCVPLVAFSLCLRDSRLTDNVA---HDDMSSGEFIDTKS 600

Query: 607 KQ 608
             
Sbjct: 601 DD 602

>KLTH0D00506g Chr4 (47320..49170) [1851 bp, 616 aa] {ON} similar to
           uniprot|P38731 Saccharomyces cerevisiae YHL040C ARN1
           Transporter member of the ARN family of transporters
           that specifically recognize siderophore-iron chelates
           responsible for uptake of iron bound to ferrirubin
           ferrirhodin and related siderophores
          Length = 616

 Score =  486 bits (1251), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 262/545 (48%), Positives = 356/545 (65%), Gaps = 20/545 (3%)

Query: 58  EIYAEMYSRPLYRVALFFSLFLIAYAYGLDGNIRYTFQAYATSSYSQHSLLSTVNCIKTV 117
           EI A  Y    YRV L F+ F+  Y YGLDGNIRY +  YAT++YS+HSLLST+  +  V
Sbjct: 50  EILAAQYDSWYYRVILLFAAFICGYGYGLDGNIRYIYTGYATNAYSEHSLLSTIGVVNNV 109

Query: 118 IAAVGQIFFARLSDIFGRFSIMIVSVIFYSVGTIIESQAVNITRFAVGGCFYQLGLTGII 177
           I A  Q+ +ARL+D FGR S+ I +++FY+VGTII+SQA ++ R+A G  FY +G  G+I
Sbjct: 110 IGAASQLVYARLADTFGRLSLFITAIVFYAVGTIIQSQAYDVQRYAAGAVFYNIGYVGVI 169

Query: 178 LILEVIASDFSNLNWRLLALFIPALPFIINTWISGDVTSAIG--TNWKWGIGMWAFILPL 235
           L+L ++ SDFS+L WRLL   +P  PFIINTWISG++TSA    TNW W IGMWAFI PL
Sbjct: 170 LVLLLMLSDFSSLRWRLLYTIVPTWPFIINTWISGNITSAAKPETNWSWDIGMWAFIFPL 229

Query: 236 ACIPLGICMLHMRYLARKHAKDRLKPEFEALNKLK--------WKSFCIDIAFWKLDIIG 287
           +C+PL  CM+HMR  ARK       PE+ AL + K        W +  +++ FWKLD++G
Sbjct: 230 SCVPLIACMIHMRIKARK------TPEWIALKQEKSYFQTNGLWDTL-VEL-FWKLDVVG 281

Query: 288 MLLITVFFGCVLVPFTLAGGLKEEWKSAHIIVPEVIGWVVVLPLYMLWEMKYSRHPLTPW 347
           +LL+    GC+LVP TLAGG   +W + HII P V+G+V+V P+ M WEM+++R PL P+
Sbjct: 282 VLLLIATLGCILVPLTLAGGYNSKWNNPHIIGPFVLGFVLV-PILMFWEMRWARDPLVPY 340

Query: 348 DLIKDRGXXXXXXXXXXXXXXWYMQGDYMYTVLVVAVHESIKSATRITSLYSFVSVIVGT 407
            LIKDRG              + +   Y+Y +L+VAV ES+KSATRI+SL SFVSV+   
Sbjct: 341 GLIKDRGVWSALAISFLNYFIFALAAGYLYAILLVAVDESVKSATRISSLSSFVSVVWSP 400

Query: 408 ILGFILIKVRRTKPFIIFGISCWIVSFGLLVHYRGDSGAHSGIIGSLCLLGFGAGSFTYV 467
           I    + + ++ KP+I+ G + W+V  GLL HYRG S AHSGIIG+LC+ G G+  +TY 
Sbjct: 401 IFSLFITRQKKLKPYIVLGCAMWMVGIGLLYHYRGGSYAHSGIIGALCVWGAGSTMWTYP 460

Query: 468 TQASIQASAKTHARMAVVTSLYLATYNIXXXXXXXXXXXXWTNILPKEISKRISDPTLAA 527
              S+Q SA +H  +A VT+L    Y I            WT  L K++ KR+ D  LAA
Sbjct: 461 VNISVQ-SATSHENLATVTALNYTLYRIGGAVGTAVSGAIWTQTLYKQLLKRLGDADLAA 519

Query: 528 QAYSAPFTFITTYTWGTPERIALVMSYRYVQKILCIIGLVFCFPLLGCAFMLRNHELTDS 587
            AY++P+TFI +Y WGTP+R A+V +YR+VQ+   I+ LVFC PL+  A  LR+ +LTD 
Sbjct: 520 AAYASPYTFIVSYAWGTPQREAVVGAYRHVQRYETIVALVFCAPLVIFAMCLRDPDLTDE 579

Query: 588 IALEG 592
           +A  G
Sbjct: 580 VAHSG 584

>ZYRO0G07414g Chr7 complement(583978..586101) [2124 bp, 707 aa] {ON}
           similar to uniprot|P38731 Saccharomyces cerevisiae
           YHL040C ARN1 Transporter member of the ARN family of
           transporters that specifically recognize
           siderophore-iron chelates responsible for uptake of iron
           bound to ferrirubin ferrirhodin and related siderophores
          Length = 707

 Score =  483 bits (1244), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 259/549 (47%), Positives = 343/549 (62%), Gaps = 8/549 (1%)

Query: 58  EIYAEMYSRPLYRVALFFSLFLIAYAYGLDGNIRYTFQAYATSSYSQHSLLSTVNCIKTV 117
           E+ A  Y    +R+ L F  F+  Y YGLD NIR+ + +Y T+S+S+HSLLSTVN I  V
Sbjct: 83  ELLAAEYDWWPFRILLLFCAFICGYGYGLDSNIRFIYTSYVTNSFSEHSLLSTVNVINAV 142

Query: 118 IAAVGQIFFARLSDIFGRFSIMIVSVIFYSVGTIIESQAVNITRFAVGGCFYQLGLTGII 177
           I+A  QI +ARL+D+FGR ++ I +V+FYS+GT+I+SQ+ NI  +A G  FY LG  G++
Sbjct: 143 ISAASQIVYARLADVFGRLTLFITAVVFYSMGTVIQSQSYNIETYAAGSIFYNLGYVGVV 202

Query: 178 LILEVIASDFSNLNWRLLALFIPALPFIINTWISGDVTSAIG--TNWKWGIGMWAFILPL 235
           L+L +I SDFS+L WRL   F P  PFIINTWISG++TS      NW W IGMWAFI PL
Sbjct: 203 LVLLLILSDFSSLKWRLFYQFAPTWPFIINTWISGNITSRANPQENWSWDIGMWAFIFPL 262

Query: 236 ACIPLGICMLHMRYLARKHAKDRLKPEFEALNKLKWKSFCIDIAFWKLDIIGMLLITVFF 295
           +C+PL  CMLHM + AR+  + ++  E +   K       I   FWKLD IG  ++TV  
Sbjct: 263 SCVPLICCMLHMWWKARRTEEWKILNEEKTYFKTHGLVSFIKELFWKLDTIGTFIMTVSL 322

Query: 296 GCVLVPFTLAGGLKEEWKSAHIIVPEVIGWVVVLPLYMLWEMKYSRHPLTPWDLIKDRGX 355
           GC+LVP TLAGG   +W  + II P V+G VV+LP+ +++E+K++R P+ PW LIKDR  
Sbjct: 323 GCILVPLTLAGGTSSKWDDSQIIGPLVLG-VVLLPMLIVYELKWAREPILPWKLIKDRAV 381

Query: 356 XXXXXXXXXXXXXWYMQGDYMYTVLVVAVHESIKSATRITSLYSFVSVIVGTILGFILIK 415
                        +YM  DY+YTV++VAV ES+KSATRI+SL +FVS +        + +
Sbjct: 382 WASMSISFLYDFIFYMAYDYLYTVMIVAVDESVKSATRISSLSAFVSTVFSPFFALYITR 441

Query: 416 VRRTKPFIIFGISCWIVSFGLLVHYRGDSGAHSGIIGSLCLLGFGAGSFTYVTQASIQAS 475
           V R KP+II G   W+V+ GLL H+RG   +HSGIIG LC+ G G   FTY    S+Q S
Sbjct: 442 VTRLKPYIIAGCGLWMVAMGLLYHFRGGKSSHSGIIGGLCVWGVGTTMFTYPVNVSVQ-S 500

Query: 476 AKTHARMAVVTSLYLATYNIXXXXXXXXXXXXWTNILPKEISKRISDPTLAAQAYSAPFT 535
           A +H  MA VTSL    Y I            WT  L  EI KR+ D  +A+ AY  P+ 
Sbjct: 501 ATSHENMATVTSLNYTLYRIGSAVGIAVSGCIWTQNLYHEIFKRVKDAKIASYAYEQPYN 560

Query: 536 FITTYTWGTPERIALVMSYRYVQKILCIIGLVFCFPLLGCAFMLRNHELTDSIAL----E 591
           FI  YTWGTP R  +V +Y +VQK+  ++GLVFC PLL  +  LR+ ELTD IA     E
Sbjct: 561 FIAEYTWGTPIRQQVVEAYMHVQKLETLVGLVFCAPLLLFSLCLRDPELTDEIAHNDLGE 620

Query: 592 GNDHLKSKD 600
           G    + KD
Sbjct: 621 GEYIARDKD 629

>SAKL0G03300g Chr7 (268199..270049) [1851 bp, 616 aa] {ON} similar
           to uniprot|P38731 Saccharomyces cerevisiae YHL040C ARN1
           Transporter member of the ARN family of transporters
           that specifically recognize siderophore-iron chelates
           responsible for uptake of iron bound to ferrirubin
           ferrirhodin and related siderophores
          Length = 616

 Score =  476 bits (1224), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 260/581 (44%), Positives = 359/581 (61%), Gaps = 25/581 (4%)

Query: 58  EIYAEMYSRPLYRVALFFSLFLIAYAYGLDGNIRYTFQAYATSSYSQHSLLSTVNCIKTV 117
           EI A  Y    YR  L FS FL  Y YGLDG++RY +  YAT+SY++HSLLST+  I  V
Sbjct: 50  EILAAQYDTWFYRSILLFSAFLCGYGYGLDGSVRYIYTGYATNSYAEHSLLSTIAVINAV 109

Query: 118 IAAVGQIFFARLSDIFGRFSIMIVSVIFYSVGTIIESQAVNITRFAVGGCFYQLGLTGII 177
           I+A  QI +ARL+D+FGR  + I +VIFY VGTII+SQA ++ R+A G  FY  G  G++
Sbjct: 110 ISAAAQIVYARLADVFGRLYLFITAVIFYVVGTIIQSQAYDVQRYAAGAVFYNTGYVGVV 169

Query: 178 LILEVIASDFSNLNWRLLALFIPALPFIINTWISGDVTSAIG--TNWKWGIGMWAFILPL 235
           L+L +I SDFS+L WRL   F+P  PFIINTWI+GD+TS      NW W I MWAFI PL
Sbjct: 170 LVLLLILSDFSSLKWRLFYQFVPTWPFIINTWIAGDITSRANPQENWSWDISMWAFIFPL 229

Query: 236 ACIPLGICMLHMRYLARKHAKDRLKPEFEALNKLKWKSF--------CIDIAFWKLDIIG 287
           + +P+  CMLHMR  ARK       PE++ L++   KSF         +   FWKLD+IG
Sbjct: 230 SALPIICCMLHMRIKARK------TPEWQVLSEE--KSFYQTHGFIQTLVQLFWKLDVIG 281

Query: 288 MLLITVFFGCVLVPFTLAGGLKEEWKSAHIIVPEVIGWVVVLPLYMLWEMKYSRHPLTPW 347
           +L++TV  GC+LVP TLAGG   +W+++ II P V+G+V++ P+Y+ WE K+++ P+ P+
Sbjct: 282 VLIMTVSLGCILVPLTLAGGYSSKWQNSQIIGPIVLGFVLI-PMYIYWESKWAKEPMAPF 340

Query: 348 DLIKDRGXXXXXXXXXXXXXXWYMQGDYMYTVLVVAVHESIKSATRITSLYSFVSVIVGT 407
            L+KDRG              +YM  DY+Y VL++ V++S+KSA+RI+SL SFVS +   
Sbjct: 341 KLLKDRGVWAALGISFLIDFIFYMAADYLYAVLLIGVNQSVKSASRISSLSSFVSTVASP 400

Query: 408 ILGFILIKVRRTKPFIIFGISCWIVSFGLLVHYRGDSGAHSGIIGSLCLLGFGAGSFTYV 467
               I+ +  R KP+II G S W+++ GLL H+RG S ++SGI+G+LC+ G G   FTY 
Sbjct: 401 FFALIITRSTRLKPYIITGCSLWMLAMGLLYHFRGGSESYSGIVGALCVWGIGTTMFTYP 460

Query: 468 TQASIQASAKTHARMAVVTSLYLATYNIXXXXXXXXXXXXWTNILPKEISKRISDPTLAA 527
              S+Q S  +H  MA VT+L    Y I            WT  L K++  R+ D  LA 
Sbjct: 461 VNVSVQ-SVTSHENMATVTALNYTLYRIGAAVGAAVSGAIWTQTLYKDLLNRLDDAALAM 519

Query: 528 QAYSAPFTFITTYTWGTPERIALVMSYRYVQKILCIIGLVFCFPLLGCAFMLRNHELTDS 587
            AYS P++FI T+TW TPER A+V SYRYVQ++  I+ LVF  PLL  +F LR+  LTD 
Sbjct: 520 SAYSEPYSFIITHTWNTPERDAMVQSYRYVQRLETIVALVFTVPLLVFSFFLRDPPLTDK 579

Query: 588 IALEGNDHLKSKDSFETEEKQESFLKSMIFTRFTRSEDKRN 628
           +A    D+++  +           +     +RF R   K+ 
Sbjct: 580 VA---QDNIEEGEYINVNHNDP--ITDWFSSRFERLRGKKE 615

>TPHA0K02330 Chr11 (506158..508053) [1896 bp, 631 aa] {ON} 
          Length = 631

 Score =  476 bits (1226), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 258/574 (44%), Positives = 357/574 (62%), Gaps = 23/574 (4%)

Query: 58  EIYAEMYSRPLYRVALFFSLFLIAYAYGLDGNIRYTFQAYATSSYSQHSLLSTVNCIKTV 117
           EI A  Y++  + + L F+ F+  Y YGLDGNIRY +  YATSSY++HSLLSTV  I  V
Sbjct: 61  EIMAAQYNKWYHHLFLLFTAFICGYGYGLDGNIRYIYTGYATSSYAEHSLLSTVTVINAV 120

Query: 118 IAAVGQIFFARLSDIFGR-FSIMIVSVIFYSVGTIIESQAVNITRFAVGGCFYQLGLTGI 176
           ++AV QI+      +FGR + I +V+++ YSVGTII+SQA ++ R+A G  FY  G +G+
Sbjct: 121 VSAVSQIYTPDFQIVFGRLYIIFLVAIVLYSVGTIIQSQAYDVQRYAAGAIFYNAGYSGV 180

Query: 177 ILILEVIASDFSNLNWRLLALFIPALPFIINTWISGDVTSAIG--TNWKWGIGMWAFILP 234
           + IL +I SDFS+L WRL   F P  PFIINTWISG++TSA     NW W IGM AFI+P
Sbjct: 181 LFILLIILSDFSSLKWRLAYQFAPTWPFIINTWISGNITSAANPIENWSWDIGMRAFIIP 240

Query: 235 LACIPLGICMLHMRYLARKHA--KDRLKPE--FEALNKLKWKSFCIDIAFWKLDIIGMLL 290
           L+C+P   CM+HM + ARK    K+ LK +  +E  N L W +  +++ FW+LD+ G++L
Sbjct: 241 LSCLPFIACMIHMEWKARKTPEWKELLKEKTFYEEHNGL-WGTL-VEL-FWRLDVAGLIL 297

Query: 291 ITVFFGCVLVPFTLAGGLKEEWKSAHIIVPEVIGWVVVLPLYMLWEMKYSRHPLTPWDLI 350
           +    GC+LVP TLAGG   +W   ++I P ++G+V++ P + LWE  ++R PL P  L+
Sbjct: 298 MGSSLGCILVPLTLAGGTSSKWNHGNVIGPFILGFVLI-PFFALWEKFFARDPLLPAKLV 356

Query: 351 KDRGXXXXXXXXXXXXXXWYMQGDYMYTVLVVAVHESIKSATRITSLYSFVSVIVGTILG 410
           KDRG              +YM  DY+YTVL+VAV ES+KSATRI+SL SFVS +      
Sbjct: 357 KDRGVWSAMGISFLIDFIYYMAADYLYTVLIVAVDESVKSATRISSLSSFVSTVASPFFA 416

Query: 411 FILIKVRRTKPFIIFGISCWIVSFGLLVHYRGDSGAHSGIIGSLCLLGFGAGSFTYVTQA 470
             L +  R KP+I+ G S W+++ GLL ++RG   +HSGIIG+LC+ G G   FTY    
Sbjct: 417 LYLTRCSRLKPWIMLGCSLWMLAMGLLYYFRGGRESHSGIIGALCVWGVGTTLFTYPVTV 476

Query: 471 SIQASAKTHARMAVVTSLYLATYNIXXXXXXXXXXXXWTNILPKEISKRISDPTLAAQAY 530
           S+QA A +H  MA VT+     Y I            WT  L K++ K + D  LA  AY
Sbjct: 477 SVQA-AVSHENMATVTAANYTLYRIGSAIGAAVSGAIWTQTLYKQLYKHLQDIALATAAY 535

Query: 531 SAPFTFITTYTWGT-PERIALVMSYRYVQKILCIIGLVFCFPLLGCAFMLRNHELTDSIA 589
           S+P+TF T Y WGT PER A+V +YRYVQ++  ++ LVFC PL+  +  LR+  LTD +A
Sbjct: 536 SSPYTFTTNYAWGTPPEREAVVQAYRYVQRLETVVALVFCVPLIAFSLCLRDARLTDEVA 595

Query: 590 ----LEGNDHLKSKDSFETEEKQESFLKSMIFTR 619
                EG   +KS    +++   E F+K  IF R
Sbjct: 596 HGNIAEGEIIVKS----DSDPISEFFVK--IFRR 623

>KLLA0C19272g Chr3 complement(1717903..1719774) [1872 bp, 623 aa]
           {ON} similar to uniprot|P38724 Saccharomyces cerevisiae
           YHL047C ARN2 Transporter or YHL040C uniprot|P38731
           Saccharomyces cerevisiae YHL040C ARN1 Transporter,
           member of the ARN family of transporters that
           specifically recognize siderophore-iron chelates
           responsible for uptake of iron bound to the siderophore
           triacetylfusarinine C,
          Length = 623

 Score =  469 bits (1208), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 248/555 (44%), Positives = 346/555 (62%), Gaps = 10/555 (1%)

Query: 58  EIYAEMYSRPLYRVALFFSLFLIAYAYGLDGNIRYTFQAYATSSYSQHSLLSTVNCIKTV 117
           EI A+ Y    ++  L FS+FL +Y YGLDG++R  +  YAT+SYS HSLLST++ I  V
Sbjct: 55  EILAQQYDTWYWKAVLLFSVFLCSYGYGLDGSVRSVYTTYATNSYSTHSLLSTISIINLV 114

Query: 118 IAAVGQIFFARLSDIFGRFSIMIVSVIFYSVGTIIESQAVNITRFAVGGCFYQLGLTGII 177
           I A  Q+FFARLSD+FGR +++IV+ +FYSVGTII+SQA ++ R+A G  FY +GL G++
Sbjct: 115 IGASAQVFFARLSDVFGRLTLLIVATVFYSVGTIIQSQAYDVQRYAAGAVFYNVGLVGVV 174

Query: 178 LILEVIASDFSNLNWRLLALFIPALPFIINTWISGDVTSAIG--TNWKWGIGMWAFILPL 235
           L + +I SDFS+L WRL   F+P+ PFIIN W+SG+V +A     NW W IGMWAFI PL
Sbjct: 175 LQVILILSDFSSLRWRLFYTFVPSWPFIINMWVSGNVVNAANPLENWSWSIGMWAFIFPL 234

Query: 236 ACIPLGICMLHMRYLARK-HAKDRLKPEFEALNKLKWKSFCIDIAFWKLDIIGMLLITVF 294
            C+PL  C+LHMRY A K  A   L+ E             I + FWKLD++G+LL+TV 
Sbjct: 235 TCLPLVCCILHMRYRASKTEAWRHLQLEKTYYQSHGLLQTLIQL-FWKLDVVGVLLLTVT 293

Query: 295 FGCVLVPFTLAGGLKEEWKSAHIIVPEVIGWVVVLPLYMLWEMKYSRHPLTPWDLIKDRG 354
            GC+LVP TLAGG+ ++W + H+I P V+G+ V+LP++++WE K++  P+ P++L+KDRG
Sbjct: 294 LGCILVPLTLAGGVSQKWNNPHVIAPFVLGF-VLLPIFVVWESKWALDPIAPFELLKDRG 352

Query: 355 XXXXXXXXXXXXXXWYMQGDYMYTVLVVAVHESIKSATRITSLYSFVSVIVGTILGFILI 414
                         + M   Y+YT+LV+AV ES  SATRITS+YSF + +       ++ 
Sbjct: 353 VWSALTIQFLIYFVYQMAVGYLYTILVIAVDESTTSATRITSVYSFTAAVASPFFALVVT 412

Query: 415 KVRRTKPFIIFGISCWIVSFGLLVHYRGDSGAHSGIIGSLCLLGFGAGSFTYVTQASIQA 474
           + +R KP+II G S W+V+ G+L H+R    +  GIIG L L G  +  FTY    S+Q 
Sbjct: 413 RSKRLKPYIITGCSLWMVAMGILYHFRSGKDSDKGIIGGLVLWGLTSTLFTYPVTVSLQ- 471

Query: 475 SAKTHARMAVVTSLYLATYNIXXXXXXXXXXXXWTNILPKEISKRIS-DPTLAAQAYSAP 533
           S  +H  MA VT+L    Y I            WT +L K++ K ++ D TLA  AY +P
Sbjct: 472 SITSHENMASVTALNYTIYRIGGAVASAASGAIWTQLLYKKLLKEMNGDATLATAAYGSP 531

Query: 534 FTFITTYTWGTPERIALVMSYRYVQKILCIIGLVFCFPLLGCAFMLRNHELTDSIALEGN 593
           F FI  Y WGTP R A+V SYRYVQK   ++ L+F  P+   +  LR+  LTD    +  
Sbjct: 532 FDFILDYPWGTPMRDAMVESYRYVQKYEVLVALIFTVPMFILSMFLRDPPLTDD---QAQ 588

Query: 594 DHLKSKDSFETEEKQ 608
           ++LK  +   TE   
Sbjct: 589 ENLKEGEYINTEHDD 603

>KLLA0A10439g Chr1 complement(913342..915246) [1905 bp, 634 aa] {ON}
           similar to uniprot|P38731 Saccharomyces cerevisiae
           YHL040C ARN1 Transporter member of the ARN family of
           transporters that specifically recognize
           siderophore-iron chelates responsible for uptake of iron
           bound to ferrirubin ferrirhodin and related siderophores
          Length = 634

 Score =  464 bits (1193), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 248/632 (39%), Positives = 367/632 (58%), Gaps = 19/632 (3%)

Query: 7   NHALPEDFTEDVVPDILEKEVGAIVDVN-----PTLTTSSPAPSYIELIDP-GVYNIEIY 60
           +  L   +++D   ++++   GA V V+     PT       P Y++      +   EI 
Sbjct: 12  DKVLKSTYSDDET-NVIKSVNGAGVGVDEKQAGPTDLNEYGIPDYLKSSKSLTIRKTEIL 70

Query: 61  AEMYSRPLYRVALFFSLFLIAYAYGLDGNIRYTFQAYATSSYSQHSLLSTVNCIKTVIAA 120
           AE YS   +RV L FS FL  Y YGLDGN+R  +  +AT+SYS HSLLST+  +  V+ A
Sbjct: 71  AEQYSSWQWRVVLLFSAFLCGYGYGLDGNLRSFYTTWATNSYSTHSLLSTIGVVNAVMGA 130

Query: 121 VGQIFFARLSDIFGRFSIMIVSVIFYSVGTIIESQAVNITRFAVGGCFYQLGLTGIILIL 180
             QI +ARLSD++GRF++ + +++FY VGTIIESQA ++ R+A G  FY +G  G+ILI+
Sbjct: 131 ASQIVYARLSDVYGRFTLFVTAIVFYVVGTIIESQAHDVQRYAAGAVFYNIGYVGVILIV 190

Query: 181 EVIASDFSNLNWRLLALFIPALPFIINTWISGDVTSAIG--TNWKWGIGMWAFILPLACI 238
            +I SDFS+L WRL   F+P  PFIINTWISG++        NW W I MWAFI PL+C+
Sbjct: 191 LLILSDFSSLKWRLFYSFVPTWPFIINTWISGNIVDVAKPEQNWSWDIAMWAFIFPLSCL 250

Query: 239 PLGICMLHMRYLARK-HAKDRLKPEFEALNKLKWKSFCIDIAFWKLDIIGMLLITVFFGC 297
           PL  CMLHM++ AR+  A   L  +             + + FWKLD+IG+  + +  GC
Sbjct: 251 PLLGCMLHMKWRARQTEAWKELSSQKTYYQTHGLVQSLVQL-FWKLDVIGVFFMIIILGC 309

Query: 298 VLVPFTLAGGLKEEWKSAHIIVPEVIGWVVVLPLYMLWEMKYSRHPLTPWDLIKDRGXXX 357
           +LVP TLAGG+  +W + HII P ++G+V++ P ++ WE K++R P+ P+ L++DRG   
Sbjct: 310 ILVPLTLAGGISNKWNNPHIIAPFILGFVLI-PFFIAWESKWAREPIAPFKLLRDRGIWA 368

Query: 358 XXXXXXXXXXXWYMQGDYMYTVLVVAVHESIKSATRITSLYSFVSVIVGTILGFILIKVR 417
                      + M   Y+YT+L+VAV+ES+ SATRI+S+ +F S +        + +  
Sbjct: 369 ALCIAFLINFIFTMAAGYLYTILMVAVNESVTSATRISSVSTFTSTVFSPFFALFITRFT 428

Query: 418 RTKPFIIFGISCWIVSFGLLVHYRGDSGAHSGIIGSLCLLGFGAGSFTYVTQASIQASAK 477
           R KPFII G S W+V+ G+L H+R    +  GIIG+L + G G   FTY    S+Q S  
Sbjct: 429 RLKPFIIAGCSLWMVAMGILFHFRSGQNSDKGIIGALVVWGLGTTMFTYPVTVSLQ-SVT 487

Query: 478 THARMAVVTSLYLATYNIXXXXXXXXXXXXWTNILPKEISKRIS-DPTLAAQAYSAPFTF 536
           +H  MA VT+L    Y I            WT +L K++ + +  D TLAA  Y +P T+
Sbjct: 488 SHENMATVTALSYTMYRIGSAVGSAVSGAIWTQLLYKQLLQHLDGDATLAASFYGSPLTY 547

Query: 537 ITTYTWGTPERIALVMSYRYVQKILCIIGLVFCFPLLGCAFMLRNHELTDSIALEGNDHL 596
           I  Y WGTP R  +V +YRYVQK   ++ LVF  PL   +  LR+  LT+ +A   ++++
Sbjct: 548 IAQYPWGTPVRDGVVQAYRYVQKYEVLVALVFTAPLFVFSLCLRDPPLTNEVA---HENI 604

Query: 597 KSKDSFETEEKQESFLKSMIFTRFTRSEDKRN 628
           K  +  + E+     + + I  +++R   K +
Sbjct: 605 KQGEYVDVEDDDP--VANWIHDKWSRIRRKSD 634

>SAKL0F00792g Chr6 (70444..72297) [1854 bp, 617 aa] {ON} similar to
           uniprot|P38731 Saccharomyces cerevisiae YHL040C ARN1
           Transporter member of the ARN family of transporters
           that specifically recognize siderophore-iron chelates
           responsible for uptake of iron bound to ferrirubin
           ferrirhodin and related siderophores
          Length = 617

 Score =  455 bits (1171), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 253/555 (45%), Positives = 345/555 (62%), Gaps = 19/555 (3%)

Query: 58  EIYAEMYSRPLYRVALFFSLFLIAYAYGLDGNIRYTFQAYATSSYSQHSLLSTVNCIKTV 117
           EI A  Y    YRV L FS F+  + YGLD NIRY +  YATSSY+QHSLLSTV  I  +
Sbjct: 51  EILAAQYDSWYYRVILLFSAFICGFGYGLDSNIRYIYTGYATSSYAQHSLLSTVAIINNL 110

Query: 118 IAAVGQIFFARLSDIFGRFSIMIVSVIFYSVGTIIESQAVNITRFAVGGCFYQLGLTGII 177
           ++A  QIF+ARLSD+FGR S+ +VS++FY +GTII+SQA ++ ++A G  FY +G  G+ 
Sbjct: 111 LSAASQIFYARLSDVFGRLSLFVVSMVFYVIGTIIQSQAYDVQKYAAGAVFYNIGYVGLF 170

Query: 178 LILEVIASDFSNLNWRLLALFIPALPFIINTWISGDVTSAIG--TNWKWGIGMWAFILPL 235
           LIL +I SD S+L WRL   + P  PFII TWISG++ S      NW WGIGMWAFI PL
Sbjct: 171 LILVLILSDCSSLKWRLFYQYAPTWPFIIITWISGNIISRANPIENWSWGIGMWAFIFPL 230

Query: 236 ACIPLGICMLHMRYLARKHAKDRLKPEFEALNKLK--WKSFCIDIA----FWKLDIIGML 289
            C+P+  CMLHMR+ ARK       PE++ L+  K  +++  I  A    FWKLD++G+ 
Sbjct: 231 TCLPILFCMLHMRFKARK------TPEWQDLSSQKSFFQTHGIVQALVQLFWKLDVVGIF 284

Query: 290 LITVFFGCVLVPFTLAGGLKEEWKSAHIIVPEVIGWVVVLPLYMLWEMKYSRHPLTPWDL 349
           ++T+  GC+LVP TLAGG   +W+++ II P V+G+V+V P+++ WE K+++ PL P++L
Sbjct: 285 IMTISLGCILVPLTLAGGSSSKWQNSEIIGPLVLGFVLV-PVFIYWESKWAKDPLAPFEL 343

Query: 350 IKDRGXXXXXXXXXXXXXXWYMQGDYMYTVLVVAVHESIKSATRITSLYSFVSVIVGTIL 409
           +KDRG              + M   Y+Y VL+VAV ES KSATRITSL SFVS +    +
Sbjct: 344 LKDRGIWASMCFNFLMDFVYCMAAGYLYPVLIVAVDESTKSATRITSLASFVSTVASPFM 403

Query: 410 GFILIKVRRTKPFIIFGISCWIVSFGLLVHYRGDSGAHSGIIGSLCLLGFGAGSFTYVTQ 469
           G+ + +  R KP+I+ G   W ++ GLL HYR    +HSGIIG L LLG G     Y   
Sbjct: 404 GYAVSRSTRLKPYIVSGCGMWFLATGLLYHYRSGLESHSGIIGGLVLLGLGCTLSIYPIN 463

Query: 470 ASIQASAKTHARMAVVTSLYLATYNIXXXXXXXXXXXXWTNILPKEISKRISDPTLAAQA 529
            S Q S  +H  MA VT+L    Y I            WT  L  ++ KR+ D TLA  A
Sbjct: 464 VSAQ-SLTSHENMASVTALNYTVYRIGGAVGVAVSGAIWTQTLYNDLLKRLGDATLAMSA 522

Query: 530 YSAPFTFITTYTWGTPERIALVMSYRYVQKILCIIGLVFCFPLLGCAFMLRNHELTDSIA 589
           YSAP++F+ TY W TP R A+V +YR VQ++  +I L+F  PLL  +  LR+  LTD + 
Sbjct: 523 YSAPYSFVLTYGWDTPVRQAVVEAYREVQRLEVLIALIFTAPLLLSSLFLRDPPLTDQV- 581

Query: 590 LEGNDHLKSKDSFET 604
             G +++K  +   T
Sbjct: 582 --GQENIKDGEYVAT 594

>Kwal_56.22298 s56 (31819..33651) [1833 bp, 610 aa] {ON} YHL040C
           (ARN1) - Product of gene unknown [contig 187] FULL
          Length = 610

 Score =  454 bits (1167), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 254/602 (42%), Positives = 350/602 (58%), Gaps = 18/602 (2%)

Query: 12  EDFTEDVVPDILEKEVGAIVDVNPTLTTSSPAPSYIELIDPGVYNIEIYAEMYSRPLYRV 71
           E F  + + D  +  +G     +P     S     I          E+ A  Y R  + V
Sbjct: 6   EGFNVETLADEEKNNLGVSQHNDPIKKLQSTKSLNIR-------KTELMASCYDRWYHHV 58

Query: 72  ALFFSLFLIAYAYGLDGNIRYTFQAYATSSYSQHSLLSTVNCIKTVIAAVGQIFFARLSD 131
            L F+ FL  Y YGLDGNIR  + +YA +SY+ H L+ST++ +  V++A  QIFFARLSD
Sbjct: 59  FLLFAAFLCGYGYGLDGNIRSVYTSYAAASYAAHPLISTLSVVTGVMSAASQIFFARLSD 118

Query: 132 IFGRFSIMIVSVIFYSVGTIIESQAVNITRFAVGGCFYQLGLTGIILILEVIASDFSNLN 191
           +FGR S+ + ++ FY VGTII+SQA +I R+AVG  F+ +G  GI+L+L +I SDFS+L 
Sbjct: 119 VFGRLSLFVTAIAFYVVGTIIQSQAYDIQRYAVGSVFWSIGYVGILLMLILIVSDFSSLR 178

Query: 192 WRLLALFIPALPFIINTWISGDVT--SAIGTNWKWGIGMWAFILPLACIPLGICMLHMRY 249
           WRLL  F P+ P IINTWI+G +T  S     W W IGMWAFI+PL C+P+ +CMLHMR+
Sbjct: 179 WRLLYQFAPSWPGIINTWIAGTITARSNPQEKWSWNIGMWAFIIPLTCLPMILCMLHMRF 238

Query: 250 LARKHAK-DRLKPEFEALNKLKWKSFCIDIAFWKLDIIGMLLITVFFGCVLVPFTLAGGL 308
            AR+  +   L+ E             I++ FWK+D++G+LL+T   GCVL P TLAGG 
Sbjct: 239 KARRTEQWAELRNERSYYQTHGLIKTLIEL-FWKVDVVGILLMTASIGCVLAPLTLAGGT 297

Query: 309 KEEWKSAHIIVPEVIGWVVVLPLYMLWEMKYSRHPLTPWDLIKDRGXXXXXXXXXXXXXX 368
             +W++  +I P V+G+ V+LP++++WE K++R P+ P+DLIKDR               
Sbjct: 298 GSKWQNPRVISPFVLGF-VLLPIFLIWEKKWARDPIIPYDLIKDRAVWASLNSQFLIGFI 356

Query: 369 WYMQGDYMYTVLVVAVHESIKSATRITSLYSFVSVIVGTILGFILIKVRRTKPFIIFGIS 428
           + M   Y+Y +L+V V+ESIKSAT IT L SFV+          + +  R K +I+ G  
Sbjct: 357 YMMAAGYIYNILIVGVNESIKSATTITILSSFVATAASPPFCLWITRCTRMKGYIVAGCG 416

Query: 429 CWIVSFGLLVHYRGDSGAHSGIIGSLCLLGFGAGSFTYVTQASIQASAKTHARMAVVTSL 488
            W+++ GL  HYRG   AH GI+ ++ + G G     Y    S+Q SA +H  MA+VT+L
Sbjct: 417 LWMLAMGLFYHYRGGEFAHGGIVAAMVVWGLGDVLLIYPITVSVQ-SATSHDNMAMVTAL 475

Query: 489 YLATYNIXXXXXXXXXXXXWTNILPKEISKRISDPTLAAQAYSAPFTFITTYTWGTPERI 548
              TY I            WT  L KE+ KR+ D TLA  AYS PF FITTYTWGTPER 
Sbjct: 476 NYTTYRIGLSTGSAISGAIWTQTLYKELFKRLGDATLAVSAYSDPFKFITTYTWGTPERE 535

Query: 549 ALVMSYRYVQKILCIIGLVFCFPLLGCAFMLRNHELTDSIALEGNDHLKSKDSFETEEKQ 608
           A+V +YR+VQ+   I+ LVF  PLL     LR+  LTD +A     H   KD     +  
Sbjct: 536 AVVQAYRHVQRYETIVALVFTVPLLIFVLFLRDPPLTDEVA-----HGSIKDGEYVAKDH 590

Query: 609 ES 610
           E 
Sbjct: 591 ED 592

>KLTH0D18150g Chr4 complement(1502817..1504640) [1824 bp, 607 aa]
           {ON} similar to uniprot|P38731 Saccharomyces cerevisiae
           YHL040C ARN1 Transporter member of the ARN family of
           transporters that specifically recognize
           siderophore-iron chelates responsible for uptake of iron
           bound to ferrirubin ferrirhodin and related siderophores
          Length = 607

 Score =  453 bits (1165), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 247/596 (41%), Positives = 351/596 (58%), Gaps = 24/596 (4%)

Query: 2   DPATANHALPEDFTEDVVPDILEKEVGAIVDVNPTLTTSSPAPSYIELIDPGVYNIEIYA 61
           D A++ HA   D   +V  D+ +   G  +    +L                +   EI A
Sbjct: 4   DNASSAHA---DLKNEVYVDVEKVTPGCTLKTTKSLV---------------IRKTEIMA 45

Query: 62  EMYSRPLYRVALFFSLFLIAYAYGLDGNIRYTFQAYATSSYSQHSLLSTVNCIKTVIAAV 121
             Y R  +   + FS F+  Y YGLDG++RY + +YA SSYS H L+ST+  +  +I+A 
Sbjct: 46  AQYDRWYHHAIILFSAFICGYGYGLDGSVRYVYTSYAVSSYSDHPLISTITVVTAIISAA 105

Query: 122 GQIFFARLSDIFGRFSIMIVSVIFYSVGTIIESQAVNITRFAVGGCFYQLGLTGIILILE 181
            QI FARLSD+FGR S+ I +++FY+VGTII+SQA ++ ++A G  F+  G  G++LIL 
Sbjct: 106 SQIVFARLSDVFGRLSLFITALLFYAVGTIIQSQATDVQKYAAGAIFWSTGYVGLLLILI 165

Query: 182 VIASDFSNLNWRLLALFIPALPFIINTWISGDVTSAIG--TNWKWGIGMWAFILPLACIP 239
           +I SDFS+L WRL+  F P+ P+IINTW +G VT+      +W W I MWAFI+PL+ +P
Sbjct: 166 LILSDFSSLRWRLVYQFAPSWPYIINTWFAGTVTARANPQEHWSWDIAMWAFIVPLSALP 225

Query: 240 LGICMLHMRYLARKHAK-DRLKPEFEALNKLKWKSFCIDIAFWKLDIIGMLLITVFFGCV 298
           +  CMLHMR+ ARK  +   +K E             +++ FWKLDI+G+LL+T+  GC+
Sbjct: 226 MIFCMLHMRFKARKTEQWAAIKDEKSFFQSHGLIRTLVEL-FWKLDIVGVLLMTISVGCI 284

Query: 299 LVPFTLAGGLKEEWKSAHIIVPEVIGWVVVLPLYMLWEMKYSRHPLTPWDLIKDRGXXXX 358
           L P TLAGG+K +W + H+I P V+G+ V+LPL+M+WE K +++P+ P+ LIKDR     
Sbjct: 285 LAPLTLAGGVKSKWSNPHLIGPLVLGF-VLLPLFMIWESKAAKYPVVPYGLIKDRAVWGA 343

Query: 359 XXXXXXXXXXWYMQGDYMYTVLVVAVHESIKSATRITSLYSFVSVIVGTILGFILIKVRR 418
                     +     Y+YT+L+VAV+ES+KSAT I+SL SFVS +  T     + +  +
Sbjct: 344 LGCQFLIGFIYNAVAGYIYTILIVAVNESVKSATVISSLSSFVSTVASTFFSLYITRCTK 403

Query: 419 TKPFIIFGISCWIVSFGLLVHYRGDSGAHSGIIGSLCLLGFGAGSFTYVTQASIQASAKT 478
            K +II G   W+++ GL  HYRG   AHSGI+G++ + G G     Y T  S+Q SA +
Sbjct: 404 LKGYIIGGCGIWMLAMGLFYHYRGGEFAHSGIVGAMVIWGLGDTLLIYPTTISVQ-SATS 462

Query: 479 HARMAVVTSLYLATYNIXXXXXXXXXXXXWTNILPKEISKRISDPTLAAQAYSAPFTFIT 538
           H  MA VT+L    Y I            W+  L K +  R+     A+ AYS PF FI 
Sbjct: 463 HDNMATVTALNYTLYRIGLATGAAVSGAIWSQTLYKALLSRLQSVEQASAAYSTPFEFIL 522

Query: 539 TYTWGTPERIALVMSYRYVQKILCIIGLVFCFPLLGCAFMLRNHELTDSIALEGND 594
           TYTWGTPER A+V +YR+VQ+   I+ LVF  PLL     LR+  LTD +A E  D
Sbjct: 523 TYTWGTPERNAMVDAYRHVQRYESIVALVFTVPLLFFGLCLRDPPLTDKVAQEDID 578

>TDEL0H00130 Chr8 complement(10267..12132) [1866 bp, 621 aa] {ON} 
          Length = 621

 Score =  448 bits (1153), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 240/545 (44%), Positives = 336/545 (61%), Gaps = 16/545 (2%)

Query: 58  EIYAEMYSRPLYRVALFFSLFLIAYAYGLDGNIRYTFQAYATSSYSQHSLLSTVNCIKTV 117
           E+ A+ Y     +    FS FL ++ YGLDGNIR  +  YA +SYS HSL+STV  I  V
Sbjct: 58  ELMAKQYDTWFLKSLFLFSAFLCSFGYGLDGNIRGIYMTYAMNSYSTHSLISTVGVISMV 117

Query: 118 IAAVGQIFFARLSDIFGRFSIMIVSVIFYSVGTIIESQAVNITRFAVGGCFYQLGLTGII 177
           I+AV Q+ +A LSD+FGR S+ IVS++FY VGTII+SQA ++ R+A G  FY +GL G++
Sbjct: 118 ISAVAQVIYAGLSDVFGRLSLFIVSIVFYVVGTIIQSQAYDVQRYAAGSVFYSVGLVGVM 177

Query: 178 LILEVIASDFSNLNWRLLALFIPALPFIINTWISGDV--TSAIGTNWKWGIGMWAFILPL 235
           L + ++ SD S+L WRL   F+PA P II TW+SG+V  T+    NW W I MWAFI PL
Sbjct: 178 LQVILVLSDNSSLKWRLFYTFVPAWPSIITTWVSGNVIETANPEDNWSWNIAMWAFIFPL 237

Query: 236 ACIPLGICMLHMRYLARKHAKDRLKPEFEALN--KLKWKSF----CIDIAFWKLDIIGML 289
           +CIPL  CMLHMR+      K R +PE++ L   K  ++S      +   FWKLD++G++
Sbjct: 238 SCIPLIACMLHMRW------KVRNEPEWKELQTEKTYYQSHGLIQTVVQLFWKLDVVGII 291

Query: 290 LITVFFGCVLVPFTLAGGLKEEWKSAHIIVPEVIGWVVVLPLYMLWEMKYSRHPLTPWDL 349
           L+TV  GC+LVP TLAGG+  +W+SA +I P V+G+V++  +++ WE K +  P+ P+ +
Sbjct: 292 LLTVGTGCILVPLTLAGGVSTQWQSAKLIAPFVLGFVLI-AIFIYWESKLALAPIAPFKM 350

Query: 350 IKDRGXXXXXXXXXXXXXXWYMQGDYMYTVLVVAVHESIKSATRITSLYSFVSVIVGTIL 409
           +KDRG              + M   Y+YT+L+VAV E+  SATRITSLYSFVS I   +L
Sbjct: 351 LKDRGIWAPLWIMFLIAFVYQMAAGYLYTILMVAVDETDLSATRITSLYSFVSAIFAPVL 410

Query: 410 GFILIKVRRTKPFIIFGISCWIVSFGLLVHYRGDSGAHSGIIGSLCLLGFGAGSFTYVTQ 469
           GFI+ +  R KP+++ G S + V+ GL   YR    AH G+IG++ + G  +  F Y   
Sbjct: 411 GFIVARSSRLKPYMVLGCSLYFVTMGLFYRYRVGKDAHQGVIGAMVVWGICSCLFDYPVT 470

Query: 470 ASIQASAKTHARMAVVTSLYLATYNIXXXXXXXXXXXXWTNILPKEISKRISDPTLAAQA 529
            SIQ S  +H  MA VT+L    ++I            WT +L  ++ + I D  LA  A
Sbjct: 471 VSIQ-SVTSHENMATVTALSYTIFSIGGAVAASVSGAIWTQLLYPKLLEYIGDADLAEAA 529

Query: 530 YSAPFTFITTYTWGTPERIALVMSYRYVQKILCIIGLVFCFPLLGCAFMLRNHELTDSIA 589
           YS+P TF   Y WGTP R A+V +Y++VQK   +I LVF  P+    F LR+  LTD +A
Sbjct: 530 YSSPLTFYLDYPWGTPIRDAMVEAYKHVQKYEVLIALVFTAPMFILTFCLRDPSLTDDVA 589

Query: 590 LEGND 594
            + ND
Sbjct: 590 QKLND 594

>KLLA0C00220g Chr3 (13632..15506) [1875 bp, 624 aa] {ON} similar to
           uniprot|P38724 Saccharomyces cerevisiae YHL047C ARN2
           Transporter member of the ARN family of transporters
           that specifically recognize siderophore-iron chelates
           responsible for uptake of iron bound to the siderophore
           triacetylfusarinine C
          Length = 624

 Score =  435 bits (1118), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 229/566 (40%), Positives = 341/566 (60%), Gaps = 18/566 (3%)

Query: 58  EIYAEMYSRPLYRVALFFSLFLIAYAYGLDGNIRYTFQAYATSSYSQHSLLSTVNCIKTV 117
           EI A  Y+    +V      FL AY Y LD +IRY +  YAT+SY+ HSLLST++ I  +
Sbjct: 61  EIMASQYNTWYSQVLFLSCAFLCAYGYSLDSSIRYVYMTYATNSYNTHSLLSTISIINMM 120

Query: 118 IAAVGQIFFARLSDIFGRFSIMIVSVIFYSVGTIIESQAVNITRFAVGGCFYQLGLTGII 177
           I+AV Q+FFA LSD+FGR  +MIV+++FY VGT+I+SQA +I R+A G  FY +G+ G++
Sbjct: 121 ISAVAQLFFAGLSDVFGRLRLMIVAILFYVVGTVIQSQAYDIQRYAAGSVFYNIGVVGVM 180

Query: 178 LILEVIASDFSNLNWRLLALFIPALPFIINTWISGDVTSAIG--TNWKWGIGMWAFILPL 235
           L + +  +D S+L WRLL  F+PA P IIN W+SG++  A     NW W I MWAFILPL
Sbjct: 181 LQVSLFLADNSSLKWRLLYSFVPAWPAIINMWVSGNIVKAANPLVNWSWNIAMWAFILPL 240

Query: 236 ACIPLGICMLHMRYLARKHAK-DRLKPEFEALNKLKWKSFCIDIAFWKLDIIGMLLITVF 294
           +C+PL  C++HMR+ A K  +   L+ E     K  +    +++ FWK+DI+G+LL+T  
Sbjct: 241 SCVPLLCCVVHMRWKASKTPEWQELESELTFYQKHGFVHTIVEV-FWKVDIVGLLLLTAS 299

Query: 295 FGCVLVPFTLAGGLKEEWKSAHIIVPEVIGWVVVLPLYMLWEMKYSRHPLTPWDLIKDRG 354
            GC+LVP T+AGG+ E+W +  II P V+G V ++PL + WE  +++ P  P+ L+KDRG
Sbjct: 300 MGCILVPLTIAGGISEQWNNGKIIGPLVLG-VFLVPLTIYWESNWAKVPFAPFLLLKDRG 358

Query: 355 XXXXXXXXXXXXXXWYMQGDYMYTVLVVAVHESIKSATRITSLYSFVSVIVGTILGFILI 414
                         + M   Y+YT+L+V+++++  SATRI +LYSFV+ I   I GF++ 
Sbjct: 359 IWAPMSIMFLVCFIYQMAAGYLYTILLVSMNQTELSATRIMNLYSFVAGIYSPIFGFVVA 418

Query: 415 KVRRTKPFIIFGISCWIVSFGLLVHYRGDSGAHSGIIGSLCLLGFGAGSFTYVTQASIQA 474
           +  R K F++ G   + +  GL   YRG  GA SGIIG++ + G  +  +TY    S Q 
Sbjct: 419 RTGRLKSFMLVGCCLYFLVMGLFYRYRGGLGAESGIIGAMVVWGIASCMYTYPVTTSAQ- 477

Query: 475 SAKTHARMAVVTSLYLATYNIXXXXXXXXXXXXWTNILPKEISKRISDPTLAAQAYSAPF 534
           S  +H  MA VT++ L  + I            WTN+L  ++ + + D  LA+ AY+AP 
Sbjct: 478 SVTSHENMATVTAMLLTIFRIGGAVGASVSGAIWTNLLYPKLLQNLGDVELASAAYTAPL 537

Query: 535 TFITTYTWGTPERIALVMSYRYVQKILCIIGLVFCFPLLGCAFMLRNHELTDS------- 587
           TFI ++ W T  R A++ +YR+VQK   ++GL+F  P+L   F LR+ ELTD        
Sbjct: 538 TFIVSHPWNTEVRTAMIDAYRHVQKYEVLVGLIFVAPMLVLTFCLRDPELTDDYGQKLAE 597

Query: 588 ---IALEGNDHLKS--KDSFETEEKQ 608
              +  EG D +     D F+  +++
Sbjct: 598 GQCVQTEGEDPIAEWFSDRFKKLKRR 623

>Kwal_23.2794 s23 (15194..17053) [1860 bp, 619 aa] {ON} YHL047C
           (ARN2) - Triacetylfusarinine C transporter [contig 246]
           FULL
          Length = 619

 Score =  434 bits (1115), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 231/565 (40%), Positives = 330/565 (58%), Gaps = 15/565 (2%)

Query: 58  EIYAEMYSRPLYRVALFFSLFLIAYAYGLDGNIRYTFQAYATSSYSQHSLLSTVNCIKTV 117
           E+ A+ Y     +     + F+ ++AYGLD  IR  +  YA   Y++HSLLSTVN +  +
Sbjct: 57  ELMAKQYDSWFSKSVFLLAAFICSFAYGLDSIIRDIYMTYAMDDYAEHSLLSTVNVVSLM 116

Query: 118 IAAVGQIFFARLSDIFGRFSIMIVSVIFYSVGTIIESQAVNITRFAVGGCFYQLGLTGII 177
           I+AVGQIFFA LSD+FGR S+ +V++IFY VGTII+SQA ++ R+  G  FY +GL G I
Sbjct: 117 ISAVGQIFFAGLSDVFGRLSLFVVAIIFYVVGTIIQSQAYDVGRYVAGSIFYNIGLVGAI 176

Query: 178 LILEVIASDFSNLNWRLLALFIPALPFIINTWISGDV--TSAIGTNWKWGIGMWAFILPL 235
             + +I SD S+L WRL   F+PA P  +  WISG+V   +    NW WGIGMW FI P 
Sbjct: 177 FQVTIILSDCSSLKWRLFYNFVPAWPAFVTVWISGNVIHIANPSENWSWGIGMWGFIFPA 236

Query: 236 ACIPLGICMLHMRYLARKHAKDRLKPEFEALNKLKWKSFCIDIAFWKLDIIGMLLITVFF 295
           +C+PL  CMLHMR+  +   + +   E ++  +       +   FWKLD+ G+LL+T   
Sbjct: 237 SCLPLIACMLHMRWKVKNDREWKELQEEKSYFQTHGVVQSLVQLFWKLDVAGVLLLTACT 296

Query: 296 GCVLVPFTLAGGLKEEWKSAHIIVPEVIGWVVVLPLYMLWEMKYSRHPLTPWDLIKDRGX 355
           GC+LVP T+AGG+  +W+SA +I P V+G+ +V P+++ WE + +  PL P+ ++KDRG 
Sbjct: 297 GCILVPLTIAGGVSAQWRSAKVIAPFVLGFALV-PVFLYWESRIALVPLAPFKMLKDRGI 355

Query: 356 XXXXXXXXXXXXXWYMQGDYMYTVLVVAVHESIKSATRITSLYSFVSVIVGTILGFILIK 415
                        + M   Y+YTVL+VA +ES  SATRITSLYSFV+ I   ILG ++ +
Sbjct: 356 WAPLAIMFLICFIYQMAAGYLYTVLLVAANESDLSATRITSLYSFVAAIFSPILGVLVAR 415

Query: 416 VRRTKPFIIFGISCWIVSFGLLVHYRGDSGAHSGIIGSLCLLGFGAGSFTYVTQASIQAS 475
             R KP+ + G S + V+ GL  HYRG   A  GIIG++ + G  +  + Y    S+Q +
Sbjct: 416 STRLKPYTLVGCSLYFVTMGLFYHYRGGEDAGKGIIGAMVVWGISSCLYDYPISISMQ-T 474

Query: 476 AKTHARMAVVTSLYLATYNIXXXXXXXXXXXXWTNILPKEISKRISDPTLAAQAYSAPFT 535
             +H  MA VT+L L  + I            WT  L  ++ K + DP +AA+AY  P T
Sbjct: 475 VTSHEMMATVTALNLTIFRIGGAVGAAVSGAIWTQALYPKLLKLLGDPEMAAKAYDEPLT 534

Query: 536 FITTYTWGTPERIALVMSYRYVQKILCIIGLVFCFPLLGCAFMLRNHELTDSIA--LEGN 593
           FI  Y WGT  R A V +YRYVQK   ++GL+F  P+    F LR+  LT+     LE +
Sbjct: 535 FIPDYEWGTSVRDATVEAYRYVQKYEVLVGLIFVAPMFVLTFFLRDPSLTEEYGQNLEDD 594

Query: 594 DHLKSKDS---------FETEEKQE 609
           +++K  D          F   +KQE
Sbjct: 595 EYVKENDDPINDWIMERFSRLKKQE 619

>KLTH0A07964g Chr1 complement(670591..672450) [1860 bp, 619 aa] {ON}
           similar to uniprot|P38724 Saccharomyces cerevisiae
           YHL047C ARN2 Transporter member of the ARN family of
           transporters that specifically recognize
           siderophore-iron chelates responsible for uptake of iron
           bound to the siderophore triacetylfusarinine C
          Length = 619

 Score =  429 bits (1102), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 220/548 (40%), Positives = 325/548 (59%), Gaps = 6/548 (1%)

Query: 58  EIYAEMYSRPLYRVALFFSLFLIAYAYGLDGNIRYTFQAYATSSYSQHSLLSTVNCIKTV 117
           E+ A+ Y     +    F++F+ ++AYGLD  IR  +  YA ++Y  HSLLSTVN I  V
Sbjct: 57  ELMAKQYDSWFLKSLFLFTVFICSFAYGLDSIIRDIYMTYAMNAYETHSLLSTVNVISMV 116

Query: 118 IAAVGQIFFARLSDIFGRFSIMIVSVIFYSVGTIIESQAVNITRFAVGGCFYQLGLTGII 177
           I+AVGQIFFARLSD+FGR S+ IVS++ Y VGT+I+SQA ++ R+A G  FY +GL G +
Sbjct: 117 ISAVGQIFFARLSDVFGRLSLFIVSIVLYVVGTVIQSQAYDVQRYAAGSVFYNVGLVGAM 176

Query: 178 LILEVIASDFSNLNWRLLALFIPALPFIINTWISGDVTSAIG--TNWKWGIGMWAFILPL 235
             + +I SD S L WRL   F+PA P II  WISG+V        NW WGI MWAFI P+
Sbjct: 177 FQVTLILSDCSTLKWRLFYNFVPAWPAIITVWISGNVVHVANPLENWSWGIAMWAFIFPV 236

Query: 236 ACIPLGICMLHMRYLARKHAKDRLKPEFEALNKLKWKSFCIDIAFWKLDIIGMLLITVFF 295
           +CIP   C+LHMR+  R   + R   E ++  +           FW+LD++G++L++VF 
Sbjct: 237 SCIPFIACILHMRWKVRNSHEWRELQEEKSFYQTHGLVQTFVQLFWRLDVVGVILLSVFT 296

Query: 296 GCVLVPFTLAGGLKEEWKSAHIIVPEVIGWVVVLPLYMLWEMKYSRHPLTPWDLIKDRGX 355
           GC+ VP T+AGG+  EW+S  +I P V+G+ ++ P ++ WE + +R PL P+ ++KDRG 
Sbjct: 297 GCICVPLTVAGGVSTEWRSGKVIAPFVLGFSLI-PAFVYWESRLARFPLAPFLMLKDRGI 355

Query: 356 XXXXXXXXXXXXXWYMQGDYMYTVLVVAVHESIKSATRITSLYSFVSVIVGTILGFILIK 415
                        + M  +Y+YT+L+VA +ES  SA RITSLYSFV+ I   I+G ++ +
Sbjct: 356 WAPLWIYFLIAFIYEMAAEYLYTILLVAANESDLSAIRITSLYSFVAAIFSPIVGLLVAR 415

Query: 416 VRRTKPFIIFGISCWIVSFGLLVHYRGDSGAHSGIIGSLCLLGFGAGSFTYVTQASIQAS 475
             R KP+ + G S + V+ GL  HYRG + A  G+IG++ + G  +  + Y    SIQ +
Sbjct: 416 SSRLKPYTVVGCSLYFVTMGLFYHYRGGNDAGKGVIGAMVVWGITSCLYDYPISVSIQ-T 474

Query: 476 AKTHARMAVVTSLYLATYNIXXXXXXXXXXXXWTNILPKEISKRISDPTLAAQAYSAPFT 535
             +H  +A V++L    + I            WT  L  ++ K + D  +A  A+++P  
Sbjct: 475 VTSHENLANVSALSSTIFRIGGAVGAAVSGAIWTQTLYPKLLKALGDAGMAEAAFNSPLD 534

Query: 536 FITTYTWGTPERIALVMSYRYVQKILCIIGLVFCFPLLGCAFMLRNHELTDSIA--LEGN 593
           FIT Y WGTP R A V +++YVQK   ++GL+F  P+    F LR+  L +     L G 
Sbjct: 535 FITDYDWGTPVREATVEAFQYVQKYEVLVGLIFVVPMFVMTFFLRDPPLNEEFGQNLNGE 594

Query: 594 DHLKSKDS 601
           +++K  D 
Sbjct: 595 EYVKENDD 602

>Kwal_34.15711 s34 (21213..23069) [1857 bp, 618 aa] {ON} YHL047C
           (ARN2) - 1:1 [contig 275] FULL
          Length = 618

 Score =  426 bits (1095), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 233/603 (38%), Positives = 342/603 (56%), Gaps = 20/603 (3%)

Query: 7   NHALPEDFTE-DVVPDILEKEVGAIVDVNPTLTTSSPAPSYIELIDPGVYNIEIYAEMYS 65
           + AL +D +E D   ++ EK+          LT        I      +   E+ A  Y 
Sbjct: 10  SSALQDDHSEIDGKTNVAEKQCDKDATHQHGLTDKLQMTKRIV-----IRKTELMANQYD 64

Query: 66  RPLYRVALFFSLFLIAYAYGLDGNIRYTFQAYATSSYSQHSLLSTVNCIKTVIAAVGQIF 125
               +    FS F+ A++YGLD  IR  +  YA +SYS HSLLSTV+ I   I+AV QIF
Sbjct: 65  NWFLKSLFLFSAFICAFSYGLDSIIRNIYMTYAMNSYSTHSLLSTVSVISLTISAVAQIF 124

Query: 126 FARLSDIFGRFSIMIVSVIFYSVGTIIESQAVNITRFAVGGCFYQLGLTGIILILEVIAS 185
           FA LSD+FGR S+ IV+++FY VGTII+SQA ++ R+A G  FY +GL G +  + +I S
Sbjct: 125 FAGLSDVFGRLSMFIVAIMFYVVGTIIQSQAYDVQRYAAGSIFYYIGLVGSMFEITLILS 184

Query: 186 DFSNLNWRLLALFIPALPFIINTWISGDVTSAIG--TNWKWGIGMWAFILPLACIPLGIC 243
           D S+L WRL   F+PA P ++  WISG+V S      NW WGI MWAFI P +C+P+  C
Sbjct: 185 DCSSLKWRLFYSFVPAWPALVTVWISGNVVSVANPLENWSWGIAMWAFIFPASCLPIIGC 244

Query: 244 MLHMRYLARKHAK----DRLKPEFEALNKLKWKSFCIDIAFWKLDIIGMLLITVFFGCVL 299
           +LHMR+  R + +       K  F+    ++     +   FWKLD++G+LL ++  GC+L
Sbjct: 245 LLHMRWKLRNNPEWIELQEEKTYFQTHGLVQ----TLKQLFWKLDVVGVLLFSISTGCIL 300

Query: 300 VPFTLAGGLKEEWKSAHIIVPEVIGWVVVLPLYMLWEMKYSRHPLTPWDLIKDRGXXXXX 359
           VP TLAGG   +W+SA +I P V+G+++V P+++ WE K +  PL P+ ++KDRG     
Sbjct: 301 VPLTLAGGASTQWRSAKVIAPFVLGFLLV-PVFIYWESKLALVPLAPFKMLKDRGIWAPL 359

Query: 360 XXXXXXXXXWYMQGDYMYTVLVVAVHESIKSATRITSLYSFVSVIVGTILGFILIKVRRT 419
                    + M   Y+YT+LVVA +ES  SATRITSLYSFV+ +   ++G  + +  R 
Sbjct: 360 VITFLICYIYMMAAGYLYTILVVAGNESPLSATRITSLYSFVAAVFSPVVGIFVARFTRL 419

Query: 420 KPFIIFGISCWIVSFGLLVHYRGDSGAHSGIIGSLCLLGFGAGSFTYVTQASIQASAKTH 479
           KPF +FG S + V+  L  H+RG +    G+IG++ + G  +  F Y    S+Q +  +H
Sbjct: 420 KPFAVFGCSLYFVTMALFYHFRGGTDTGKGVIGAMVIWGITSCFFNYPINISMQ-TVTSH 478

Query: 480 ARMAVVTSLYLATYNIXXXXXXXXXXXXWTNILPKEISKRISDPTLAAQAYSAPFTFITT 539
             MA VT+  L  + I            WT  L   + K + DP +A +AYS P +F+  
Sbjct: 479 ENMATVTAFGLTIFRIGGAVGAAVSGAIWTQSLYPRLLKTLGDPNMAIEAYSMPLSFVLK 538

Query: 540 YTWGTPERIALVMSYRYVQKILCIIGLVFCFPLLGCAFMLRNHELTDSIA--LEGNDHLK 597
           + WGT  R  +V +YRYVQ+   ++GL+F  P+    F LR+  LT+     L+ N++LK
Sbjct: 539 HEWGTSAREGMVEAYRYVQRYEVLVGLIFVAPMFLLTFFLRDPPLTEDYGQKLDDNEYLK 598

Query: 598 SKD 600
             D
Sbjct: 599 QDD 601

>SAKL0F00110g Chr6 (1456..3318) [1863 bp, 620 aa] {ON} similar to
           uniprot|P38724 Saccharomyces cerevisiae YHL047C ARN2
           Transporter member of the ARN family of transporters
           that specifically recognize siderophore-iron chelates
           responsible for uptake of iron bound to the siderophore
           triacetylfusarinine C
          Length = 620

 Score =  426 bits (1095), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 229/553 (41%), Positives = 328/553 (59%), Gaps = 18/553 (3%)

Query: 58  EIYAEMYSRPLYRVALFFSLFLIAYAYGLDGNIRYTFQAYATSSYSQHSLLSTVNCIKTV 117
           E+ A  Y   + +    FS F+ +++YGLD  IR  +  YA ++Y  HSLLSTVN I   
Sbjct: 59  ELMANQYDNWVLKSLFLFSAFICSFSYGLDSIIRNIYMTYAMNNYETHSLLSTVNVISMT 118

Query: 118 IAAVGQIFFARLSDIFGRFSIMIVSVIFYSVGTIIESQAVNITRFAVGGCFYQLGLTGII 177
           I+AV QIFFA LSD+FGR SI IV+++FY VGTII+SQA ++ R+A G  FY +GL G +
Sbjct: 119 ISAVAQIFFAGLSDVFGRLSIFIVTIVFYVVGTIIQSQAYDVQRYAAGSIFYNIGLVGAM 178

Query: 178 LILEVIASDFSNLNWRLLALFIPALPFIINTWISGDVTSAIG--TNWKWGIGMWAFILPL 235
             + ++ SD S+L WRL   F+PA P ++  WISGDV +      NW WGI MWAFI P 
Sbjct: 179 FQVTLMLSDSSSLKWRLFYNFVPAWPAVVTVWISGDVINVANPKQNWSWGIAMWAFIFPA 238

Query: 236 ACIPLGICMLHMRYLARKHAKDRLKPEFEALNKLK--WKSF----CIDIAFWKLDIIGML 289
            C+P+  C+LHMR+      K +  PE++ L + K  +++      +   FWKLD +G+L
Sbjct: 239 TCLPIIGCLLHMRW------KLKNDPEWKDLQEKKTYFQTHGLVQTLKQLFWKLDAVGVL 292

Query: 290 LITVFFGCVLVPFTLAGGLKEEWKSAHIIVPEVIGWVVVLPLYMLWEMKYSRHPLTPWDL 349
           L +V  GC+LVP T+AGG+  +W+SA II P V+G V+VL +++ WE K +  PL P+ +
Sbjct: 293 LFSVSTGCILVPLTIAGGVSTQWRSAKIIAPIVLGSVLVL-VFIYWESKLALVPLAPFKM 351

Query: 350 IKDRGXXXXXXXXXXXXXXWYMQGDYMYTVLVVAVHESIKSATRITSLYSFVSVIVGTIL 409
           +KDRG              + M  DY+YT+L+VA +ES  SATRITSLYSFV+ ++    
Sbjct: 352 LKDRGIWAPLLLMFLVCFVYVMPADYLYTILLVAGNESSLSATRITSLYSFVTAVLSAAA 411

Query: 410 GFILIKVRRTKPFIIFGISCWIVSFGLLVHYRGDSGAHSGIIGSLCLLGFGAGSFTYVTQ 469
           G ++ +  R KPF  FG + + V+  L   +RG      G+IG++ + G  +  F Y   
Sbjct: 412 GILVTRFPRLKPFAFFGCALYFVTMALFYCFRGGEDTGKGVIGAMVVWGVASCFFDYPIN 471

Query: 470 ASIQASAKTHARMAVVTSLYLATYNIXXXXXXXXXXXXWTNILPKEISKRISDPTLAAQA 529
            S+Q +  +H  MA VT+L LA + I            WT  L   + K + DP +A +A
Sbjct: 472 ISMQ-TVTSHENMATVTALGLAIFRIGGAVGAAVSGAIWTQTLYPRLLKTLGDPDMAIEA 530

Query: 530 YSAPFTFITTYTWGTPERIALVMSYRYVQKILCIIGLVFCFPLLGCAFMLRNHELTDSIA 589
           Y  P +F+  + WGTP R A+V SYRYVQK   ++GLVF  P+    F LR+  LT+   
Sbjct: 531 YDMPLSFMLEHEWGTPVREAMVDSYRYVQKYEVLVGLVFVAPMFLLTFCLRDPPLTEDYG 590

Query: 590 --LEGNDHLKSKD 600
             LE N+++K  D
Sbjct: 591 QRLEDNEYVKHDD 603

>SAKL0E00132g Chr5 (3269..5131) [1863 bp, 620 aa] {ON} similar to
           uniprot|P38724 Saccharomyces cerevisiae YHL047C ARN2
           Transporter member of the ARN family of transporters
           that specifically recognize siderophore-iron chelates
           responsible for uptake of iron bound to the siderophore
           triacetylfusarinine C
          Length = 620

 Score =  424 bits (1090), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 226/553 (40%), Positives = 325/553 (58%), Gaps = 18/553 (3%)

Query: 58  EIYAEMYSRPLYRVALFFSLFLIAYAYGLDGNIRYTFQAYATSSYSQHSLLSTVNCIKTV 117
           E+ A  Y     +    FS F+ A++YGLD  IR  +  YA + Y  HSLLSTV+ I   
Sbjct: 59  ELMANQYDNWFLKSLFLFSAFICAFSYGLDSIIRSVYMTYAMNDYQTHSLLSTVSVISLT 118

Query: 118 IAAVGQIFFARLSDIFGRFSIMIVSVIFYSVGTIIESQAVNITRFAVGGCFYQLGLTGII 177
           I+AV QIFFA LSD+FGR SI IV++ FY VGTII+SQA ++ R+A G  FY +GL G +
Sbjct: 119 ISAVAQIFFAGLSDVFGRLSIFIVAIAFYVVGTIIQSQAYDVQRYAAGSIFYNIGLVGAM 178

Query: 178 LILEVIASDFSNLNWRLLALFIPALPFIINTWISGDVTSAIG--TNWKWGIGMWAFILPL 235
             + ++ SD S+L WRL   F+PA P ++  WISG+V        NW WGI MWAFI P 
Sbjct: 179 FQVTLMLSDSSSLKWRLFYNFVPAWPALVTVWISGNVIHLANPKQNWSWGIAMWAFIFPA 238

Query: 236 ACIPLGICMLHMRYLARKHAKDRLKPEFEALNKLK--WKSF----CIDIAFWKLDIIGML 289
           AC+P+  C+LHMR+      K R  PE++ L + K  +++      +   FWKLD++G+L
Sbjct: 239 ACLPIIGCLLHMRW------KLRNDPEWKDLQEEKTYFQTHGLVQTLKQLFWKLDVVGVL 292

Query: 290 LITVFFGCVLVPFTLAGGLKEEWKSAHIIVPEVIGWVVVLPLYMLWEMKYSRHPLTPWDL 349
           L +V  GC+L+P T+AGG    W+SA +I P V+G V+V P ++ WE K +  PL P+ +
Sbjct: 293 LFSVSTGCILIPLTVAGGASTHWRSAKVIAPIVLGSVLV-PAFIYWESKLALVPLAPFKM 351

Query: 350 IKDRGXXXXXXXXXXXXXXWYMQGDYMYTVLVVAVHESIKSATRITSLYSFVSVIVGTIL 409
           +KDRG              + M   Y+YT+L+VA +ES  SATRITSLYSFV+ +   ++
Sbjct: 352 LKDRGIWAPLLITFLICFIYMMAAGYLYTILLVAGNESSLSATRITSLYSFVAAVFSPVV 411

Query: 410 GFILIKVRRTKPFIIFGISCWIVSFGLLVHYRGDSGAHSGIIGSLCLLGFGAGSFTYVTQ 469
           G  + +  R KPF +FG S + V+  L  H+RG      G+IG++ + G  +  F Y   
Sbjct: 412 GIFVARFSRLKPFAVFGCSLYFVTMALFYHFRGGVDTGKGVIGAMVIWGITSCFFNYPIN 471

Query: 470 ASIQASAKTHARMAVVTSLYLATYNIXXXXXXXXXXXXWTNILPKEISKRISDPTLAAQA 529
            S+Q +  +H  MA VT+L L  + I            WT  L   + K + DPT+A +A
Sbjct: 472 ISMQ-TVTSHENMATVTALGLTIFRIGGAVGAAVSGAIWTQTLYPRLLKALGDPTMATEA 530

Query: 530 YSAPFTFITTYTWGTPERIALVMSYRYVQKILCIIGLVFCFPLLGCAFMLRNHELTDSIA 589
           Y+ P +F+  + WGT  R A+V SYRYVQ+   ++GL+F  P+    F+LR+  LT+   
Sbjct: 531 YNMPLSFMLKHEWGTAARDAMVDSYRYVQRYEVLVGLIFVAPMFVLTFLLRDPPLTEDYG 590

Query: 590 --LEGNDHLKSKD 600
             LE N+++K  D
Sbjct: 591 QRLEDNEYVKHDD 603

>KLTH0D00110g Chr4 (796..2658) [1863 bp, 620 aa] {ON} similar to
           uniprot|P38724 Saccharomyces cerevisiae YHL047C ARN2
           Transporter member of the ARN family of transporters
           that specifically recognize siderophore-iron chelates
           responsible for uptake of iron bound to the siderophore
           triacetylfusarinine C
          Length = 620

 Score =  423 bits (1088), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 223/562 (39%), Positives = 328/562 (58%), Gaps = 8/562 (1%)

Query: 58  EIYAEMYSRPLYRVALFFSLFLIAYAYGLDGNIRYTFQAYATSSYSQHSLLSTVNCIKTV 117
           E+ A  Y   L +    FS F+ A++YGLD  IR  +  YA + Y  HSLLSTV+ I   
Sbjct: 59  ELMANQYDGWLLKSMFLFSAFICAFSYGLDSIIRSIYMTYAMNDYQTHSLLSTVSVISLT 118

Query: 118 IAAVGQIFFARLSDIFGRFSIMIVSVIFYSVGTIIESQAVNITRFAVGGCFYQLGLTGII 177
           I+AV QIFFA LSD+FGR S+ IV+++FY VGT+I+SQA ++ R+A G  FY +GL G +
Sbjct: 119 ISAVAQIFFAGLSDVFGRLSMFIVAIMFYVVGTVIQSQAYDVQRYAAGSIFYYIGLVGSM 178

Query: 178 LILEVIASDFSNLNWRLLALFIPALPFIINTWISGDVTSAIG--TNWKWGIGMWAFILPL 235
             + ++ SD S+L WRLL  F+PA P ++  WISG+V        NW WGI MWAFI P 
Sbjct: 179 FQVTLMLSDCSSLKWRLLYNFVPAWPALVTVWISGNVVHVANPEKNWSWGIAMWAFIFPA 238

Query: 236 ACIPLGICMLHMRYLARKHAKDRLKPEFEALNKLKWKSFCIDIAFWKLDIIGMLLITVFF 295
            C+P+  C+LHMR+  R +++ +   E +   +       +   FWKLD++G+LL +V  
Sbjct: 239 TCLPIIGCLLHMRWKLRNNSEWKELQEEKTYFQTHGLVQTLKQLFWKLDVVGVLLFSVST 298

Query: 296 GCVLVPFTLAGGLKEEWKSAHIIVPEVIGWVVVLPLYMLWEMKYSRHPLTPWDLIKDRGX 355
           GC+L+P T+AGG    W+SA +I P V+G ++V P ++ WE K +  PL P+ ++KDRG 
Sbjct: 299 GCILIPLTIAGGASTHWRSAKVIAPLVLGSLLV-PFFIYWESKLALVPLAPFKMLKDRGI 357

Query: 356 XXXXXXXXXXXXXWYMQGDYMYTVLVVAVHESIKSATRITSLYSFVSVIVGTILGFILIK 415
                        + M   Y+YT+L+VA +ES  SATRITSLYSFV+ +   ++G  + +
Sbjct: 358 WAPLLITFLICFIYMMAAGYLYTILLVAGNESSLSATRITSLYSFVAAVFSPVVGIFVAR 417

Query: 416 VRRTKPFIIFGISCWIVSFGLLVHYRGDSGAHSGIIGSLCLLGFGAGSFTYVTQASIQAS 475
             R KPF +FG S + V+  L  H+RG +    G+IG++ + G  +  F Y    S+Q +
Sbjct: 418 FSRLKPFAVFGCSLYFVTMALFYHFRGGTDTGKGVIGAMVVWGITSCFFNYPINISMQ-T 476

Query: 476 AKTHARMAVVTSLYLATYNIXXXXXXXXXXXXWTNILPKEISKRISDPTLAAQAYSAPFT 535
             +H  MA VT+  L  + I            WT  L   + K + DPTLA +AY+ P +
Sbjct: 477 VTSHENMATVTAFGLTIFRIGGAVGAAVSGAIWTQSLYPRLLKALGDPTLALEAYNMPLS 536

Query: 536 FITTYTWGTPERIALVMSYRYVQKILCIIGLVFCFPLLGCAFMLRNHELTDSIA--LEGN 593
           F+  + WGTP R A++ +YRYVQK   ++GL+F  P+    F LR+  LT+     LE +
Sbjct: 537 FMLKHEWGTPARDAMIEAYRYVQKYEVLVGLIFVAPMFLLTFFLRDPPLTEDYGQKLEDD 596

Query: 594 DHLKSKDSFET--EEKQESFLK 613
           +++K  D       E+  SF K
Sbjct: 597 EYVKHDDPITDWIAERFSSFKK 618

>KLTH0B10450g Chr2 complement(885429..887291) [1863 bp, 620 aa] {ON}
           similar to uniprot|P38724 Saccharomyces cerevisiae
           YHL047C ARN2 Transporter member of the ARN family of
           transporters that specifically recognize
           siderophore-iron chelates responsible for uptake of iron
           bound to the siderophore triacetylfusarinine C
          Length = 620

 Score =  423 bits (1088), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 223/562 (39%), Positives = 328/562 (58%), Gaps = 8/562 (1%)

Query: 58  EIYAEMYSRPLYRVALFFSLFLIAYAYGLDGNIRYTFQAYATSSYSQHSLLSTVNCIKTV 117
           E+ A  Y   L +    FS F+ A++YGLD  IR  +  YA + Y  HSLLSTV+ I   
Sbjct: 59  ELMANQYDGWLLKSMFLFSAFICAFSYGLDSIIRSIYMTYAMNDYQTHSLLSTVSVISLT 118

Query: 118 IAAVGQIFFARLSDIFGRFSIMIVSVIFYSVGTIIESQAVNITRFAVGGCFYQLGLTGII 177
           I+AV QIFFA LSD+FGR S+ IV+++FY VGT+I+SQA ++ R+A G  FY +GL G +
Sbjct: 119 ISAVAQIFFAGLSDVFGRLSMFIVAIMFYVVGTVIQSQAYDVQRYAAGSIFYYIGLVGSM 178

Query: 178 LILEVIASDFSNLNWRLLALFIPALPFIINTWISGDVTSAIG--TNWKWGIGMWAFILPL 235
             + ++ SD S+L WRLL  F+PA P ++  WISG+V        NW WGI MWAFI P 
Sbjct: 179 FQVTLMLSDCSSLKWRLLYNFVPAWPALVTVWISGNVVHVANPEKNWSWGIAMWAFIFPA 238

Query: 236 ACIPLGICMLHMRYLARKHAKDRLKPEFEALNKLKWKSFCIDIAFWKLDIIGMLLITVFF 295
            C+P+  C+LHMR+  R +++ +   E +   +       +   FWKLD++G+LL +V  
Sbjct: 239 TCLPIIGCLLHMRWKLRNNSEWKELQEEKTYFQTHGLVQTLKQLFWKLDVVGVLLFSVST 298

Query: 296 GCVLVPFTLAGGLKEEWKSAHIIVPEVIGWVVVLPLYMLWEMKYSRHPLTPWDLIKDRGX 355
           GC+L+P T+AGG    W+SA +I P V+G ++V P ++ WE K +  PL P+ ++KDRG 
Sbjct: 299 GCILIPLTIAGGASTHWRSAKVIAPLVLGSLLV-PFFIYWESKLALVPLAPFKMLKDRGI 357

Query: 356 XXXXXXXXXXXXXWYMQGDYMYTVLVVAVHESIKSATRITSLYSFVSVIVGTILGFILIK 415
                        + M   Y+YT+L+VA +ES  SATRITSLYSFV+ +   ++G  + +
Sbjct: 358 WAPLLITFLICFIYMMAAGYLYTILLVAGNESSLSATRITSLYSFVAAVFSPVVGIFVAR 417

Query: 416 VRRTKPFIIFGISCWIVSFGLLVHYRGDSGAHSGIIGSLCLLGFGAGSFTYVTQASIQAS 475
             R KPF +FG S + V+  L  H+RG +    G+IG++ + G  +  F Y    S+Q +
Sbjct: 418 FSRLKPFAVFGCSLYFVTMALFYHFRGGTDTGKGVIGAMVVWGITSCFFNYPINISMQ-T 476

Query: 476 AKTHARMAVVTSLYLATYNIXXXXXXXXXXXXWTNILPKEISKRISDPTLAAQAYSAPFT 535
             +H  MA VT+  L  + I            WT  L   + K + DPTLA +AY+ P +
Sbjct: 477 VTSHENMATVTAFGLTIFRIGGAVGAAVSGAIWTQSLYPRLLKALGDPTLALEAYNMPLS 536

Query: 536 FITTYTWGTPERIALVMSYRYVQKILCIIGLVFCFPLLGCAFMLRNHELTDSIA--LEGN 593
           F+  + WGTP R A++ +YRYVQK   ++GL+F  P+    F LR+  LT+     LE +
Sbjct: 537 FMLKHEWGTPARDAMIEAYRYVQKYEVLVGLIFVAPMFLLTFFLRDPPLTEDYGQKLEDD 596

Query: 594 DHLKSKDSFET--EEKQESFLK 613
           +++K  D       E+  SF K
Sbjct: 597 EYVKHDDPITDWIAERFSSFKK 618

>YHL047C Chr8 complement(8351..10213) [1863 bp, 620 aa] {ON}
           ARN2Transporter, member of the ARN family of
           transporters that specifically recognize
           siderophore-iron chelates; responsible for uptake of
           iron bound to the siderophore triacetylfusarinine C
          Length = 620

 Score =  418 bits (1075), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 232/569 (40%), Positives = 323/569 (56%), Gaps = 12/569 (2%)

Query: 58  EIYAEMYSRPLYRVALFFSLFLIAYAYGLDGNIRYTFQAYATSSYSQHSLLSTVNCIKTV 117
           E+ A+ Y     +    FS F+  +AYGLD +IR T+  YA +SYS HSL+STV+ I  +
Sbjct: 57  ELMAKKYDTWQLKAIFLFSAFICTFAYGLDSSIRGTYMTYAMNSYSAHSLISTVSVIVLM 116

Query: 118 IAAVGQIFFARLSDIFGRFSIMIVSVIFYSVGTIIESQAVNITRFAVGGCFYQLGLTGII 177
           I+AV Q+ F  LSDIFGR ++ +VS++ Y VGTII+SQA ++ R+A G  FY +GL G++
Sbjct: 117 ISAVSQVIFGGLSDIFGRLTLFLVSIVLYIVGTIIQSQAYDVQRYAAGAVFYYVGLVGVM 176

Query: 178 LILEVIASDFSNLNWRLLALFIPALPFIINTWISGDVTSAIG--TNWKWGIGMWAFILPL 235
           L + ++ SD S+L WRL    IP+ P II TW+SG V  A     NW W I MWAFI PL
Sbjct: 177 LQVVLMLSDNSSLKWRLFYTLIPSWPSIITTWVSGSVVEAANPLENWSWNIAMWAFIFPL 236

Query: 236 ACIPLGICMLHMRYLARKHAK-DRLKPEFEALNKLKWKSFCIDIAFWKLDIIGMLLITVF 294
            CIPL +CMLHMR+  R   +   L+ E             + + FWKLD++G+LL T  
Sbjct: 237 CCIPLILCMLHMRWKVRNDVEWKELQDEKSYYQTHGLVQMLVQL-FWKLDVVGVLLFTAG 295

Query: 295 FGCVLVPFTLAGGLKEEWKSAHIIVPEVIGWVVVLPLYMLWEMKYSRHPLTPWDLIKDRG 354
            GC+LVP TLAGG+   W+++ II P V+G+V+V P ++ WE + +  P  P+ L+KDRG
Sbjct: 296 VGCILVPLTLAGGVSTNWRNSKIIGPFVLGFVLV-PGFIYWESRLALVPFAPFKLLKDRG 354

Query: 355 XXXXXXXXXXXXXXWYMQGDYMYTVLVVAVHESIKSATRITSLYSFVSVIVGTILGFILI 414
                         + M   Y+YT+LVVAV ES  SATRI +LYSFV+ +V   LG I+ 
Sbjct: 355 VWAPLGIMFFICFVYQMAAGYLYTILVVAVDESASSATRIINLYSFVTAVVAPFLGLIVT 414

Query: 415 KVRRTKPFIIFGISCWIVSFGLLVHYRGDSGAHSGIIGSLCLLGFGAGSFTYVTQASIQA 474
           +  R K +IIFG S + ++ GL   YR    A  GII  + + G  +  F Y T  SIQ 
Sbjct: 415 RSSRLKSYIIFGGSLYFITMGLFYRYRSGQDADGGIIAGMVIWGLSSCLFDYPTIVSIQ- 473

Query: 475 SAKTHARMAVVTSLYLATYNIXXXXXXXXXXXXWTNILPKEISKRISDPTLAAQAYSAPF 534
           S  +H  MA VT+L    + I            WT  L  ++   + D  LA  AY +P 
Sbjct: 474 SVTSHENMATVTALNYTVFRIGGAVAAAISGAIWTQSLYPKLLHYMGDADLATAAYGSPL 533

Query: 535 TFITTYTWGTPERIALVMSYRYVQKILCIIGLVFCFPLLGCAFMLRNHELTDSIALEGND 594
           TFI +  WGTP R A+V +YR+VQK   I+ LVF  P+    F +R+  LT+  A     
Sbjct: 534 TFILSNPWGTPVRSAMVEAYRHVQKYEVIVALVFSAPMFLLTFCVRDPRLTEDFA----- 588

Query: 595 HLKSKDSFETEEKQESFLKSMIFTRFTRS 623
             K  D    + K++  +   I  RF ++
Sbjct: 589 -QKLPDREYVQTKEDDPINDWIAKRFAKA 616

>TBLA0F00470 Chr6 (123691..125889) [2199 bp, 732 aa] {ON} 
          Length = 732

 Score =  414 bits (1063), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 234/558 (41%), Positives = 327/558 (58%), Gaps = 17/558 (3%)

Query: 54  VYNIEIYAEMYSRPLYRVALFFSLFLIAYAYGLDGNIRYTFQAYATSSYSQHSLLSTVNC 113
           +  IEI   +Y    +   L F  F+ +Y Y LD  +R  ++ YA SSY +HSL+ST+N 
Sbjct: 97  IKEIEIMKSVYDTWYFHALLLFGAFICSYGYSLDSRVRRVYKTYAASSYKKHSLVSTINV 156

Query: 114 IKTVIAAVGQIFFARLSDIFGRFSIMIVSVIFYSVGTIIESQAVNITRFAVGGCFYQLGL 173
           I +V +A  Q+ ++R SDIFGR S+++V++I Y VGTII+SQA +I R+  G  FY LG 
Sbjct: 157 IDSVASATSQVVYSRASDIFGRLSLLLVAIICYVVGTIIQSQAYDIQRYCAGSFFYNLGY 216

Query: 174 TGIILILEVIASDFSNLNWRLLALFIPALPFIINTWISGDVTSAIG--TNWKWGIGMWAF 231
            G+ L++ +I SD+S+L WR     I A P IIN WISG +        +W W IGMWAF
Sbjct: 217 VGVSLLMTLILSDYSSLKWRFFYQAILAWPNIINDWISGIIVDRANPIKHWSWDIGMWAF 276

Query: 232 ILPLACIPLGICMLHMRYLARKHAK-DRLKPEFEALNKLKWKSFCIDIAFWKLDIIGMLL 290
           I PL+CIP+  C++HM++LA +  +  +LK          +K   ID+ FW+ D++G++L
Sbjct: 277 IFPLSCIPILCCLIHMQWLASQTDEWKQLKKGKSYFKYYGYKDSLIDM-FWRFDVVGVIL 335

Query: 291 ITVFFGCVLVPFTLAGGLKEEWKSAHIIVPEVIGWVVVLPLYMLWEMKYSRHPLTPWDLI 350
           +  F G +L+P TLAGG K  W    +I P VIG V+V P + +WE  +++HP+ PW LI
Sbjct: 336 LAAFIGLILIPLTLAGGTKSRWSEGKLIAPFVIGCVMV-PCFAIWEKWFAKHPIMPWRLI 394

Query: 351 KDRGXXXXXXXXXXXXXXWYMQGDYMYTVLVVAVHESIKSATRITSLYSFVSVIVGTILG 410
           KDR               + +  DYMY++L+VAV ESIKSAT I  ++SFVS +      
Sbjct: 395 KDRSIWAALTLSLVYKFVFAVAQDYMYSLLLVAVDESIKSATTIGLIHSFVSSVGSPFFS 454

Query: 411 FILIKVRRTKPFIIFGISCWIVSFGLLVHYRGDSGAHSGIIGSLCLLG-----FGAGSFT 465
           +    V R KPFI  G   +++S GLL +YRG   AHSGIIG+LC++G     F     T
Sbjct: 455 YGTTFVGRLKPFIFLGTLLYMLSLGLLYYYRGGKWAHSGIIGALCVVGGLQLLFFITPLT 514

Query: 466 YVTQASIQASAKTHARMAVVTSLYLATYNIXXXXXXXXXXXXWTNILPKEISKRISDPTL 525
            +TQAS+ +     A MA VT+L L   NI            WT  L KE+ KR+ + TL
Sbjct: 515 VITQASVSS-----ADMANVTALILTFDNIGTGIGAAVSGAIWTQTLYKELFKRMKNKTL 569

Query: 526 AAQAYSAPFTFITTYTWGTPERIALVMSYRYVQKILCIIGLVFCFPLLGCAFMLRNHELT 585
           A +AYS+P +FI  Y+WGTP R  +V SYR VQ+   I+ + FC PL+   F LR+  L 
Sbjct: 570 AKKAYSSPLSFIANYSWGTPVRNIMVESYRSVQRYEIIVAISFCAPLVLLTFALRDINLN 629

Query: 586 DSI--ALEGNDHLKSKDS 601
            S    LE   H+K  DS
Sbjct: 630 RSTDADLEDGKHVKMTDS 647

>NCAS0I00110 Chr9 complement(5312..6670) [1359 bp, 452 aa] {ON} 
          Length = 452

 Score =  395 bits (1014), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 212/446 (47%), Positives = 284/446 (63%), Gaps = 24/446 (5%)

Query: 21  DILEKEVGAIVDVNPTLTTSSPAPSYIELIDPGVYNIEIYAEMYSRPLYRVALFFSLFLI 80
           DI  KE+ +  D      T S  P +       +   EI + +Y +  + V L FS F+ 
Sbjct: 21  DIFTKEIESQND-----DTQSSVPDFAVKRSLVIKKTEIMSAVYDKWYHHVILLFSAFVC 75

Query: 81  AYAYGLDGNIRYTFQAYATSSYSQHSLLSTVNCIKTVIAAVGQIFFARLSDIFGRFSIMI 140
            YAYGL+ NIRY +  YATSSY++HSLLSTVN I  V++A  QI ++RLSD FGR ++ I
Sbjct: 76  GYAYGLECNIRYIYTGYATSSYAEHSLLSTVNVINAVVSAASQIIYSRLSDFFGRLTLFI 135

Query: 141 VSVIFYSVGTIIESQAVNITRFAVGGCFYQLGLTGIILILEVIASDFSNLNWRLLALFIP 200
           ++++ Y VGTII+SQA ++ R+A G  FY  G  GIILIL +I SDFS+L WRL   F P
Sbjct: 136 IAIVLYVVGTIIQSQAYDVQRYAAGAIFYNAGYVGIILILLLILSDFSSLKWRLFYQFAP 195

Query: 201 ALPFIINTWISGDVTSAIG--TNWKWGIGMWAFILPLACIPLGICMLHMRYLARKHAKDR 258
             PFIINTWISG+VTS+     +W W +GMWAFI PLACIP+  CM+HM++ A K     
Sbjct: 196 TWPFIINTWISGNVTSSANPLVHWSWDVGMWAFIFPLACIPMIGCMIHMQWKASK----- 250

Query: 259 LKPEFEALNKLKWKSF--------CIDIAFWKLDIIGMLLITVFFGCVLVPFTLAGGLKE 310
             PE+ AL     KSF         +   FWKLDIIG LL T   GC+LVP TLAGG   
Sbjct: 251 -TPEWHALRSE--KSFYQANGFYKTMTELFWKLDIIGTLLFTACLGCILVPLTLAGGTNS 307

Query: 311 EWKSAHIIVPEVIGWVVVLPLYMLWEMKYSRHPLTPWDLIKDRGXXXXXXXXXXXXXXWY 370
           +W ++ +I P V+G+V++ P+  +WE K++R PL P+ L++DRG              +Y
Sbjct: 308 KWNNSRVIGPFVLGFVLI-PILGVWEYKWARDPLIPYKLVRDRGVWAALGISFLIDFIFY 366

Query: 371 MQGDYMYTVLVVAVHESIKSATRITSLYSFVSVIVGTILGFILIKVRRTKPFIIFGISCW 430
           M  DY+YTV+VVAVHES+KSATRI++L SFVS +       ++ +  R KPFIIFG S W
Sbjct: 367 MAADYLYTVMVVAVHESVKSATRISTLSSFVSTVASPFFALLMTRCTRLKPFIIFGCSLW 426

Query: 431 IVSFGLLVHYRGDSGAHSGIIGSLCL 456
           ++S GLL ++RG   +HSGIIG+LC+
Sbjct: 427 MLSMGLLYNFRGGEQSHSGIIGALCV 452

>Skud_18.6 Chr18 (14597..16429) [1833 bp, 610 aa] {ON} YCL073C
           (REAL)
          Length = 610

 Score =  400 bits (1028), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 219/594 (36%), Positives = 333/594 (56%), Gaps = 23/594 (3%)

Query: 44  PSYIELIDPGVYNIEIYAEMYSRPLYRVALFFSLFLIAYAYGLDGNIRYTFQAYATSSYS 103
           P+ +E    G    EI A  +  P YR  +  + FL  + Y LD  +R T+  YAT+SY+
Sbjct: 30  PANVEFSKLG--ESEIIAVQFDTPKYRALMIATAFLCGFGYSLDHTLRSTYTGYATNSYA 87

Query: 104 QHSLLSTVNCIKTVIAAVGQIFFARLSDIFGRFSIMIVSVIFYSVGTIIESQAVNITRFA 163
           +HSLLST+  I  V++   Q+ F+RLSD FGR  + + + I Y +GTI++SQA +++ +A
Sbjct: 88  EHSLLSTIQVINAVVSVGSQVVFSRLSDYFGRVELFVAATILYVIGTIVQSQAYSVSIYA 147

Query: 164 VGGCFYQLGLTGIILILEVIASDFSNLNWRLLALFIPALPFIINTWISGDVTSAIG--TN 221
            G  FY  G  G+ L+L +I SDFS+L WR+L  ++P  PFII  WISG++ +A     +
Sbjct: 148 AGAVFYNSGNVGVTLVLLLILSDFSSLKWRILYQYVPYWPFIIIPWISGNIVTAANPEKD 207

Query: 222 WKWGIGMWAFILPLACIPLGICMLHMRYLARKHAKDRLKPEFEALNKL----KWKSFCID 277
           W W I MWAFI PL+ +P+   +++M Y + K       PE++AL +     K + F  +
Sbjct: 208 WSWDIAMWAFIFPLSALPMICLLVYMMYKSSK------TPEWKALKERTHIKKNQGFLKN 261

Query: 278 IA--FWKLDIIGMLLITVFFGCVLVPFTLAGGLKEEWKSAHIIVPEVIGWVVVLPLYMLW 335
               FW+LD IG++LITV  GCVLVP TLA G+ ++W S+ II   V G V+   +++ W
Sbjct: 262 TVFLFWELDSIGIILITVSLGCVLVPLTLANGVSQKWHSSKIIGTLVFGGVLFC-IFVFW 320

Query: 336 EMKYSRHPLTPWDLIKDRGXXXXXXXXXXXXXXWYMQGDYMYTVLVVAVHESIKSATRIT 395
           E  Y+++PL P+ L+ DRG              +++  D++Y VL+V+++ES  +ATRI 
Sbjct: 321 ETAYAKNPLLPFKLLGDRGIWAPLGVAFFNYFTFFIACDFLYPVLLVSMNESSTTATRIL 380

Query: 396 SLYSFVSVIVGTILGFILIKVRRTKPFIIFGISCWIVSFGLLVHYRGDSGAHSGIIGSLC 455
           +L  FV   +    G ++ K RR K  ++ G + W++S GL   YRG S +H G I +  
Sbjct: 381 NLPDFVGATLSPFYGILVAKARRLKFSVVGGCAAWMISMGLFYQYRGGSESHGGAIAASV 440

Query: 456 LLGFGAGSFTYVTQASIQASAKTHARMAVVTSLYLATYNIXXXXXXXXXXXXWTNILPKE 515
           ++G      +     S+QA   TH RMAV+TS+Y     +            WT I+P +
Sbjct: 441 IMGMSGLLCSNSVIVSLQA-MTTHGRMAVITSIYFTFSKVGAAVGASVSGAVWTQIMPNQ 499

Query: 516 ISKRISDPTLAAQAYSAPFTFITTYTWGTPERIALVMSYRYVQKILCIIGLVFCFPLLGC 575
           + K  S+ TLA  AY +P+TFI  Y WG+PERIA+V +YRYVQ+I+  IGLV   P    
Sbjct: 500 LRKAFSNDTLADAAYESPYTFIYEYPWGSPERIAVVEAYRYVQRIMMTIGLVCTIPFFAF 559

Query: 576 AFMLRNHELTDSIALEGNDHLKSKDSFETEEKQESFLKSM-IFTRFTRSEDKRN 628
              +R+ EL D    +      ++D     + +   L  + +F R  R+  K  
Sbjct: 560 TLFMRDPELID----KSTHEEFTEDGLALSKDEPGILPQLKVFFRGNRANRKEK 609

>KLLA0E14609g Chr5 (1302073..1303992) [1920 bp, 639 aa] {ON} similar
           to uniprot|P38731 Saccharomyces cerevisiae YHL040C ARN1
           Transporter member of the ARN family of transporters
           that specifically recognize siderophore-iron chelates
           responsible for uptake of iron bound to ferrirubin
           ferrirhodin and related siderophores
          Length = 639

 Score =  378 bits (970), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 199/558 (35%), Positives = 308/558 (55%), Gaps = 15/558 (2%)

Query: 54  VYNIEIYAEMYSRPLYRVALFFSLFLIAYAYGLDGNIRYTFQAYATSSYSQHSLLSTVNC 113
           +  +EI  + Y+         F+ FL      L+  +R  +  YAT+SY  HSLLST+  
Sbjct: 65  IRKMEIMRKQYTSVFAICVFLFTAFLAGVGTDLNSQLRNNYTTYATNSYRSHSLLSTIGV 124

Query: 114 IKTVIAAVGQIFFARLSDIFGRFSIMIVSVIFYSVGTIIESQAVNITRFAVGGCFYQLGL 173
           + ++I+A     +ARLSD+FGR  + + +++F+ VGTII+SQA N+ ++A G  FY LG 
Sbjct: 125 VSSIISAGALTVYARLSDVFGRIRLYLSAMLFFVVGTIIQSQANNVQKYAAGTVFYSLGT 184

Query: 174 TGIILILEVIASDFSNLNWRLLALFIPALPFIINTWISGDVTSAIG--TNWKWGIGMWAF 231
            GI +++ +I SDFS+L WRL   F P  P +   WI+G +   +     W WGIGMWAF
Sbjct: 185 AGIQVMMFIIMSDFSSLKWRLFFTFAPTWPNLFIPWITGSIVDRLDPVERWSWGIGMWAF 244

Query: 232 ILPLACIPLGICMLHMRYLARKHAKDRLKPEFEALNKLKWKSFCIDIAFWKLDIIGMLLI 291
           I PL+ +P    +L +RY A K  + ++    +   +       +   FWK+D++G+LL 
Sbjct: 245 IYPLSSVPFVAYLLLVRYKASKTEEWKMLSSEKTYYETHGIIQTLVQLFWKVDVVGLLLF 304

Query: 292 TVFFGCVLVPFTLAGGLKEEWKSAHIIVPEVIGWVVVLPLYMLWEMKYSRHPLTPWDLIK 351
             F GC+LVP TLAGG+  +W +  I+ P ++G+ +V P ++LWE KY+R P+ P+ ++K
Sbjct: 305 VAFLGCILVPLTLAGGVSSQWSNGKILGPFILGFCLV-PAFILWETKYARLPIAPFKMLK 363

Query: 352 DRGXXXXXXXXXXXXXXWYMQGDYMYTVLVVAVHESIKSATRITSLYSFVSVIVGTILGF 411
           DRG              +Y+   Y+ T+L+VAV++S   A  I +++S V         +
Sbjct: 364 DRGIWSALIISMLAKTVYYLAAGYLLTILMVAVNQSRGMAAVIMNVWSVVGCGFSPFFSY 423

Query: 412 ILIKVRRTKPFIIFGISCWIVSFGLLVHYRGDSGAHSGIIGSLCLLGFGAGSFTYVTQAS 471
            +++VRR KPFII G   W+VS GLL +YR    +  GIIG++ L G G+   T  T  S
Sbjct: 424 FVVRVRRLKPFIIIGCGIWMVSMGLLYYYRSGEHSKGGIIGAMVLWGLGSTMITRTTVIS 483

Query: 472 IQASAKTHARMAVVTSLYLATYNIXXXXXXXXXXXXWTNILPKEISKRISDPTLAAQAYS 531
            Q S   H  MA +T++ LA   I            WT  L  ++ + I DP +A + Y 
Sbjct: 484 SQ-SITAHENMATITAIMLAISRIGGGIGSAVSGAIWTQTLYAKLVETIGDPEIAKKVYQ 542

Query: 532 APFTFITTYTWGTPERIALVMSYRYVQKILCIIGLVFCFPLLGCAFMLRNHELTDS---- 587
           +P + I  Y WGTP R A+V +YR+VQ+   ++ ++   PL   +  LR+ ELTD     
Sbjct: 543 SPLSAIRVYAWGTPTRDAIVEAYRHVQRFEVLVAMILVIPLFIASLCLRDPELTDEVAHT 602

Query: 588 -------IALEGNDHLKS 598
                  IA++GND + +
Sbjct: 603 DIKDGEFIAVDGNDAIAN 620

>Kwal_14.722 s14 (9019..10854) [1836 bp, 611 aa] {ON} YCL073C -
           Hypothetical ORF [contig 245] FULL
          Length = 611

 Score =  374 bits (961), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 209/565 (36%), Positives = 315/565 (55%), Gaps = 13/565 (2%)

Query: 34  NPTLTTSSPAPSYIELIDPGVYNIEIYAEMYSRPLYRVALFFSLFLIAYAYGLDGNIRYT 93
            P+LT         + +   V  +EI  ++ S  L RV L  S FL  +AY LD   R  
Sbjct: 29  KPSLTKGDKGRQQYDYMK--VKEMEIIKDVCSGNLARVFLLASAFLCGFAYYLDMVTRSV 86

Query: 94  FQAYATSSYSQHSLLSTVNCIKTVIAAVGQIFFARLSDIFGRFSIMIVSVIFYSVGTIIE 153
           +  YA +SY +HSLLST+  I +V+    QI FARLSD+FGR  + +V  I Y VGTII+
Sbjct: 87  YTTYAANSYEKHSLLSTIQVINSVVGVGAQISFARLSDVFGRLQMFVVGTILYVVGTIIQ 146

Query: 154 SQAVNITRFAVGGCFYQLGLTGIILILEVIASDFSNLNWRLLALFIPALPFIINTWISGD 213
           SQA ++  +AVG  FY  G  G+ L+L ++ SD S L WRL   F  + P II +WISGD
Sbjct: 147 SQAHDVKVYAVGAIFYNTGFVGVSLLLILVLSDMSPLRWRLFYQFTASFPCIIISWISGD 206

Query: 214 VTSAIG--TNWKWGIGMWAFILPLACIPLGICMLHMRYLARKHAK---DRLKPEFEALNK 268
           +  A     NW W IGMWAFI PL+ +P    + +  +++ K  K    R K E    N 
Sbjct: 207 IVEAANPMKNWSWDIGMWAFIFPLSSLPFITYLFYATHISSKTKKWKDLRNKVETHKRNI 266

Query: 269 LKWKSFCIDIAFWKLDIIGMLLITVFFGCVLVPFTLAGGLKEEWKSAHIIVPEVIGWVVV 328
           +      +   F ++DI+G +L+T   G +LVP TLAGG+ E W    II   VIG + +
Sbjct: 267 I----LVVKDIFNQIDIVGTVLVTAALGLILVPLTLAGGVSERWHEPGIIATLVIG-IAL 321

Query: 329 LPLYMLWEMKYSRHPLTPWDLIKDRGXXXXXXXXXXXXXXWYMQGDYMYTVLVVAVHESI 388
           L +++ WE K++++   P++L+KDRG              + M  DY+Y VL+V+V+E+ 
Sbjct: 322 LLVFLFWEAKFAKNAALPFNLLKDRGVWASIVAAFLEKMIYAMISDYLYPVLLVSVNETN 381

Query: 389 KSATRITSLYSFVSVIVGTILGFILIKVRRTKPFIIFGISCWIVSFGLLVHYRGDSGAHS 448
           KSATRI  L +F++ +     G +++ V+R K F I G   WI+S GL   +RG   +HS
Sbjct: 382 KSATRIVWLPTFMACLCSVFFGLLVVSVQRLKVFTICGTFLWIISIGLFYQFRGGESSHS 441

Query: 449 GIIGSLCLLGFGAGSFTYVTQASIQASAKTHARMAVVTSLYLATYNIXXXXXXXXXXXXW 508
           GIIG+  +LGFG+  FT     ++QA A +H  MA +T LY     +            W
Sbjct: 442 GIIGASIVLGFGSAIFTQSIIVTLQAMA-SHDNMASITGLYFMFAQVGAATGASISGAIW 500

Query: 509 TNILPKEISKRISDPTLAAQAYSAPFTFITTYTWGTPERIALVMSYRYVQKILCIIGLVF 568
           T  + K++ K++ D  L    +++P+ FI +Y WGT ER  ++ +YR+VQK+  ++ L+ 
Sbjct: 501 TQTMYKQLLKQLKDSDLTMAVFASPYEFIASYAWGTKERDLVIQAYRHVQKVTMLVSLIL 560

Query: 569 CFPLLGCAFMLRNHELTDSIALEGN 593
             PLL      ++ +L+DS++ + +
Sbjct: 561 TVPLLVSVLFTKDRKLSDSVSSDAS 585

>YKR106W Chr11 (661442..663289) [1848 bp, 615 aa] {ON}
           GEX2Proton:glutathione antiporter localized to the
           vacuolar and plasma membranes; expressed at a very low
           level; almost identical to paralog Gex1p; potential role
           in resistance to oxidative stress and modulation of the
           PKA pathway
          Length = 615

 Score =  374 bits (960), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 201/536 (37%), Positives = 301/536 (56%), Gaps = 4/536 (0%)

Query: 58  EIYAEMYSRPLYRVALFFSLFLIAYAYGLDGNIRYTFQAYATSSYSQHSLLSTVNCIKTV 117
           EI +  +    Y++ L  + F+  +   LD  +R T+  YAT+SYS+HSLLSTV  I  V
Sbjct: 47  EIMSAQFDSLKYKILLISTAFVCGFGISLDYTLRSTYTGYATNSYSEHSLLSTVQVINAV 106

Query: 118 IAAVGQIFFARLSDIFGRFSIMIVSVIFYSVGTIIESQAVNITRFAVGGCFYQLGLTGII 177
           ++   Q+ ++RLSD FGR  + +V+ IFY +GTII+SQA  +T +A G  FY  G  G  
Sbjct: 107 VSVGSQVVYSRLSDHFGRLRLFLVATIFYIMGTIIQSQATRLTMYAAGSVFYNCGYVGTN 166

Query: 178 LILEVIASDFSNLNWRLLALFIPALPFIINTWISGDVTSAIG--TNWKWGIGMWAFILPL 235
           L+L +I SDFS+L WR+   +    P+II  WISG++ +A     NW W I MWAFI PL
Sbjct: 167 LLLTLILSDFSSLKWRMFYQYASYWPYIIIPWISGNIITAANPQKNWSWNIAMWAFIYPL 226

Query: 236 ACIPLGICMLHMRYLARKHAKDRLKPEFEALNKLKWKSFCIDIAFWKLDIIGMLLITVFF 295
           + +P+   +L+M+Y + K A+ R   E     +       +   FWKLDI+G+LLITV  
Sbjct: 227 STLPIIFLILYMKYKSSKTAEWRSLKEQARKERTGGLFENLVFLFWKLDIVGILLITVSL 286

Query: 296 GCVLVPFTLAGGLKEEWKSAHIIVPEVIGWVVVLPLYMLWEMKYSRHPLTPWDLIKDRGX 355
           GC+LVP TLA    ++W ++ II   V G  +   +++ WE K+++ PL P+ L+ DRG 
Sbjct: 287 GCILVPLTLANETSQKWHNSKIIATLVSGGCLFF-IFLYWEAKFAKSPLLPFKLLSDRGI 345

Query: 356 XXXXXXXXXXXXXWYMQGDYMYTVLVVAVHESIKSATRITSLYSFVSVIVGTILGFILIK 415
                        +++  DY+Y VL+V++ ES  SA RI +L  FV+         ++ K
Sbjct: 346 WAPLGVTFFNFFTFFISCDYLYPVLLVSMKESSTSAARIVNLPDFVAATASPFYSLLVAK 405

Query: 416 VRRTKPFIIFGISCWIVSFGLLVHYRGDSGAHSGIIGSLCLLGFGAGSFTYVTQASIQAS 475
            R+ K  +I G + W+V  GL   YRG SG+H G+I +  ++G  +G     +   I  +
Sbjct: 406 TRKLKLSVIGGCAAWMVCMGLFYKYRGGSGSHEGVIAASVIMGL-SGLLCSNSVIVILQA 464

Query: 476 AKTHARMAVVTSLYLATYNIXXXXXXXXXXXXWTNILPKEISKRISDPTLAAQAYSAPFT 535
             TH+RMAV+T +      +            WT  +P ++ K + + TLA  AY++P+T
Sbjct: 465 MTTHSRMAVITGIQYTFSKLGAAIGASVSGAIWTQTMPNQLYKNLGNDTLAEIAYASPYT 524

Query: 536 FITTYTWGTPERIALVMSYRYVQKILCIIGLVFCFPLLGCAFMLRNHELTDSIALE 591
           FI+ Y WG+PER A+V SYRYVQ+I+  +GL    P       +RN EL D    E
Sbjct: 525 FISDYPWGSPERDAVVESYRYVQRIIMTVGLACTVPFFTFTMFMRNPELIDKATHE 580

>YCL073C Chr3 complement(6479..8326) [1848 bp, 615 aa] {ON}
           GEX1Proton:glutathione antiporter localized to the
           vacuolar and plasma membranes; imports glutathione from
           the vacuole and exports it through the plasma membrane;
           has a role in resistance to oxidative stress and
           modulation of the PKA pathway
          Length = 615

 Score =  373 bits (958), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 200/536 (37%), Positives = 301/536 (56%), Gaps = 4/536 (0%)

Query: 58  EIYAEMYSRPLYRVALFFSLFLIAYAYGLDGNIRYTFQAYATSSYSQHSLLSTVNCIKTV 117
           EI +  +    Y++ L  + F+  +   LD  +R T+  YAT+SYS+HSLLSTV  I  V
Sbjct: 47  EIMSAQFDSLKYKILLISTAFVCGFGISLDYTLRSTYTGYATNSYSEHSLLSTVQVINAV 106

Query: 118 IAAVGQIFFARLSDIFGRFSIMIVSVIFYSVGTIIESQAVNITRFAVGGCFYQLGLTGII 177
           ++   Q+ ++RLSD FGR  + +V+ IFY +GTII+SQA  +T +A G  FY  G  G  
Sbjct: 107 VSVGSQVVYSRLSDHFGRLRLFLVATIFYIMGTIIQSQATRLTMYAAGSVFYNCGYVGTN 166

Query: 178 LILEVIASDFSNLNWRLLALFIPALPFIINTWISGDVTSAIG--TNWKWGIGMWAFILPL 235
           L+L +I SDFS+L WR+   +    P+II  WISG++ +A     NW W I MWAFI PL
Sbjct: 167 LLLTLILSDFSSLKWRMFYQYASYWPYIIIPWISGNIITAANPQKNWSWNIAMWAFIYPL 226

Query: 236 ACIPLGICMLHMRYLARKHAKDRLKPEFEALNKLKWKSFCIDIAFWKLDIIGMLLITVFF 295
           + +P+   +L+M+Y + K A+ R   E     +       +   FWKLDI+G+LLITV  
Sbjct: 227 SALPIIFLILYMKYKSSKTAEWRSLKEQARKERTGGLFENLVFLFWKLDIVGILLITVSL 286

Query: 296 GCVLVPFTLAGGLKEEWKSAHIIVPEVIGWVVVLPLYMLWEMKYSRHPLTPWDLIKDRGX 355
           GC+LVP TLA    ++W ++ II   V G  +   +++ WE K+++ PL P+ L+ DRG 
Sbjct: 287 GCILVPLTLANETSQKWHNSKIIATLVSGGCLFF-IFLYWEAKFAKSPLLPFKLLSDRGI 345

Query: 356 XXXXXXXXXXXXXWYMQGDYMYTVLVVAVHESIKSATRITSLYSFVSVIVGTILGFILIK 415
                        +++  DY+Y VL+V++ ES  SA RI +L  FV+         ++ K
Sbjct: 346 WAPLGVTFFNFFTFFISCDYLYPVLLVSMKESSTSAARIVNLPDFVAATASPFYSLLVAK 405

Query: 416 VRRTKPFIIFGISCWIVSFGLLVHYRGDSGAHSGIIGSLCLLGFGAGSFTYVTQASIQAS 475
            R+ K  +I G + W+V  GL   YRG SG+H G+I +  ++G  +G     +   I  +
Sbjct: 406 TRKLKLSVIGGCAAWMVCMGLFYKYRGGSGSHEGVIAASVIMGL-SGLLCSNSVIVILQA 464

Query: 476 AKTHARMAVVTSLYLATYNIXXXXXXXXXXXXWTNILPKEISKRISDPTLAAQAYSAPFT 535
             TH+RMAV+T +      +            WT  +P ++ K + + TLA  AY++P+T
Sbjct: 465 MTTHSRMAVITGIQYTFSKLGAAIGASVSGAIWTQTMPNQLYKNLGNDTLAEIAYASPYT 524

Query: 536 FITTYTWGTPERIALVMSYRYVQKILCIIGLVFCFPLLGCAFMLRNHELTDSIALE 591
           FI+ Y WG+PER A+V SYRYVQ+I+  +GL    P       +R+ EL D    E
Sbjct: 525 FISDYPWGSPERDAVVESYRYVQRIIMTVGLACTVPFFAFTMFMRDPELIDKATHE 580

>KLTH0B00110g Chr2 complement(1655..3538) [1884 bp, 627 aa] {ON}
           similar to uniprot|P25596 Saccharomyces cerevisiae
           YCL073C and similar to uniprot|P36173 Saccharomyces
           cerevisiae YKR106W
          Length = 627

 Score =  370 bits (951), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 215/610 (35%), Positives = 332/610 (54%), Gaps = 37/610 (6%)

Query: 21  DILEKEVGAIVDVNPTLTTSSPAPSYIELIDPGVYNIEIYAEMYSRPLYRVALFFSLFLI 80
           D+ E ++ ++ D N +   S     +++     V  +EI +   S    R AL  S FL 
Sbjct: 36  DVTEHDIESVADSNKS---SKLGSGFLK-----VKEMEIMSSTCSGKSARAALLASAFLC 87

Query: 81  AYAYGLDGNIRYTFQAYATSSYSQHSLLSTVNCIKTVIAAVGQIFFARLSDIFGRFSIMI 140
            + Y LD   R  +  YATSSY++H+LLST+  I +VI+   QI FA+LSDIFGR  + +
Sbjct: 88  GFGYYLDYITRSVYTGYATSSYNEHALLSTIQVINSVISIAAQIIFAQLSDIFGRLQLFL 147

Query: 141 VSVIFYSVGTIIESQAVNITRFAVGGCFYQLGLTGIILILEVIASDFSNLNWRLLALFIP 200
           V  + Y VGTII+ +A +I  +AVG  FY  G  G+ ++L ++ SD S   WRLL  F  
Sbjct: 148 VGTVLYIVGTIIQCEARDIRTYAVGAAFYNSGYVGVSILLIIVLSDLSPSKWRLLFQFAT 207

Query: 201 ALPFIINTWISGDVTSAI--GTNWKWGIGMWAFILPLACIPLGICMLHMRYLARKHAKDR 258
           + P II  WISGD+  +     NW++ IGMWAF+ P++ +P  I +L   Y  R+ +K  
Sbjct: 208 SWPCIIICWISGDIVQSANPAKNWRFDIGMWAFLFPISALPFIIFLL---YFTRQASKTA 264

Query: 259 LKPEFEALNKLKWKSFCIDIAFW------KLDIIGMLLITVFFGCVLVPFTLAGGLKEEW 312
              E +  NK       + I +W       +D++G  L+TV  GC+LVP TLAGG+ ++W
Sbjct: 265 EWKEIQGDNKEP----SVRIVYWIKSIYSNIDVVGTSLVTVSLGCILVPLTLAGGISDDW 320

Query: 313 KSAHIIVPEVIGWVVVLPLYMLWEMKYSRHPLTPWDLIKDRGXXXXXXXXXXXXXXWYMQ 372
               II   V+G+V  +  ++ W++K++++ + P+ L+KDRG              +   
Sbjct: 321 NKPGIIATIVVGFVSFM-FFLAWDIKFAKNAVLPFKLLKDRGVWASLAAALLEKLIYATI 379

Query: 373 GDYMYTVLVVAVHESIKSATRITSLYSFVSVIVGTILGFILIKVRRTKPFIIFGISCWIV 432
            DY+Y VL+V+V+ES KSATRI  L +FV+       G ++++ +R K + I G+  WI+
Sbjct: 380 SDYLYPVLLVSVNESSKSATRILWLPTFVACTGSIFFGLLVVRTKRLKIYSIIGVCLWIL 439

Query: 433 SFGLLVHYRGDSGAHSGIIGSLCLLGFGAGSFTYVTQASIQASAKTHARMAVVTSLYLAT 492
           S GL  HYRG + +HSGIIG+  +LG G+  FT     ++Q +  +H  MA +T LY   
Sbjct: 440 SIGLFYHYRGGASSHSGIIGASVVLGTGSAIFTQSLIVNLQ-TMTSHKNMASITGLYFMF 498

Query: 493 YNIXXXXXXXXXXXXWTNILPKEISKRISDPTLAAQAYSAPFTFITTYTWGTPERIALVM 552
             I            WT  + K++ KR+ D +LAA A+S+P+ FI  Y WGTPER  ++ 
Sbjct: 499 AQIGSASGASISGAIWTQTMYKQLYKRLEDSSLAATAFSSPYEFIELYPWGTPERTQMIY 558

Query: 553 SYRYVQKILCIIGLVFCFPLLGCAFMLRNHELTDSIALEGNDHLKSKDSFETEEKQESFL 612
           +YR VQK   ++ LV   PL       ++ +L D++            + ET +  E  +
Sbjct: 559 AYREVQKKTMLVSLVLTGPLFLLILFTKDRKLGDNV------------TAETTQSDEDPM 606

Query: 613 KSMIFTRFTR 622
            + I  RF +
Sbjct: 607 LTWILKRFNK 616

>KLLA0D19945g Chr4 (1701681..1703615) [1935 bp, 644 aa] {ON} similar
           to uniprot|P36173 Saccharomyces cerevisiae YKR106W
          Length = 644

 Score =  354 bits (909), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 219/640 (34%), Positives = 342/640 (53%), Gaps = 20/640 (3%)

Query: 2   DPATANHALPEDFTEDVVPDI--LEKEVGAIVDVNP--TLTTSSPAPSYIELI-----DP 52
            PA +      ++ +D   D    +KE G I D+     +  + P    +E+        
Sbjct: 3   QPAVSPEWEQCEYDKDSETDKRSCKKEQGIIHDIEKMTVVEETQPVGPNLEITARFSTKR 62

Query: 53  GVYNIEIYAEMYSRPLYRVALFFSLFLIAYAYGLDGNIRYTFQAYATSSYSQHSLLSTVN 112
            +  +EI +       ++  L  +  +  ++Y LD  +R T+  YAT+S+SQHSLL+T+N
Sbjct: 63  KMKELEIVSSFCKEWHFQSILLVTAIVCGFSYNLDAVLRSTYTGYATNSFSQHSLLATIN 122

Query: 113 CIKTVIAAVGQIFFARLSDIFGRFSIMIVSVIFYSVGTIIESQAVNITRFAVGGCFYQLG 172
            I +V++   Q+FFARLSD FGR  +     + Y VGTI++SQ+ N++ +A G  FY  G
Sbjct: 123 VINSVVSIASQLFFARLSDHFGRLQLFGFCTLMYIVGTILQSQSKNVSIYAGGAVFYNAG 182

Query: 173 LTGIILILEVIASDFSNLNWRLLALFIPALPFIINTWISGDVTSAIG--TNWKWGIGMWA 230
            TG+ L++ ++ SDFS L WR   +  P   +II TW+SG++        NW W I MWA
Sbjct: 183 YTGVRLLMTIMMSDFSTLGWRYFMIASPDWCYIIITWVSGNIIEISNPLENWSWDIAMWA 242

Query: 231 FILPLACIPLGICMLHMRYLARKHAKDRLKPEFEALNKLKWKSFCIDIAFWKLDIIGMLL 290
           FI PL  IPL   +++M Y A +   D  K E  ++ K       I   FW LDI G+LL
Sbjct: 243 FIFPLTTIPLVGFLVYMFYKASR--TDEWK-ELRSVTKKMPTPVYIKEVFWNLDIPGVLL 299

Query: 291 ITVFFGCVLVPFTLAGGLKEEWKSAHIIVPEVIGWVVVLPLYMLWEMKYSRHPLTPWDLI 350
           I +  GC+L+P T++GG  EEWK +  I    +G  V+ P+++LWE K ++ P+     +
Sbjct: 300 IAISLGCILIPLTVSGGETEEWKDSRNIGVLCLG-SVLFPIFLLWEGKIAKRPVLALTYL 358

Query: 351 KDRGXXXXXXXXXXXXXXWYMQGDYMYTVLVVAVHESIKSATRITSLYSFVSVIVGTILG 410
           KDRG              + +  DY+Y VL+V  ++S  ++ RIT L SF  V++    G
Sbjct: 359 KDRGVWAPLAASFFMSNAYLIATDYLYAVLLVGFNQSESASQRITWLPSFAGVVITPFTG 418

Query: 411 FILIKVRRTKPFIIFGISCWIVSFGLLVHYRGDSGAHSGIIGSLCLLGFGAGSFTYVTQA 470
            ++ + +  K   I G   + ++FGL   YRG S   +GII     +GFG+G  TY    
Sbjct: 419 LLITRWKHLKVLTITGCIFYYIAFGLFYRYRGGSTNVAGIIVGTIFMGFGSGISTYPLMV 478

Query: 471 SIQASAKTHARMAVVTSLYLATYNIXXXXXXXXXXXXWTNILPKEISKRI-SDPTLAAQA 529
           S+QA   +H ++A+VT+L+     +            WT ++ KEISKR+  +P +A  A
Sbjct: 479 SLQA-VSSHTKIAIVTALFYTFEQVGRAVGSSISGAIWTQVMFKEISKRLPEEPEVALAA 537

Query: 530 YSAPFTFITTYTWGTPERIALVMSYRYVQKILCIIGLVFCFPLLGCAFMLRNHEL-TDSI 588
           Y++P+TF+T Y W T +R+A+V +Y +VQKIL ++ L+   PL   A M+R+ EL T  +
Sbjct: 538 YASPYTFVTKYGWETSQRMAVVGAYMHVQKILLLVALLMLCPLFLMAIMMRDAELSTSDV 597

Query: 589 ALEGNDHLKSKDSFETEEKQESFLKSMIFTRFTRSEDKRN 628
           AL  +D      S   ++  E+F K   F+  T+ E  R 
Sbjct: 598 ALSSSDDSHVIISKHEDKIYEAFCKFFSFS--TKKEGSRE 635

>KLTH0G00198g Chr7 (5908..7284) [1377 bp, 458 aa] {ON} similar to
           uniprot|P38731 Saccharomyces cerevisiae YHL040C ARN1
           Transporter member of the ARN family of transporters
           that specifically recognize siderophore-iron chelates
           responsible for uptake of iron bound to ferrirubin
           ferrirhodin and related siderophores
          Length = 458

 Score =  310 bits (795), Expect = 1e-98,   Method: Compositional matrix adjust.
 Identities = 171/439 (38%), Positives = 249/439 (56%), Gaps = 5/439 (1%)

Query: 123 QIFFARLSDIFGRFSIMIVSVIFYSVGTIIESQAVNITRFAVGGCFYQLGLTGIILILEV 182
           Q+  ARLSD FGR  I + S + Y   +I+ES A NI+ +  G   Y +G   + ++L V
Sbjct: 2   QLILARLSDYFGRLEIFLTSTVLYIARSIVESPAYNISAYGAGAVLYNVGFCCVNIVLLV 61

Query: 183 IASDFSNLNWRLLALFIPALPFIINTWISGDVTSAIG--TNWKWGIGMWAFILPLACIPL 240
           + SDFS+L WR+L  F P    ++  WISGDV ++IG   +W WGIG WAF  PLA +P 
Sbjct: 62  VMSDFSSLKWRVLYQFAPTWGCVVIPWISGDVVNSIGPIKHWSWGIGFWAFSFPLASLPF 121

Query: 241 GICMLHMRYLARKHAKDRLKPEFEALNKLKWKSFCIDIAFWKLDIIGMLLITVFFGCVLV 300
             CM++M Y  RK  + +L  + + LN+ K  +  + I F ++D IG L+ +V  GCVLV
Sbjct: 122 ICCMVYMIYTTRKSDQWKLFNQEKPLNEAKLLTRVMRI-FHQVDFIGTLIFSVALGCVLV 180

Query: 301 PFTLAGGLKEEWKSAHIIVPEVIGWVVVLPLYMLWEMKYSRHPLTPWDLIKDRGXXXXXX 360
           P TLAGG   +W  +  IVP V+G  V+   Y++WE   + +P  P+ L+KDRG      
Sbjct: 181 PLTLAGGYSSKWSHSDSIVPLVVG-SVLFVFYIVWESFMASYPALPFKLLKDRGIWIPIL 239

Query: 361 XXXXXXXXWYMQGDYMYTVLVVAVHESIKSATRITSLYSFVSVIVGTILGFILIKVRRTK 420
                   +Y   DYMY VL+VA++ES KSAT I SL  FV+ +       +L    R K
Sbjct: 240 AGFLMDLVYYFSCDYMYPVLMVAINESTKSATNIASLPLFVTTVASPFFAVLLRWTGRLK 299

Query: 421 PFIIFGISCWIVSFGLLVHYRGDSGAHSGIIGSLCLLGFGAGSFTYVTQASIQASAKTHA 480
            + I G + W+VS GL   YR   G+H G++ ++ LLG G     +    ++QA A  H 
Sbjct: 300 WYAIGGFAIWMVSLGLFFRYRCGEGSHDGMVAAVVLLGLGRTFTQFPLLTTMQARAP-HT 358

Query: 481 RMAVVTSLYLATYNIXXXXXXXXXXXXWTNILPKEISKRISDPTLAAQAYSAPFTFITTY 540
           +MA VT L+    ++            WT  +PK++ K +    LA  AY++P+TFI +Y
Sbjct: 359 KMATVTGLFHVWGSVGSVVGASISGAVWTQKMPKKLLKMLGSNGLATAAYASPYTFIISY 418

Query: 541 TWGTPERIALVMSYRYVQK 559
            WGT ER+A+V++Y+ VQK
Sbjct: 419 PWGTSERLAVVLAYKNVQK 437

>Smik_11.370 Chr11 (653235..654554) [1320 bp, 440 aa] {ON} YKR106W
           (REAL)
          Length = 440

 Score =  291 bits (744), Expect = 2e-91,   Method: Compositional matrix adjust.
 Identities = 165/441 (37%), Positives = 252/441 (57%), Gaps = 15/441 (3%)

Query: 153 ESQAVNITRFAVGGCFYQLGLTGIILILEVIASDFSNLNWRLLALFIPALPFIINTWISG 212
            S   +++ +A G  FY  G  G+ LIL +I SDFS L WR+   +    P+II  W+SG
Sbjct: 8   NSLCKHVSIYAAGAVFYNCGYVGVSLILTLILSDFSTLKWRIFYQYSSYWPYIIIPWVSG 67

Query: 213 DVTSAIG--TNWKWGIGMWAFILPLACIPLGICMLHMRYLARKHAKDRLKPEFEALNKLK 270
           ++ +A     NW W I MWAFI PL+ +PL  C++   YL  K  K    PE++AL +  
Sbjct: 68  NIITAAKPEKNWTWDIAMWAFIFPLSSLPL-YCLI--IYLKMKSVKT---PEWKALKERA 121

Query: 271 W---KSFCIDI--AFWKLDIIGMLLITVFFGCVLVPFTLAGGLKEEWKSAHIIVPEVIGW 325
               + F  +I   FW+LD+IG++LITV  GC+LVP TLA G  E+W+S+ II   V G 
Sbjct: 122 HSVKRGFFKNIIFLFWELDVIGIVLITVSTGCILVPLTLAAGASEKWRSSKIIGTLVSGG 181

Query: 326 VVVLPLYMLWEMKYSRHPLTPWDLIKDRGXXXXXXXXXXXXXXWYMQGDYMYTVLVVAVH 385
           V+ L ++M WE  Y+ +PL P+ L+KDRG              +Y+  D++Y VL+V+++
Sbjct: 182 VLFL-IFMFWEASYAHNPLLPFKLLKDRGIWAPLGVAFFNYFTFYIACDFLYPVLLVSMN 240

Query: 386 ESIKSATRITSLYSFVSVIVGTILGFILIKVRRTKPFIIFGISCWIVSFGLLVHYRGDSG 445
           ES  SA RI +L  FV+         ++ K +R K  +I G + W++S GL   +RG  G
Sbjct: 241 ESSTSAARILNLPDFVASTASPFYSLLIAKSKRLKISVIVGCATWMLSMGLFYRFRGGYG 300

Query: 446 AHSGIIGSLCLLGFGAGSFTYVTQASIQASAKTHARMAVVTSLYLATYNIXXXXXXXXXX 505
           +H G+I +  ++GF +G     +   +  +  TH+RMAV+T ++     I          
Sbjct: 301 SHGGVISASVIMGF-SGLLCSNSVIVLLQAMTTHSRMAVMTGIHYTFSRIGAAVGASVSG 359

Query: 506 XXWTNILPKEISKRISDPTLAAQAYSAPFTFITTYTWGTPERIALVMSYRYVQKILCIIG 565
             WT  +P  + K + + TLAA+AY +P++FI +Y WGT ER A+V +Y+YVQ+I+ I+G
Sbjct: 360 GVWTQTMPSRLYKLLGNDTLAAEAYESPYSFIDSYPWGTVERYAVVEAYKYVQRIMMIVG 419

Query: 566 LVFCFPLLGCAFMLRNHELTD 586
           L+   PL   +  +R+ EL D
Sbjct: 420 LICTIPLFAFSLFMRDPELID 440

>YOL158C Chr15 complement(19491..21311) [1821 bp, 606 aa] {ON}
           ENB1Endosomal ferric enterobactin transporter, expressed
           under conditions of iron deprivation; member of the
           major facilitator superfamily; expression is regulated
           by Rcs1p and affected by chloroquine treatment
          Length = 606

 Score =  266 bits (680), Expect = 4e-80,   Method: Compositional matrix adjust.
 Identities = 167/556 (30%), Positives = 286/556 (51%), Gaps = 23/556 (4%)

Query: 70  RVALFFSLFLIAYAYGLDGNIRYTFQAYATSSYSQHSLLSTVNCIKTVIAAVGQIFFARL 129
           + AL  +LFL  Y  GL G I  + Q YA +S+ +HS + ++N +K+++A+V  + +AR+
Sbjct: 63  KTALLVALFLQGYCTGLGGQISQSIQTYAANSFGKHSQVGSINTVKSIVASVVAVPYARI 122

Query: 130 SDIFGRFSIMIVSVIFYSVGTIIESQAVNITRFAVGGCFYQLGLTGIILILEVIASDFSN 189
           SD FGR    I +++ Y++G II +     +    G    Q G +G  L+   +  D S 
Sbjct: 123 SDRFGRIECWIFALVLYTIGEIISAATPTFSGLFAGIVIQQFGYSGFRLLATALTGDLSG 182

Query: 190 LNWRLLALFIPALPFIINTWISGDVTSAIGTN-----WKWGIGMWAFILPLACIPLGICM 244
           L  R  A+ I  +P IINTW+SG++ S++  N     W+WG G++  I+P++ + L +  
Sbjct: 183 LRDRTFAMNIFLIPVIINTWVSGNIVSSVAGNVAPYKWRWGYGIFCIIVPISTLILVLPY 242

Query: 245 LHMRYLARKHAK---DRLKPEFEALNKLKWKSFCIDIAFWKLDIIGMLLITVFFGCVLVP 301
           ++ +Y++ +  K    +LK + + L +  WK F  DI     ++IG++L T F   VL+P
Sbjct: 243 VYAQYISWRSGKLPPLKLKEKGQTLRQTLWK-FADDI-----NLIGVILFTAFLVLVLLP 296

Query: 302 FTLAGGLKEEWKSAHIIVPEVIGWVVVLPLYMLWEMKYSRHPLTPWDLIKDRGXXXXXXX 361
            T+AGG   +W+  HII   V+G  +   ++++WE+K++++P  P   + D         
Sbjct: 297 LTIAGGATSKWREGHIIAMIVVGGCLGF-IFLIWELKFAKNPFIPRVYLGDPTIYVALLM 355

Query: 362 XXXXXXXWYMQGDYMYTVLVVAVHESIKSATRITSLYSFVSVIVGTILGFILIKVRRTKP 421
                    ++ +Y+ TVL+VA  ES  SA RI  LY+F+      ++G +L      K 
Sbjct: 356 EFVWRLGLQIELEYLVTVLMVAFGESTLSAQRIAQLYNFLQSCTNIVVGIMLHFYPHPKV 415

Query: 422 FIIFGISCWIVSFGLLVHYRGDSGAHSGIIGSLCLLGFGAGSFTYVTQASIQASAKTHAR 481
           F++ G    ++  GLL  YR      SG+IG+  ++G   G   +     + AS  TH  
Sbjct: 416 FVVAGSLLGVIGMGLLYKYRVVYDGISGLIGAEIVVGIAGGMIRFPMWTLVHAST-THNE 474

Query: 482 MAVVTSLYLATYNIXXXXXXXXXXXXWTNILPKEISKRISDPTLAAQAYSAPFTFITTYT 541
           MA VT L ++ Y I            WT  L KE+ +R+   +L    Y +P  ++  Y 
Sbjct: 475 MATVTGLLMSVYQIGDAVGASIAGAIWTQRLAKELIQRLGS-SLGMAIYKSPLNYLKKYP 533

Query: 542 WGTPERIALVMSYRYVQKILCIIGLVF-CFPLLGCAFMLRNHELTDSIALEGNDHLKSKD 600
            G+  R+ ++ SY  +Q++L I+ + F  F  + C F LR   +    +L   +  K K 
Sbjct: 534 IGSEVRVQMIESYSKIQRLLIIVSISFAAFNAVLC-FFLRGFTVNKKQSLSAEEREKEK- 591

Query: 601 SFETEEKQESFLKSMI 616
               + KQ+S+L+ +I
Sbjct: 592 ---LKIKQQSWLRRVI 604

>Smik_21.4 Chr21 (1261..3078) [1818 bp, 605 aa] {ON} YOL158C (REAL)
          Length = 605

 Score =  231 bits (589), Expect = 6e-67,   Method: Compositional matrix adjust.
 Identities = 161/554 (29%), Positives = 274/554 (49%), Gaps = 33/554 (5%)

Query: 70  RVALFFSLFLIAYAYGLDGNIRYTFQAYATSSYSQHSLLSTVNCIKTVIAAVGQIFFARL 129
           ++ L  +LFL  Y  GL G I  + Q YA +S+ +HS + ++N +K+++A+V  + +AR+
Sbjct: 62  KITLLVALFLQGYCTGLGGQISQSIQTYAANSFGKHSQVGSINTVKSIVASVVAVPYARM 121

Query: 130 SDIFGRFSIMIVSVIFYSVGTIIESQAVNITRFAVGGCFYQLGLTGIILILEVIASDFSN 189
           SD FGR    + +++ Y+VG II +          G    Q G +G  L+   +  D S 
Sbjct: 122 SDRFGRIECWMFALVLYTVGEIISAATPTFAGLFAGIVIQQFGYSGFRLLATALTGDLSG 181

Query: 190 LNWRLLALFIPALPFIINTWISGDVTSAIGT-----NWKWGIGMWAFILPLACIPLGICM 244
           L  R  A+ I  +P IINTW+SG++ S++       NW+WG G++  I+P + + L +  
Sbjct: 182 LRDRTFAMNIFLIPVIINTWVSGNIVSSVAGHTTPYNWRWGYGIFCIIVPFSTLMLVLPY 241

Query: 245 LHMRYLARKHAKDRLKPEFEALNKLKWKSFCIDIAFWK----LDIIGMLLITVFFGCVLV 300
            + +Y+  ++    L P      KL+ K   +    WK    +++IG++L + F   +L+
Sbjct: 242 AYAQYIGWRNGT--LPPY-----KLREKGQNLRQTLWKIVEDINLIGVILFSAFLVLLLL 294

Query: 301 PFTLAGGLKEEWKSAHIIVPEVIGWVVVLPLYMLWEMKYSRHPLTPWDLIKDRGXXXXXX 360
           P T+AGG   +W+  +II   V+G  +   ++++WE++++++P  P   + D        
Sbjct: 295 PLTIAGGATSKWREGYIIAMIVVGGCLGF-IFLIWELRFAKNPFIPRVYLGDPTIYVALL 353

Query: 361 XXXXXXXXWYMQGDYMYTVLVVAVHESIKSATRITSLYSFVSVIVGTILGFILIKVRRTK 420
                     ++ +Y+ TVL+VA  ES  SA RI  LY+F+      ++G IL      K
Sbjct: 354 MEFVWRLSLQIELEYLVTVLMVAFGESKLSAQRIAQLYNFLQSCTNIVVGIILHFYPHPK 413

Query: 421 PFIIFGISCWIVSFGLLVHYRGDSGAHSGIIGSLCLLGFGAGSFTYVTQASIQASAKTHA 480
            F++ G    ++  GLL  YR      SG+IG+  ++G   G   +     + AS  TH 
Sbjct: 414 LFVVAGSLLGVLGMGLLYKYRVVYDGISGLIGAEIVVGIAGGMIRFPMWTLVHAST-THN 472

Query: 481 RMAVVTSLYLATYNIXXXXXXXXXXXXWTNILPKEISKRISDPTLAAQAYSAPFTFITTY 540
            MA VT L ++ Y I            WT  L KE+ +R+    L    Y +P  ++  Y
Sbjct: 473 EMATVTGLLMSVYQIGDAVGASIAGAIWTQCLAKELIQRLGS-NLGMSIYKSPLNYLKKY 531

Query: 541 TWGTPERIALVMSYRYVQKILCIIGLVF-CFPLLGCAFMLRNHELTDSIALEGNDHLKSK 599
             G+  R  +V SY  +Q++L I+ + F  F  + C F LR   +              K
Sbjct: 532 PIGSEVRDQMVESYSKIQRLLIIVSISFAAFNAVLC-FFLRGFTVNK------------K 578

Query: 600 DSFETEEKQESFLK 613
            SF TEE+++  L+
Sbjct: 579 QSFSTEEREKEKLR 592

>TDEL0H01600 Chr8 complement(273692..275506) [1815 bp, 604 aa] {ON} 
          Length = 604

 Score =  222 bits (566), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 179/619 (28%), Positives = 299/619 (48%), Gaps = 42/619 (6%)

Query: 20  PDILEKE-VGAIVDVNPTLTTSSPAPSYIELIDPGVYNIEIYAEMYSRP----------- 67
           P++L+K+ V    D + +L+ ++  P     +  GV  ++      SR            
Sbjct: 4   PELLKKDHVEEDDDKSSSLSQTNEPP-----LSNGVRRMDAVNATLSRAGSFTAFGVRFQ 58

Query: 68  LYRVALFFSLFLIAYAYGLDGNIRYTFQAYATSSYSQHSLLSTVNCIKTVIAAVGQIFFA 127
             ++AL  +LFL  Y  GL G I  + Q YA +++ +   + ++N +K+V+AA   + +A
Sbjct: 59  TLKIALLIALFLQGYCTGLGGQISQSIQTYAANAFKKQPQIGSINTVKSVVAAAVAVPYA 118

Query: 128 RLSDIFGRFSIMIVSVIFYSVGTIIESQAVNITRFAVGGCFYQLGLTGIILILEVIASDF 187
           RLSD FGR    I +++ Y+VG II +          G    Q G +G  L+   + +D 
Sbjct: 119 RLSDRFGRIECWIFALVLYTVGDIISAATPTFGGLFAGVVIQQFGYSGFRLLATALTADI 178

Query: 188 SNLNWRLLALFIPALPFIINTWISGDVTSAIGT-----NWKWGIGMWAFILPLACIPLGI 242
           S L  R  A+ I  +P IINTW+SG++  ++        W+WG G++  I+P + + L +
Sbjct: 179 SGLRDRTFAMNIFLIPVIINTWVSGNIVDSLAGVKVPYEWRWGYGIFCIIVPFSTLLLIL 238

Query: 243 CMLHMRYLARKHAKDRLKPEFEALNKLK-WKSFCIDIAFWKL----DIIGMLLITVFFGC 297
              + +YLA +  +    P+FE   + + WK      A WKL    ++IG++L T F   
Sbjct: 239 PYAYAQYLAWREGR---LPQFEFRKQGQSWKQ-----ALWKLTEDVNLIGIVLFTAFLVL 290

Query: 298 VLVPFTLAGGLKEEWKSAHIIVPEVIGWVVVLPLYMLWEMKYSRHPLTPWDLIKDRGXXX 357
           VL+P TLAGG   +WK  HII   V+G    + L+ +WE+  ++ P  P   + D     
Sbjct: 291 VLLPLTLAGGASTKWKEGHIIAMIVVGGCCGI-LFFVWELWLAKKPFIPRVYLGDATIYV 349

Query: 358 XXXXXXXXXXXWYMQGDYMYTVLVVAVHESIKSATRITSLYSFVSVIVGTILGFILIKVR 417
                        ++ +Y+ TVL+VA  ES  SA RI  LY+F+      ++G +L    
Sbjct: 350 ALLMEFAWRLALQIELEYLITVLMVAFGESKLSAQRIGQLYNFLQSCTNVVVGIMLHFYP 409

Query: 418 RTKPFIIFGISCWIVSFGLLVHYRGDSGAHSGIIGSLCLLGFGAGSFTYVTQASIQASAK 477
             KPFI+ G    ++  GLL  YR      SG+IG+  ++G  AGS       ++  ++ 
Sbjct: 410 HPKPFIVAGSLLGVLGMGLLYKYRVAYDGISGLIGAEVVVGI-AGSMVRFPMWTLVHAST 468

Query: 478 THARMAVVTSLYLATYNIXXXXXXXXXXXXWTNILPKEISKRISDPTLAAQAYSAPFTFI 537
           +H  MAV T L ++ Y I            WT  L KE+ KR+      A  Y++P +++
Sbjct: 469 SHEEMAVATGLLMSVYQIGNAVGASIAGAIWTQRLAKELIKRLGSKVGLA-VYNSPLSYL 527

Query: 538 TTYTWGTPERIALVMSYRYVQKILCIIGLVFCFPLLGCAFMLRNHELTDSIALEGNDHLK 597
           T Y  G+  R  ++ SY  +Q++L I+ + F        F L  + +++  +    +  K
Sbjct: 528 TKYPLGSEVRNEILESYSEIQRLLIIVSISFAALNAVLCFFLPGYTVSEKQSFTQEEREK 587

Query: 598 SKDSFETEEKQESFLKSMI 616
            K     E KQ+  L+ +I
Sbjct: 588 KK----LEMKQQWPLRRLI 602

>Suva_26.1 Chr26 (1..1602) [1602 bp, 534 aa] {ON} YOL158C (REAL)
          Length = 534

 Score =  218 bits (554), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 144/486 (29%), Positives = 245/486 (50%), Gaps = 17/486 (3%)

Query: 70  RVALFFSLFLIAYAYGLDGNIRYTFQAYATSSYSQHSLLSTVNCIKTVIAAVGQIFFARL 129
           +  L  +LFL  Y  GL G I  + Q YA + + +HS + ++N +K+++++V  + +AR+
Sbjct: 58  KTVLLVALFLQGYCTGLGGQISQSIQTYAANGFGKHSQVGSINTVKSIVSSVVAVPYARM 117

Query: 130 SDIFGRFSIMIVSVIFYSVGTIIESQAVNITRFAVGGCFYQLGLTGIILILEVIASDFSN 189
           SD FGR    I +++ Y+VG II +   N      G    Q G +G  L+   +  D S 
Sbjct: 118 SDRFGRIECWIFALVLYTVGEIISAATPNFGGLFAGIVIQQFGYSGFRLLATALTGDLSG 177

Query: 190 LNWRLLALFIPALPFIINTWISGDVTSAIGTN-----WKWGIGMWAFILPLACIPLGICM 244
           L  R  A+ I  +P IINTW+SG++ S++  +     W+WG G++  I+P + + L +  
Sbjct: 178 LRDRTFAMNIFLIPVIINTWVSGNIVSSLAGSVAPYKWRWGYGIFCIIVPFSTLILVLPY 237

Query: 245 LHMRYLARKHAKD---RLKPEFEALNKLKWKSFCIDIAFWKLDIIGMLLITVFFGCVLVP 301
            + +Y++ ++      +LK + + L +  WK F  DI     ++IG++L T F   VL+P
Sbjct: 238 AYAQYISWRNGTLPPFKLKEKGQNLRQTIWK-FAEDI-----NLIGIILFTAFLVLVLLP 291

Query: 302 FTLAGGLKEEWKSAHIIVPEVIGWVVVLPLYMLWEMKYSRHPLTPWDLIKDRGXXXXXXX 361
            T+AGG   +W+  +II   V+G  +   ++++WE++++++P  P   + D         
Sbjct: 292 LTIAGGATSKWREGYIIAMIVVGGFLGF-IFLIWELRFAKNPFIPRVYLGDPTIYVALLM 350

Query: 362 XXXXXXXWYMQGDYMYTVLVVAVHESIKSATRITSLYSFVSVIVGTILGFILIKVRRTKP 421
                    ++ +Y+ TVL+VA  ES  SA RI  LY+F+      ++G IL      K 
Sbjct: 351 EFVWRLGLQIELEYLVTVLMVAFGESTLSAQRIGQLYNFLQSCTNIVVGIILHFYPHPKV 410

Query: 422 FIIFGISCWIVSFGLLVHYRGDSGAHSGIIGSLCLLGFGAGSFTYVTQASIQASAKTHAR 481
           F++ G    ++  GLL  YR      SG+IG+  ++G   G   +     + AS  TH  
Sbjct: 411 FVVAGSLLGVLGMGLLYKYRVVYDGISGLIGAEIVVGIAGGMIRFPMWTLVHAST-THKE 469

Query: 482 MAVVTSLYLATYNIXXXXXXXXXXXXWTNILPKEISKRISDPTLAAQAYSAPFTFITTYT 541
           MA VT L ++ Y I            WT  L KE+ +R+    L    Y +P  ++  Y 
Sbjct: 470 MATVTGLLMSVYQIGDAVGASIAGAIWTQRLAKELIQRLGY-DLGMSIYKSPLNYLKKYP 528

Query: 542 WGTPER 547
            G+  R
Sbjct: 529 IGSEVR 534

>Skud_6.14 Chr6 complement(19547..21457) [1911 bp, 636 aa] {ON}
           YEL065W (REAL)
          Length = 636

 Score =  190 bits (482), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 155/622 (24%), Positives = 284/622 (45%), Gaps = 29/622 (4%)

Query: 2   DPATANHALPEDFTEDVVPDILEKEVGAIVDVNPTLTTSSPAPSYIELIDP-GVYNIEIY 60
           D  +    + E + E+   D  EK + +I      +T+++      ++I   GV  IE+ 
Sbjct: 9   DSISGKLNVQEKYHEEAKSDAAEKNLVSIDGSLKQITSATSCYDGEKIIKTRGVTRIEVV 68

Query: 61  AEMYSRPLYRVALFFSLFLIAYAYGLDGNIRYTFQAYATSSYSQHSLLSTVNCIKTVIAA 120
            E  S  + R  L  S+FL +    LD    Y +Q YATSS+++HS+LST+    +VI A
Sbjct: 69  REKMSTRV-RWILGLSIFLTSAVAALDATTTYNYQPYATSSFNRHSMLSTLTIANSVIGA 127

Query: 121 VGQIFFARLSDIFGRFSIMIVSVIFYSVGTIIESQAVNITRFAVGGCFYQLGLTGIILIL 180
           V + F A++SD+  R     V ++ Y +G +I + +  I  + VG  F  +G +GI L+ 
Sbjct: 128 VCKPFIAKISDLSSRPVTYFVVLLLYVIGFVITACSPTIAAYVVGSVFIAIGQSGISLMN 187

Query: 181 EVIASDFSNLNWRLLALFIPALPFIINTWISGD-VTSAIGTNWKWGIGMWAFILPLACIP 239
            VI +D + L WR     + ++P+++ TWISG  V   I +NW+WG GM+A I P+A  P
Sbjct: 188 MVIIADTTTLKWRSFFTSLLSVPYLVTTWISGYIVEDIINSNWRWGYGMFAIITPVALTP 247

Query: 240 LGICMLHMRYLARKH----------AKDRLKPEFEALNKLKWKSFCIDIAFWKLDIIGML 289
             + M ++ + A K           +K R++     ++  +     + ++  ++D  G++
Sbjct: 248 AILVMAYLEHQANKTGEIPVGSDPLSKKRIEVTESHVSGFREYWELVKVSLIEIDAFGLI 307

Query: 290 LITVFFGCVLVPFTLAGGLKEEWKSAHIIVPEVIGWVVVLPLYMLWEMKYSRHPLTPWDL 349
           L+   F  +L+P +L    +  W +  +I  EV+G + ++  Y+++E+ ++  PL P  +
Sbjct: 308 LLGFAFSLILLPCSLYSYAEGGWNNPSMIAMEVVGGIFLIS-YVVFEVFFAPFPLLPKRV 366

Query: 350 IKDRGXXXXXXXXXXXXXXWYMQGDYMYTVLVVAVHESIKSATRITSLYSFVSVIVGTIL 409
           + +R                Y    +  +   V ++ S ++   +++  +      G + 
Sbjct: 367 LMNRTFICCVIIDFIYQMAGYFSLLFFTSYTFVVLNLSYRNWVYLSNTTTMGLCFFGVVW 426

Query: 410 GFILIKVRRTKPFIIFGISCWIVSFGLLVHYRGDSGAH--SGIIGSLCLLGFGAGSFTYV 467
           G +     R K F + GI+  ++  GL V      G+     ++ +L +  FG  +    
Sbjct: 427 GALFRGFHRYKIFQVVGIAIKLIGMGLYVTCSKKEGSPGIGLVVAALVVTNFGDAANVMG 486

Query: 468 TQASIQASAKTHARMAVVTSLYLATYNIXXXXXXXXXXXXWTNILPKEISKRISDPTLAA 527
           TQ + QA A  H  MA   S+     +I            WT+ LP  +SK + D   AA
Sbjct: 487 TQVAAQA-AVPHQDMAATISVLSLYSSIGAAVGTAITSAIWTDRLPGALSKYVPDREKAA 545

Query: 528 QAYSAPFTFITTYTWGTPERIALVMSYRYVQKILCIIGLVFCFPLLGCAFMLRNHELTDS 587
            A+    T +    WG+  R   + +Y+ V   L  +GL     +   A    N+ L D 
Sbjct: 546 -AFFESLTTVWEEPWGSANREGAIDAYQEVNYTLFCMGLGVSAIMFIVALFQTNYYLGD- 603

Query: 588 IALEGNDHLKSKDSFETEEKQE 609
                      ++  E E++++
Sbjct: 604 ----------QQNCVEGEQRED 615

>Smik_6.22 Chr6 complement(31536..33446) [1911 bp, 636 aa] {ON}
           YEL065W (REAL)
          Length = 636

 Score =  187 bits (474), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 149/600 (24%), Positives = 278/600 (46%), Gaps = 18/600 (3%)

Query: 2   DPATANHALPEDFTEDVVPDILEKEVGAIVDVNPTLTTSSPAPSYIELIDP-GVYNIEIY 60
           D  +      E   ++   D  EK++ ++      +++S  + +  +++   GV  IE+ 
Sbjct: 9   DSTSGQLNFQEKLHDEARKDAAEKDLISVNGCLQQVSSSITSCNGEKIVKTRGVTRIEVV 68

Query: 61  AEMYSRPLYRVALFFSLFLIAYAYGLDGNIRYTFQAYATSSYSQHSLLSTVNCIKTVIAA 120
            E  S  +  + L  S+FL ++   LD    Y +Q YATSS+++HS+LST+    +VI A
Sbjct: 69  REKMSTKVIWI-LGLSIFLTSWVAALDATTTYNYQPYATSSFNRHSMLSTLTIANSVIGA 127

Query: 121 VGQIFFARLSDIFGRFSIMIVSVIFYSVGTIIESQAVNITRFAVGGCFYQLGLTGIILIL 180
           V + F A++SD+  R     V ++ Y +G +I + + NI+ + +G  F  +G +GI L+ 
Sbjct: 128 VCKPFIAKISDLSSRPVTYFVVLLLYVIGFVITACSPNISAYVIGSVFIAVGQSGISLMN 187

Query: 181 EVIASDFSNLNWRLLALFIPALPFIINTWISG-DVTSAIGTNWKWGIGMWAFILPLACIP 239
            VI +D + L WR     + ++P+++ TWISG  V   I +NW+WG GM+A I P+A  P
Sbjct: 188 MVIIADTTTLKWRSFFTSLLSVPYLVTTWISGYIVEDIINSNWRWGYGMFAIITPVALTP 247

Query: 240 LGICMLHMRYLARKHAK-----DRLKPEFEALNKLKWKSF-----CIDIAFWKLDIIGML 289
             + M ++ + A K  +     D L  +   + + + + F      + ++  ++D  G++
Sbjct: 248 AILVMAYLEHSANKAGEIPIGFDPLAKKKVEVTEARIRGFKVYWELLKVSLIEIDAFGLI 307

Query: 290 LITVFFGCVLVPFTLAGGLKEEWKSAHIIVPEVIGWVVVLPLYMLWEMKYSRHPLTPWDL 349
           L+   F  +L+P +L    +  W +  +I  EV+G ++++  Y+++E+ ++  PL P  +
Sbjct: 308 LLGFAFSLILLPCSLYSYAEGGWNNPSMIAMEVVGGILLIS-YVVFEVFFAPFPLLPKRV 366

Query: 350 IKDRGXXXXXXXXXXXXXXWYMQGDYMYTVLVVAVHESIKSATRITSLYSFVSVIVGTIL 409
           + +R                Y    +  +   V ++ S +    +++  +      G + 
Sbjct: 367 LMNRTFICCVIIDFIYQMAGYFSLLFFTSYTFVVLNLSYRDWVYLSNTTTMGLCFFGVVW 426

Query: 410 GFILIKVRRTKPFIIFGISCWIVSFGLLVHYRGDSGAH--SGIIGSLCLLGFGAGSFTYV 467
           G +     R K F + GI+  ++  GL V      G+     ++ +L +  FG  +    
Sbjct: 427 GALFRGFHRYKIFQVVGIAIKLIGMGLYVACSKKDGSPGIGLVVAALVVTNFGDAANVMG 486

Query: 468 TQASIQASAKTHARMAVVTSLYLATYNIXXXXXXXXXXXXWTNILPKEISKRISDPTLAA 527
           TQ + QA A  H  MA   S+     +I            WT+ LP  + K + D   A 
Sbjct: 487 TQVAAQA-AVPHQDMAATISVLSLYSSIGAAVGTAITSAVWTDQLPGALFKYVPDKEKAV 545

Query: 528 QAYSAPFTFITTYTWGTPERIALVMSYRYVQKILCIIGLVFCFPLLGCAFMLRNHELTDS 587
            A+    T I    WG+  R   + +Y+ V   L  +GL     +   A    N+ L D 
Sbjct: 546 -AFFESLTSIWEEPWGSINREGAISAYQEVNYTLFCMGLGVSSIMFVVALFQTNYYLGDQ 604

>Suva_10.9 Chr10 complement(12679..14592) [1914 bp, 637 aa] {ON}
           YEL065W (REAL)
          Length = 637

 Score =  187 bits (474), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 153/570 (26%), Positives = 261/570 (45%), Gaps = 28/570 (4%)

Query: 53  GVYNIEIYAEMYSRPLYRVALFFSLFLIAYAYGLDGNIRYTFQAYATSSYSQHSLLSTVN 112
           GV  IE+  E  S  +  + L  S+ L A+   LD    Y +Q YATSS+++HS+LST+ 
Sbjct: 62  GVTRIEVVKEKMSTKVTWI-LAASILLTAWIAALDATTTYNYQPYATSSFNRHSMLSTLT 120

Query: 113 CIKTVIAAVGQIFFARLSDIFGRFSIMIVSVIFYSVGTIIESQAVNITRFAVGGCFYQLG 172
              +VI AV + F A++SD+  R     V +I Y +G II + +  I  + VG  F  +G
Sbjct: 121 IANSVIGAVCKPFIAKISDLSSRPVTYFVVLILYVIGFIITACSPTIAAYVVGSVFIAVG 180

Query: 173 LTGIILILEVIASDFSNLNWRLLALFIPALPFIINTWISGD-VTSAIGTNWKWGIGMWAF 231
            +GI L+  VI +D ++L WR     + ++P+++ TWISG  V + I +NW+WG GM+A 
Sbjct: 181 QSGINLMNMVIVADTTSLKWRSFITSLLSVPYLVTTWISGYIVQNIISSNWRWGYGMFAI 240

Query: 232 ILPLACIPLGICMLHMRYLARKHAKDRL--KPEFEALNKLKWKSFCIDIAFWKL------ 283
           I P+A  P  + M ++ + A K  +  +   P  E   +++         +W+L      
Sbjct: 241 ITPVALTPAILVMAYLEHEANKTGEIPIGSDPLTEKKREIRESGISGFKGYWQLLKTSLI 300

Query: 284 --DIIGMLLITVFFGCVLVPFTLAGGLKEEWKSAHIIVPEVIGWVVVLPLYMLWEMKYSR 341
             D  G++L+   F  +L+P +L    +  WK+  +I  EVIG + ++  Y+++E+ ++ 
Sbjct: 301 EIDAFGLILLGFAFSLILLPCSLYSYAEGGWKNPSMIAMEVIGGIFLIS-YVIFEVFFAP 359

Query: 342 HPLTPWDLIKDRGXXXXXXXXXXXXXXWYMQGDYMYTVLVVAVHESIKSATRITSLYSFV 401
            PL P  ++ +R                Y    +  +   V ++ S K+   +++  +  
Sbjct: 360 FPLLPKRVLVNRTFICCVVIDFIYQMGGYFSLLFFTSYTFVVLNLSYKNWVYLSNTTTMG 419

Query: 402 SVIVGTILGFILIKVRRTKPFIIFGISCWIVSFGLLVHYRGDSGAH--SGIIGSLCLLGF 459
               G + G +     R K F + GI+  ++  GL V      G+     I+ +L +  F
Sbjct: 420 LCFFGVVWGVLFRYFHRYKIFQVVGIAIKLIGMGLYVACSKKDGSPGIGLIVAALIVTNF 479

Query: 460 GAGSFTYVTQASIQASAKTHARMAVVTSLYLATYNIXXXXXXXXXXXXWTNILPKEISKR 519
           G  +    TQ + QA A  H  MA   S+     +I            WTN LP  + K 
Sbjct: 480 GDAANVMGTQVAAQA-AVPHQDMAATISVLSLYSSIGAAVGTAITSAVWTNELPGALLKY 538

Query: 520 ISDPTLAAQAYSAPFTFITTYTWGTPERIALVMSYRYVQKILCIIGLVFCFPLLGCAFML 579
           + D   A   + +  T I    WG+  R   + +Y+ V   L  +GL     +   A   
Sbjct: 539 VPDKEKAITFFES-LTLIWQEPWGSENREGAIAAYQEVNYTLFCMGLGVSSIMFIVALFQ 597

Query: 580 RNHELTDSIALEGNDHLKSKDSFETEEKQE 609
            N  L D            ++  E E+K++
Sbjct: 598 TNFYLGD-----------QQNCVEGEQKED 616

>TDEL0A03210 Chr1 (574153..575907) [1755 bp, 584 aa] {ON} 
          Length = 584

 Score =  138 bits (348), Expect = 5e-34,   Method: Compositional matrix adjust.
 Identities = 128/497 (25%), Positives = 224/497 (45%), Gaps = 31/497 (6%)

Query: 78  FLIAYAYGLDGNIRYTFQAYATSSYSQHSLLSTVNCIKTVIAAVGQIFFARLSDIFGR-- 135
           F++A++ G+ G    T   Y TSS+ QHSL +   C         QI   +  DI+GR  
Sbjct: 76  FVLAFSSGIIG----TLTPYVTSSFEQHSLTAFDWCYFNSYCWSDQIALCQSIDIWGRAQ 131

Query: 136 -FSIMIVSVIFYSVGTIIESQAVNITRFAVGGCFYQLGLTGIILILEVIASDFSNLNWRL 194
            F+ M++S+   ++GTI+ +   N+  +     FY +G  GI   + +  +D + L  R 
Sbjct: 132 GFAFMVLSI---TIGTIMMAGCNNVKTYCAAQVFYWVGYNGIDFTITIFIADTTKLKNRA 188

Query: 195 LALFIPALPFIINTWISGDVTSAI--GTNWKWGIGMWAFILPLACIPL-GICMLHMRYLA 251
             L   +  +I   W  G    +I     ++WG G+WA I+P+ C PL G+    + Y  
Sbjct: 189 FILAYTSSCYIATVWAYGPAAESILNTIGFRWGFGIWAIIIPVVCSPLFGL----LYYYQ 244

Query: 252 RKHAKDRLKPEFEALNKLKWKSFCIDIAFW--KLDIIGMLLITVFFGCVLVPFTLAGGLK 309
           +K  K  L P+ E   +  W+S    + F+  + D+IG+ ++ +     L+ F L    K
Sbjct: 245 QKAVKVGLIPKREKSGRTFWQS----VVFYGKEFDVIGIFILALGLALFLLGFNLYSYQK 300

Query: 310 EEWKSAHIIVPEVIGWVVVLPLYMLWEMKYSRHPLTPWDLIKDRGXXXXXXXXXXXXXXW 369
            EW+S  II   +IG ++++  + +WE  ++     PW+L+ +R               +
Sbjct: 301 NEWRSPLIICFLIIGGLLIIS-FGIWEY-FAPVSFIPWELLTNRTVIFTYSMAAAMYCSF 358

Query: 370 YMQGDYMYTVLVVAVHESIKSATRITSLYSFVSVIVGTILGFILIKVRRTKPFIIF-GIS 428
           Y+   Y +       + S   AT IT++YS  S     ++G I+    R K   +F G+ 
Sbjct: 359 YIWDSYFFR-HHCRFNLSTARATYITNIYSIGSCFCALVVGVIIRCYGRLKSIALFWGVP 417

Query: 429 CWIVSFGLLVHYRGDSGAHSGIIGSLCLLGFGAGSFTYVTQASIQA-SAKTHARMAVVTS 487
             ++  GL++ YR        I+     + FG G+     Q ++ A SA+ H  +  V +
Sbjct: 418 ITMLGCGLMIKYRSPDSNLGLIVMCQLFIAFGGGALVICEQMTVMAVSAQQH--IPAVLA 475

Query: 488 LYLATYNIXXXXXXXXXXXXWTNILPKEISKRI-SDPTLAAQAYSAPFTFITTYTWGTPE 546
           +      I            WT I PK++++ + +D      +     T   +Y  GT  
Sbjct: 476 MEAMVIAIGEAVGQTIAGAMWTGIFPKKLAEYLPADVQDQLLSIYGSLTVQISYPRGTAA 535

Query: 547 RIALVMSYRYVQKILCI 563
           R A+  SY   Q+++CI
Sbjct: 536 REAIDRSYGDTQRLMCI 552

>NCAS0I00100 Chr9 complement(4805..5296) [492 bp, 163 aa] {ON} 
          Length = 163

 Score =  107 bits (268), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 59/131 (45%), Positives = 79/131 (60%), Gaps = 2/131 (1%)

Query: 464 FTYVTQASIQASAKTHARMAVVTSLYLATYNIXXXXXXXXXXXXWTNILPKEISKRIS-D 522
           FTY    S QA A +H  MA VT+L    Y I            WT  L  EI KR+  +
Sbjct: 2   FTYPVTVSCQA-ATSHEHMATVTALTYTVYRIGSAVGSAISGCIWTQKLYPEILKRLGGN 60

Query: 523 PTLAAQAYSAPFTFITTYTWGTPERIALVMSYRYVQKILCIIGLVFCFPLLGCAFMLRNH 582
            ++A  AY++P+TFITTYTWGT ER A+V +Y+YVQK+  ++ LVFC PLL  +  LR+ 
Sbjct: 61  VSMATAAYASPYTFITTYTWGTSEREAVVEAYKYVQKLETVVALVFCAPLLMFSLCLRDA 120

Query: 583 ELTDSIALEGN 593
           +LTD +A +G 
Sbjct: 121 KLTDKVAHDGE 131

>Smik_11.369 Chr11 (652600..653106) [507 bp, 168 aa] {ON} YKR106W
           (REAL)
          Length = 168

 Score =  102 bits (255), Expect = 9e-25,   Method: Compositional matrix adjust.
 Identities = 47/121 (38%), Positives = 76/121 (62%)

Query: 58  EIYAEMYSRPLYRVALFFSLFLIAYAYGLDGNIRYTFQAYATSSYSQHSLLSTVNCIKTV 117
           E+ +  ++   YR+ +  + FL  + + LD  +R T+  YAT+SY++HSLLST+  I  V
Sbjct: 45  ELISSQFNSLTYRILILSTAFLCGFGFSLDATLRSTYTGYATNSYAEHSLLSTIQVINAV 104

Query: 118 IAAVGQIFFARLSDIFGRFSIMIVSVIFYSVGTIIESQAVNITRFAVGGCFYQLGLTGII 177
           ++   Q+ F+RLSD FGR  +  V+ I Y +GTI++SQA +++ +A G  FY  G  G+ 
Sbjct: 105 VSVGSQVVFSRLSDYFGRLELFTVASILYIIGTIVQSQAYSVSIYAAGAVFYNCGYVGVS 164

Query: 178 L 178
           L
Sbjct: 165 L 165

>Smik_17.11 Chr17 complement(8582..10216) [1635 bp, 544 aa] {ON}
           YPR198W (REAL)
          Length = 544

 Score = 67.4 bits (163), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 79/347 (22%), Positives = 147/347 (42%), Gaps = 30/347 (8%)

Query: 120 AVGQIFFARLSDIFGRFSIMIVSVIFYSVGTIIESQAVNITRFAVGGCFYQLGLTGIILI 179
           AV  + + RL++I G    +++SV+ + +G++I + +  +     G      G +GI  +
Sbjct: 57  AVFMLLWGRLAEILGTTECLMISVVIFEIGSLISALSNTMGTLIGGRVIAGFGGSGIESL 116

Query: 180 LEVIASDFSNLNWRLLALFIPALPFIINTWISGDVTSAIGTN--WKWG------IGMWAF 231
             V+ +     N+R + +   A+ ++I   +   +  A   +  W+W       IG +AF
Sbjct: 117 AFVVGTSIVQENYRGIMITALAVSYVIAEGVGPFIGGAFNEHLSWRWCFYINLPIGAFAF 176

Query: 232 ILPLACIPLGICMLHMRYLARKHAKDRLKPEFEALNKLKWKSFCIDIAFWKLDIIGMLLI 291
           I    C   G   L  ++L  K         +E      WK     I  +KLD+IG++L 
Sbjct: 177 ISLAFCCASGGKWLSKKWLLSKINSITSYKYYEIFKASFWKK-VFQILVFKLDMIGIILS 235

Query: 292 TVFFGCVLVPFTLAGGLKEEWKSAHIIVPEVIGWVV----------VLPLYML-WEMKYS 340
           +  F  +++  +  GG    W S+ II    +G ++          +LPL  + ++ KY+
Sbjct: 236 SAGFTLLMLGLSF-GGNNFAWNSSIIISFFTLGPILLILFCAYDFHILPLLGVHYKSKYA 294

Query: 341 RHPLTPWDLIKDRGXXXXXXXXXXXXXXWYMQGDYMYTVLVVAVHESIKSATRITSLY-- 398
           R PL  W +  + G              + +Q  Y    LV      +K  + + S++  
Sbjct: 295 R-PLLTWKIASNAGIFTSSITGFFSCFAYELQSAY----LVQLYQLVLKRNSMLASIHLW 349

Query: 399 --SFVSVIVGTILGFILIKVRRTKPFIIFGISCWIVSFGLLVHYRGD 443
             S  ++I      ++  K    KP I+FG+ C IV  G+     G+
Sbjct: 350 ELSIPAMITTMATAYLNAKYGIIKPAIVFGVLCGIVGSGIFTLINGE 396

>Skud_16.503 Chr16 (880571..882202) [1632 bp, 543 aa] {ON} YPR198W
           (REAL)
          Length = 543

 Score = 65.5 bits (158), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 89/381 (23%), Positives = 152/381 (39%), Gaps = 32/381 (8%)

Query: 120 AVGQIFFARLSDIFGRFSIMIVSVIFYSVGTIIESQAVNITRFAVGGCFYQLGLTGIILI 179
           AV  + + RL++I G    +++SVI + VG++I + + ++     G      G +GI  +
Sbjct: 57  AVFMLLWGRLAEILGTNECLMISVIIFEVGSLISALSNSMGTLISGRLIAGFGGSGIESL 116

Query: 180 LEVIASDFSNLNWRLLALFIPALPFIINTWISGDVTSAIGTN--WKWG------IGMWAF 231
             V+ +     N R   +   A  ++I   +   +  A   +  W+W       IG +A 
Sbjct: 117 AFVVGTSIVQENHRGTMITALATSYVIAEGVGPFIGGAFNEHLSWRWCFYINLPIGAFAL 176

Query: 232 ILPLACIPLGICMLHMRYLARKHAKDRLKPEFEALNKLKWKSFCIDIAFWKLDIIGMLLI 291
           I+   C   G  +  +  L++  +    K + E      WK     +  +KLD+IG+ L 
Sbjct: 177 IILAFCNTSGESLPKVSLLSKIKSIMSYKYD-EVFKASFWKK-AFKVFVFKLDMIGVTLS 234

Query: 292 TVFFGCVLVPFTLAGGLKEEWKSAHIIVPEVIGWVVV----------LPLYMLWEMKYSR 341
           +  F  +++  +  GG    W S+ II    +G +++          LPL  L       
Sbjct: 235 SAGFTLLMLGLSF-GGNNFAWNSSTIISLFTVGPILLILFCAYDFHFLPLLGLRYENKRT 293

Query: 342 HPLTPWDLIKDRGXXXXXXXXXXXXXXWYMQGDYMYTVLVVAVHESIKSATRITSLY--- 398
            PL  W +  + G              + +Q  Y    LV      +K    + S++   
Sbjct: 294 KPLLTWSIASNSGIFTSSVTGFFSCFAYELQSAY----LVQLYQLVLKRKPTLASIHLWE 349

Query: 399 -SFVSVIVGTILGFILIKVRRTKPFIIFGISCWIVSFGLLVHYRGDSGAHSGIIGSLCLL 457
            S  ++I    + ++  K    KP I+FG+ C IV  GL     G S   S  IG   L 
Sbjct: 350 LSIPAIIATMAIAYLNAKYGIIKPAIVFGVLCGIVGSGLFTLINGKS---SQSIGYSILP 406

Query: 458 GFGAGSFTYVTQASIQASAKT 478
           G   GS    T  S Q   K+
Sbjct: 407 GLAFGSIFQATLLSSQVQIKS 427

>KLTH0C10120g Chr3 (839780..841735) [1956 bp, 651 aa] {ON} similar
           to uniprot|P33335 Saccharomyces cerevisiae YPR198W SGE1
           Member of drug-resistance protein family multicopy
           suppressor of gal11 null mutation
          Length = 651

 Score = 63.5 bits (153), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 84/377 (22%), Positives = 159/377 (42%), Gaps = 34/377 (9%)

Query: 119 AAVGQIFFARLSDIFGRFSIMIVSVIFYSVGTIIESQAVNITRFAVGGCFYQLGLTGIIL 178
           +A+  + + R++ + G  + +++SV+ + +G++I + + ++     G      G +GI  
Sbjct: 91  SALFTLLWGRMASLLGLKTCLMLSVLIFEIGSLIAAVSNSMGMLIAGRVVAGAGGSGIQS 150

Query: 179 ILEVIASDFSNLNWRLLALFIPALPFIINTWISGDVTSAIGTNWKWGIGMWAFILPLACI 238
           ++ ++ +   +   R + + +    F+ +      +  A+  +  W    W F + L   
Sbjct: 151 LVYIVGTSLVSERSRGMVIMVLTFAFVGSNAGGPILGGALNEHASW---RWCFFINL--- 204

Query: 239 PLGICMLHMRYL----ARKHAKDRLKPEFEALNKLKWKSFC--------IDIAFWKLDII 286
           P+G     M +L    + K     L  + EA    ++ + C        +D+  ++ DII
Sbjct: 205 PIGGAAAFMLFLCYNPSGKPLLSTLTSKLEAARDYRYSNVCTRKFWAHALDLGVFRFDII 264

Query: 287 GMLLITVFFGCVLVPFTLAGGLKEEWKSAHIIVPEVIG--WVVVLPLY-------MLWEM 337
           G  L +  F  +L+  T  G  K  W S   I    +G   +VV  LY       +   +
Sbjct: 265 GFALSSAGFVLLLLGLTFGG-RKYSWSSGTTIAYLTVGPVLIVVFCLYDFLVLPVLARSL 323

Query: 338 KYSRH--PLTPWDLIKDRGXXXXXXXXXXXXXXWYMQGDYMYTVLVVAVHESIKSATRIT 395
            YS    PL PW +I   G              + MQ  Y+     V  +ES  +A+   
Sbjct: 324 AYSSEVTPLVPWPVISKPGVFATSFASFFNFFAYNMQIIYLVQFYQVVHNESPTNASTHM 383

Query: 396 SLYSFVSVIVGTILGFILIKVRRTKPFIIFGISCWIVSFGLLVHYRGDSGAHSGIIGSLC 455
              S  +++V  +LG I  K    KP  + G +C  +  GLL   +G + +   I    C
Sbjct: 384 WALSIPALVVIIVLGRINKKFGILKPVAVIGAACGTIGAGLLTLLKGSTTSGQSI--GYC 441

Query: 456 LLGFGAGSFTYVTQASI 472
           +L  GAG F+ V Q+++
Sbjct: 442 ILA-GAG-FSAVMQSTL 456

>YPR198W Chr16 (934034..935665) [1632 bp, 543 aa] {ON}  SGE1Plasma
           membrane multidrug transporter of the major facilitator
           superfamily, acts as an extrusion permease; partial
           multicopy suppressor of gal11 mutations
          Length = 543

 Score = 61.2 bits (147), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 72/347 (20%), Positives = 140/347 (40%), Gaps = 31/347 (8%)

Query: 120 AVGQIFFARLSDIFGRFSIMIVSVIFYSVGTIIESQAVNITRFAVGGCFYQLGLTGIILI 179
           AV  + + RL++I G    +++SVI + +G++I + + ++     G      G +GI  +
Sbjct: 57  AVFMLLWGRLAEILGTKECLMISVIVFEIGSLISALSNSMATLISGRVVAGFGGSGIESL 116

Query: 180 LEVIASDFSNLNWRLLALFIPALPFIINTWISGDVTSAIGTN--WKWG------IGMWAF 231
             V+ +     N R + +   A+ ++I   +   +  A   +  W+W       IG +AF
Sbjct: 117 AFVVGTSIVRENHRGIMITALAISYVIAEGVGPFIGGAFNEHLSWRWCFYINLPIGAFAF 176

Query: 232 ILPLACIPLGICMLHMRYLARKHAKDRLKPEFEALNKLKWKSFCIDIAFWKLDIIGMLLI 291
           I+   C   G    H +       K  +  ++  L K  +     ++  +KLD++G++L 
Sbjct: 177 IILAFCNTSG--EPHQKMWLPSKIKKIMNYDYGELLKASFWKNTFEVLVFKLDMVGIILS 234

Query: 292 TVFFGCVLVPFTLAGGLKEEWKSAHIIVPEVIGWVVVLPLYMLWEMKYSRH--------- 342
           +  F  +++  +  GG    W S  II    +G     P+ +L    Y  H         
Sbjct: 235 SAGFTLLMLGLSF-GGNNFPWNSGIIICFFTVG-----PILLLLFCAYDFHFLSLSGLHY 288

Query: 343 ------PLTPWDLIKDRGXXXXXXXXXXXXXXWYMQGDYMYTVLVVAVHESIKSATRITS 396
                 PL  W++  + G              + +Q  Y+  +  +   +    A+    
Sbjct: 289 DNKRIKPLLTWNIASNCGIFTSSITGFLSCFAYELQSAYLVQLYQLVFKKKPTLASIHLW 348

Query: 397 LYSFVSVIVGTILGFILIKVRRTKPFIIFGISCWIVSFGLLVHYRGD 443
             S  ++I    + ++  K    KP I+FG+ C IV  GL     G+
Sbjct: 349 ELSIPAMIATMAIAYLNSKYGIIKPAIVFGVLCGIVGSGLFTLINGE 395

>Skud_7.560 Chr7 (917668..919596) [1929 bp, 642 aa] {ON} YGR224W
           (REAL)
          Length = 642

 Score = 60.8 bits (146), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 91/381 (23%), Positives = 155/381 (40%), Gaps = 41/381 (10%)

Query: 127 ARLSDIFGRFSIMIVSVIFYSVGTIIESQAVNITRFAVGGCFYQLGLTGIILILEVIASD 186
            R++   G    M+ +++ + VG++I + A ++     G     +G  GI  +  VI S+
Sbjct: 132 GRIATPIGFKRTMLFAIVIFEVGSLISALANSMNVLIGGRVIAGVGGCGIQSLSFVIGSN 191

Query: 187 FSNLNWRLLALFIPALPF----IINTWISGDVTSAIGTNWKWGI-------GMWAFILPL 235
               + R + + I +  F    ++  ++ G  TS +   W+W         G+  F+  +
Sbjct: 192 LVEESNRGVLIAILSCSFAIASVVGPFLGGVFTSRV--TWRWCFYINLPIGGLTFFLFLM 249

Query: 236 ACIPLGICMLH-MRYLAR---------KHAKDRLKPEFEALNKLKWKSFCIDIAFWKLDI 285
            C P        +R + R         +     L    E   +  WK    ++ F   DI
Sbjct: 250 FCNPDPHTFQETVRNILRIPSQLIEFVRKVGHHLSKVKELGKRTSWKILLTELVFM-YDI 308

Query: 286 IGMLLITVFFGCVLVPFTLAGGLKEEWKSAHIIVPEVIGWVVVL----------PLYMLW 335
           I  +L T  F  +L+ FT  GG +  W SA IIV  VIG ++V+          P + + 
Sbjct: 309 IEFVLCTAGFTSILLAFTF-GGNRYAWDSAEIIVLFVIGVILVILAAVYDFFVFPKFDVV 367

Query: 336 EMKYSRHPLTPWDLIKDRGXXXXXXXXXXXXXXWYMQGDYMYTVLVVAVHESI-KSATRI 394
           +      PL  W  IK  G              +  Q  Y+     +  ++S  K+A  +
Sbjct: 368 KTAPRYQPLMSWRNIKRPGIFTVNIALFLLCTGYISQFTYIVQYFQLIYNDSAWKAAVHL 427

Query: 395 TSLYSFVSVIVGTILGFILIKVRRTKPFIIFGISCWIVSFGLLVHYRGDSGAHSGIIGSL 454
            +     +VI   + G I  K R+ KP I+      +V  GLL     +S ++S  IG L
Sbjct: 428 VACI-IPTVITSVVCGVITDKTRQIKPIIVISSILGVVGAGLLTLLN-NSASNSAHIGLL 485

Query: 455 CLLGFGAGSFTYVTQASIQAS 475
            L G    +F  + Q+S+ AS
Sbjct: 486 ILPGI---AFGGLMQSSMLAS 503

>Smik_16.81 Chr16 complement(152022..153515,153516..153899) [1878
           bp, 625 aa] {ON} YGR224W (REAL)
          Length = 625

 Score = 57.4 bits (137), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 95/386 (24%), Positives = 158/386 (40%), Gaps = 51/386 (13%)

Query: 127 ARLSDIFGRFSIMIVSVIFYSVGTIIESQAVNITRFAVGGCFYQLGLTGIILILEVIASD 186
            R++   G  + M+ +++ + +G++I + A ++     G     +G  GI  +  VI S 
Sbjct: 117 GRIATPIGFKATMLFAIVIFEIGSLISALASSMNMLIGGRVIAGIGGCGIQSLSFVIGST 176

Query: 187 FSNLNWRLLALFIPALPF----IINTWISGDVTSAIGTNWKW------GIGMWAFILPLA 236
               + R + + I +  F    ++  ++ G  TS++   W+W       IG  AF L + 
Sbjct: 177 LVEESKRGMLIAILSSSFAIASVVGPFLGGVFTSSV--TWRWCFYINLPIGGLAFFLFVL 234

Query: 237 CIPLGICMLH--MRYL----------ARKHAKDRLK-PEFEALNKLKWKSFCIDIAFWKL 283
               G+      M+ +           RK A   LK   F   N   WK   I++ F   
Sbjct: 235 FYNPGLHTFRETMKNIPRIPSQFVKVVRKVAHHSLKVKNFNKSNS--WKKLFIELVFM-Y 291

Query: 284 DIIGMLLITVFFGCVLVPFTLAGGLKEEWKSAH----------IIVPEVIGWVVVLPLYM 333
           D+I ++L +  F  +L+ FT  GG +  W S            +++  +I    V P + 
Sbjct: 292 DVIELVLCSAGFTSILLAFTF-GGNRYAWNSTSIIILFIVGIILVISAIIYDFFVFPKFN 350

Query: 334 LWEMKYSRHPLTPWDLIKDRGXXXXXXXXXXXXXXWYMQGDYMYTVLVVAVHESI-KSAT 392
           L +   S  PL  W  IK  G              +  Q  Y+     +  ++S  K+A 
Sbjct: 351 LVKATPSYQPLMLWRNIKKPGVFTVNIALFLLCAGYISQFTYIVQYFQLIYNDSAWKAAV 410

Query: 393 R-ITSLYSFVSVIVGTILGFILIKVRRTKPFIIFGISCWIVSFGL--LVHYRGDSGAHSG 449
             IT + S  +VI   + G I  K R+ KP I+      +V  GL  L++    S AH  
Sbjct: 411 HLITCVIS--TVITAIVCGVITDKTRQIKPIIVISSILGVVGAGLLTLLNNNASSSAH-- 466

Query: 450 IIGSLCLLGFGAGSFTYVTQASIQAS 475
            IG L L G   G    + Q+S+ AS
Sbjct: 467 -IGLLILPGIAFGG---LAQSSMLAS 488

>KNAG0K01020 Chr11 complement(198213..200012) [1800 bp, 599 aa] {ON}
           
          Length = 599

 Score = 57.4 bits (137), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 96/384 (25%), Positives = 165/384 (42%), Gaps = 46/384 (11%)

Query: 122 GQIFFARLSDIFGRFSIMIVSVIFYSVGTIIESQAVNITRFAVGGCFYQLGLTGIILILE 181
           G+I F+ L    G  + M+ +++ + +G++I + A ++     G     +G +GI  +  
Sbjct: 114 GRIAFSFL----GFKTAMLSAIVIFEIGSLICALANSMDMLIGGRVIAGIGGSGIQSLSF 169

Query: 182 VIASDFSNLNWR-LLALFIPA---LPFIINTWISGDVTSAIGTNWKWGIGMWAFILPLAC 237
           VI S   +   R  +  F+ A   +  +I  +I G  TS +   W+W    W   LP+  
Sbjct: 170 VIGSTLVSPRGRGFIIAFMSASFGIASVIGPFIGGAFTSHV--TWRWC--FW-INLPVGA 224

Query: 238 IPLGICMLHMRYLARKHAK---DRLKPEFEALNKLKWKSFCIDIAFWKLDIIGMLLITVF 294
           + L I         +K        LK   E + K+++K     + F KLDII  +LI+  
Sbjct: 225 VALVIFTWVYNPTGKKQVLLTIHDLKELSEKVKKVRFKDLLKHLLF-KLDIIEFMLISAG 283

Query: 295 FGCVLVPFTLAGGLKEEWKSAHIIVPEVIGWV----------VVLPLYMLWEMKYSRH-P 343
             C+L+ FT  GG + +W S  II+  VIG            V+ P   + +  Y ++ P
Sbjct: 284 IVCILLAFTF-GGNRFKWGSYSIILLFVIGGCLVIVALVYDFVIFPNLQIVKANYIQYQP 342

Query: 344 LTPWDLIKDRGXXXXXXXXXXXXXXWYMQGDYMYTVLVVAVHESIKSATRITSLYSFVSV 403
           L  W  ++ RG              +  Q     TV  V   + I +++   +    ++V
Sbjct: 343 LISWKNLRIRGIFTASMTTFFFCIGYMSQ-----TVYYVQFFQLIYNSSPWKASIHLIAV 397

Query: 404 IVGTIL-----GFILIKVRRTKPFIIFGISCWIVSFGL--LVHYRGDSGAHSGIIGSLCL 456
           ++ T+L     GF+  K    KP  + G+   ++  GL  L+    +S  H   IG L L
Sbjct: 398 MIPTVLTAVVCGFLNGKFGYVKPITVAGMCLAVIGAGLLTLLDNHSNSAQH---IGLLIL 454

Query: 457 LG--FGAGSFTYVTQASIQASAKT 478
            G  FGA +   +  A I+   K+
Sbjct: 455 PGVAFGACNQCTMMAAQIELDKKS 478

>NCAS0C03460 Chr3 complement(690089..691981) [1893 bp, 630 aa] {ON} 
          Length = 630

 Score = 56.6 bits (135), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 87/387 (22%), Positives = 151/387 (39%), Gaps = 44/387 (11%)

Query: 124 IFFARLSDIFGRFSIMIVSVIFYSVGTIIESQAVNITRFAVGGCFYQLGLTGIILILEVI 183
           + + R++ I G  S M+ ++I + +G++I   A ++     G     +G +GI  +  VI
Sbjct: 131 LLWGRIASIIGFKSCMLAAIIIFEIGSLISGVANSMNMLIGGRVIAGVGGSGIQSLAFVI 190

Query: 184 ASDFSNLNWRLLALFIPALPFIINTWISGDVTSAIGTNWKWGIGMWAFILPLACIPLGIC 243
            S+  +   R L +   +  F + + I   +  A  T+  W    W F + L    +   
Sbjct: 191 GSNLVDERRRGLIIACMSSAFAVASVIGPFLGGAFTTHATW---RWCFYINLPVGGVAFA 247

Query: 244 MLHMRYLARKHAKDRLK-----PEF-------EALNKLK----WKSFCIDIAFWKLDIIG 287
           +  + Y  ++ + + +       EF         +  LK    WKS    + F + DII 
Sbjct: 248 LFVVFYNPQRKSLEGISILSSLKEFCNTLRQITVIKNLKNWPTWKSIVYSLVF-RFDIIE 306

Query: 288 MLLITVFFGCVLVPFTLAGGLKEEWKSAHIIVPEVIGWV----------VVLPLYMLWEM 337
            +  +  F  VL+ FT  GG +  W SA IIV  VIG +          V+ P +   + 
Sbjct: 307 FIFCSAGFVLVLLAFTF-GGNQYNWSSASIIVMFVIGIILLIVSLLYDFVIFPRFKAVKE 365

Query: 338 KYSRHPLTPWDLIKDRGXXXXXXXXXXXXXXWYMQGDYMYTVLVVAVHESIKSATRITSL 397
                PL  W +    G              +  Q     TV ++   + ++  T   + 
Sbjct: 366 NSLYQPLIKWSIFSHPGIFTANAALFFECTAYICQ-----TVYIIQFFQLVRGNTAWKAA 420

Query: 398 YSFVSVIVGTIL-----GFILIKVRRTKPFIIFGISCWIVSFGLLVHYRGDSGAHSGIIG 452
              ++ +V T++     G    K    K     G+   +V  GLL     +S +    IG
Sbjct: 421 VHLIATVVPTVITTFSSGIANSKFGLVKHVTFIGVVTSLVGAGLLTLLDNNSSSAKH-IG 479

Query: 453 SLCL--LGFGAGSFTYVTQASIQASAK 477
            L L  +GFGA   + +  A IQ   K
Sbjct: 480 LLILPGIGFGATMQSTMIGAQIQLDKK 506

>KLTH0B00132g Chr2 (4664..6370) [1707 bp, 568 aa] {ON} similar to
           uniprot|P36172 Saccharomyces cerevisiae YKR105C
           Hypothetical ORF
          Length = 568

 Score = 52.4 bits (124), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 81/361 (22%), Positives = 143/361 (39%), Gaps = 29/361 (8%)

Query: 120 AVGQIFFARLSDIFGRFSIMIVSVIFYSVGTIIESQAVNITRFAVGGCFYQLGLTGIILI 179
           A+  + + RLS + G    +I  +I +  G++I + A ++     G     +G +G+  +
Sbjct: 93  ALFSLLWGRLSAVLGPRISVISCIILFETGSLISALAKSMNMLISGRVIAGVGGSGLQTL 152

Query: 180 LEVIASDFSNLNWRLLALFIPALPFIINTWISGDVTSAIGTNWKWGIGMWAFILPLACIP 239
             VI     N   R L L +    F + + +   +  A  T+  W    W F + L    
Sbjct: 153 SLVIGCQLVNEKSRPLVLSLLNCTFAVASIVGPFLGGAFTTHVTW---RWCFYINLPIGG 209

Query: 240 LGICMLHMRYLARKHAKDRLKPEFEALNKL--------KWKSFCIDIAFWKLDIIGMLLI 291
           L I +    Y       D L+   +   KL          K   +D   +  DI+  +L 
Sbjct: 210 LAIAIFIFFY--NPEGADLLEKGSQTFKKLLSYRRANLSLKQL-LDQLLFGFDIVSFVLF 266

Query: 292 TVFFGCVLVPFTLAGGLKEEWKSAHIIVPEVIGWVVVLPLYMLWEMKYSRH--------P 343
           T  +   L+  T  GG    WKS  I++  +I  V+++ L ++++ +   H        P
Sbjct: 267 TAGWLLFLLALTF-GGQTHPWKSG-IVISFIIVGVLLIALSLIYDFRLFDHIKTMDTFRP 324

Query: 344 LTPWDLIKDRGXXXXXXXXXXXXXXWYMQGDYMYTVL-VVAVHESIKSATRITSLYSFVS 402
           L  W L+  R               + +Q  Y      +V    + K+   +  +   VS
Sbjct: 325 LLSWHLMSQRAILNANFTGFFSTIAYNVQMIYSVQFFQLVYGFSAWKAGLHLIPI--LVS 382

Query: 403 VIVGTIL-GFILIKVRRTKPFIIFGISCWIVSFGLLVHYRGDSGAHSGIIGSLCLLGFGA 461
            +V +I  G I+ K    KP ++FG +  ++  GL++     S  H+  IG L L G   
Sbjct: 383 TVVFSIASGVIIKKTGHIKPLLVFGSAMGVLGSGLMILLNNTSTKHTQ-IGVLILPGVAL 441

Query: 462 G 462
           G
Sbjct: 442 G 442

>KLTH0C10142g Chr3 (842371..844092) [1722 bp, 573 aa] {ON} similar
           to uniprot|P33335 Saccharomyces cerevisiae YPR198W SGE1
           Member of drug-resistance protein family multicopy
           suppressor of gal11 null mutation
          Length = 573

 Score = 52.0 bits (123), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 85/379 (22%), Positives = 145/379 (38%), Gaps = 44/379 (11%)

Query: 124 IFFARLSDIFGRFSIMIVSVIFYSVGTII----ESQAVNITRFAVGGCFYQLGLTGIILI 179
           + + RL+ I G  + +  S++ + +G++I     S  + I    V GC    G +GI  +
Sbjct: 60  LLWGRLASILGLKTSLTFSIVIFEIGSLIVAVSNSMGMIIGGRVVAGC----GGSGIQSL 115

Query: 180 LEVIASDFSNLNWRLLALFIPALPFIINTWISGDVTSAIGTNWKWGIGMWAFILPLACIP 239
           + V+ +       R + + +  L F +   +   +  A   N  W    W F + L    
Sbjct: 116 VFVVGTSLVEERNRGMVITVLGLAFAVAFAVGPVIGGAFTENVSW---RWCFYINLPIGG 172

Query: 240 LGICMLHMRY-LARKHAKDRLKPEFEALNKLKWKSFCIDIAFWK---------LDIIGML 289
           + + ML   Y    K  ++ L      L   ++  + +  +FW+         LD IG  
Sbjct: 173 VALTMLTFSYNTTEKSVQETLTYNCRQLQTYRYGQW-VTASFWRRAYNFLMFDLDFIGFA 231

Query: 290 LITVFFGCVLVPFTLAGGLKEEWKSAHIIVPEVIGWVVVL--------PLY--MLWEMKY 339
           L +  F   ++  T  GG    W S  II    +G ++VL         LY    W  K 
Sbjct: 232 LSSTGFVLFMLGLTF-GGNTYAWNSGTIISFLTVGAILVLFWLVFDFVLLYKWAAWCRKR 290

Query: 340 SRHPLTPWDLIKDRGXXXXXXXXXXXXXXWYMQGDYMYTVLVVAVHESIKSATRITSLYS 399
              PL    L    G              + MQ     TV +V +++ + ++    +   
Sbjct: 291 EATPLLRRSLCFRPGIFTSSIANLFTCFGFNMQ-----TVYIVQLYQLVFNSGPTAASMH 345

Query: 400 FVSVIVGTILGFILIKVRRT-----KPFIIFGISCWIVSFGLLVHYRGDSGAHSGIIGSL 454
             + ++ T++  I+I          KP I+FG +C +V  GL+   R  S     +IG  
Sbjct: 346 LWAFLIATMVSVIIIGKAAAIFGLIKPAIVFGATCGLVGSGLMTLVRNTS-TTGNVIGYC 404

Query: 455 CLLGFGAGSFTYVTQASIQ 473
            L G   GS    T  S Q
Sbjct: 405 ILPGAAFGSIMQGTLLSAQ 423

>SAKL0A08228g Chr1 complement(732518..734227) [1710 bp, 569 aa] {ON}
           similar to uniprot|P33335 Saccharomyces cerevisiae
           YPR198W SGE1 Member of drug-resistance protein family
           multicopy suppressor of gal11 null mutation
          Length = 569

 Score = 50.4 bits (119), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 86/380 (22%), Positives = 164/380 (43%), Gaps = 36/380 (9%)

Query: 120 AVGQIFFARLSDIFGRFSIMIVSVIFYSVGTIIESQAVNITRFAVGGCFYQLGLTGIILI 179
           A+  + + R + IFG  + ++VS+I + +G+++ + + ++     G      G +GI  +
Sbjct: 69  ALFTLLWGRFAVIFGSKTTLMVSIIIFEIGSLVIAVSNSMDMIIGGRVIAGCGASGIQTL 128

Query: 180 LEVIASDFSNLNWRLLALFIPALPFIINT----WISGDVTSAIGTNWKWGIGMWAFILPL 235
           +  IA+   + + R   + + +L + + +    +I G +T  +   W+W    +   LP+
Sbjct: 129 VFAIATSLVDEHTRGTIVTLLSLSYAVASALGPYIGGALTEYV--TWRW---CFYINLPI 183

Query: 236 ACIPLGICMLHMRYLARK-------HAKDRLKPEFEALNKLKWKSFCIDIAFWKLDIIGM 288
             + LG+  L      RK         K     EF+ L  LK+    +    ++LD  G 
Sbjct: 184 GGLALGVFYLSYNPAQRKVLKCFPHFFKSVTSLEFKQLLSLKFYRMLLKFLVFELDFFGF 243

Query: 289 LLITVFFGCVLVPFTLAGGLKEEWKSAHIIVPEVIG--WVVVLPLY------MLWEMKYS 340
              +V F  +L+     GG    W+S  II   V+G  ++V+  +Y      M W+ + +
Sbjct: 244 TFCSVGF-VLLLLGLTFGGNLHPWQSGTIIAYLVVGSFFIVIFFVYEFVIFDMFWQSQRN 302

Query: 341 RH--PLTPWDLIKDRGXXXXXXXXXXXXXXWYMQGDYMYTVLVVAVHES-IKSATRITSL 397
            +  PL  W      G              + +Q  ++  +  +   +S  ++A+ + SL
Sbjct: 303 GNARPLISWTTFSKSGIFTATATMFFGCCAYNLQSIHVVQLFQLVFGQSPSRAASHLWSL 362

Query: 398 Y--SFVSVIVGTILGFILIKVRRTKPFIIFGISCWIVSFGLLVHYRGDSGAHSGIIGSLC 455
              +FVS+I+    G I  +    KP  +F     ++  GLL    G+S  +S  IG   
Sbjct: 363 LIPAFVSIIIS---GKITSRYGYVKPITLFAGISGVIGAGLLTLLNGES-TNSEQIGYAI 418

Query: 456 LLG--FGAGSFTYVTQASIQ 473
           L G  FG  + + +  A IQ
Sbjct: 419 LSGAAFGCINLSTLLSAQIQ 438

>SAKL0A00726g Chr1 (82164..83960) [1797 bp, 598 aa] {ON} similar to
           uniprot|P36172 Saccharomyces cerevisiae YKR105C
           Hypothetical ORF
          Length = 598

 Score = 50.4 bits (119), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 56/247 (22%), Positives = 102/247 (41%), Gaps = 23/247 (9%)

Query: 127 ARLSDIFGRFSIMIVSVIFYSVGTIIESQAVNITRFAVGGCFYQLGLTGIILILEVIASD 186
            R + I G  S M++S+I + VG+++ + A ++     G     +G +G+  +  +I S 
Sbjct: 99  GRAASIIGFKSSMLLSIIIFEVGSLVSALANSMNMLIGGRVISGVGGSGLQTLCFLIIST 158

Query: 187 FSNLNWRLLALFIPALPFIINTWISGDVTSAIGTNWKWGIGMWAFI--LPLACIPLGICM 244
             N   R +A+ + +  F + + +   +  A  T+  W    W F   LP+  +   + +
Sbjct: 159 LVNERSRGMAISVLSCSFAVASIVGPFLGGAFTTHVTW---RWCFYINLPIGGLAFLVFV 215

Query: 245 LHMRYLARKHAKDRLKP-------EFEALNKLKWKSFCIDIAFWKLDIIGMLLITVFFGC 297
           L          K+  K        +F  L K K      +   +K D +G  L +  F  
Sbjct: 216 LSYNPNGGNSIKNFTKAVRSISHVDFGGLLKAKSYYNTFEKLVFKFDFVGFALCSAGFCL 275

Query: 298 VLVPFTLAGGLKEEWKSAHIIVPEVIGWVVVLPLYMLWEMKYSR----------HPLTPW 347
           +L+  T  GG +  W S  II   VIG V+ +  ++     ++R           PL  W
Sbjct: 276 ILLGLTF-GGNEYSWGSGTIIAYLVIGIVLSIAFFLYDFFVFNRFKAPRENMVYRPLVSW 334

Query: 348 DLIKDRG 354
           ++I   G
Sbjct: 335 NVISKPG 341

>Kwal_26.9616 s26 (1294683..1296371) [1689 bp, 562 aa] {ON} YPR198W
           (SGE1) - Member of drug-resistance protein family
           [contig 363] FULL
          Length = 562

 Score = 50.1 bits (118), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 75/376 (19%), Positives = 150/376 (39%), Gaps = 29/376 (7%)

Query: 120 AVGQIFFARLSDIFGRFSIMIVSVIFYSVGTIIESQAVNITRFAVGGCFYQLGLTGIILI 179
           A+  + + R++ + G  + ++ S++ +  G+++ + A ++     G      G +GI  +
Sbjct: 56  ALCMLLWGRIASLVGLKNSLVASIVIFEAGSLLAALATSMGMLIGGRVIAGFGGSGIETL 115

Query: 180 LEVIASDFSNLNWRLLALFIPALPFIINTWISGDVTSAIGTNWKWGIGMWAFILPLACIP 239
           +  + +   +   R   + I  + +++       +  A   +  W    W F + +    
Sbjct: 116 VFAVGTRMVDEKHRARVVTILGIAYMLAEGAGPFIGGAFAEHVSW---RWCFFINIPIGG 172

Query: 240 LGICMLHMRYL-ARKHAKDRLKPEFEALNKLKWKSF--------CIDIAFWKLDIIGMLL 290
           + + +L   Y  A +   + L   +++  K  WK           + +  ++LDI+G+LL
Sbjct: 173 VALAILCWGYNPAGRTPINALNHYWKSYRKCSWKKVFRLTSLTKVVKLFIYQLDIVGLLL 232

Query: 291 ITVFFGCVLVPFTLAGGLKEEWKSAHIIVPEVIGWVVVLPLYMLWEM-----------KY 339
            +  F  +++  T  GG K  W SA II    IG + +L ++ML++              
Sbjct: 233 SSGGFALIMLALTF-GGNKFAWNSASIICMFTIG-IALLGIFMLYDFVVLPYIGRRLENG 290

Query: 340 SRHPLTPWDLIKDRGXXXXXXXXXXXXXXWYMQGDYMYTVLVVAVHESIKSATRITSLYS 399
              PL PW L  +                + +Q  Y+     +  +E    A+      S
Sbjct: 291 EAMPLVPWSLACNMPILTSSMAGFFNSFAFELQSIYLVQYYQLVTNEGPVFASIHLWQMS 350

Query: 400 FVSVIVGTILGFILIKVRRTKPFIIFGISCWIVSFGLLVHYRGDSGAHSGIIGSLCLLGF 459
             ++I   +   I  K    KP I+ G+    +  GLL  + G + +    IG   L G 
Sbjct: 351 VPALITVIVSAAINEKFGIVKPIIVTGVVFGFIGSGLLTLF-GSNTSTGASIGYSMLAG- 408

Query: 460 GAGSFTYVTQASIQAS 475
              SF  V Q S+ +S
Sbjct: 409 --ASFGCVYQLSLLSS 422

>KLTH0D16962g Chr4 (1399514..1401229) [1716 bp, 571 aa] {ON} similar
           to uniprot|P33335 Saccharomyces cerevisiae YPR198W SGE1
           Member of drug-resistance protein family multicopy
           suppressor of gal11 null mutation
          Length = 571

 Score = 47.8 bits (112), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 70/259 (27%), Positives = 102/259 (39%), Gaps = 26/259 (10%)

Query: 248 RYLARKHAKDRLKPEFEALNKLKWKSFCIDIAFWKLDIIGMLLITVFFGCVLVPFTLAGG 307
           R LAR   + R  P    L    W+     + F +LDI G+ L +  F  V++  T  GG
Sbjct: 191 RALARFWVRARAFPYGTLLQAQFWRRAAALMVF-RLDIPGLALSSGGFALVMLALTF-GG 248

Query: 308 LKEEWKSAHIIVPEVIGWVVVLPLYMLWEM-----------KYSRHPLTPWDLIKDRGXX 356
            +  W+SA I+   V G   +L L+ML++             Y   PL PW L  +    
Sbjct: 249 NQYAWRSATIVCMFVFG-AALLALFMLYDFVVLPRVGARIAGYEPLPLVPWRLAANVPVL 307

Query: 357 XXXXXXXXXXXXWYMQGDYM--YTVLVVAVHESIKSATR-ITSLYSFVSVIVGTILGFIL 413
                       + +Q  Y+  Y  LVV    ++ S      SL + VSVI   ++    
Sbjct: 308 TSSLCGFFNCFAFELQSIYLVQYYQLVVNKGPTLASVHLWQMSLPALVSVIASAVVN--- 364

Query: 414 IKVRRTKPFIIFGISCWIVSFGLLVHYRGDSGAHSGIIGSLCLLGFGAGSFTYVTQASIQ 473
            +    KP ++ G+    V  GLL   R D+      IG   L G   G    ++  S Q
Sbjct: 365 ERFGVVKPLVLAGVVMGFVGSGLLTLVRSDTTLGQS-IGFSVLAGASFGCVYQLSLISAQ 423

Query: 474 ASAKT-----HARMAVVTS 487
              +      HAR   VTS
Sbjct: 424 LQVERDDPDFHARFIEVTS 442

>Kwal_56.23754 s56 complement(690851..692620) [1770 bp, 589 aa] {ON}
           YBR293W - Hypothetical ORF [contig 173] FULL
          Length = 589

 Score = 47.8 bits (112), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 49/210 (23%), Positives = 87/210 (41%), Gaps = 9/210 (4%)

Query: 73  LFFSLFLIAYAYGLDGNIRYTFQAYATSSYSQHSLLSTVNCIKTVIAAVGQIFFARLSDI 132
           +  S+FL  +   LDG I  T      S ++    +S +     + ++  Q  + +LSD 
Sbjct: 84  IMISMFLGIFLAALDGTIVSTLLTRIGSEFNSLDKVSWIATSYLLSSSTCQPLYGKLSDQ 143

Query: 133 FGRFSIMIVSVIFYSVGTIIESQAVNITRFAVGGCFYQLGLTGIILILEVIASDFSNLNW 192
            GR  +++ S + +S+G +I   + +I    VG     +G  G+  +  ++ SD   L  
Sbjct: 144 LGRKPLLVFSNVVFSIGCLICGMSTSIWWVVVGRFVSGIGGCGLTCLASMVISDLVPLRE 203

Query: 193 RLLALFIPALPFIINTWISGDVTSAIGTNWKWGIGMWAFILPLACIPLGICMLHMRYLA- 251
           R +   +    F + T  SG +  A   +W+      AF +    I L  C L + YL  
Sbjct: 204 RAVYQGLCNFIFGLGT-ASGGLVGAAFQDWR-----MAFTIQCP-ISLASCALIVSYLEL 256

Query: 252 -RKHAKDRLKPEFEALNKLKWKSFCIDIAF 280
             +H  D+ +     L  L W      + F
Sbjct: 257 PPRHEDDKDRHWTSKLRDLDWAGVVTLVCF 286

>TDEL0G03260 Chr7 (605429..607267) [1839 bp, 612 aa] {ON} 
          Length = 612

 Score = 47.4 bits (111), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 109/443 (24%), Positives = 179/443 (40%), Gaps = 45/443 (10%)

Query: 71  VALFFSLFLIAYAYGLDGNIRYTFQAYATSSYSQHSLLSTVNCIKTVIAAVGQIFFARLS 130
           ++L  S+FL A    LD  I  T        +  +S    +    ++ +A+  + + R++
Sbjct: 59  ISLILSIFLAA----LDIMIVSTIIENVAREFGDYSKTGWIYAGYSLPSALLTLIWGRIA 114

Query: 131 DIFGRFSIMIVSVIFYSVGTIIESQAVNITRFAVGGCFYQLGLTGIILILEVIASDFSNL 190
            + G  S M+ ++I + VG+++ + A ++     G     LG +GI  +  VI S     
Sbjct: 115 AVCGFKSSMLTAIIIFEVGSLVAALANSMDMLIGGRVIAGLGGSGIQTLCFVIISTLVEE 174

Query: 191 NWRLLALFIPALPF----IINTWISGDVTSAIGTNWKW---------GIGMWAFILPLAC 237
           + R L +      F    ++  ++ G  T+ +   W+W         G+    FIL    
Sbjct: 175 SKRGLLIACMGSAFGIASVVGPFLGGAFTTHV--TWRWCFWINLPIGGLAFAFFILFYN- 231

Query: 238 IPLGICMLHMRYLAR--KHAKDRLKPEFEALNKLKWKSFCIDIAFWKLDIIGMLLITVFF 295
            P G     + Y+    K     LK   + L    W+    ++  +K DII   L T   
Sbjct: 232 -PHGSDQTFVGYVTDFFKQVGGWLKNSGKLLKLSTWRMIVHEL-IYKFDIIEFALCTT-- 287

Query: 296 GCVLVPFTLA-GGLKEEWKSAHIIVPEVIGWVVVLPLYMLWE------MKYSR-----HP 343
           G VL+   L+ GG K  W S   I   VIG +V + L ++++      +K  R      P
Sbjct: 288 GLVLILLALSFGGNKYAWNSGSTIAMFVIGILVTI-LALVYDFAIFPRLKVVRENPRYQP 346

Query: 344 LTPWDLIKDRGXXXXXXXXXXXXXXWYMQGDYMYTVLVVAVHESIKSATRITSLYSFVSV 403
           L P  + K                 +  Q +Y+     +  +E+   A+ I  +   V  
Sbjct: 347 LIPLRVAKKFFICVNNIAVFFVCMAFMAQVNYIIQFFQLIYNETAWKAS-IHVIACVVPT 405

Query: 404 IVGTILGFIL-IKVRRTKPFIIFGISCWIVSFGLLVHYRGDSGAHSGIIGSLCLLG--FG 460
           ++  I   IL  K    KP  + GI+  IV  GLL      S  +S  IG L L G  FG
Sbjct: 406 VITVITSGILNSKFGIVKPINVLGITAAIVGAGLLTLLTNKS-TNSEHIGLLILPGVAFG 464

Query: 461 AGSFTYVTQASIQASAK-THARM 482
           A   + +  + IQ   K TH RM
Sbjct: 465 ATMQSTLIGSQIQLDKKSTHYRM 487

>TDEL0F03990 Chr6 (740471..742366) [1896 bp, 631 aa] {ON} Anc_8.272
           YDR119W
          Length = 631

 Score = 47.4 bits (111), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 70/294 (23%), Positives = 129/294 (43%), Gaps = 43/294 (14%)

Query: 2   DPATANHALP------EDFTEDVVPDILEKEVGAIVDVNPTLTTSSPAPSYIELIDP--G 53
           +P  A+  LP      +D + D+ P  + +E+G   +V         A  Y  + DP  G
Sbjct: 42  EPIEASLLLPIKPEILQDPSTDL-PGFVAEEIGQQEEV---------ANGYGSITDPHDG 91

Query: 54  VYNIE---IYAEMYSRPLYRVALFFSLFLIAYAYGLDGNIRYTFQAYATSSYSQHSLLST 110
               E     AE  S    RV +  S++L  +   +D  I  T  A+  S ++Q S +S 
Sbjct: 92  DNKSERPVSTAEEISGARLRV-IMLSMYLGIFLAAIDNTIVSTTSAHVASEFNQLSKVSW 150

Query: 111 VNCIKTVIAAVGQIFFARLSDIFGRFSIMIVSVIFYSVGTIIESQAVN-----ITRFAVG 165
           +     + +A  Q  + ++SDIFGR  +++ + + + +G ++   + +     I RF  G
Sbjct: 151 IATSYLLSSATFQPLYGKVSDIFGRKCLLVFTNVAFLIGCLMCGLSKSFWWLVIARFVAG 210

Query: 166 GCFYQLGLTGIILILEVIASDFSNLNWRLLALFIPALPFIINTWISGDVTSAIGTNWKWG 225
                +G  G+  +  +  +D   L  R +   I  + + + T   G V      N K G
Sbjct: 211 -----VGGGGLTSMSSITITDLVPLRERAMYQGICNVFYGLGTACGGIVGGWFSDN-KGG 264

Query: 226 IGMWAFIL--PLACIPLGICMLHMRYLARKHAKDRLKPEFEALNKLKWKSFCID 277
             M AF++  PL+ I L + +LH++  +++  +++        N +K K   ID
Sbjct: 265 WRM-AFLIQVPLSAISLLVIILHLKLPSKRATRNQ-------DNSIKRKLLAID 310

>Smik_13.272 Chr13 complement(427283..428968) [1686 bp, 561 aa] {ON}
           YMR088C (REAL)
          Length = 561

 Score = 46.6 bits (109), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 36/152 (23%), Positives = 64/152 (42%), Gaps = 5/152 (3%)

Query: 42  PAPSYIELIDPGVYNIEIYAEMYSRPLYRVALFFSLFLIAYAYGLDGNIRYTFQAYATSS 101
           P P  +E +      +E     Y+  L +  + FSL+L ++   LDG I           
Sbjct: 12  PVPEEVETLP-----LEQKFHEYNLALPKFPILFSLWLGSFLSSLDGTIVANIMNRVAEE 66

Query: 102 YSQHSLLSTVNCIKTVIAAVGQIFFARLSDIFGRFSIMIVSVIFYSVGTIIESQAVNITR 161
           +S+ S    +     +     Q  + +LSDI GR S ++ +  F+ +G ++   A N+T 
Sbjct: 67  FSESSRKQWIATSFLLTNTAFQPLYGKLSDITGRKSALLTAHFFFGIGCLLTCFARNVTE 126

Query: 162 FAVGGCFYQLGLTGIILILEVIASDFSNLNWR 193
           F++      +G  G+  I  +  SD      R
Sbjct: 127 FSIARAICGIGAGGLNAIGSIAVSDICTARER 158

>KLLA0A04631g Chr1 complement(415070..416809) [1740 bp, 579 aa] {ON}
           weakly similar to uniprot|Q04602 Saccharomyces
           cerevisiae YDR119W Uncharacterized transporter
          Length = 579

 Score = 45.8 bits (107), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 32/120 (26%), Positives = 60/120 (50%)

Query: 76  SLFLIAYAYGLDGNIRYTFQAYATSSYSQHSLLSTVNCIKTVIAAVGQIFFARLSDIFGR 135
           S+ L ++   LD  I  T  ++  S +++ S +S +     + +A  Q  + ++SDIFGR
Sbjct: 66  SMCLGSFLAALDNTIVTTLLSHIASEFNELSHISWIATAYLLSSATFQPLYGKISDIFGR 125

Query: 136 FSIMIVSVIFYSVGTIIESQAVNITRFAVGGCFYQLGLTGIILILEVIASDFSNLNWRLL 195
             ++I+S +F+ +G +I   + N+     G     +G  G+  +  + ASD   L  R L
Sbjct: 126 RPLIIISNLFFILGCLICGLSKNLWTLVAGRFIAGIGGGGVTSLGSITASDIVPLRSRAL 185

>Kpol_543.44 s543 (96992..98923) [1932 bp, 643 aa] {ON}
           (96992..98923) [1932 nt, 644 aa]
          Length = 643

 Score = 45.4 bits (106), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 65/284 (22%), Positives = 122/284 (42%), Gaps = 16/284 (5%)

Query: 73  LFFSLFLIAYAYGLDGNIRYTFQAYATSSYSQHSLLSTVNCIKTVIAAVGQIFFARLSDI 132
           +  S++L  +   LD  I  T  A+  S +++   +S V     + +A  Q  + ++SDI
Sbjct: 123 IMLSMYLGIFLAALDNTIVSTLLAHIASEFNELPRISWVATAYLLSSATFQPIYGKISDI 182

Query: 133 FGRFSIMIVSVIFYSVGTIIESQAVNITRFAVGGCFYQLGLTGIILILEVIASDFSNLNW 192
           FGR  ++I   I + VG++I   + +      G     +G  GI  +  +  SD   L  
Sbjct: 183 FGRKVVLIFCNITFFVGSLICGLSPSFEWLVAGRFIAGIGGGGITSMSSITTSDIVPLRN 242

Query: 193 RLLALFIPALPFIINTWISGDVT---SAIGTNWKWGIGMWAFILPLACIPLGICMLHMRY 249
           R L   I    F + T + G V    S     W+     +   LP+A     + +L +R 
Sbjct: 243 RALYQGICNFYFGLGTALGGVVGGWFSDRSVGWRMS---FLIQLPIAFFSTILIILFLR- 298

Query: 250 LARKHAKDRLKPEFEALNKLKWKSFCIDIAFWKLDIIGMLLITVFFGCVLVPFTLAGGLK 309
           L ++     L+ +    + +K +   +D   W    IG   + +F    ++  +L G  K
Sbjct: 299 LPKESKGRGLQVDGNYFSTIKVRLSAVD---W----IGATTLVLFLFSFMITASLGG--K 349

Query: 310 EEWKSAHIIVPEVIGWVVVLPLYMLWEMKYSRHPLTPWDLIKDR 353
           E   ++H  +   +  V+   ++   E+K ++ P+ P   +KDR
Sbjct: 350 EIPYTSHKFIGLCVVTVIGALIFGYTELKIAKDPILPLRFLKDR 393

>ZYRO0C01430g Chr3 complement(101140..102912) [1773 bp, 590 aa] {ON}
           weakly similar to uniprot|Q04602 Saccharomyces
           cerevisiae YDR119W Uncharacterized transporter
          Length = 590

 Score = 45.1 bits (105), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 65/289 (22%), Positives = 118/289 (40%), Gaps = 36/289 (12%)

Query: 75  FSLFLIAYAYGLDGNIRYTFQAYATSSYSQHSLLSTVNCIKTVIAAVGQIFFARLSDIFG 134
            S++L  +    DG +  T  A+  S +++   +S +     + +A  Q  + +LSDIFG
Sbjct: 83  LSMYLGIFLAAADGTLVSTIMAHIASEFNELPRISWIATAYLLSSATFQPLYGKLSDIFG 142

Query: 135 RFSIMIVSVIFYSVGTIIESQAVNI-----TRFAVGGCFYQLGLTGIILILEVIASDFSN 189
           R  +++++ I + VG ++     +       RF  G     +G  G+  +  +  SD   
Sbjct: 143 RKPLLMLNNIVFLVGCLMCGLTPSFWGLVGARFISG-----IGGGGVTSMCSITISDIVP 197

Query: 190 LNWRLLALFIPALPFIINTWISGDVT---SAIGTNWKWGIGMWAFIL--PLACIPLGICM 244
           L  R L   +    F + T   G V    S  G  W+      AF++  PL+ +   +  
Sbjct: 198 LRDRALYQGMCNFFFGLGTACGGVVGGWFSDHGGGWR-----MAFLIQVPLSALSSLLIA 252

Query: 245 LHMRYLARKHAKDRLKPEFEALNKLKWKSFCIDIAFWKLDIIGMLLITVFFGCVLVPFTL 304
           + M+   R     R+       NKL             +D IG   + VF    LV  +L
Sbjct: 253 VFMKLPPRSK---RVNSPASIKNKL-----------LSVDWIGASALVVFLSLFLVTASL 298

Query: 305 AGGLKEEWKSAHIIVPEVIGWVVVLPLYMLWEMKYSRHPLTPWDLIKDR 353
            G  KE   ++   V   IG  +    ++  E+  ++ P+ P   +++R
Sbjct: 299 GG--KEIAFNSKTFVALCIGSSLACAFFIGVELYGAKDPILPLSFLRNR 345

>NDAI0H02200 Chr8 complement(536385..538100) [1716 bp, 571 aa] {ON} 
           YGR224W
          Length = 571

 Score = 44.7 bits (104), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 39/165 (23%), Positives = 71/165 (43%), Gaps = 4/165 (2%)

Query: 33  VNPTLTTSS--PAPSYIELIDPGVYNIEIYAEMYSRPLY--RVALFFSLFLIAYAYGLDG 88
           ++P   TSS  PA S IE +  G Y I +  + +   L   +V +  SL+L ++   LD 
Sbjct: 1   MDPLDETSSLLPARSTIEEVPEGEYEISLEKKYHEHNLSLPKVPILSSLWLGSFFSSLDS 60

Query: 89  NIRYTFQAYATSSYSQHSLLSTVNCIKTVIAAVGQIFFARLSDIFGRFSIMIVSVIFYSV 148
            I           +++      +     +     Q  + +LSDI GR   ++ +  F+ +
Sbjct: 61  TIVANIMNRVAEEFAESDKKQWIATSFLLTNTAFQPLYGKLSDITGRKFAVLTAHFFFGL 120

Query: 149 GTIIESQAVNITRFAVGGCFYQLGLTGIILILEVIASDFSNLNWR 193
           G ++   A N+T+F++      +G  GI  +  +  SD      R
Sbjct: 121 GCLLTCFAQNVTQFSIARAICGMGAGGINAMSSITTSDICTTRER 165

>Skud_14.406 Chr14 (740510..742204) [1695 bp, 564 aa] {ON} YNR072W
           (REAL)
          Length = 564

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 47/201 (23%), Positives = 84/201 (41%), Gaps = 31/201 (15%)

Query: 89  NIRYTFQAYATSS---YSQHSLLSTVNCIKTVIAAVGQIFFARLSDIFGRFSIMIVSVIF 145
           N +  F +Y  S+   Y  +  +  +  + +V  A+G + FAR +D  GR   +++ V+ 
Sbjct: 86  NFKMNFGSYKHSTGEYYLSNVRMGLLVAMFSVGCAIGGLIFARFADKLGRRLAIVIVVLV 145

Query: 146 YSVGTIIE-SQAVNITRFAVGGCFYQLGLTGIILILEVIASDFSNLNWR--LLALFIPAL 202
           Y VG II+ S +    ++ VG   Y LG  G  ++  ++ S+ +  + R  L++L+   +
Sbjct: 146 YMVGAIIQISSSHKWYQYFVGKIIYGLGAGGCSVLCPMLLSEIAPKDLRGGLISLYQLNM 205

Query: 203 PFIINTWISGDVTSAIGTNWKWGIGMWAFILPLACIPLGICML--------------HMR 248
            F I         S  GT        W        +PLG+C L                R
Sbjct: 206 TFGIFL----GYCSVYGTRKYDDTAQWR-------VPLGLCFLWALIIIVGMLLVPESPR 254

Query: 249 YLARKHAKDRLKPEFEALNKL 269
           YL  +   +  +     +NK+
Sbjct: 255 YLIEREKHEEARISLAKINKV 275

>Suva_13.265 Chr13 complement(424929..426614) [1686 bp, 561 aa] {ON}
           YMR088C (REAL)
          Length = 561

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 35/152 (23%), Positives = 63/152 (41%), Gaps = 5/152 (3%)

Query: 42  PAPSYIELIDPGVYNIEIYAEMYSRPLYRVALFFSLFLIAYAYGLDGNIRYTFQAYATSS 101
           PAP   E++      +E     Y+  L +  + FSL+L ++   LD  I           
Sbjct: 12  PAPEEAEVLP-----LEQKYHEYNLALPKFPILFSLWLGSFLSSLDSTIVANIMNRVAEE 66

Query: 102 YSQHSLLSTVNCIKTVIAAVGQIFFARLSDIFGRFSIMIVSVIFYSVGTIIESQAVNITR 161
           +S+ S    +     +     Q  + +LSDI GR   ++ +  F+ +G ++   A N+T 
Sbjct: 67  FSESSKKQWIATSFLLTNTAFQPLYGKLSDIIGRRPALLTAQFFFGLGCLMTCFARNVTE 126

Query: 162 FAVGGCFYQLGLTGIILILEVIASDFSNLNWR 193
           F++      +G  G+  I  +  SD      R
Sbjct: 127 FSIARAVCGIGAGGLNAISSIAVSDICTARER 158

>YNR072W Chr14 (772657..774351) [1695 bp, 564 aa] {ON}  HXT17Hexose
           transporter, up-regulated in media containing raffinose
           and galactose at pH 7.7 versus pH 4.7, repressed by high
           levels of glucose
          Length = 564

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 42/163 (25%), Positives = 74/163 (45%), Gaps = 17/163 (10%)

Query: 89  NIRYTFQAYATSS---YSQHSLLSTVNCIKTVIAAVGQIFFARLSDIFGRFSIMIVSVIF 145
           N +  F +Y  S+   Y  +  +  +  + ++  A+G + FARL+D  GR   +++ V+ 
Sbjct: 86  NFKMNFGSYKHSTGEYYLSNVRMGLLVAMFSIGCAIGGLIFARLADTLGRRLAIVIVVLV 145

Query: 146 YSVGTIIE-SQAVNITRFAVGGCFYQLGLTGIILILEVIASDFSNLNWR--LLALFIPAL 202
           Y VG II+ S      ++ VG   Y LG  G  ++  ++ S+ +  + R  L++L+   +
Sbjct: 146 YMVGAIIQISSNHKWYQYFVGKIIYGLGAGGCSVLCPMLLSEIAPTDLRGGLVSLYQLNM 205

Query: 203 PFIINTWISGDVTSAIGTNWKWGIGMWAFILPLACIPLGICML 245
            F I         S  GT        W        +PLG+C L
Sbjct: 206 TFGIFL----GYCSVYGTRKYDNTAQWR-------VPLGLCFL 237

>KLTH0G13464g Chr7 complement(1154304..1156085) [1782 bp, 593 aa]
           {ON} weakly similar to uniprot|Q04602 Saccharomyces
           cerevisiae YDR119W Uncharacterized transporter
          Length = 593

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 74/320 (23%), Positives = 130/320 (40%), Gaps = 27/320 (8%)

Query: 38  TTSSPAPSYIELIDPGVYNIEI--YAEMYSRPLYRVALFFSLFLIAYAYGLDGNIRYTFQ 95
           TT S   S  E  D G   +     AE Y      + + FS+FL  +   LDG I  T  
Sbjct: 51  TTKSSISSENEREDAGGATVAGCGSAEFYLPSSRILIIMFSMFLGIFLAALDGTIVSTLL 110

Query: 96  AYATSSYSQHSLLSTVNCIKTVIAAVGQIFFARLSDIFGRFSIMIVSVIFYSVGTIIESQ 155
            +  S ++     S +     + ++  Q  + +LSD  GR  +++ S   +++G +I   
Sbjct: 111 THIGSEFNSLDKASWIATSYLLSSSTCQPLYGKLSDRLGRKPLLVFSNAVFAIGCLICGL 170

Query: 156 AVNITRFAVGGCFYQLGLTGIILILEVIASDFSNLNWRLLALFIPALPFIINTWISGDVT 215
           + +I     G     +G  G+  +  +I SD   L  R +   +    F + T  SG + 
Sbjct: 171 SNSIWAVVAGRFISGIGGCGLTSLATMIMSDLVPLRDRAVYQGLCNFVFGLGT-ASGGLV 229

Query: 216 SAIGTNWKWGIGMWAFIL--PLACIPLGICMLHMRYLARKHAKDRLKPEFEALNKLKWKS 273
            A   +W+      AFIL  P++ +  GI  L + YL        L P   A NK  W +
Sbjct: 230 GAYFRDWR-----LAFILQCPISVLS-GI--LIVVYL-------ELPPRASASNKDCWSA 274

Query: 274 FCIDIAFWKLDIIGMLLITVFFGCVLVPFTLAGGLKEEWKSAHIIVPEVIGWVVVLPLYM 333
                   +LD  G   +  F    ++  ++ GG    + S  +        +V   +++
Sbjct: 275 -----RLRRLDWAGATSLIAFLFLFMLTSSM-GGSSVAYGS-RLFAAMCAATLVFGAVFV 327

Query: 334 LWEMKYSRHPLTPWDLIKDR 353
             E++ +  P+ P   ++DR
Sbjct: 328 YVELRVAADPVLPVTFLRDR 347

>YEL069C Chr5 complement(21537..23231) [1695 bp, 564 aa] {ON}
           HXT13Hexose transporter, induced in the presence of
           non-fermentable carbon sources, induced by low levels of
           glucose, repressed by high levels of glucose
          Length = 564

 Score = 43.5 bits (101), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 42/163 (25%), Positives = 74/163 (45%), Gaps = 17/163 (10%)

Query: 89  NIRYTFQAYATSS---YSQHSLLSTVNCIKTVIAAVGQIFFARLSDIFGRFSIMIVSVIF 145
           N +  F +Y  S+   Y  +  +  +  + ++  A+G + FARL+D  GR   +++ V+ 
Sbjct: 86  NFKMNFGSYKHSTGEYYLSNVRMGLLVAMFSIGCAIGGLIFARLADTLGRRLAIVIVVLV 145

Query: 146 YSVGTIIE-SQAVNITRFAVGGCFYQLGLTGIILILEVIASDFSNLNWR--LLALFIPAL 202
           Y VG II+ S      ++ VG   Y LG  G  ++  ++ S+ +  + R  L++L+   +
Sbjct: 146 YMVGAIIQISSNHKWYQYFVGKIIYGLGAGGCSVLCPMLLSEIAPTDLRGGLVSLYQLNM 205

Query: 203 PFIINTWISGDVTSAIGTNWKWGIGMWAFILPLACIPLGICML 245
            F I         S  GT        W        +PLG+C L
Sbjct: 206 TFGIFL----GYCSVYGTRKYDNTAQWR-------VPLGLCFL 237

>Skud_13.244 Chr13 complement(417271..418959) [1689 bp, 562 aa] {ON}
           YMR088C (REAL)
          Length = 562

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 30/123 (24%), Positives = 56/123 (45%)

Query: 64  YSRPLYRVALFFSLFLIAYAYGLDGNIRYTFQAYATSSYSQHSLLSTVNCIKTVIAAVGQ 123
           Y+  L +  + FSL+L ++   LD  I           +S+ S    +     +     Q
Sbjct: 29  YNLALPKFPILFSLWLGSFLSSLDSTIVANIMNRVAEDFSESSRKQWIATSFLLTNTAFQ 88

Query: 124 IFFARLSDIFGRFSIMIVSVIFYSVGTIIESQAVNITRFAVGGCFYQLGLTGIILILEVI 183
             + +LSDI GR S ++++  F+ +G ++   A N+T F++      +G  G+  I  + 
Sbjct: 89  PLYGKLSDITGRKSALLIAQFFFGLGCLLTCFARNVTEFSIARAICGIGAGGLNAISSIA 148

Query: 184 ASD 186
            SD
Sbjct: 149 VSD 151

>YKR105C Chr11 complement(658716..660464) [1749 bp, 582 aa] {ON}
           VBA5Putative transporter of the Major Facilitator
           Superfamily (MFS); proposed role as a basic amino acid
           permease based on phylogeny
          Length = 582

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 82/379 (21%), Positives = 147/379 (38%), Gaps = 35/379 (9%)

Query: 120 AVGQIFFARLSDIFGRFSIMIVSVIFYSVGTIIESQAVNITRFAVGGCFYQLGLTGIILI 179
           A+  + + R + I G    +I++++ +  G++I + A ++     G     +G +G+  +
Sbjct: 86  AILSLIWGRFASIIGFQHSLILAILIFEAGSLIAALASSMNMLIFGRVVAGVGGSGLQTL 145

Query: 180 LEVIASDFSNLNWRLLALFIPALPFIINTWISGDVTSAIGTNWKWGIGMWAFILPLACIP 239
             VI         R L + I +  F +   +   +  A  T+  W    W F + L    
Sbjct: 146 CFVIGCTMVGERSRPLVISILSCAFAVAAIVGPIIGGAFTTHVTW---RWCFYINLPIGG 202

Query: 240 LGICMLHMRYLAR-KHAKDRLKPEFEALNKLKWKSFCIDIAFWKLDIIGMLLITVFFGCV 298
           L I M  + Y A  K    ++K     ++   +  F   + F +L + G++    FFG  
Sbjct: 203 LAIIMFLLTYKAENKGILQQIKDAIGTISSFTFSKFRHQVNFKRL-MNGIIFKFDFFGFA 261

Query: 299 L-----VPFTLA---GGLKEEWKSAHIIVPEVIGWVVVLPLYMLWEM-----------KY 339
           L     V F L    GG K  W S  +I   V+G V++    ++++              
Sbjct: 262 LCSAGLVLFLLGLTFGGNKYSWNSGQVITYLVLG-VLLFIFSLVYDFFLFDKFNPEPDNI 320

Query: 340 SRHPLTPWDLIKDRGXXXXXXXXXXXXXXWYMQGDYMYTV---LVVAVHESIKSATRITS 396
           S  PL    L+                  +   G  +Y+V    ++    + K+   +  
Sbjct: 321 SYRPLLLRRLVAKPAIIIVNMVTFLLCTGY--NGQMIYSVQFFQLIFASSAWKAGLHLIP 378

Query: 397 LYSFVSVIVGTILGFILIKVRRTKPFIIFGISCWIVSFGLLVHYRGDSGAHSGIIGSLCL 456
           +    +VI     G I  K+   KP +IFG    ++  GL+      S   S  IG L L
Sbjct: 379 IV-ITNVIAAIASGVITKKLGLVKPLLIFGGVLGVIGAGLMTLMTNTS-TKSTQIGVLLL 436

Query: 457 LGFGAGSFTYVTQASIQAS 475
            GF  G   +  QAS+ ++
Sbjct: 437 PGFSLG---FALQASLMSA 452

>SAKL0C05588g Chr3 (527748..529781) [2034 bp, 677 aa] {ON} similar
           to uniprot|P36172 Saccharomyces cerevisiae YKR105C
           Hypothetical ORF
          Length = 677

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 58/250 (23%), Positives = 106/250 (42%), Gaps = 23/250 (9%)

Query: 124 IFFARLSDIFGRFSIMIVSVIFYSVGTIIESQAVNITRFAVGGCFYQLGLTGIILILEVI 183
           + + R + I G  S ++VS++ +  G++I + + ++     G     +G +GI  +  VI
Sbjct: 171 LLWGRFATIIGFKSSLLVSILIFEAGSLISAISNSMNMLIGGRVVAGIGGSGIQSLCFVI 230

Query: 184 ASDFSNLNWRLLALFIPALPFIINTWISGDVTSAIGTNWKWGIGMWAFILPLACIPLGIC 243
           AS  +    R++ + + +  + +   +   +  A+ T+  W    W F + L    L   
Sbjct: 231 ASTLTPDRSRVIIISVLSCSYAVAAVVGPFLGGALTTHVTW---RWCFYINLPIGGLAFV 287

Query: 244 MLHMRY--LARKHAKDRL---KPEF-EALNKLKWKSFCIDIAFW---KLDIIGMLLITVF 294
           +L M Y    RK  KD     K  +   + +L    F   I  W   ++D +G +L T  
Sbjct: 288 VLAMVYNPSGRKSIKDVFSVTKANYRRGMGRLLTARFYSKIPNWLVFQIDFVGFVLCTAG 347

Query: 295 FGCVLVPFTLAGGLKEEWKSAHIIVPEVIGWVVV----------LPLYMLWEMKYSRHPL 344
           F  +L+  T  G +   W S  IIV  V+G +++           P +       S  PL
Sbjct: 348 FTLLLLGLTFGGSM-YAWSSGTIIVSLVVGVLLITASLVYDFALFPRFKQVRKDASCMPL 406

Query: 345 TPWDLIKDRG 354
            PW ++   G
Sbjct: 407 LPWRVVSRPG 416

>AGR076C Chr7 complement(871564..873624) [2061 bp, 686 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR119W
          Length = 686

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 35/145 (24%), Positives = 65/145 (44%)

Query: 70  RVALFFSLFLIAYAYGLDGNIRYTFQAYATSSYSQHSLLSTVNCIKTVIAAVGQIFFARL 129
           R  +  S+ L  +   LDG I  T   +  S +++   +S +     + +A  Q  + +L
Sbjct: 139 RRVVMASMCLGVFLAALDGTIVTTLLDHIASEFNELPRISWIATAYLLSSATFQPLYGKL 198

Query: 130 SDIFGRFSIMIVSVIFYSVGTIIESQAVNITRFAVGGCFYQLGLTGIILILEVIASDFSN 189
           SDIFGR  +++ S + + +G +I   + N+    +G     +G  G+  +  +  +D   
Sbjct: 199 SDIFGRRPLLVFSNLVFCLGALICGMSKNLWVLVLGRFVAGIGGGGLTSMCSITTTDIVP 258

Query: 190 LNWRLLALFIPALPFIINTWISGDV 214
           L  R L   I  + F + T   G V
Sbjct: 259 LRSRALYQGICNVFFGLGTACGGLV 283

>TBLA0F03040 Chr6 complement(735352..738072) [2721 bp, 906 aa] {ON}
           Anc_8.272 YDR119W
          Length = 906

 Score = 42.4 bits (98), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 37/141 (26%), Positives = 63/141 (44%), Gaps = 2/141 (1%)

Query: 53  GVYNIEIYAEMYSRPLYRVALFFSLFLIAYAYGLDGNIRYTFQAYATSSYSQHSLLSTVN 112
           G   IE   EM +  +    +  S++L  +   LD  +  T  A+  S ++Q   +  V 
Sbjct: 381 GTLPIEPSVEMSNMKMN--IIMCSMYLGVFLAALDNTVVSTLMAHIGSEFNQIPKVPWVA 438

Query: 113 CIKTVIAAVGQIFFARLSDIFGRFSIMIVSVIFYSVGTIIESQAVNITRFAVGGCFYQLG 172
               + +AV Q  + +LSDIFGR +++I S + +  G II   + ++     G     +G
Sbjct: 439 TSYLLSSAVFQPLYGKLSDIFGRKALLIFSNLIFFFGCIICGMSNSLNMLVWGRFVAGIG 498

Query: 173 LTGIILILEVIASDFSNLNWR 193
             GI  +  +  SD   L  R
Sbjct: 499 GGGITSMTTITVSDIVPLRSR 519

>YJR158W Chr10 (732440..734143) [1704 bp, 567 aa] {ON}  HXT16Protein
           of unknown function with similarity to hexose
           transporter family members, expression is repressed by
           high levels of glucose
          Length = 567

 Score = 42.4 bits (98), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 42/163 (25%), Positives = 74/163 (45%), Gaps = 17/163 (10%)

Query: 89  NIRYTFQAYATSS---YSQHSLLSTVNCIKTVIAAVGQIFFARLSDIFGRFSIMIVSVIF 145
           N +  F +Y  S+   Y  +  +  +  + +V  ++G + FARL+D  GR   +++ V+ 
Sbjct: 89  NFKMNFGSYKHSTGEYYLSNVRMGLLVAMFSVGCSIGGVAFARLADTLGRRLAIVIVVLV 148

Query: 146 YSVGTIIE-SQAVNITRFAVGGCFYQLGLTGIILILEVIASDFSNLNWR--LLALFIPAL 202
           Y VG II+ S      ++ VG   Y LG  G  ++  ++ S+ +  + R  L++L+   +
Sbjct: 149 YMVGAIIQISSNHKWYQYFVGKIIYGLGAGGCSVLCPMLLSEIAPTDLRGGLVSLYQLNM 208

Query: 203 PFIINTWISGDVTSAIGTNWKWGIGMWAFILPLACIPLGICML 245
            F I         S  GT        W        IP+G+C L
Sbjct: 209 TFGIFL----GYCSVYGTRKYSNTAQWR-------IPVGLCFL 240

>YMR088C Chr13 complement(443414..445102) [1689 bp, 562 aa] {ON}
           VBA1Permease of basic amino acids in the vacuolar
           membrane
          Length = 562

 Score = 42.4 bits (98), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 30/123 (24%), Positives = 55/123 (44%)

Query: 64  YSRPLYRVALFFSLFLIAYAYGLDGNIRYTFQAYATSSYSQHSLLSTVNCIKTVIAAVGQ 123
           Y+  L +  + FSL+L ++   LD  I           +S+ S    +     +     Q
Sbjct: 29  YNLALPKFPILFSLWLGSFLSSLDSTIVANIMNRVAEEFSESSKKQWIATSFLLTNTAFQ 88

Query: 124 IFFARLSDIFGRFSIMIVSVIFYSVGTIIESQAVNITRFAVGGCFYQLGLTGIILILEVI 183
             + +LSDI GR S ++ +  F+ +G ++   A N+T F++      +G  G+  I  + 
Sbjct: 89  PLYGKLSDITGRKSALLTAQFFFGLGCLLTCFARNVTEFSIARAICGIGAGGLNAISSIA 148

Query: 184 ASD 186
            SD
Sbjct: 149 VSD 151

>YDL245C Chr4 complement(11657..13360) [1704 bp, 567 aa] {ON}
           HXT15Protein of unknown function with similarity to
           hexose transporter family members, expression is induced
           by low levels of glucose and repressed by high levels of
           glucose
          Length = 567

 Score = 42.0 bits (97), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 42/163 (25%), Positives = 74/163 (45%), Gaps = 17/163 (10%)

Query: 89  NIRYTFQAYATSS---YSQHSLLSTVNCIKTVIAAVGQIFFARLSDIFGRFSIMIVSVIF 145
           N +  F +Y  S+   Y  +  +  +  + +V  ++G + FARL+D  GR   +++ V+ 
Sbjct: 89  NFKMNFGSYKHSTGEYYLSNVRMGLLVAMFSVGCSIGGVAFARLADTLGRRLAIVIVVLV 148

Query: 146 YSVGTIIE-SQAVNITRFAVGGCFYQLGLTGIILILEVIASDFSNLNWR--LLALFIPAL 202
           Y VG II+ S      ++ VG   Y LG  G  ++  ++ S+ +  + R  L++L+   +
Sbjct: 149 YMVGAIIQISSNHKWYQYFVGKIIYGLGAGGCSVLCPMLLSEIAPTDLRGGLVSLYQLNM 208

Query: 203 PFIINTWISGDVTSAIGTNWKWGIGMWAFILPLACIPLGICML 245
            F I         S  GT        W        IP+G+C L
Sbjct: 209 TFGIFL----GYCSVYGTRKYSNTAQWR-------IPVGLCFL 240

>SAKL0F00198g Chr6 complement(10713..12326) [1614 bp, 537 aa] {ON}
           similar to uniprot|P36172 Saccharomyces cerevisiae
           YKR105C Hypothetical ORF
          Length = 537

 Score = 42.0 bits (97), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 84/362 (23%), Positives = 144/362 (39%), Gaps = 32/362 (8%)

Query: 124 IFFARLSDIFGRFSIMIVSVIFYSVGTIIESQAVNITRFAVGGCFYQLGLTGIILILEVI 183
           + + R + IFG    +++S++ +  G++I + + ++     G     +G +GI  +  VI
Sbjct: 94  LLWGRFATIFGFKLSLLLSILIFETGSLISAVSNSMNVLIGGRVVAGIGGSGIQSLCFVI 153

Query: 184 ASDFSNLNWRLLALFIPALPFIINTWISGDVTSAIGTNWKWGIGMWAFILPLACIPLGIC 243
           AS  +    R +A+ + +  + +    S  + SA  T+  W    W F + L    L   
Sbjct: 154 ASTLTTERSRGVAISVLSCAYAVAAVASPFMGSAFTTHVTW---RWCFYINLPIGGLAFA 210

Query: 244 MLHMRYLARKHAKDRLKPEFEALNKL----KWKSFCIDIAFWKL--DIIGMLLITVFFGC 297
           +L + Y  + H  +  +     L         + F  D+ + K+  +++       F  C
Sbjct: 211 VLVLTY--KPHEGNSARSIVSVLKSCCEFGTARLFSKDL-YLKMFNELVFGFDFIGFIFC 267

Query: 298 VL--VPFTLA---GGLKEEWKSAHIIVPEVIGWVV----------VLPLYMLWEMKYSRH 342
            +  + F L    GG K  W S  IIV  V+G  +          V P +       S  
Sbjct: 268 SVGFILFRLGLTFGGDKYTWSSGAIIVYFVVGVTISVAFLLYDFMVFPKFGRVRKNASFR 327

Query: 343 PLTPWDLIKDRGXXXXXXXXXXXXXXWYMQGDYMYTVL-VVAVHESIKSATRITSLYSFV 401
           PL PW ++   G              +  Q  Y+     +V   ++ +++  + +L    
Sbjct: 328 PLVPWSVVSRPGIATAVAANFLMCVAYSAQVVYIIQFFQLVRGSDAWRASIHVVAL-EIP 386

Query: 402 SVIVGTILGFILIKVRRTKPFIIFGISCWIVSFGLLVHYRGDSGAHSGIIGSLCLLG--F 459
            +I   I G I       KP I  GI   +V  GLL     DSG+ S  IG L L G  F
Sbjct: 387 DIITVAISGAISRMTGHVKPIIFVGIIAGLVGAGLLTLLDNDSGS-SKHIGLLILPGVAF 445

Query: 460 GA 461
           GA
Sbjct: 446 GA 447

>Smik_14.401 Chr14 (716260..718170) [1911 bp, 636 aa] {ON} YNR072W
           (REAL)
          Length = 636

 Score = 41.6 bits (96), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 42/163 (25%), Positives = 73/163 (44%), Gaps = 17/163 (10%)

Query: 89  NIRYTFQAYATSS---YSQHSLLSTVNCIKTVIAAVGQIFFARLSDIFGRFSIMIVSVIF 145
           N +  F +Y  S+   Y  +  +  +  + +V  A+G + FAR +D  GR   +++ V+ 
Sbjct: 158 NFKMNFGSYKHSTGEYYLSNVRMGLLVAMFSVGCAIGGVSFARFADKLGRRLAIVIVVLV 217

Query: 146 YSVGTIIE-SQAVNITRFAVGGCFYQLGLTGIILILEVIASDFSNLNWR--LLALFIPAL 202
           Y VG II+ S      ++ VG   Y LG  G  ++  ++ S+ +  + R  L++L+   +
Sbjct: 218 YMVGAIIQISSNHKWYQYFVGKIIYGLGAGGCSVLCPMLLSEIAPKDLRGGLISLYQLNM 277

Query: 203 PFIINTWISGDVTSAIGTNWKWGIGMWAFILPLACIPLGICML 245
            F I         S  GT        W        +PLG+C L
Sbjct: 278 TFGIFL----GYCSVYGTRKYDNTAQWR-------VPLGLCFL 309

>CAGL0J01375g Chr10 (127843..129537) [1695 bp, 564 aa] {ON} similar
           to uniprot|Q04301 Saccharomyces cerevisiae YMR088c
          Length = 564

 Score = 41.6 bits (96), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 79/388 (20%), Positives = 155/388 (39%), Gaps = 48/388 (12%)

Query: 64  YSRPLYRVALFFSLFLIAYAYGLDGNIRYTFQAYATSSYSQHSLLSTVNCIKTVIAAVGQ 123
           ++  L ++ +  SL+L ++   LDG I           + +      +     +     Q
Sbjct: 30  HNLSLPKLPIVLSLWLGSFLSSLDGTIVANIMNRVAEEFQESDKKQWIATSYLLTNTAFQ 89

Query: 124 IFFARLSDIFGRFSIMIVSVIFYSVGTIIESQAVNITRFAVGGCFYQLGLTGIILILEVI 183
             + +LSD+ GR   ++ +  F+ +G ++   A ++T+FA+      +G  GI  +  + 
Sbjct: 90  PLYGKLSDLTGRKFAVLTAHFFFGLGCLLTCFANSVTQFAIARAICGVGGGGINAMSSIT 149

Query: 184 ASDFSNLNWRLL----ALFIPALPFIINTWISGDVTSAIGTNWKWGIGMWAFILPLACIP 239
            SD      R +    A  +  L  I+   I G     +G         W  +  L    
Sbjct: 150 VSDICTQRERGIYQGYANIVFGLGQILGAPIGGLFIDTLG---------WRILFGLQVPT 200

Query: 240 LGICMLHMRYLARKHAKDRLKPEFEALNKLKWKSFCIDIAFWKLDIIGMLLITVFFGCVL 299
           + +C      L  K+   +L        + KW +        ++DI+G           L
Sbjct: 201 ILLC----SSLVHKNVNIKLSHLLPVEERFKWSNLS------RIDILG--------SSTL 242

Query: 300 VPFTLAGGL---KEEWKSAHIIVPEVIGWVVVLPLYMLWEMKYSRHPLTPWDLIKDRGXX 356
           V FT++G L     E   A + +  VI ++     ++L E+ YS+  + P++L+K     
Sbjct: 243 V-FTISGVLFLCSTELNKALLSIFTVISFIA----FILIELYYSKERIMPFELLKGS--- 294

Query: 357 XXXXXXXXXXXXWYMQGDYMYTVLVVAVHESIK-SATRITSLYSFVSVIVGTI-LGFILI 414
                       + + GD   + + + + + +  + T    L+  +SV VG++  G+IL 
Sbjct: 295 FGLASAATVISSFIIFGDIFRSPIYLQLIQGVSVTKTGFFMLFPSISVAVGSLATGWIL- 353

Query: 415 KVRRTKPFIIFGISCWIVSFGLLVHYRG 442
             R TK   +   + WIV+ G+ +   G
Sbjct: 354 --RHTK-MKLSHCAYWIVTIGMSIQLLG 378

>Smik_6.20 Chr6 (28923..30632) [1710 bp, 569 aa] {ON} YJL219W (REAL)
          Length = 569

 Score = 41.6 bits (96), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 45/197 (22%), Positives = 89/197 (45%), Gaps = 28/197 (14%)

Query: 88  GNIRYTFQAYATSSYSQHSLLSTVNCIKTVIAAVGQIFFARLSDIFGRFSIMIVSVIFYS 147
           GN  ++   Y  S+     ++S  N    V +A+G +F ++L DI+GR   +I+ ++ Y 
Sbjct: 101 GNYSHSKGTYYLSNVRTGLIVSIFN----VGSAIGCLFLSKLGDIYGRCMGLIIVIVVYM 156

Query: 148 VGTIIESQAVNI-TRFAVGGCFYQLGLTGIILILEVIASDFSNLN--------WRLLALF 198
           VG +I+  +V+   ++ +G     +G   I ++  ++ S+ +  +        W+L+  F
Sbjct: 157 VGIVIQIASVDKWYQYFIGRIIAGIGAGSISVLAPMLISETAPKHIRGTLLACWQLMVTF 216

Query: 199 IPALPFIINTWISGDVTSAIGTNWKWGIGM---WAFILPLACIPLGICML---HMRYLAR 252
              L +  N    G  T +    W+  +G+   WA I+      +G  M      R+L +
Sbjct: 217 AIFLGYCTNY---GTKTYSNSVQWRVPLGLCFAWAIIM------IGGMMFVPESPRFLVQ 267

Query: 253 KHAKDRLKPEFEALNKL 269
               ++ +  F   NKL
Sbjct: 268 VKKTEQARASFAKSNKL 284

>Skud_6.12 Chr6 (17593..18687,18791..19108) [1413 bp, 470 aa] {ON}
           YJL214W (REAL)
          Length = 470

 Score = 41.6 bits (96), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 48/197 (24%), Positives = 84/197 (42%), Gaps = 28/197 (14%)

Query: 88  GNIRYTFQAYATSSYSQHSLLSTVNCIKTVIAAVGQIFFARLSDIFGRFSIMIVSVIFYS 147
           GN  ++  AY  S+     ++S  N    V +A+G +F ++L DI+GR   +I+ ++ Y 
Sbjct: 100 GNYSHSRNAYYLSNVRTGLIVSIFN----VGSAIGCLFLSKLGDIYGRCVGLIIVIVVYM 155

Query: 148 VGTIIESQAVN------ITRFAVGGCFYQLGLTGIILILEVIASDFSNL---NWRLLALF 198
           VG +I+  +V+      I R   G     + +   +LI E             W+L+  F
Sbjct: 156 VGIVIQIASVDKWYQYFIGRIVAGIGAGSISVLAPMLISETAPKQIRGTLLACWQLMVTF 215

Query: 199 IPALPFIINTWISGDVTSAIGTNWKWGIGM---WAFILPLACIPLGICML---HMRYLAR 252
              L +  N    G  + +    W+  +G+   WA I+      +G  M      R+L +
Sbjct: 216 AIFLGYCTNY---GTKSYSNSIQWRVPLGLCFAWAIIM------IGGMMFVPESPRFLVQ 266

Query: 253 KHAKDRLKPEFEALNKL 269
               ++ K  F   NKL
Sbjct: 267 VGRVEKAKASFAKSNKL 283

>KLTH0B00594g Chr2 (64332..66188) [1857 bp, 618 aa] {ON} similar to
           uniprot|P36172 Saccharomyces cerevisiae YKR105C
           Hypothetical ORF
          Length = 618

 Score = 41.6 bits (96), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 82/367 (22%), Positives = 145/367 (39%), Gaps = 39/367 (10%)

Query: 127 ARLSDIFGRFSI-------MIVSVIFYSVGTIIESQAVNITRFAVGGCFYQLGLTGIILI 179
           A LS ++GRF         M++S++ + VG++I + A ++T    G     +G +GI  +
Sbjct: 124 ALLSLLWGRFGTVAGFKTSMLLSIVIFEVGSLIAAAATSMTMLIGGRVISGIGGSGIQTL 183

Query: 180 LEVIASDFSNLNWRLLALFIPALPFIINTWISGDVTSAIGTNWKWGIGMWAFILPLACIP 239
             VI S       R  A+ I +  F + +     +  A  T+  W    W F + L   P
Sbjct: 184 CFVITSTLVTDRTRGTAISILSCAFAVASVAGPFLGGAFATHVTW---RWCFYINL---P 237

Query: 240 LGICMLHMRYLARKHAKDRLKPEFE-ALNKLKWKSFC--IDIAFW---------KLDIIG 287
           +G         +     +     F+  L ++K  S+   + ++F+         K D   
Sbjct: 238 IGGLAFFFFLFSYNPNGENTFENFKILLGRIKRISYSQLLTVSFYRRLFRTLVFKFDFFE 297

Query: 288 MLLITVFFGCVLVPFTLAGGLKEEWKSAHIIVPEVIGWVVVLPLYMLWEMKYSR------ 341
             L +  F  VL+  T  GG + +W S  II   V+G ++++  ++   + + R      
Sbjct: 298 FALSSAGFTLVLLALTF-GGNRYDWNSGTIIAYFVVGILLIIASFVYDFVVFDRVKPQTD 356

Query: 342 ----HPLTPWDLIKDRGXXXXXXXXXXXXXXWYMQGDYMYTVLVVAVHESIKSATRITSL 397
                PL  W++I   G              + MQ  Y+     +   +S   A+ I  +
Sbjct: 357 RIPYLPLLSWNVISKPGVLIPNIANFCTCFCYNMQVVYIVQYFQLVWGDSAWKAS-IHLI 415

Query: 398 YSFVSVIVGTIL-GFILIKVRRTKPFIIFGISCWIVSFGLLVHYRGDSGAHSGIIGSLCL 456
              +S ++  +  G I  K    K  ++ G     V+ G+L    G   + S  IG L L
Sbjct: 416 APVISTVITVLFCGIITRKTGHVKILLVVGGIVIPVASGILT-LLGPKSSSSAKIGLLIL 474

Query: 457 LGFGAGS 463
            G   GS
Sbjct: 475 PGISFGS 481

>Smik_10.8 Chr10 (9814..11523) [1710 bp, 569 aa] {ON} YJL214W (REAL)
          Length = 569

 Score = 41.6 bits (96), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 45/197 (22%), Positives = 88/197 (44%), Gaps = 28/197 (14%)

Query: 88  GNIRYTFQAYATSSYSQHSLLSTVNCIKTVIAAVGQIFFARLSDIFGRFSIMIVSVIFYS 147
           GN  ++   Y  S+     ++S  N    V +A+G +F ++L DI+GR   +I+ ++ Y 
Sbjct: 101 GNYNHSKDTYYLSNVRTGLIVSIFN----VGSAIGCLFLSKLGDIYGRCMGLIIVIVVYM 156

Query: 148 VGTIIESQAVNI-TRFAVGGCFYQLGLTGIILILEVIASDFSNLN--------WRLLALF 198
           VG II+  +V+   ++ +G     +G   I ++  ++ S+ +           W+L+  F
Sbjct: 157 VGIIIQIASVDKWYQYFIGRIIAGIGAGSISVLAPMLISETAPKQIRGTLLACWQLMVTF 216

Query: 199 IPALPFIINTWISGDVTSAIGTNWKWGIGM---WAFILPLACIPLGICML---HMRYLAR 252
              L +  N    G  + +    W+  +G+   WA I+      +G  M      R+L +
Sbjct: 217 AIFLGYCTNY---GTKSYSNSVQWRVPLGLCFAWAIIM------IGGMMFVPESPRFLVQ 267

Query: 253 KHAKDRLKPEFEALNKL 269
               ++ +  F   NKL
Sbjct: 268 VKKTEQARASFAKSNKL 284

>Smik_5.19 Chr5 complement(25102..26805) [1704 bp, 567 aa] {ON}
           YEL069C (REAL)
          Length = 567

 Score = 41.2 bits (95), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 42/163 (25%), Positives = 73/163 (44%), Gaps = 17/163 (10%)

Query: 89  NIRYTFQAYATSS---YSQHSLLSTVNCIKTVIAAVGQIFFARLSDIFGRFSIMIVSVIF 145
           N +  F +Y  S+   Y  +  +  +  + +V  A+G + FAR +D  GR   +++ V+ 
Sbjct: 89  NFKMNFGSYKHSTGEYYLSNVRMGLLVAMFSVGCAIGGVSFARFADKLGRRLAIVIVVLV 148

Query: 146 YSVGTIIE-SQAVNITRFAVGGCFYQLGLTGIILILEVIASDFSNLNWR--LLALFIPAL 202
           Y VG II+ S      ++ VG   Y LG  G  ++  ++ S+ +  + R  L++L+   +
Sbjct: 149 YMVGAIIQISSNHKWYQYFVGKIIYGLGAGGCSVLCPMLLSEIAPKDLRGGLISLYQLNM 208

Query: 203 PFIINTWISGDVTSAIGTNWKWGIGMWAFILPLACIPLGICML 245
            F I         S  GT        W        +PLG+C L
Sbjct: 209 TFGIFL----GYCSVYGTRKYDNTAQWR-------VPLGLCFL 240

>TBLA0A03450 Chr1 complement(836248..837969) [1722 bp, 573 aa] {ON} 
          Length = 573

 Score = 41.2 bits (95), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 44/165 (26%), Positives = 70/165 (42%), Gaps = 12/165 (7%)

Query: 114 IKTVIAAVGQIFFARLSDIFGRFSIMIVSVIFYSVGTIIESQAVN------ITRFAVGGC 167
           I  V  A+G +   RL DI+GR   +I++   + VG +IE  +++      I R   G  
Sbjct: 123 IFNVGCAIGSVTLGRLGDIYGRRLGLIMATAIFVVGVVIEIASIDKWYQYFIGRIIAGIG 182

Query: 168 FYQLGLTGIILILEVIASDFSNLNWRLLALFIPALPFIINTWISGDVTSAIGTNWKWGIG 227
              + +   +LI EV   D          L I    F+ +    G  T +  T W+ G+G
Sbjct: 183 MGVIAVLSPMLISEVSPKDMRGAMVSCYQLMITMGIFLGDCCNYGTKTYSDSTQWRVGLG 242

Query: 228 M-WAFILPLACIPLGICML--HMRYLARKHAKDRLKPEFEALNKL 269
           + +A+ L   C+  G+  +    RYL  K   +  K      NKL
Sbjct: 243 LQFAWCL---CMVGGMMFVPESPRYLVEKGKLEEAKRSVATSNKL 284

>Suva_15.291 Chr15 complement(497138..498916) [1779 bp, 592 aa] {ON}
           YHR094C (REAL)
          Length = 592

 Score = 41.2 bits (95), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 35/128 (27%), Positives = 65/128 (50%), Gaps = 9/128 (7%)

Query: 75  FSLFLIAYAYG-LDGNIRYT--FQAYATSSYSQHSLLSTVN-----CIKTVIAAVGQIFF 126
           F  F+  +  G + G +R T   + + T+  +  S LS V       I  +  A+G I  
Sbjct: 95  FGGFVFGWDTGTISGFVRQTDYIRRFGTTRANGTSYLSNVRTGLLVSIFNIGCAIGGIVL 154

Query: 127 ARLSDIFGRFSIMIVSVIFYSVGTIIESQAVNI-TRFAVGGCFYQLGLTGIILILEVIAS 185
           +RL D++GR   +++ V+ YSVG II+  +++   ++ +G     LG+ GI ++  ++ S
Sbjct: 155 SRLGDMYGRKIGLVIVVVIYSVGIIIQIASIDKWYQYFIGRIISGLGVGGITVLSPMLIS 214

Query: 186 DFSNLNWR 193
           + S    R
Sbjct: 215 EVSPKQLR 222

>YJL214W Chr10 (26887..28596) [1710 bp, 569 aa] {ON}  HXT8Protein of
           unknown function with similarity to hexose transporter
           family members, expression is induced by low levels of
           glucose and repressed by high levels of glucose
          Length = 569

 Score = 40.8 bits (94), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 44/196 (22%), Positives = 89/196 (45%), Gaps = 26/196 (13%)

Query: 88  GNIRYTFQAYATSSYSQHSLLSTVNCIKTVIAAVGQIFFARLSDIFGRFSIMIVSVIFYS 147
           GN  ++   Y  S+     ++S  N    V +A+G +F ++L DI+GR   +I+ ++ Y 
Sbjct: 101 GNYSHSKNTYYLSNVRTGLIVSIFN----VGSAIGCLFLSKLGDIYGRCMGLIIVIVVYM 156

Query: 148 VGTIIESQAVNI-TRFAVGGCFYQLGLTGIILILEVIASDFSNLN--------WRLLALF 198
           VG +I+  +++   ++ +G     +G   I ++  ++ S+ +  +        W+L+  F
Sbjct: 157 VGIVIQIASIDKWYQYFIGRIIAGIGAGSISVLAPMLISETAPKHIRGTLLACWQLMVTF 216

Query: 199 IPALPFIINTWISGDVTSAIGTNWKWGIGM---WAFIL--PLACIPLGICMLHMRYLARK 253
              L +  N    G  T +    W+  +G+   WA I+   +  +P        R+L + 
Sbjct: 217 AIFLGYCTNY---GTKTYSNSVQWRVPLGLCFAWAIIMIGGMTFVP-----ESPRFLVQV 268

Query: 254 HAKDRLKPEFEALNKL 269
              ++ K  F   NKL
Sbjct: 269 GKIEQAKASFAKSNKL 284

>SAKL0H16808g Chr8 complement(1477137..1479110) [1974 bp, 657 aa]
           {ON} weakly similar to uniprot|Q04602 Saccharomyces
           cerevisiae YDR119W Uncharacterized transporter
          Length = 657

 Score = 40.8 bits (94), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 42/179 (23%), Positives = 74/179 (41%), Gaps = 3/179 (1%)

Query: 48  ELIDPGVYNIEIYAEMYSRPLYRVALFFSLFLIAYAYGLDGNIRYTFQAYATSSYSQHSL 107
           + ID    +IE        P     +  S++L  +   LD  I  T  A+  S +++   
Sbjct: 106 KTIDLETSSIEAKNNTGLSPARIKIIMGSMYLGIFLASLDNTIVSTLLAHIASEFNEMPH 165

Query: 108 LSTVNCIKTVIAAVGQIFFARLSDIFGRFSIMIVSVIFYSVGTIIESQAVNITRFAVGGC 167
           +S +     + +A  Q  + ++SDIFGR  ++I S + +++G +I   +  +     G  
Sbjct: 166 ISWIATAYLLSSATFQPLYGKISDIFGRKPLLIFSNVMFALGCLICGLSPGLWCLVAGRF 225

Query: 168 FYQLGLTGIILILEVIASDFSNLNWRLLALFIPALPFIINTWISGDVT---SAIGTNWK 223
              +G  G+  +  +  SD   L  R L   I    F + T   G V    S  G  W+
Sbjct: 226 IAGIGGGGLTSMSSITTSDIVPLRNRALYQGICNFFFGLGTACGGLVGGWFSEHGGGWR 284

>Skud_4.5 Chr4 complement(9302..11023) [1722 bp, 573 aa] {ON}
           YJR158W (REAL)
          Length = 573

 Score = 40.8 bits (94), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 42/163 (25%), Positives = 74/163 (45%), Gaps = 17/163 (10%)

Query: 89  NIRYTFQAYATSS---YSQHSLLSTVNCIKTVIAAVGQIFFARLSDIFGRFSIMIVSVIF 145
           N +  F +Y  S+   Y  +  +  +  + ++  ++G + FARL+D  GR   +++ V+ 
Sbjct: 86  NFKMNFGSYKHSTGEYYLSNVRMGLLVAMFSIGCSLGGVAFARLADTLGRRLAIVIVVLV 145

Query: 146 YSVGTIIE-SQAVNITRFAVGGCFYQLGLTGIILILEVIASDFSNLNWR--LLALFIPAL 202
           Y VG II+ S      ++ VG   Y LG  G  ++  ++ S+ +  + R  L++LF   +
Sbjct: 146 YMVGAIIQISSNHKWYQYFVGKIIYGLGAGGCSVLCPMLLSEIAPKDLRGGLVSLFQLNV 205

Query: 203 PFIINTWISGDVTSAIGTNWKWGIGMWAFILPLACIPLGICML 245
            F I         S  GT        W        IP+G+C L
Sbjct: 206 TFGIFL----GYCSVYGTRKYDNTAQWR-------IPVGLCFL 237

>Smik_25.4 Chr25 (8471..9415) [945 bp, 315 aa] {ON} YJL214W (REAL)
          Length = 315

 Score = 40.0 bits (92), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 44/197 (22%), Positives = 88/197 (44%), Gaps = 28/197 (14%)

Query: 88  GNIRYTFQAYATSSYSQHSLLSTVNCIKTVIAAVGQIFFARLSDIFGRFSIMIVSVIFYS 147
           GN  ++   Y  S+     ++S  N    V +A+G +F ++L DI+GR + +I+ ++ Y 
Sbjct: 97  GNYSHSKGTYYLSNVRTGLIVSIFN----VGSAIGCLFLSKLGDIYGRCTGLIIVIVVYM 152

Query: 148 VGTIIESQAVNI-TRFAVGGCFYQLGLTGIILILEVIASDFSNLN--------WRLLALF 198
           VG +I+  +V+   ++ +G     +G   I ++  ++ S+ +           W+L+  F
Sbjct: 153 VGIVIQIASVDKWYQYFIGRIIAGIGAGSISVLAPMLISETAPKQIRGTLLACWQLMVTF 212

Query: 199 IPALPFIINTWISGDVTSAIGTNWKWGIGM---WAFILPLACIPLGICML---HMRYLAR 252
              L +  N    G  + +    W+  +G+   WA I+      +G  M      R+L +
Sbjct: 213 AIFLGYCTNY---GTKSYSNSVQWRVPLGLCFAWAIIM------IGGMMFVPESPRFLVQ 263

Query: 253 KHAKDRLKPEFEALNKL 269
               +  +  F   NKL
Sbjct: 264 VKKTEEARASFAKSNKL 280

>YGR224W Chr7 (942806..944647) [1842 bp, 613 aa] {ON}  AZR1Plasma
           membrane transporter of the major facilitator
           superfamily, involved in resistance to azole drugs such
           as ketoconazole and fluconazole
          Length = 613

 Score = 40.4 bits (93), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 79/340 (23%), Positives = 140/340 (41%), Gaps = 47/340 (13%)

Query: 127 ARLSDIFGRFSIMIVSVIFYSVGTIIESQAVNITRFAVGGCFYQLGLTGIILILEVIASD 186
            R++   G    M+ +++ + +G++I + A +++    G     +G  GI  +  VI S 
Sbjct: 123 GRIATPIGFKETMLFAIVIFEIGSLISALANSMSMLIGGRVIAGVGGCGIQSLSFVIGST 182

Query: 187 FSNLNWRLLALFIPALPF----IINTWISGDVTSAIGTNWKWG------IGMWAFILPLA 236
               + R + + + +  F    ++  ++ G  TS++   W+W       IG  AF L L 
Sbjct: 183 LVEESQRGILIAVLSCSFAIASVVGPFLGGVFTSSV--TWRWCFYVNLPIGGLAFFLFLF 240

Query: 237 CIPLGIC-----MLHMRY-------LARKHAKDRLKPE-FEALNKLKWKSFCIDIAFWKL 283
               G+      M ++R        + R  A   LK + F  LN   W+   +++ F   
Sbjct: 241 FYNPGLSTFQETMDNIRKFPSQFIEIVRNVAYHLLKIKGFSKLNG--WRKPFMELIFM-Y 297

Query: 284 DIIGMLLITVFFGCVLVPFTLAGGLKEEWKSAH----------IIVPEVIGWVVVLPLYM 333
           DII  +  +  F C+L+ FT  GG +  W SA           ++V   I   +V P + 
Sbjct: 298 DIIEFVFCSAGFTCILLAFTF-GGNRYAWNSASIIILFIIGIVLVVLAGIYDFLVFPKFN 356

Query: 334 LWEMKYSRHPLTPWDLIKDRGXXXXXXXXXXXXXXWYMQGDYMYTVLVVAVHESI-KSAT 392
           + +      PL  W  IK  G              +  Q  Y+     +  ++S  ++A 
Sbjct: 357 IVKATPHYQPLMSWTNIKKPGIFTVNIALFLTCAGYISQFTYIVQYFQLIYNDSAWRAAV 416

Query: 393 RITSLYSFVSVIVGTIL-GFILIKVRRTKPFI----IFGI 427
            + +    +S +V  IL G I  K R+ KP I    IFG+
Sbjct: 417 HLVA--CIISTVVTAILCGAITDKTRQIKPIIVISSIFGV 454

>KLTH0B10142g Chr2 complement(847376..849082) [1707 bp, 568 aa] {ON}
           similar to uniprot|P36172 Saccharomyces cerevisiae
           YKR105C Hypothetical ORF
          Length = 568

 Score = 40.4 bits (93), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 78/360 (21%), Positives = 141/360 (39%), Gaps = 27/360 (7%)

Query: 120 AVGQIFFARLSDIFGRFSIMIVSVIFYSVGTIIESQAVNITRFAVGGCFYQLGLTGIILI 179
           A+  + +ARLS + G    ++  +I +  G++I + A ++     G     +G +G+  +
Sbjct: 93  ALFSLLWARLSAVLGPRISVVSCIILFEAGSLISALANSMNMLIAGRVVAGIGGSGLQTL 152

Query: 180 LEVIASDFSNLNWRLLALFIPALPFIINTWISGDVTSAIGTNWKWGIGMWAFILPLACIP 239
             VI     +   R L L +    F + + +   +  A  T+  W    W F + L    
Sbjct: 153 SLVIGCQLVDEKSRPLVLSLLNCTFAVASIVGPFLGGAFTTHVTW---RWCFYINLPIGG 209

Query: 240 LGICMLHMRY------LARKHAKDRLK-PEFEALNKLKWKSFCIDIAFWKLDIIGMLLIT 292
           L I +    Y      L  K      K   F  + K   K   +    +  DI+  +  T
Sbjct: 210 LAIAIFVFFYNPEGVNLLEKFGNTFKKVSSFHPVKKSPKK--VLQQLLFGFDILSFISFT 267

Query: 293 VFFGCVLVPFTLAGGLKEEWKSAHIIVPEVIGWVVVLPLYMLWEMKY--------SRHPL 344
             +   L+  T  GG    W S  +I   +IG V+++ + ++++ K         S  PL
Sbjct: 268 AGWLLFLLALTF-GGQTHAWNSGIVISFIIIG-VLLIAISLVYDFKVFEQIKTQDSFRPL 325

Query: 345 TPWDLIKDRGXXXXXXXXXXXXXXWYMQGDYMYTVL-VVAVHESIKSATRITSLYSFVSV 403
             W+++ +R               + +Q  Y      +V    + K+   +  +   VS 
Sbjct: 326 LSWEIMSNRSILLSNFTGFFSTVAYNVQMIYSVQFFQLVYGFSAWKAGLHLIPI--LVST 383

Query: 404 IVGTILGFILIK-VRRTKPFIIFGISCWIVSFGLLVHYRGDSGAHSGIIGSLCLLGFGAG 462
           +V +I   IL K     KP ++FG +  ++  GL+      S  H+  IG L L G   G
Sbjct: 384 VVFSIASGILTKKTGHIKPLLVFGSAMGVLGGGLMTLLDNKSTKHTQ-IGVLILPGVALG 442

>SAKL0B12716g Chr2 (1101141..1103039) [1899 bp, 632 aa] {ON} similar
           to uniprot|P36172 Saccharomyces cerevisiae YKR105C
           Hypothetical ORF
          Length = 632

 Score = 40.0 bits (92), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 83/363 (22%), Positives = 145/363 (39%), Gaps = 34/363 (9%)

Query: 124 IFFARLSDIFGRFSIMIVSVIFYSVGTIIESQAVNITRFAVGGCFYQLGLTGIILILEVI 183
           + + R + IFG    +++S++ +  G++I + + ++     G     +G +GI  +  VI
Sbjct: 94  LLWGRFATIFGFKLSLLLSILIFETGSLISAVSNSMNVLIGGRVVAGIGGSGIQSLCFVI 153

Query: 184 ASDFSNLNWRLLALFIPALPFIINTWISGDVTSAIGTNWKWGIGMWAFILPLACIPLGIC 243
           AS  +    R +A+ + +  + +       +  A  T+  W    W F + L    L   
Sbjct: 154 ASTLTTERSRGVAISVLSCAYAVAAVAGPFMGGAFTTHVTW---RWCFYINLPIGSLAFA 210

Query: 244 MLHMRYLARKHAKDRLKPEFEALNKL----KWKSFCIDIAFWKLDII-------GMLLIT 292
           +L + Y  + H  +  +     L         + F  D+     D +       G +  +
Sbjct: 211 VLVLTY--KPHEGNSARSIVSVLKSCCEFGTARLFSKDLYLKMFDELVFGFDFIGFIFCS 268

Query: 293 VFFGCVLVPFTLAGGLKEEWKSAHIIVPEVIGWVVVLPLYMLWEM----KYSR------- 341
           V F   L+  T  GG K  W S  IIV  ++G V +   ++L++     K+ R       
Sbjct: 269 VGFILFLLGLTF-GGDKYAWSSGAIIVYFIVG-VTISVAFLLYDFMIFPKFGRVRKNASF 326

Query: 342 HPLTPWDLIKDRGXXXXXXXXXXXXXXWYMQGDYMYTVL-VVAVHESIKSATRITSLYSF 400
            PL PW ++   G              +  Q  Y+     +V   ++ +++  + +L   
Sbjct: 327 RPLVPWSVVSRPGIATAVAANFLMCVAYSAQVVYIIQFFQLVRGSDAWRASIHVVAL-EI 385

Query: 401 VSVIVGTILGFILIKVRRTKPFIIFGISCWIVSFGLLVHYRGDSGAHSGIIGSLCLLG-- 458
             +I   I G I       KP I  GI   +V  GLL     DSG+ S  IG L L G  
Sbjct: 386 PDIITVAISGAISRMTGHVKPIIFVGIIAGLVGAGLLTLLDNDSGS-SKHIGLLILPGVA 444

Query: 459 FGA 461
           FGA
Sbjct: 445 FGA 447

>AFL207C Chr6 complement(44349..45968) [1620 bp, 539 aa] {ON}
           Unclear if syntenic homolog of Saccharomyces cerevisiae
           YDR343C (HXT6), YDR342C (HXT7) and YHR092C (HXT4)
          Length = 539

 Score = 40.0 bits (92), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 48/185 (25%), Positives = 77/185 (41%), Gaps = 27/185 (14%)

Query: 102 YSQHSLLSTVNCIKTVIAAVGQIFFARLSDIFG-RFSIMIVSVIFYSVGTIIE-SQAVNI 159
           Y  ++ +  +  I  +  AVG I  +RL D++G R  +MIVS+I Y VG II+ S     
Sbjct: 88  YWSNARVGLIVAIFNIGCAVGGIILSRLGDMYGRRIGLMIVSLI-YVVGIIIQISSNTKW 146

Query: 160 TRFAVGGCFYQLGLTGIILILEVIASDFSNLNWRLLALFIPALPFIINTWISGDVTSAIG 219
            ++ +G     LG+ GI ++  ++ S+ S  + R     +     +I   I     +  G
Sbjct: 147 YQYCIGRVISGLGVGGIAVLSPMLISETSPKHLR--GTLVSCYQLMITAGILLGYCANYG 204

Query: 220 TNWKWGIG-MWAFILPLACIPLGICML--------------HMRYLARKHAKDRLKPEFE 264
           T  ++     W        IPLG+C L                RYL  K   +  K    
Sbjct: 205 TKSRYDDSRQWR-------IPLGLCFLWAIFMITGMAFVPESPRYLIEKDKIEEAKRSLA 257

Query: 265 ALNKL 269
             NK+
Sbjct: 258 TSNKV 262

>Skud_7.620 Chr7 complement(1041205..1041522,1041626..1042714) [1407
           bp, 468 aa] {ON} YJL214W (REAL)
          Length = 468

 Score = 39.7 bits (91), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 46/197 (23%), Positives = 83/197 (42%), Gaps = 28/197 (14%)

Query: 88  GNIRYTFQAYATSSYSQHSLLSTVNCIKTVIAAVGQIFFARLSDIFGRFSIMIVSVIFYS 147
           GN  ++   Y  S+     ++S  N    V +A+G +F ++L DI+GR   +++ ++ Y 
Sbjct: 98  GNYSHSKDVYYLSNVRTGLIVSIFN----VGSAIGCLFLSKLGDIYGRCMGLVIVIVVYM 153

Query: 148 VGTIIESQAVN------ITRFAVGGCFYQLGLTGIILILEVIASDFSNL---NWRLLALF 198
           VG +I+  +V+      I R   G     + +   +LI E             W+L+  F
Sbjct: 154 VGIVIQIASVDKWYQYFIGRIVAGVGAGSISVLAPMLISETAPKQIRGTLLACWQLMVTF 213

Query: 199 IPALPFIINTWISGDVTSAIGTNWKWGIGM---WAFILPLACIPLGICML---HMRYLAR 252
              L +  N    G  + +    W+  +G+   WA I+      +G  M      R+L +
Sbjct: 214 AIFLGYCTNY---GTKSYSNSIQWRVPLGLCFAWAIIM------IGGMMFVPESPRFLVQ 264

Query: 253 KHAKDRLKPEFEALNKL 269
               ++ K  F   NKL
Sbjct: 265 VGRVEKAKASFAKSNKL 281

>TBLA0B02940 Chr2 (677253..679238) [1986 bp, 661 aa] {ON} Anc_8.858
           YML123C
          Length = 661

 Score = 39.7 bits (91), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 44/170 (25%), Positives = 72/170 (42%), Gaps = 44/170 (25%)

Query: 103 SQHSLLSTVNCIKTVIAAVGQIFFARLSDIFGRFSIMIVSVIFYSVGTIIES---QAVNI 159
           S  +LL     + TV   VGQ+ F  L+D+ GR  I    +I   V TI+++   QA  +
Sbjct: 99  STQTLLKVSTSVGTV---VGQVGFGVLADLLGRKKIYGCELIIIIVCTILQTMCGQAPGL 155

Query: 160 TRFAVGGCFYQ----LGLTGIILILEVIASDFSNLNWRLLALFIPALPFIINTWISGDVT 215
           + F     FY+    LG+ G   +  +I S+F+   WR                  G + 
Sbjct: 156 S-FTAMLTFYRIVMGLGIGGDYPLSSIITSEFATTKWR------------------GAIM 196

Query: 216 SAIGTNWKWGIGMWAFILPLACIPLGICMLHMRYLARKHAKDRLKPEFEA 265
            A+  N  WG  +++ I+ + CI                 KD+LKP +++
Sbjct: 197 GAVFANQAWG-QIFSGIVSIVCIAA--------------YKDQLKPAYDS 231

>Skud_18.3 Chr18 complement(10782..12554) [1773 bp, 590 aa] {ON}
           YCL069W (REAL)
          Length = 590

 Score = 39.7 bits (91), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 80/375 (21%), Positives = 146/375 (38%), Gaps = 27/375 (7%)

Query: 120 AVGQIFFARLSDIFGRFSIMIVSVIFYSVGTIIESQAVNITRFAVGGCFYQLGLTGIILI 179
           AV  + + R + I G    +I++V+ +  G+++ + A ++    VG     +G +G+  +
Sbjct: 94  AVLSLLWGRFASIIGFQHSLILAVLIFEAGSLVAALANSMNMLIVGRVVAGVGGSGLQTL 153

Query: 180 LEVIASDFSNLNWRLLALFIPALPFIINTWISGDVTSAIGTNWKWGIGMWAFILPLACIP 239
             VI     +   R L + I +  F +   +   +  A  T+  W    W F + L    
Sbjct: 154 CFVIGCTMVDERSRPLVISILSCAFAVAAIVGPIIGGAFTTHVTW---RWCFYINLPIGG 210

Query: 240 LGICMLHMRYLAR-----KHAKDRLKP----EFEALNKLKWKSFCIDIAFWKLDIIGMLL 290
           L + M  + Y A+     +  K  L+     EF  L K       I+   +K D  G  L
Sbjct: 211 LAVIMFLLTYDAKNDGIIQQMKGALRKISGFEFSRLKKPGNLRKAINCLIFKFDFFGFAL 270

Query: 291 ITVFFGCVLVPFTLAGGLKEEWKSAHIIVPEVIGWV-----VVLPLYMLWEMKYSRHPLT 345
            +      L+  T  GG K  W S  +I   V+G V     +V   ++  +    R  ++
Sbjct: 271 SSTGLVLFLLGLTF-GGNKYTWSSGQVITYLVLGIVLFIFSLVYDFFLFDKFNPERDNIS 329

Query: 346 PWDLIKDRGXXXXXXXXXXXXXXWYMQGDYMYTVLVVAVHESIKSATRITSLYSFVSVIV 405
              L   R                   G     +  V   + I +++   +    + +++
Sbjct: 330 YRPLFLRRLVAKPAIIIVNMVTFLLCTGYNGQMIYSVQFFQLIFASSAWKAGLHLIPIVI 389

Query: 406 GTIL-----GFILIKVRRTKPFIIFGISCWIVSFGLLVHYRGDSGAHSGIIGSLCLLGFG 460
             ++     G I  K+   KP +IFG    ++  GL+   + +S   S  IG L L GF 
Sbjct: 390 TNVIAAIASGIITKKLGLVKPLLIFGGFLGVIGAGLMTLMKNNS-TSSTQIGVLILPGFS 448

Query: 461 AGSFTYVTQASIQAS 475
            G   +  QAS+ ++
Sbjct: 449 LG---FALQASLMSA 460

>Ecym_4298 Chr4 complement(636605..638641) [2037 bp, 678 aa] {ON}
           similar to Ashbya gossypii AGR076C
          Length = 678

 Score = 39.7 bits (91), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 32/122 (26%), Positives = 55/122 (45%)

Query: 72  ALFFSLFLIAYAYGLDGNIRYTFQAYATSSYSQHSLLSTVNCIKTVIAAVGQIFFARLSD 131
           A+  SL +  +   LDG I  T   Y  S +     +S +     + A + Q  + +LSD
Sbjct: 153 AIVSSLVVGVFLGSLDGTILSTLLDYIASEFEALPYISWIAASYLLSACIFQPLYGKLSD 212

Query: 132 IFGRFSIMIVSVIFYSVGTIIESQAVNITRFAVGGCFYQLGLTGIILILEVIASDFSNLN 191
           IFGR +I++ S + + +G ++   A  +     G     +G  G+  +  +I SD   L 
Sbjct: 213 IFGRKAILLFSNLMFGLGCLVCGTAPTVWWLLAGRFVAGIGGGGLTSMPSIIISDIVPLR 272

Query: 192 WR 193
            R
Sbjct: 273 SR 274

>SAKL0D00814g Chr4 complement(63086..64798) [1713 bp, 570 aa] {ON}
           highly similar to gnl|GLV|KLLA0C16852g Kluyveromyces
           lactis KLLA0C16852g and similar to uniprot|P25297
           YML123C Saccharomyces cerevisiae PHO84 High- affinity
           inorganic phosphate (Pi) transporter and low- affinity
           manganese transporter
          Length = 570

 Score = 39.7 bits (91), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 52/192 (27%), Positives = 81/192 (42%), Gaps = 34/192 (17%)

Query: 103 SQHSLLSTVNCIKTVIAAVGQIFFARLSDIFGRFSIMIVSVIFYSVGTIIE-----SQAV 157
           S  +LL     + TVI   GQI F  ++DI GR  I  + +I     T+++     S AV
Sbjct: 96  STTTLLKVSTSVGTVI---GQIGFGTMADIVGRKKIYGLELIVMMAATVLQCTLGKSPAV 152

Query: 158 NITRFAVGGCFYQ----LGLTGIILILEVIASDFSNLNWR---LLALFIPALPFIINTWI 210
           +   F     FY+    +G+ G   +  +I S+FS   WR   + A+F       I+  I
Sbjct: 153 S---FVAVLAFYRVIMGIGIGGDYPLSSIITSEFSTTKWRGAIMGAVFANQAWGQISAGI 209

Query: 211 SGDVTSA--------IGTNWKWGI-------GMWAFILPLACIPLGICMLHMRYLARKHA 255
              V  A        + T  + GI        MW  ++ L C+P G+  L+ R    +  
Sbjct: 210 VALVLVAAYKNQLIDVNTGAECGIECAKACDQMWRILVGLGCVP-GVVALYFRLTIPESP 268

Query: 256 KDRLKPEFEALN 267
           + +L    EA N
Sbjct: 269 RYQLDVHVEAEN 280

>KAFR0F04080 Chr6 complement(795772..797421) [1650 bp, 549 aa] {ON} 
          Length = 549

 Score = 39.3 bits (90), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 47/189 (24%), Positives = 86/189 (45%), Gaps = 25/189 (13%)

Query: 95  QAYATSSYS--QHSLLSTVNCIKTVIAAVGQIFFARLSDIFGRFSIMIVSVIFYSVGTII 152
           QA  T ++S  +  L+ ++ C+     A+G I F++L D +GR   +++  + Y VG +I
Sbjct: 93  QADGTYAFSNIRTGLVVSIFCLG---CAIGGILFSKLGDTYGRRIALVIVTLVYMVGIVI 149

Query: 153 E-SQAVNITRFAVGGCFYQLGLTGIILILEVIASDFSNLNWR-----LLALFIPA---LP 203
             S      ++A+G  F  LG+ GI +   ++ S+ S  + R        L I A   + 
Sbjct: 150 CISANSKWYQYAIGRVFAGLGVGGIAVYSPLLISEASPKHLRGTLVSCYQLMITAGIFVG 209

Query: 204 FIINTWISGDVTSAIGTNWKWGIG-MWAFIL----------PLACIPLGICMLHMRYLAR 252
           +I+N      +T+++      G+G +WA ++          P   I +G      R +AR
Sbjct: 210 YILNYITKSTLTNSLQWRLPLGLGFLWAILMIVAMFFVPESPRYLIEVGKIEEARRSVAR 269

Query: 253 KHAKDRLKP 261
            +  D   P
Sbjct: 270 SNKIDVEDP 278

>KAFR0F02800 Chr6 (556502..558157) [1656 bp, 551 aa] {ON} 
          Length = 551

 Score = 39.3 bits (90), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 47/189 (24%), Positives = 86/189 (45%), Gaps = 25/189 (13%)

Query: 95  QAYATSSYS--QHSLLSTVNCIKTVIAAVGQIFFARLSDIFGRFSIMIVSVIFYSVGTII 152
           QA  T ++S  +  L+ ++ C+     A+G I F++L D +GR   +++  + Y VG +I
Sbjct: 95  QADGTYAFSNIRTGLVVSIFCLG---CAIGGILFSKLGDTYGRRIALVIVTLVYMVGIVI 151

Query: 153 E-SQAVNITRFAVGGCFYQLGLTGIILILEVIASDFSNLNWR-----LLALFIPA---LP 203
             S      ++A+G  F  LG+ GI +   ++ S+ S  + R        L I A   + 
Sbjct: 152 CISANSKWYQYAIGRVFAGLGVGGIAVYSPLLISEASPKHLRGTLVSCYQLMITAGIFVG 211

Query: 204 FIINTWISGDVTSAIGTNWKWGIG-MWAFIL----------PLACIPLGICMLHMRYLAR 252
           +I+N      +T+++      G+G +WA ++          P   I +G      R +AR
Sbjct: 212 YILNYITKSTLTNSLQWRLPLGLGFLWAILMIVAMFFVPESPRYLIEVGKIEEARRSVAR 271

Query: 253 KHAKDRLKP 261
            +  D   P
Sbjct: 272 SNKIDVEDP 280

>KAFR0E02030 Chr5 (404370..406016) [1647 bp, 548 aa] {ON} 
          Length = 548

 Score = 38.9 bits (89), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 47/189 (24%), Positives = 86/189 (45%), Gaps = 25/189 (13%)

Query: 95  QAYATSSYS--QHSLLSTVNCIKTVIAAVGQIFFARLSDIFGRFSIMIVSVIFYSVGTII 152
           QA  T ++S  +  L+ ++ C+     A+G I F++L D +GR   +++  + Y VG +I
Sbjct: 92  QADGTYAFSNIRTGLVVSIFCLG---CAIGGILFSKLGDTYGRRIALVIVTLVYMVGIVI 148

Query: 153 E-SQAVNITRFAVGGCFYQLGLTGIILILEVIASDFSNLNWR-----LLALFIPA---LP 203
             S      ++A+G  F  LG+ GI +   ++ S+ S  + R        L I A   + 
Sbjct: 149 CISANSKWYQYAIGRVFAGLGVGGIAVYSPLLISEASPKHLRGTLVSCYQLMITAGIFVG 208

Query: 204 FIINTWISGDVTSAIGTNWKWGIG-MWAFIL----------PLACIPLGICMLHMRYLAR 252
           +I+N      +T+++      G+G +WA ++          P   I +G      R +AR
Sbjct: 209 YILNYITKSTLTNSLQWRLPLGLGFLWAILMIVAMFFVPESPRYLIEVGKIEEARRSVAR 268

Query: 253 KHAKDRLKP 261
            +  D   P
Sbjct: 269 SNKIDVEDP 277

>Kpol_541.16 s541 complement(43396..44982) [1587 bp, 528 aa] {ON}
           complement(43396..44982) [1587 nt, 529 aa]
          Length = 528

 Score = 38.9 bits (89), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 36/62 (58%), Gaps = 1/62 (1%)

Query: 292 TVFFGCVLVPFTLAGGLKEEWKSAHIIVPEVIGWVVVLPLYMLWEMKYSRHPLTPWDLIK 351
           T   G +L  F       + W SA++IV  VI  V+ L  + ++E++Y+ +PL P ++I+
Sbjct: 258 TGVLGLILFNFVWNQAPADGWNSAYLIVLLVIS-VIALIAFGIYELRYAENPLLPSEIIR 316

Query: 352 DR 353
           +R
Sbjct: 317 NR 318

>KLLA0D19941g Chr4 complement(1698889..1700724) [1836 bp, 611 aa]
           {ON} similar to uniprot|P36172 Saccharomyces cerevisiae
           YKR105C Hypothetical ORF
          Length = 611

 Score = 38.9 bits (89), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 83/367 (22%), Positives = 149/367 (40%), Gaps = 38/367 (10%)

Query: 123 QIFFARLSDIFGRFSIMIVSVIFYSVGTIIESQAVNITRFAVGGCFYQLGLTGIILILEV 182
            + + R + + G  + M +S+  + VG+I+ + A ++    VG     +G +G+  +  V
Sbjct: 110 SLIWGRTASLLGFQASMTLSIFIFEVGSIVSASATSMDNLIVGRVIAGVGGSGLQTLSLV 169

Query: 183 IASDFSNLNWRLLALFIPALPFIINTWISGDVTSAIGTNWKWGIGMWAFILPLACIPLGI 242
           I S       R + + I    F   + I   V  A  T+  W    W F + L   P+G 
Sbjct: 170 IGSSIVEEKNRAMIVSIVMSAFAAASLIGPFVGGAFTTHVIW---RWCFWINL---PIGA 223

Query: 243 CMLHMRYLA----RKHAKDRLKPEFEALNKLK------WKSF-CIDIAF-WKLDIIGMLL 290
               + Y      R  A  R    F+++  L       W+++ C+     ++ DI+G   
Sbjct: 224 VTALLFYFTYNPKRLSAASRFTSCFKSVKALSFEKLASWETYRCMGKNLLFRFDIVG--F 281

Query: 291 ITVFFG-CVLVPFTLAGGLKEEWKSAHIIVPEVIGWV-----VVLPLYMLWEM-----KY 339
            T   G C+L+     GG  + WKSA +I   ++G++     VV   Y+  ++       
Sbjct: 282 ATGCAGVCLLLLGLTLGGEDDSWKSAIVICFLIVGFLLSVLSVVYDFYIFDKINPEPSNL 341

Query: 340 SRHPLTPWDLIKDRGXXXXXXXXXXXXXXWYMQGDYMYTV---LVVAVHESIKSATRITS 396
           S  P+    L+ +R               +   G  +Y+V    +V    +  +   +  
Sbjct: 342 SFRPMLVKGLLNNRFILLPNLVTCASAIAF--SGYMLYSVQFFQLVMGSSAWNAGLHLIP 399

Query: 397 LYSFVSVIVGTILGFILIKVRRTKPFIIFGISCWIVSFGLLVHYRGDSGAHSGIIGSLCL 456
           L    S++   I G I+ K  + KP +I  +S  ++  G+       SG +S  IG   L
Sbjct: 400 LV-IASIVSAIICGGIMKKTGQVKPLMISTVSILLIGGGVSTLLDNHSG-NSMQIGVWIL 457

Query: 457 LGFGAGS 463
            GFG G+
Sbjct: 458 PGFGLGA 464

>NCAS0B00290 Chr2 (33760..35388) [1629 bp, 542 aa] {ON} Anc_8.843
          Length = 542

 Score = 38.5 bits (88), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 40/71 (56%), Gaps = 3/71 (4%)

Query: 283 LDIIGMLLITVFFGCVLVPFTLAGGLKEEWKSAHIIVPEVIGWVVVLPLYMLWEMKYSRH 342
           +D IG +L  +  G +L+ F    G    W++A+II   V+  V  L L+  +E+KY+  
Sbjct: 265 MDWIGSVLAVI--GLILLNFVWNQGPIVGWQTAYIIALLVVS-VFFLALFFTYEVKYAES 321

Query: 343 PLTPWDLIKDR 353
           PL P ++ K+R
Sbjct: 322 PLLPVEVTKNR 332

>Skud_8.157 Chr8 complement(268495..270273) [1779 bp, 592 aa] {ON}
           YHR094C (REAL)
          Length = 592

 Score = 38.5 bits (88), Expect = 0.046,   Method: Compositional matrix adjust.
 Identities = 44/182 (24%), Positives = 78/182 (42%), Gaps = 22/182 (12%)

Query: 34  NPTLTTSSPAPSYIELIDPGVYNIEIYAEMYSRPLYRVA----LFFSLFLIAYAYG---- 85
           N  L    P  SY+    P    +E   +     L   +    LF S+  +  A+G    
Sbjct: 41  NNDLPQVKPVSSYVSHEGPPKDELEELQKEVDNQLESKSKSDLLFVSICCLMVAFGGFVF 100

Query: 86  ------LDGNIRYT--FQAYATSSYSQHSLLSTVN-----CIKTVIAAVGQIFFARLSDI 132
                 + G +R T   + + ++     S LS V       I  +  A+G I  +RL D+
Sbjct: 101 GWDTGTISGFVRQTDFIRRFGSTRADGTSYLSDVRTGLMVSIFNIGCAIGGIVLSRLGDM 160

Query: 133 FGRFSIMIVSVIFYSVGTIIESQAVNI-TRFAVGGCFYQLGLTGIILILEVIASDFSNLN 191
           +GR   ++  V+ YSVG II+  +++   ++ +G     LG+ GI ++  ++ S+ S   
Sbjct: 161 YGRKIGLMSVVVIYSVGIIIQIASIDKWYQYFIGRIISGLGVGGITVLAPMLISEVSPKQ 220

Query: 192 WR 193
            R
Sbjct: 221 LR 222

>NDAI0E00210 Chr5 complement(19177..21018) [1842 bp, 613 aa] {ON}
           Anc_8.858
          Length = 613

 Score = 38.5 bits (88), Expect = 0.047,   Method: Compositional matrix adjust.
 Identities = 42/150 (28%), Positives = 63/150 (42%), Gaps = 36/150 (24%)

Query: 103 SQHSLLSTVNCIKTVIAAVGQIFFARLSDIFGRFSIMIVSVIFYSVGTIIE-----SQAV 157
           S ++LL     + TVI   GQI F  ++DI GR  I  + +I   V TI++     S ++
Sbjct: 113 STNTLLKVSTSVGTVI---GQIGFGTMADIMGRKKIYGLELILMIVTTILQCMTGSSPSI 169

Query: 158 NITRFAVGGCFYQ----LGLTGIILILEVIASDFSNLNWRLLALFIPALPFIINTWISGD 213
           N         FY+    +G+ G   +  +I S+FS   WR                  G 
Sbjct: 170 NFVAILT---FYRIVMGIGIGGDYPLSSIITSEFSTTKWR------------------GA 208

Query: 214 VTSAIGTNWKWGI---GMWAFILPLACIPL 240
           +  A+  N  WG    G+ A IL  A  P+
Sbjct: 209 IMGAVFANQAWGQILGGIVALILVAAYKPM 238

>TPHA0L01570 Chr12 complement(333218..334585) [1368 bp, 455 aa] {ON}
           Anc_8.521 YBR207W
          Length = 455

 Score = 38.5 bits (88), Expect = 0.047,   Method: Compositional matrix adjust.
 Identities = 20/64 (31%), Positives = 37/64 (57%)

Query: 101 SYSQHSLLSTVNCIKTVIAAVGQIFFARLSDIFGRFSIMIVSVIFYSVGTIIESQAVNIT 160
           S S+H     ++ I +VI +V  +FF R+  +  +F + + S+I+   G ++E QAVN +
Sbjct: 153 SVSEHYYEGILSIIASVIISVMGLFFLRMGKLREKFRVKLASMIYSEHGNLLERQAVNDS 212

Query: 161 RFAV 164
           +  V
Sbjct: 213 KNVV 216

>Ecym_1388 Chr1 complement(806312..808030) [1719 bp, 572 aa] {ON}
           similar to Ashbya gossypii AFR442C
          Length = 572

 Score = 38.5 bits (88), Expect = 0.052,   Method: Compositional matrix adjust.
 Identities = 45/173 (26%), Positives = 72/173 (41%), Gaps = 34/173 (19%)

Query: 103 SQHSLLSTVNCIKTVIAAVGQIFFARLSDIFGRFSIMIVSVIFYSVGTIIE-----SQAV 157
           S +SLL     + TVI   GQ+ F  L+D+ GR  I  V +I     T+++     S ++
Sbjct: 97  STNSLLKVSTSVGTVI---GQVGFGTLADVVGRKKIYGVELIIMIAATVLQCTIGSSPSI 153

Query: 158 NITRFAVGGCFYQ----LGLTGIILILEVIASDFSNLNWR---LLALFIPA--------- 201
           N         FY+    +G+ G   +  +I S+FS   WR   + A+F            
Sbjct: 154 NFVAVLT---FYRIVMGIGIGGDYPLSSIITSEFSTTKWRGAIMGAVFANQAWGQLSCGI 210

Query: 202 LPFIINTWISGDVTSAIGTN------WKWGIGMWAFILPLACIPLGICMLHMR 248
           L  I+     GD+  A   +       K    MW  ++   C+P G+  L+ R
Sbjct: 211 LALILVAAYKGDLVGATTGDECGFECQKACDQMWRILVGFGCVP-GLIALYFR 262

>TBLA0E01970 Chr5 complement(478901..480637) [1737 bp, 578 aa] {ON} 
          Length = 578

 Score = 38.5 bits (88), Expect = 0.055,   Method: Compositional matrix adjust.
 Identities = 39/165 (23%), Positives = 68/165 (41%), Gaps = 22/165 (13%)

Query: 119 AAVGQIFFARLSDIFGRFSIMIVSVIFYSVGTIIESQAVN------ITRFAVGGCFYQLG 172
            AVG +   +L DI+GR   +I++ I + +G +IE  +V+      I R   G     + 
Sbjct: 126 CAVGSVTLGKLGDIYGRRWGLILATIIFVIGVLIEITSVDKWYQYFIGRIIAGIGMGLIA 185

Query: 173 LTGIILILEVIASDFSNLNWRLLALFIPALPFIINTWISGDVTSAIGTNWKWGIG---MW 229
           +   +LI EV   +          L I    F+ N    G  + +    W+ G+G   +W
Sbjct: 186 VLSPMLISEVAPKELRGAMVSCYQLMITFGIFLGNCCNYGTKSYSNSAQWRIGVGLQFLW 245

Query: 230 AFILPLACIPLGICMLHM-----RYLARKHAKDRLKPEFEALNKL 269
           + I+        +C +       RYL +K   ++ K      NK+
Sbjct: 246 SIIM--------VCAMMFVPESPRYLIQKGKTEQAKISIARSNKV 282

>TBLA0A03480 Chr1 (859635..861359) [1725 bp, 574 aa] {ON}
          Length = 574

 Score = 38.1 bits (87), Expect = 0.063,   Method: Compositional matrix adjust.
 Identities = 42/168 (25%), Positives = 67/168 (39%), Gaps = 18/168 (10%)

Query: 114 IKTVIAAVGQIFFARLSDIFGRFSIMIVSVIFYSVGTIIESQAVN------ITRFAVGGC 167
           I  V  A+G +   RL DI+GR   +I++ + + VG +IE  +++      I R   G  
Sbjct: 124 IFNVGCAIGSVTLGRLGDIYGRRLGLIMATVIFVVGVVIEIASIDKWYQYFIGRIIAGIG 183

Query: 168 FYQLGLTGIILILEVIASDFSNLNWRLLALFIPALPFIINTWISGDVTSAIGTNWKWGIG 227
              + +   +LI EV   D          L I    F+ +    G  T +  T W+ G+G
Sbjct: 184 MGVIAVLSPMLISEVSPKDMRGAMVSCYQLMITMGIFLGDCTEYGSKTYSDSTQWRVGLG 243

Query: 228 M---WAFILPLACIPLGICML---HMRYLARKHAKDRLKPEFEALNKL 269
           +   W   +      +G  M      R+L  K   +  K      NKL
Sbjct: 244 LQFAWCLFM------VGGMMFVPESPRFLIEKGKLEEAKRSVATSNKL 285

>TBLA0D03270 Chr4 complement(813041..814693) [1653 bp, 550 aa] {ON}
           Anc_8.843 YMR279C
          Length = 550

 Score = 38.1 bits (87), Expect = 0.073,   Method: Compositional matrix adjust.
 Identities = 23/73 (31%), Positives = 43/73 (58%), Gaps = 3/73 (4%)

Query: 282 KLDIIGMLLITVFFGCVLVPFTLAGGLKEEWKSAHIIVPEVIGWVVVLPLYMLWEMKYSR 341
           K+D +G +L    FG +++ F         W+SA+IIV  V+ +   L +++++E+KY++
Sbjct: 270 KMDWLGSVLGV--FGLIILNFVFNQAPIVGWQSAYIIVLLVLSFCA-LVIFVVYEVKYAK 326

Query: 342 HPLTPWDLIKDRG 354
            PL P  +  +RG
Sbjct: 327 TPLIPKAISSNRG 339

>TBLA0A03460 Chr1 complement(845685..847391) [1707 bp, 568 aa] {ON}
          Length = 568

 Score = 37.7 bits (86), Expect = 0.081,   Method: Compositional matrix adjust.
 Identities = 56/229 (24%), Positives = 94/229 (41%), Gaps = 31/229 (13%)

Query: 81  AYAYGLDGNIRYTFQA-------YATSSYSQHSLLSTVN-----CIKTVIAAVGQIFFAR 128
            Y  G D      F+A       + ++S S    LS V       +  V  A+G  F  R
Sbjct: 74  GYISGWDSGTIGGFEAQTDFLARFGSTSGSGKRYLSKVRTGLLTSMFNVGQAIGSFFLGR 133

Query: 129 LSDIFGRFSIMIVSVIFYSVGTIIESQAVNI-TRFAVGGCFYQLGLTGIILILEVIASDF 187
           L DI+GR   +IV+   + VGT+I+  +V    ++ +G     LG   I ++  ++ S+ 
Sbjct: 134 LGDIYGRRIGLIVASFIFIVGTVIQIASVKAWYQYMIGRIVAGLGCGLIAILSPMLISEV 193

Query: 188 SNLNWRLLALFIPALPFIINTWIS-----GDVTSAIGTNWKWGIGMWAFILPLA-CIPLG 241
           S  N R   +    L   +  ++      G       T W+ G+G     L  A C+ + 
Sbjct: 194 SPKNMRGAMVSCYQLMITLGIFLGYCTNYGTKRYHDSTQWRVGLG-----LQFAWCLCMI 248

Query: 242 ICMLHM----RYLARKHAKDRLKPEFEALNKLKWKSFCIDIAFWKLDII 286
           + ML +    R+L  K    R++    ++ K    S    +  W+LD I
Sbjct: 249 VAMLFVPESPRFLVEKG---RIEEAKRSIGKSNGVSPDDPVTLWELDEI 294

>TBLA0B00840 Chr2 complement(188743..190656) [1914 bp, 637 aa] {ON} 
          Length = 637

 Score = 37.7 bits (86), Expect = 0.082,   Method: Compositional matrix adjust.
 Identities = 24/79 (30%), Positives = 42/79 (53%), Gaps = 1/79 (1%)

Query: 116 TVIAAVGQIFFARLSDIFGRFSIMIVSVIFYSVGTIIESQAVNI-TRFAVGGCFYQLGLT 174
            V  A+G  F  RL DI+GR   +IV+ + + +GT+I+  +V    ++ +G     LG  
Sbjct: 128 NVGQAIGSFFLGRLGDIYGRRIGLIVASVIFIIGTVIQIASVKAWYQYMIGRIIAGLGCG 187

Query: 175 GIILILEVIASDFSNLNWR 193
            I ++  ++ S+ S  N R
Sbjct: 188 LIAILSPMLISEVSPKNMR 206

>TPHA0G03150 Chr7 (670343..672145) [1803 bp, 600 aa] {ON} Anc_2.473
           YMR088C
          Length = 600

 Score = 37.7 bits (86), Expect = 0.091,   Method: Compositional matrix adjust.
 Identities = 55/235 (23%), Positives = 100/235 (42%), Gaps = 36/235 (15%)

Query: 123 QIFFARLSDIFGRFSIMIVSVIFYSVGTIIESQAVNITRFAVGGCFYQLGLTGIILILEV 182
           Q  + RLSDI GR    ++   F+ +G+ + + +  + +FA+      +G  GI  +  +
Sbjct: 118 QPLYGRLSDIIGRKYTQLIVPFFFGMGSFLTTFSKTLPQFALARAVAGIGGGGISAMSSI 177

Query: 183 IASDFSNLNWRLL----ALFIPALPFIINTWISGDVTSAIGTNWKWGIGMWAFILPLACI 238
             SD   +  R +    A        +I   I G +   IG  W+    ++AF +P+  +
Sbjct: 178 AVSDICTVKERGMYQGYANIFYGAGQLIGAPIGGLLIDRIG--WR---ALFAFQVPMVAV 232

Query: 239 PLGICMLHMRYLARKHAKDRLKPEFEALNKLKWKSFCIDIAFWKLDIIGMLLITVFFGCV 298
            +    L   YL  K A   L P+ E   + KWK         KLDI G + + +  G  
Sbjct: 233 AM---FLSFTYLNIKLA--HLPPKEE---RYKWKHLS------KLDIFGSITLVITIGIC 278

Query: 299 LVPFTLAGGLKEEWKSAHIIVPEVIGWVVVLP--LYMLWEMKYSRHPLTPWDLIK 351
           +V  +  G           +   V+G + +L   L+++ E  Y++H + P   ++
Sbjct: 279 IVILSDNG-----------LNRMVLGAMGLLSFGLFLIIEKYYTKHQILPLKCLQ 322

>NCAS0A07810 Chr1 complement(1554541..1556247) [1707 bp, 568 aa]
           {ON} Anc_2.473
          Length = 568

 Score = 37.4 bits (85), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 39/163 (23%), Positives = 67/163 (41%), Gaps = 3/163 (1%)

Query: 33  VNPTLTTSS--PAPSYIELIDPGVYNIEIYAEMYSRPLYRVALFFSLFLIAYAYGLDGNI 90
           ++P   TSS  P  S IE  +      E Y E Y+  L +  +  SL+L ++   LD  I
Sbjct: 1   MDPLDETSSLLPIRSSIEDGEEDNGLEEQYHE-YNLSLPKFPILLSLWLGSFLSSLDSTI 59

Query: 91  RYTFQAYATSSYSQHSLLSTVNCIKTVIAAVGQIFFARLSDIFGRFSIMIVSVIFYSVGT 150
                      + +      +     +     Q  + +LSDI GR   ++ S  F+ +G 
Sbjct: 60  VANIMNKVAEEFEESDKKQWIATSFLLTNTAFQPLYGKLSDITGRKFAVLTSHFFFGLGC 119

Query: 151 IIESQAVNITRFAVGGCFYQLGLTGIILILEVIASDFSNLNWR 193
            +   A NIT+F++      +G  G+  +  +  SD  +   R
Sbjct: 120 FLTCFAQNITQFSIARAICGIGAGGVNAMSSITVSDICSTRER 162

>TBLA0D05800 Chr4 complement(1435290..1437014) [1725 bp, 574 aa]
           {ON} 
          Length = 574

 Score = 37.4 bits (85), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 40/160 (25%), Positives = 67/160 (41%), Gaps = 12/160 (7%)

Query: 120 AVGQIFFARLSDIFGRFSIMIVSVIFYSVGTIIESQAVN------ITRFAVGGCFYQLGL 173
           A+G +   RL DI+GR   +I++   + VG +IE  +++      I R   G     + +
Sbjct: 130 AIGSVTLGRLGDIYGRRLGLIMATTIFVVGVVIEIASIDKWYQYFIGRIIAGVGMGVIAI 189

Query: 174 TGIILILEVIASDFSNLNWRLLALFIPALPFIINTWISGDVTSAIGTNWKWGIGM-WAFI 232
              +LI EV   +          L I    F+ +    G  T +    W+ G+G+ +A+ 
Sbjct: 190 LSPMLISEVSPREMRGAMVSCFQLMITLGIFLGDCTEYGTKTYSNSVQWRVGLGLQFAWC 249

Query: 233 LPLACIPLGICML--HMRYLARKHAKDRLKPEFEALNKLK 270
           L   C+  G+  +    RYL  K   +  K      NKL 
Sbjct: 250 L---CMVGGMMFVPESPRYLVEKGKLEEAKRSVATSNKLN 286

>TBLA0D03280 Chr4 complement(815937..817679) [1743 bp, 580 aa] {ON} 
          Length = 580

 Score = 37.4 bits (85), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 23/73 (31%), Positives = 42/73 (57%), Gaps = 3/73 (4%)

Query: 282 KLDIIGMLLITVFFGCVLVPFTLAGGLKEEWKSAHIIVPEVIGWVVVLPLYMLWEMKYSR 341
            +D IG +L    FG +++ F         W+SA+IIV  V+ +   L +++++E+KY++
Sbjct: 294 SMDWIGAIL--GIFGLLILNFVFNQAPIVGWQSAYIIVLLVLSFCA-LVIFVVYEVKYAK 350

Query: 342 HPLTPWDLIKDRG 354
            PL P  +  +RG
Sbjct: 351 TPLIPKAISSNRG 363

>ZYRO0G21868g Chr7 complement(1799212..1801074) [1863 bp, 620 aa]
           {ON} weakly similar to uniprot|Q04301 Saccharomyces
           cerevisiae YMR088C VBA1 Permease of basic amino acids in
           the vacuolar membrane
          Length = 620

 Score = 37.0 bits (84), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 27/108 (25%), Positives = 50/108 (46%)

Query: 86  LDGNIRYTFQAYATSSYSQHSLLSTVNCIKTVIAAVGQIFFARLSDIFGRFSIMIVSVIF 145
           LDG I  T      S + Q S+++ V     +     Q  + ++SDI GR   ++   I 
Sbjct: 117 LDGTIVSTTVNDVASRFQQASMVTWVATAYLLTTTAAQPLYGKISDIIGRRKCLLFGEIV 176

Query: 146 YSVGTIIESQAVNITRFAVGGCFYQLGLTGIILILEVIASDFSNLNWR 193
           ++VG  +   + +I + A+      +G +G   +  +I SD + L+ R
Sbjct: 177 FAVGVGLCIFSKSIPQLAIARGICGIGGSGTGAMTNIILSDMAPLSER 224

>Kwal_14.1585 s14 (377103..378815) [1713 bp, 570 aa] {ON} YMR088C -
           Hypothetical ORF [contig 239] FULL
          Length = 570

 Score = 37.0 bits (84), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 33/147 (22%), Positives = 63/147 (42%), Gaps = 4/147 (2%)

Query: 51  DPGVYNIEIYAEMYSRPLYRVALF----FSLFLIAYAYGLDGNIRYTFQAYATSSYSQHS 106
           D G+Y++E   E   R       F     SL+L      +DG I  T      S + + S
Sbjct: 27  DEGIYDLEETEEDLERDFRDPKTFPLVLLSLWLNTSICAIDGTIISTTMNEVASIFQEAS 86

Query: 107 LLSTVNCIKTVIAAVGQIFFARLSDIFGRFSIMIVSVIFYSVGTIIESQAVNITRFAVGG 166
           L++ V     +     Q  + + SD+ GR   ++ + + + +G ++   A  +   A+  
Sbjct: 87  LVTWVATAYMLTTCSVQPLYGKTSDLLGRKKCLLFAEVVFIIGLVLCGMARTVKELAIAR 146

Query: 167 CFYQLGLTGIILILEVIASDFSNLNWR 193
               +G +G+  +  +I SD + L+ R
Sbjct: 147 AICGIGGSGLGAMCNIILSDLAPLSQR 173

>NCAS0C00270 Chr3 complement(34958..36670) [1713 bp, 570 aa] {ON}
           Anc_8.858
          Length = 570

 Score = 36.6 bits (83), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 39/145 (26%), Positives = 63/145 (43%), Gaps = 34/145 (23%)

Query: 103 SQHSLLSTVNCIKTVIAAVGQIFFARLSDIFGRFSIMIVSVIFYSVGTII-----ESQAV 157
           S  +LL     + TVI   GQ+ F  ++DI GR  I  + +I   V +++     ES+A+
Sbjct: 88  STATLLKVSTSVGTVI---GQVGFGTIADIVGRKKIYGLELIIMIVMSVLQTTTGESRAI 144

Query: 158 NITRFAVGGCFYQ----LGLTGIILILEVIASDFSNLNWRLLALFIPALPFIINTWISGD 213
           N   F     FY+    +G+ G   +  +I S+F+   WR                  G 
Sbjct: 145 N---FVAVLTFYRIVMGIGIGGDYPLSSIITSEFATTKWR------------------GA 183

Query: 214 VTSAIGTNWKWGIGMWAFILPLACI 238
           +  A+  N  WG  + A I+ L C+
Sbjct: 184 IMGAVFANQAWG-QIAAGIVALVCV 207

>Skud_13.18 Chr13 complement(23890..25647) [1758 bp, 585 aa] {ON}
           YML123C (REAL)
          Length = 585

 Score = 36.6 bits (83), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 32/100 (32%), Positives = 48/100 (48%), Gaps = 15/100 (15%)

Query: 103 SQHSLLSTVNCIKTVIAAVGQIFFARLSDIFGRFSIMIVSVIFYSVGTIIE-----SQAV 157
           S  +LL     + TVI   GQ+ F  L+DI GR  I  + +I   V TI++     S A+
Sbjct: 102 SSQTLLKVSTSVGTVI---GQVGFGTLADIVGRKKIYGLELIIMIVCTILQTTVAHSPAI 158

Query: 158 NITRFAVGGCFYQ----LGLTGIILILEVIASDFSNLNWR 193
           N   F     FY+    +G+ G   +  +I S+F+   WR
Sbjct: 159 N---FVAVLTFYRIVMGIGIGGDYPLSSIITSEFATTKWR 195

>Suva_13.20 Chr13 complement(24012..25766) [1755 bp, 584 aa] {ON}
           YML123C (REAL)
          Length = 584

 Score = 36.6 bits (83), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 32/100 (32%), Positives = 48/100 (48%), Gaps = 15/100 (15%)

Query: 103 SQHSLLSTVNCIKTVIAAVGQIFFARLSDIFGRFSIMIVSVIFYSVGTIIE-----SQAV 157
           S  +LL     + TVI   GQ+ F  L+DI GR  I  + +I   V TI++     S A+
Sbjct: 102 SSQTLLKVSTSVGTVI---GQVGFGTLADIVGRKKIYGLELIIMIVCTILQTTVAHSPAI 158

Query: 158 NITRFAVGGCFYQ----LGLTGIILILEVIASDFSNLNWR 193
           N   F     FY+    +G+ G   +  +I S+F+   WR
Sbjct: 159 N---FVAVLTFYRIVMGIGIGGDYPLSSIITSEFATTKWR 195

>Skud_18.5 Chr18 (13411..13461,13465..13500,13504..13575) [159 bp,
           53 aa] {OFF}  YCL073C (HSP)
          Length = 53

 Score = 32.7 bits (73), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 29/51 (56%), Gaps = 3/51 (5%)

Query: 94  FQAYATSSYSQHSLLSTVNCIKTVIAAVGQIFFARLSDIFGRFSIMIVSVI 144
           F  Y TS+YS+H   S+ +   ++++   QI F+ LSD F R  +  V+ I
Sbjct: 5   FTGYTTSAYSEH---SSQHFNPSILSEFSQITFSSLSDYFRRLELSAVATI 52

>TBLA0A03470 Chr1 complement(849164..850900) [1737 bp, 578 aa] {ON}
          Length = 578

 Score = 36.2 bits (82), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 24/79 (30%), Positives = 41/79 (51%), Gaps = 1/79 (1%)

Query: 116 TVIAAVGQIFFARLSDIFGRFSIMIVSVIFYSVGTIIESQAVNI-TRFAVGGCFYQLGLT 174
            V  A+G  F  RL DI+GR   +IV+ + +  GTII+  ++    ++ +G     LG  
Sbjct: 131 NVGQAIGSFFLGRLGDIYGRRIGLIVASVIFIAGTIIQIASIKAWYQYMIGRIVAGLGCG 190

Query: 175 GIILILEVIASDFSNLNWR 193
            I ++  ++ S+ S  N R
Sbjct: 191 LIAILSPMLISEVSPKNMR 209

>Smik_13.11 Chr13 complement(20464..22224) [1761 bp, 586 aa] {ON}
           YML123C (REAL)
          Length = 586

 Score = 36.2 bits (82), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 30/100 (30%), Positives = 50/100 (50%), Gaps = 15/100 (15%)

Query: 103 SQHSLLSTVNCIKTVIAAVGQIFFARLSDIFGR---FSIMIVSVIFYSV--GTIIESQAV 157
           S  +LL     + TVI   GQ+ F  L+DI GR   + + ++ +IF ++   T+  S A+
Sbjct: 102 SSQTLLKVSTSVGTVI---GQVGFGTLADIVGRKKIYGMELIVMIFCTILQTTVAHSPAI 158

Query: 158 NITRFAVGGCFYQ----LGLTGIILILEVIASDFSNLNWR 193
           N   F     FY+    +G+ G   +  +I S+F+   WR
Sbjct: 159 N---FVAVLTFYRIVMGIGIGGDYPLSSIITSEFATTKWR 195

>ZYRO0A00902g Chr1 complement(64264..66078) [1815 bp, 604 aa] {ON}
           similar to uniprot|P25297 Saccharomyces cerevisiae
           YML123C PHO84 High-affinity inorganic phosphate (Pi)
           transporter and low-affinity manganese transporter
           regulated by Pho4p and Spt7p mutation confers resistance
           to arsenate exit from the ER during maturation requires
           Pho86p
          Length = 604

 Score = 36.2 bits (82), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 55/221 (24%), Positives = 88/221 (39%), Gaps = 44/221 (19%)

Query: 72  ALFFSLFLIAYAYGLDGNIRYTFQAYATSSYSQHSLLSTVNCIKTVIAAVGQIFFARLSD 131
           A+   + ++ Y Y  DGNI            S  +LL     + TVI   GQ  F  L+D
Sbjct: 77  AINLGVSMMTYVYWKDGNI----------PSSSETLLKVSTSVGTVI---GQFGFGILAD 123

Query: 132 IFGRFSIMIVSVIFYSVGTIIE-----SQAVNITRFAVGGCFYQLGLTGIIL----ILEV 182
           + GR  I  V +I      I++     S AVN T       F+++ +   I     +  +
Sbjct: 124 VLGRKKIYGVELIIMIAACIMQCVIGASPAVNFTAIMT---FFRIIMGIGIGGDYPLSSI 180

Query: 183 IASDFSNLNWR---LLALFIPA---------LPFIINTWISGDVTSA-----IGTNWKWG 225
           I S+FS   WR   + A+F            +  I+      D+ +A      G + K  
Sbjct: 181 ITSEFSTTKWRGAIMSAVFANQAFGQVAAGIVALILVEGYKDDLKAAKSGSTCGPSCKRA 240

Query: 226 IG-MWAFILPLACIPLGICMLHMRYLARKHAKDRLKPEFEA 265
              MW  ++ + C+P G   L+ R    +  +  L  EF+A
Sbjct: 241 CDQMWRILIGMGCVP-GCIALYFRLTIPESPRYTLDVEFDA 280

>ZYRO0A00330g Chr1 (19597..21327) [1731 bp, 576 aa] {ON} similar to
           uniprot|P38358 Saccharomyces cerevisiae YBR293W VBA2
           Permease of basic amino acids in the vacuolar membrane
          Length = 576

 Score = 36.2 bits (82), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 62/291 (21%), Positives = 115/291 (39%), Gaps = 29/291 (9%)

Query: 68  LYRVALFFSLFLIAYAYGLDGNIRYTFQAYATSSYSQHSLLSTVNCIKTVIAAVGQIFFA 127
           L   AL+ ++FL     G D  +  +      + ++   L S +     + +   Q  + 
Sbjct: 68  LIEAALYTNVFL----SGFDSTVTASTYQTIGNEFNHMDLSSWITASYLITSTSFQPLYG 123

Query: 128 RLSDIFGRFSIMIVSVIFYSVGTIIESQAVNITRFAVGGCFYQLGLTGIILILEVIASDF 187
             SD+ GR   +  + + +S+G +    ++NI   +    F  +G  G+I +  ++ SD 
Sbjct: 124 SFSDVLGRRKCLFFASMIFSIGCLGCGISINILWLSFMRAFTGIGGGGLITLSTIVNSDM 183

Query: 188 SNLNWR----LLALFIPALPFIINTWISGDVTSAIGTNWKWGIGMWAFILPLACIPLGIC 243
              + R         +  L  I      G +TS+IG  W+     W F+L +     G  
Sbjct: 184 IPTSKRGIFQAFQNLLLGLGAICGASFGGVITSSIG--WR-----WCFLLQVPISLAGAL 236

Query: 244 MLHMRYLARKHAKDRLKPEFEALNKLKWKSFCIDIAFWKLDIIGMLLITVFFGCVLVPFT 303
           + H+ Y+  +   +R K +  +  K   K          +D  G  LI +     LV  +
Sbjct: 237 IGHL-YVRNQDEYERRKSKESSQTKEMLK---------HIDFSGAFLIIIGLTLQLVYLS 286

Query: 304 LAGGLKEE---WKSAHIIVPEVIGWVVVLPLYMLWEMKYSRHPLTPWDLIK 351
           L     E    W S  +    V  + +VL L++L E + S   + P  L++
Sbjct: 287 LGSAADESGNTWSSPGLSAVLVASF-IVLVLFVLTEERTSARAIIPSKLVR 336

>SAKL0C02178g Chr3 complement(191542..193239) [1698 bp, 565 aa] {ON}
           weakly similar to uniprot|Q04301 Saccharomyces
           cerevisiae YMR088C VBA1 Permease of basic amino acids in
           the vacuolar membrane
          Length = 565

 Score = 36.2 bits (82), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 52/231 (22%), Positives = 97/231 (41%), Gaps = 17/231 (7%)

Query: 49  LIDPGVYNIEIYAEMYSRPLYRVAL-FFSLFLIAYAYGLDGNIRYTFQAYATSSYSQHSL 107
           L+D G  +   ++E+   P  +V +   +L + ++   LD  I  T      S     S 
Sbjct: 21  LVDTGEESTTSHSEL---PPTKVRITVLALLMGSFLSALDTTIVATLLPTIASDLDASSQ 77

Query: 108 LSTVNCIKTVIAAVGQIFFARLSDIFGRFSIMIVSVIFYSVGTIIESQ--AVNITRFAVG 165
           +S +     +  +  Q  + +LSDIFGR  ++I+S + +++G  I       N+   + G
Sbjct: 78  MSWIATAYLLSCSAFQPLYGKLSDIFGRKILLILSNLTFALGCAICGSPWTNNVWVLSTG 137

Query: 166 GCFYQLGLTGIILILEVIASDFSNLNWRLLALFIPALPFIINTWISGDVTSAI---GTNW 222
                +G  G   +  +  SD   L  R +   +  + F +    SG V  A+   G  W
Sbjct: 138 RFVAGIGGGGQATLSTITTSDIIPLRKRGVYQGLVNICFSLGC-ASGSVLGAVLQQGIGW 196

Query: 223 KWGIGMWAFI--LPLACIPLGICMLHMRYLARKHAKDRLKPEFEALNKLKW 271
           +     WAF+  +P+A +   +  + +   A    +  L  E +   +LKW
Sbjct: 197 R-----WAFLVQVPMALVCALMIAVVLDLPADSPGRGLLWLELKRGKRLKW 242

>AFR343C Chr6 complement(1060723..1062438) [1716 bp, 571 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOL103W
           (ITR2) and YDR497C (ITR1)
          Length = 571

 Score = 36.2 bits (82), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 30/109 (27%), Positives = 49/109 (44%), Gaps = 9/109 (8%)

Query: 71  VALFFSLFLIAYAYGLD-GNIRYTFQAYATS-----SYSQHSLLSTVNCIKTVIAAVGQI 124
           V L F   L  + +G D G I    Q+  T      +Y     +++   +  +IAA+G  
Sbjct: 67  VMLTFVASLSGFLFGYDTGYISSALQSVGTDLGHQLTYRDKEYITSATSLGALIAALGAG 126

Query: 125 FFARLSDIFGRFSIMIVSVIFYSVGTIIESQAVNITRFAVGGCFYQLGL 173
             A   D+FGR   ++ S I + VGT+++  A N  +  VG      G+
Sbjct: 127 ICA---DLFGRRKCIMFSNILFVVGTVLQVAAFNFWQMVVGRLVMGFGI 172

>NDAI0D05010 Chr4 complement(1193201..1194925) [1725 bp, 574 aa]
           {ON} 
          Length = 574

 Score = 36.2 bits (82), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 46/192 (23%), Positives = 78/192 (40%), Gaps = 23/192 (11%)

Query: 20  PDILEKEVGAIVDVNPTLTTS-----SPAPSYIELIDPGVYNIEIY-AEMYSRPLYRVAL 73
           P I  K V       P+ + S     +P+    E  + G  ++ I  AEM  +P      
Sbjct: 10  PTIGPKRVNNDFQSQPSESGSHSIMEAPSNKGEEEENKGFNDVNIPPAEMPKKPASEYVT 69

Query: 74  FFSLFLI----AYAYGLD-GNI-----------RYTFQAYATSSYSQHSLLSTVNCIKTV 117
              L L+     Y YG D G I           R+  Q    + Y        +  I  +
Sbjct: 70  VSILCLMIAFGGYVYGWDTGTISGFVSQTDWIRRFGQQRADGTYYLSKVRTGLLLAIFNI 129

Query: 118 IAAVGQIFFARLSDIFGRFSIMIVSVIFYSVGTIIESQAVNI-TRFAVGGCFYQLGLTGI 176
             A+G + F+RL DI+GR   ++   I Y VG +I   +++   ++ +G     +G+ GI
Sbjct: 130 GCAIGGLAFSRLGDIYGRRKALVFVTIVYMVGLVISIASIDKWYQYFIGRIISGMGVGGI 189

Query: 177 ILILEVIASDFS 188
            +   ++ S+ S
Sbjct: 190 AVYSPLLISEVS 201

>SAKL0C00154g Chr3 complement(4145..5860) [1716 bp, 571 aa] {ON}
           highly similar to uniprot|P53387 Kluyveromyces lactis
           KHT2 Hexose transporter 2
          Length = 571

 Score = 35.8 bits (81), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 39/170 (22%), Positives = 76/170 (44%), Gaps = 22/170 (12%)

Query: 114 IKTVIAAVGQIFFARLSDIFGRFSIMIVSVIFYSVGTIIESQAVNI-TRFAVGGCFYQLG 172
           I  V  AVG +  ++L DI+GR   ++   I Y VG +I+  +V+   ++ +G     LG
Sbjct: 125 IFNVGCAVGGLVLSKLGDIYGRCIGLMAVTIVYVVGIVIQISSVDKWYQYFIGRIVSGLG 184

Query: 173 LTGIILILEVIASDFSNLN--------WRLLALFIPALPFIINTWISGDVTSAIGTNWKW 224
           + G+ ++  ++ S+ +  +        W+L+  F   L +  N    G  +      W+ 
Sbjct: 185 VGGVCVLAPMLISETAPKHLRGTLLACWQLMVTFAIFLGYCANY---GTKSYDNSVQWRV 241

Query: 225 GIGM---WAFILPLACIPLGICML--HMRYLARKHAKDRLKPEFEALNKL 269
            +G+   WA I+      +G+C +    R+L +    +  K      NK+
Sbjct: 242 PLGLCFAWAIIM-----VVGMCFVPESPRFLVKVGRVEDAKRSVAKSNKI 286

>Ecym_5319 Chr5 complement(643494..645086) [1593 bp, 530 aa] {ON}
           similar to Ashbya gossypii AFR602W
          Length = 530

 Score = 35.8 bits (81), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 54/266 (20%), Positives = 111/266 (41%), Gaps = 34/266 (12%)

Query: 32  DVNPTLTTSSPAPSYIELIDPGVYNIEIYAEMYSRPLYRVALFFSLFLIAYAYGLDGNIR 91
           DVN  + +S+       +    V +  +   +    L+ + + F  F++ +  G  G + 
Sbjct: 21  DVNGVIASSTDKSVEQLVTVVPVMDSPVMGSLAKPVLFCMVIAFGGFILGWDIGTIGGLM 80

Query: 92  Y--TFQAYATSSYSQHS--------LLSTVNCIKTVIAAVGQIFFARLSDIFGRFSIMIV 141
              +F+ +  + Y+  +        LL  +  I  V  A+G +  A++ D  GR   + V
Sbjct: 81  NMPSFKNHFGTRYNASTGLNEFPNLLLGLIIGIFNVACALGGLTLAKVGDFKGRKVGIAV 140

Query: 142 SVIFYSVGTIIE-SQAVNITRFAVGGCFYQLGLTGIILILEVIASDFSNLNWRLLALFIP 200
           S++ Y  G +IE ++  +  +F +G  F  +G+  + +++ +  ++ S +  R   + + 
Sbjct: 141 SLLVYVFGVVIELAKPTHWGQFFIGRIFTGVGVGSLTVLVPMYVAEISPVRIRGSMVVLF 200

Query: 201 ALPFIINTWIS-----------GDVTSAIGTNWKWGIG---MWAFILPLACIPLGICML- 245
            L   +   +            GD+ S    +W+  I    MWA     A + LG+ M+ 
Sbjct: 201 QLNITVGVLVGNFVNYGCKKGFGDILSK--KHWQVPIALGPMWA-----AVVLLGLVMIP 253

Query: 246 -HMRYLARKHAKDRLKPEFEALNKLK 270
               YLA K      +  F  +N L+
Sbjct: 254 ESSHYLASKDKIKEAERSFAVMNALE 279

>TDEL0E02290 Chr5 (441643..443358) [1716 bp, 571 aa] {ON} Anc_5.395
           YHR094C
          Length = 571

 Score = 35.8 bits (81), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 48/187 (25%), Positives = 72/187 (38%), Gaps = 39/187 (20%)

Query: 114 IKTVIAAVGQIFFARLSDIFGRFSIMIVSVIFYSVGTIIESQAVNI-TRFAVGGCFYQLG 172
           I  V  A+G I  +R+ D++GR   +I  VI Y VG +I+  + +   ++ +G     LG
Sbjct: 122 IFNVGCAIGGIILSRIGDVYGRRVGLITVVIIYVVGILIQICSFDKWYQYFIGRIISGLG 181

Query: 173 LTGI-----ILILEVIASDFSNLNWRLLALFIPALPFIINTWISGDVTSAIGTNWKWGIG 227
           + GI     +LI EV   +          L I    F+      G  T +  T W+    
Sbjct: 182 VGGISVLSPMLISEVSPKEMRGAMVSSYQLMITLGIFLGYCCNYGTKTYSDSTQWR---- 237

Query: 228 MWAFILPLACIPLGIC----------MLHM----RYLARKHAKDRLKPEFEALNKLKWKS 273
                     +PLG+C          ML +    RYL      D  +     +NK     
Sbjct: 238 ----------VPLGLCFAWALFMIGGMLFVPESPRYLIEAGKHDEARRSLARVNKCP--- 284

Query: 274 FCIDIAF 280
             ID AF
Sbjct: 285 --IDSAF 289

>NDAI0G01520 Chr7 complement(336365..337957) [1593 bp, 530 aa] {ON}
           Anc_3.23
          Length = 530

 Score = 35.4 bits (80), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 27/93 (29%), Positives = 46/93 (49%), Gaps = 10/93 (10%)

Query: 71  VALFFSLFLIAYAYGLDGNIRY--TFQAYATSSYSQHS--------LLSTVNCIKTVIAA 120
           +A+ F+ F + +  G  G +    +FQ    +SY            LL  +  I  +  A
Sbjct: 61  IAIAFAGFTLGWDIGTIGGMTSMESFQNRFGTSYDSQRGVQYFPDLLLGLIISIFNIGCA 120

Query: 121 VGQIFFARLSDIFGRFSIMIVSVIFYSVGTIIE 153
           VG +  A+L+D FGR + + V+VI Y +G +I+
Sbjct: 121 VGSVTLAKLADWFGRKTGLYVTVIIYVIGLLIQ 153

>NDAI0D05020 Chr4 complement(1197075..1198796) [1722 bp, 573 aa]
           {ON} 
          Length = 573

 Score = 35.4 bits (80), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 21/76 (27%), Positives = 41/76 (53%), Gaps = 1/76 (1%)

Query: 114 IKTVIAAVGQIFFARLSDIFGRFSIMIVSVIFYSVGTIIESQAVNI-TRFAVGGCFYQLG 172
           I  +  A+G + F+RL DI+GR   ++   + Y VG II   +++   ++ +G     +G
Sbjct: 125 IFNIGCAIGGLLFSRLGDIYGRRKALVFVTVVYMVGLIISIASIDKWYQYFIGRIISGMG 184

Query: 173 LTGIILILEVIASDFS 188
           + GI +   ++ S+ S
Sbjct: 185 VGGIAVYSPLLISEVS 200

>TPHA0A01750 Chr1 complement(354061..355971) [1911 bp, 636 aa] {ON}
           Anc_8.272 YDR119W
          Length = 636

 Score = 35.4 bits (80), Expect = 0.48,   Method: Compositional matrix adjust.
 Identities = 59/282 (20%), Positives = 117/282 (41%), Gaps = 11/282 (3%)

Query: 76  SLFLIAYAYGLDGNIRYTFQAYATSSYSQHSLLSTVNCIKTVIAAVGQIFFARLSDIFGR 135
           S++L  +   LD  I  T  A   S +++   +S +     + +A  Q  + ++SDIFGR
Sbjct: 100 SMYLGIFLSALDNTIVSTLLARIGSEFNELPRISWIATAYLLSSATFQPLYGKISDIFGR 159

Query: 136 FSIMIVSVIFYSVGTIIESQAVNITRFAVGGCFYQLGLTGIILILEVIASDFSNLNWRLL 195
             ++    + + +G +I   A +     +G     +G  GI  +  +  SD   L  R L
Sbjct: 160 KIVLTFCNVNFFIGCLICGTAKSFWVLVIGRFISGVGGGGITSMSTITVSDIIPLRNRAL 219

Query: 196 ALFIPALPFIINTWISGDV----TSAIGTNWKWGIGMWAFILPLACIPLGICMLHMRYLA 251
              +    + +   + G +    T  +G+ W+   G + F +PL+ I     M+ ++ L 
Sbjct: 220 YQGVCNFYYGLGIALGGIIGGWFTEKLGS-WR---GAFLFQVPLSVISTVTVMVWLQ-LP 274

Query: 252 RKHAKDRLKPEFEALNKLKWKSFCIDIAFWKLDIIGMLLITVFFGCVLVPFTLAGGLKEE 311
           +      L+      +        I      +D  G + + +F    ++  + AGG    
Sbjct: 275 KDSKSYGLEITMSNNSSNNGTESIIMKKLKTIDWYGAMSLVIFLLSFMI-LSSAGGSDIS 333

Query: 312 WKSAHIIVPEVIGWVVVLPLYMLWEMKYSRHPLTPWDLIKDR 353
            KS   +   +I  V     ++  E+K+++ P+ P   +KDR
Sbjct: 334 VKSNTFLYLTLIS-VTSFISFIYIELKFAKDPILPLVFLKDR 374

>Kwal_14.854 s14 complement(82977..84689) [1713 bp, 570 aa] {ON}
           YMR011W (HXT2) - high affinity hexose transporter-2
           [contig 245] FULL
          Length = 570

 Score = 35.0 bits (79), Expect = 0.55,   Method: Compositional matrix adjust.
 Identities = 45/202 (22%), Positives = 76/202 (37%), Gaps = 38/202 (18%)

Query: 88  GNIRYTFQAYATSSYSQHSLLSTVNCIKTVIAAVGQIFFARLSDIFGRFSIMIVSVIFYS 147
           GN     Q Y  S      ++S  N    +  A+G +   RL D++GR   ++  ++ Y 
Sbjct: 102 GNFDVGEQKYVLSDVRTGLIVSIFN----IGCAIGGLTLGRLGDMYGRRLGLMAVILVYV 157

Query: 148 VGTIIESQAVNI-TRFAVGGCFYQLGLTGIILILEVIASDFSNLNWRLLALFIPALPFII 206
           VG II+  + N   ++ +G     LG+ GI ++   + S+ +  + R   +    L   +
Sbjct: 158 VGIIIQIASSNKWYQYFIGRIVSGLGVGGIAVLSPTLISETAPKHLRGTCVSFYQLMITL 217

Query: 207 NTWIS-----GDVTSAIGTNWKWGIGMWAFILPLACIPLGICML--------------HM 247
             ++      G  T +    WK              +PLG+C L                
Sbjct: 218 GIFMGYCTNYGTKTYSNAVQWK--------------LPLGLCFLWAIFMIAGMIFVPESP 263

Query: 248 RYLARKHAKDRLKPEFEALNKL 269
           RYL  K   +  K      NKL
Sbjct: 264 RYLIEKGNFEEAKRSIAKSNKL 285

>Kwal_26.6669 s26 complement(14202..15974) [1773 bp, 590 aa] {ON}
           YBR293W - Hypothetical ORF [contig 294] FULL
          Length = 590

 Score = 35.0 bits (79), Expect = 0.55,   Method: Compositional matrix adjust.
 Identities = 38/166 (22%), Positives = 69/166 (41%), Gaps = 5/166 (3%)

Query: 61  AEMYSRPLYRVALFFSLFLIAYAYGLDGNIRYTFQAYATSSYSQHSLLSTVNCIKTVIAA 120
           +++ SR ++ ++   S+FL  +   LD  I  T   +  S  +    +S V        A
Sbjct: 73  SDLMSRRIFMISA--SMFLGIFLAALDNTIVSTLLPHIGSELNDMPNVSLVATSYVFSCA 130

Query: 121 VGQIFFARLSDIFGRFSIMIVSVIFYSVGTIIESQAVNITRFAVGGCFYQLGLTGIILIL 180
           + Q  F + SD+FGR  ++I S + +  G +    +  I    +G     +G  G+  + 
Sbjct: 131 IFQPLFGKTSDVFGRKPLLISSNLLFFAGCLTCGLSKTIWWLILGRLVTGIGGGGLTSMC 190

Query: 181 EVIASDFSNLNWRLLALFIPALPFIINTWISGDVT---SAIGTNWK 223
            +I +D   L  R +      L + + T   G V    S  G  W+
Sbjct: 191 TIIINDIVPLRNRAVYQGFGNLFYALGTACGGLVGGLFSEYGNGWR 236

>CAGL0B02079g Chr2 complement(191736..193610) [1875 bp, 624 aa] {ON}
           similar to uniprot|P50080 Saccharomyces cerevisiae
           YGR224w AZR1 or uniprot|P36172 Saccharomyces cerevisiae
           YKR105c
          Length = 624

 Score = 35.0 bits (79), Expect = 0.61,   Method: Compositional matrix adjust.
 Identities = 76/386 (19%), Positives = 149/386 (38%), Gaps = 49/386 (12%)

Query: 127 ARLSDIFGRFSIMIVSVIFYSVGTIIESQAVNITRFAVGGCFYQLGLTGIILILEVIASD 186
            R++ + G  +  + +++ + VG+++ + A ++     G     +G +G+  ++ VI+S 
Sbjct: 99  GRIATLVGFKTSTLAAIVIFEVGSLVSALANSMDMLIGGRVIAGIGGSGVQSLVFVISST 158

Query: 187 FSNLNWRLLALFIPALPFIINTWISGDVTSAIGTNWKWGIGMWAFILPLACIPLGICMLH 246
                 R L + + +  F I + +   +  A  T+  W    W F + L    L   +  
Sbjct: 159 LVEERNRGLIIAVMSSSFGIASVVGPFLGGAFTTHVTW---RWCFYINLPVGGLAFFLFL 215

Query: 247 MRYLARKHAKDRLKPEFEALNKLKW--------------KSFCIDIA------------- 279
             Y   K   ++   E E +   +               KS  + +A             
Sbjct: 216 TFYNPEKWVVNKDTAEDEVVGNGRLGLLSILGGQAVRFVKSVGVQLAKLRYPGTWRIIAR 275

Query: 280 --FWKLDIIGMLLITVFFGCVLVPFTLAGGLKEEWKSAHIIVPEVIGWVVVLPLYMLWEM 337
             F++ DI+  + +T+    +L+ FT  GG K +W S   I   V+G +  L  ++    
Sbjct: 276 ELFYRFDIVEFVFMTLGSVLILLAFTF-GGNKYKWNSGSTISMFVLGILFTLGAFVYDFF 334

Query: 338 KYSR----------HPLTPWDLIKDRGXXXXXXXXXXXXXXWYMQGDYMYTVLVVAVHES 387
            Y +           PL  W++ K  G              + +Q +Y+     +  +++
Sbjct: 335 IYPKFEAVKTVPHYQPLMSWNICKKPGVWLFNIAVFFVACAFSIQTNYIIQYFQLVFNDT 394

Query: 388 I-KSATRITSLYSFVSVIVGTILGFILIKVRRTKPFIIFGISCWIVSFGLLVHYRGDSGA 446
             K+A  + +    V + V +  G +  K    KP  IF     I+  GLL     +  +
Sbjct: 395 AWKAAIHLIATVVPVVITVVS-SGIVNSKTGYVKPIAIFSGVTGIIGAGLLTLLD-NHAS 452

Query: 447 HSGIIGSLCLLGFGAGSFTYVTQASI 472
            +  IG L L G    +F  + Q+SI
Sbjct: 453 SAKKIGLLILPGV---TFGAIMQSSI 475

>KLTH0D05434g Chr4 (486319..488049) [1731 bp, 576 aa] {ON} similar
           to uniprot|Q04301 Saccharomyces cerevisiae YMR088C VBA1
           Permease of basic amino acids in the vacuolar membrane
          Length = 576

 Score = 35.0 bits (79), Expect = 0.63,   Method: Compositional matrix adjust.
 Identities = 29/131 (22%), Positives = 56/131 (42%), Gaps = 1/131 (0%)

Query: 64  YSRPLYRVALFFSLFLIAYAYGLDGNIRYTFQAYATSSYSQHSLLSTVNCIKTVIAAVGQ 123
           ++  L ++ +  SL+L ++   LDG I           + +      +     +     Q
Sbjct: 33  HNLALPKIPILVSLWLGSFLVALDGTIVANVMNRIAEEFQESDKKQWIATSFLLTNTAFQ 92

Query: 124 IFFARLSDIF-GRFSIMIVSVIFYSVGTIIESQAVNITRFAVGGCFYQLGLTGIILILEV 182
             + +LSD+  GR    +++  F+ +G II   A N+T+FA+G     +G  G+  +  +
Sbjct: 93  PLYGKLSDVATGRKLATLIAQFFFFLGLIISCFAQNVTQFAIGRAVCGIGGGGVSAMSSI 152

Query: 183 IASDFSNLNWR 193
             SD      R
Sbjct: 153 AVSDICTAKER 163

>ABL040W Chr2 (321534..323237) [1704 bp, 567 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR088C
          Length = 567

 Score = 35.0 bits (79), Expect = 0.68,   Method: Compositional matrix adjust.
 Identities = 23/104 (22%), Positives = 48/104 (46%)

Query: 62  EMYSRPLYRVALFFSLFLIAYAYGLDGNIRYTFQAYATSSYSQHSLLSTVNCIKTVIAAV 121
           + ++R L +  +  SL+L ++   +D +I           + +      +     +  A 
Sbjct: 35  QEHNRSLPKAPILTSLWLGSFLASIDASIVANIMNKIAEEFHESDKKQWMATSFLLTNAA 94

Query: 122 GQIFFARLSDIFGRFSIMIVSVIFYSVGTIIESQAVNITRFAVG 165
            Q  + R SDI GR   ++++  F+ +GT++   A N+T FA+ 
Sbjct: 95  FQPLYGRCSDIVGRKCALLIAQSFFLLGTLLTCFARNVTEFAIA 138

>TBLA0A03390 Chr1 complement(806095..807819) [1725 bp, 574 aa] {ON}
           Anc_5.395 YHR094C
          Length = 574

 Score = 35.0 bits (79), Expect = 0.68,   Method: Compositional matrix adjust.
 Identities = 23/61 (37%), Positives = 35/61 (57%), Gaps = 2/61 (3%)

Query: 120 AVGQIFFARLSDIFGRFSIMIVSVIFYSVGTIIESQAVNI-TRFAVGGCFYQLGLTGIIL 178
           A+G  F  RL D++GR   +I++ I + VGTII+  +V    ++ +G     LG  GII 
Sbjct: 131 AIGCFFLGRLGDMYGRRMAIIIASIIFVVGTIIQIASVKAWYQYMIGRIVAGLG-CGIIA 189

Query: 179 I 179
           I
Sbjct: 190 I 190

>KAFR0B03940 Chr2 complement(820954..822597) [1644 bp, 547 aa] {ON}
           Anc_8.843 YMR279C
          Length = 547

 Score = 35.0 bits (79), Expect = 0.69,   Method: Compositional matrix adjust.
 Identities = 23/72 (31%), Positives = 38/72 (52%), Gaps = 3/72 (4%)

Query: 282 KLDIIGMLLITVFFGCVLVPFTLAGGLKEEWKSAHIIVPEVIGWVVVLPLYMLWEMKYSR 341
           K+D IG LL  +  G +L+ F         W  A+IIV  ++  V  L  + ++E+K + 
Sbjct: 269 KMDWIGSLLGVI--GLILMNFVWNQAPISGWSKAYIIVILIVA-VFFLVAFFIYELKKAE 325

Query: 342 HPLTPWDLIKDR 353
            PL P ++ K+R
Sbjct: 326 SPLLPPEVTKNR 337

>CAGL0A01826g Chr1 complement(184013..185779) [1767 bp, 588 aa] {ON}
           highly similar to uniprot|P38695 Saccharomyces
           cerevisiae YHR096c HXT5 or uniprot|P32466 Saccharomyces
           cerevisiae YDR345c HXT3
          Length = 588

 Score = 34.7 bits (78), Expect = 0.71,   Method: Compositional matrix adjust.
 Identities = 41/189 (21%), Positives = 77/189 (40%), Gaps = 16/189 (8%)

Query: 91  RYTFQAYATSSYSQHSLLSTVNCIKTVIAAVGQIFFARLSDIFGRFSIMIVSVIFYSVGT 150
           R+  Q    + Y  +     +  I  +  A+G I  ++L DI+GR   ++  V+ Y++G 
Sbjct: 116 RFGQQRSDGTYYLSNVRTGLIVAIFNIGCAIGGITLSKLGDIWGRRLGLVTVVVVYTIGI 175

Query: 151 IIESQAVNI-TRFAVGGCFYQLGLTGIILILEVIASDFSNLNWR-----LLALFIPALPF 204
           +I+  +++   ++ +G     LG+ GI ++  ++ S+ S    R        L I    F
Sbjct: 176 VIQIASIDKWYQYFIGRIISGLGVGGIAVLSPMLISEVSPKQLRGTLVSCYQLMITCGIF 235

Query: 205 IINTWISGDVTSAIGTNWKWGIGM---WAF--ILPLACIPLGICMLHMRYLARKHAKDRL 259
           +      G    +    W+  +G+   WA   I  + C+P        RYL      +  
Sbjct: 236 LGYCTNYGTKNYSNSVQWRVPLGLCFAWALFMIFGVMCVP-----ESPRYLVEVGKLEEA 290

Query: 260 KPEFEALNK 268
           K      NK
Sbjct: 291 KRSLARANK 299

>SAKL0E02992g Chr5 complement(243652..245364) [1713 bp, 570 aa] {ON}
           similar to uniprot|Q04301 Saccharomyces cerevisiae
           YMR088C VBA1 Permease of basic amino acids in the
           vacuolar membrane
          Length = 570

 Score = 34.7 bits (78), Expect = 0.71,   Method: Compositional matrix adjust.
 Identities = 36/168 (21%), Positives = 65/168 (38%), Gaps = 26/168 (15%)

Query: 1   MDPATANHALPEDFTEDVVPDILEKEVGAIVDVNPTLTTSSPAPSYIELIDPGVYNIEIY 60
           MD ATA      D   +++PD L+                 P    + L D         
Sbjct: 1   MDKATA------DERTNLLPDTLD-----------------PQSLSLNLEDEFNRKNSSL 37

Query: 61  AEMYSR---PLYRVALFFSLFLIAYAYGLDGNIRYTFQAYATSSYSQHSLLSTVNCIKTV 117
            E Y +    L ++ + FSL++ ++   LDG I           + +      +     +
Sbjct: 38  EEEYHKHNLDLPKLPIVFSLWMGSFLGALDGTIVANIMNRVAEEFQESDKKQWIATSFLL 97

Query: 118 IAAVGQIFFARLSDIFGRFSIMIVSVIFYSVGTIIESQAVNITRFAVG 165
                Q  + +LSDI GR   ++V+  F+ +G ++   A N+T F++ 
Sbjct: 98  TNTAFQPLYGKLSDITGRKFALLVAHTFFCLGCLLTCFARNVTEFSIA 145

>NDAI0C01740 Chr3 (378218..380041) [1824 bp, 607 aa] {ON} 
          Length = 607

 Score = 34.7 bits (78), Expect = 0.76,   Method: Compositional matrix adjust.
 Identities = 24/88 (27%), Positives = 47/88 (53%), Gaps = 1/88 (1%)

Query: 100 SSYSQHSLLSTVNCIKTVIAAVGQIFFARLSDIFGRFSIMIVSVIFYSVGTIIESQAVNI 159
           S Y  +  +  +  I  V AA+G +  AR  D++GR   +I  V  Y+VG +I+  +++ 
Sbjct: 125 SHYLSNVRMGLLVSIFNVGAAIGGVMLARTGDMWGRRLGLITVVSIYTVGIVIQIASIDK 184

Query: 160 -TRFAVGGCFYQLGLTGIILILEVIASD 186
             ++ +G     LG+ GI ++  ++ S+
Sbjct: 185 WFQYFIGRIISGLGVGGIAVLAPMLISE 212

>Suva_12.263 Chr12 (430196..431659) [1464 bp, 487 aa] {ON} YNR072W
           (REAL)
          Length = 487

 Score = 34.3 bits (77), Expect = 0.90,   Method: Compositional matrix adjust.
 Identities = 48/201 (23%), Positives = 83/201 (41%), Gaps = 31/201 (15%)

Query: 89  NIRYTFQAYATSS---YSQHSLLSTVNCIKTVIAAVGQIFFARLSDIFGRFSIMIVSVIF 145
           N +  F +Y  S+   Y  +  +  +  + +V  A+G + FARL+D  GR   +++ V+ 
Sbjct: 3   NFKMNFGSYKHSTGEYYLSNVRMGLLVAMFSVGCAIGGLIFARLADTLGRRLAIVIVVLV 62

Query: 146 YSVGTIIE-SQAVNITRFAVGGCFYQLGLTGIILILEVIASDFSNLNWR--LLALFIPAL 202
           Y VG II+ S      ++ VG   Y LG  G  ++  ++ S+ +  + R  L++L+   +
Sbjct: 63  YIVGAIIQISSNHKWYQYFVGKIIYGLGAGGCSVLCPMLLSEIAPKDLRGGLISLYQLNM 122

Query: 203 PFIINTWISGDVTSAIGTNWKWGIGMWAFILPLACIPLGICML--------------HMR 248
            F I         S  GT        W        IP+G+C L                R
Sbjct: 123 TFGIFL----GYCSVYGTRKYDNTAQWR-------IPIGLCFLWALIIIIGMLLVPESPR 171

Query: 249 YLARKHAKDRLKPEFEALNKL 269
           YL      +  +     +NK+
Sbjct: 172 YLIESEKHEEARTSIAKVNKV 192

>Suva_15.419 Chr15 (740086..741852) [1767 bp, 588 aa] {ON} YLR081W
           (REAL)
          Length = 588

 Score = 34.3 bits (77), Expect = 0.95,   Method: Compositional matrix adjust.
 Identities = 48/201 (23%), Positives = 83/201 (41%), Gaps = 31/201 (15%)

Query: 89  NIRYTFQAYATSS---YSQHSLLSTVNCIKTVIAAVGQIFFARLSDIFGRFSIMIVSVIF 145
           N +  F +Y  S+   Y  +  +  +  + +V  A+G + FARL+D  GR   +++ V+ 
Sbjct: 104 NFKMNFGSYKHSTGEYYLSNVRMGLLVAMFSVGCAIGGLIFARLADTLGRRLAIVIVVLV 163

Query: 146 YSVGTIIE-SQAVNITRFAVGGCFYQLGLTGIILILEVIASDFSNLNWR--LLALFIPAL 202
           Y VG II+ S      ++ VG   Y LG  G  ++  ++ S+ +  + R  L++L+   +
Sbjct: 164 YIVGAIIQISSNHKWYQYFVGKIIYGLGAGGCSVLCPMLLSEIAPKDLRGGLISLYQLNM 223

Query: 203 PFIINTWISGDVTSAIGTNWKWGIGMWAFILPLACIPLGICML--------------HMR 248
            F I         S  GT        W        IP+G+C L                R
Sbjct: 224 TFGIFL----GYCSVYGTRKYDNTAQWR-------IPIGLCFLWALIIIIGMLLVPESPR 272

Query: 249 YLARKHAKDRLKPEFEALNKL 269
           YL      +  +     +NK+
Sbjct: 273 YLIESEKHEEARTSIAKVNKV 293

>TBLA0A01250 Chr1 (294923..296434) [1512 bp, 503 aa] {ON} 
          Length = 503

 Score = 34.3 bits (77), Expect = 0.96,   Method: Compositional matrix adjust.
 Identities = 21/67 (31%), Positives = 35/67 (52%), Gaps = 5/67 (7%)

Query: 97  YATSSYSQHSLLSTVN-----CIKTVIAAVGQIFFARLSDIFGRFSIMIVSVIFYSVGTI 151
           + ++S S    LS V       +  +  A+G  F  RL D++GR   +IV+ I + VGT+
Sbjct: 32  FGSTSGSGKRYLSKVRTGLLTSMFNIGQAIGCFFLGRLGDMYGRRIAIIVASIIFVVGTV 91

Query: 152 IESQAVN 158
           I+  +V 
Sbjct: 92  IQIASVK 98

>AFL205C Chr6 complement(49039..50679) [1641 bp, 546 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YHR094C
           (HXT1)
          Length = 546

 Score = 34.3 bits (77), Expect = 0.98,   Method: Compositional matrix adjust.
 Identities = 22/76 (28%), Positives = 45/76 (59%), Gaps = 3/76 (3%)

Query: 120 AVGQIFFARLSDIFG-RFSIMIVSVIFYSVGTIIE-SQAVNITRFAVGGCFYQLGLTGII 177
           AVG IF ++ +D++G R  +MIV+++ Y +G +++ S      ++ +G     LG+ GI 
Sbjct: 111 AVGGIFLSKFADMYGRRIGLMIVTLV-YVIGIVVQISSTDKWYQYCIGRVISGLGVGGIA 169

Query: 178 LILEVIASDFSNLNWR 193
           ++  ++ S+ S  + R
Sbjct: 170 VLSPMLISETSPKHLR 185

>TBLA0A01240 Chr1 complement(289083..290792) [1710 bp, 569 aa] {ON} 
          Length = 569

 Score = 34.3 bits (77), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 23/61 (37%), Positives = 35/61 (57%), Gaps = 2/61 (3%)

Query: 120 AVGQIFFARLSDIFGRFSIMIVSVIFYSVGTIIESQAVNI-TRFAVGGCFYQLGLTGIIL 178
           A+G  F  RL D++GR   +IV+ I + VGT+I+  +V    ++ +G     LG  GII 
Sbjct: 126 AIGCFFLGRLGDMYGRRIAIIVASIIFIVGTVIQIASVKAWYQYMIGRIVAGLG-CGIIA 184

Query: 179 I 179
           I
Sbjct: 185 I 185

>KLTH0E02750g Chr5 (248224..249927) [1704 bp, 567 aa] {ON} highly
           similar to uniprot|P32466 Saccharomyces cerevisiae
           YDR345C HXT3 Low affinity glucose transporter of the
           major facilitator superfamily expression is induced in
           low or high glucose conditions
          Length = 567

 Score = 34.3 bits (77), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 30/125 (24%), Positives = 57/125 (45%), Gaps = 10/125 (8%)

Query: 120 AVGQIFFARLSDIFGRFSIMIVSVIFYSVGTIIESQAVNI-TRFAVGGCFYQLGLTGIIL 178
           A+G I   +L +++GR   + + VI YSVG II+  +++   ++ +G     LG+  I +
Sbjct: 125 AIGGIVLGKLGEVYGRRLGLTIVVIIYSVGIIIQIASIDKWYQYFIGRIISGLGVGAITI 184

Query: 179 ILEVIASDFSNLNWRLLALFIPALPFIINTWISGDVTSAIGTNWKWGIGMWAFILPLACI 238
           +  ++ S+ S  + R     +    F++   I     +  GT        W        +
Sbjct: 185 LSPMLISEVSPKHLR--GTLVSCYQFMVTGGIFLGYCTNYGTKRYSNSVQWR-------V 235

Query: 239 PLGIC 243
           PLG+C
Sbjct: 236 PLGLC 240

>NDAI0K00280 Chr11 complement(51303..53018) [1716 bp, 571 aa] {ON}
           Anc_8.858
          Length = 571

 Score = 34.3 bits (77), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 30/99 (30%), Positives = 46/99 (46%), Gaps = 19/99 (19%)

Query: 106 SLLSTVNCIKTVIAAVGQIFFARLSDIFGR-------FSIMIVSVIFYSVGTIIESQAVN 158
           +LL     + TVI   GQ+ F  L+D+ GR         IMI++ I     T  ES+A+N
Sbjct: 90  TLLKVSTSVGTVI---GQLGFGTLADVVGRKKIYGLELIIMIITAILQC--TTGESKAIN 144

Query: 159 ITRFAVGGCFYQ----LGLTGIILILEVIASDFSNLNWR 193
                    FY+    +G+ G   +  +I S+F+   WR
Sbjct: 145 FVAILT---FYRIVMGIGIGGDYPLSSIITSEFATTKWR 180

>TBLA0A03500 Chr1 complement(863154..864875) [1722 bp, 573 aa] {ON} 
          Length = 573

 Score = 34.3 bits (77), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 27/103 (26%), Positives = 51/103 (49%), Gaps = 6/103 (5%)

Query: 97  YATSSYSQHSLLSTVN-----CIKTVIAAVGQIFFARLSDIFGRFSIMIVSVIFYSVGTI 151
           + ++S S    LS V       +  V  A+G  F  RL DI+GR   +IV+ + + +G++
Sbjct: 102 FGSTSGSGKRYLSKVRTGLLTSMFNVGQAIGCFFLGRLGDIYGRRIGLIVASVIFIIGSV 161

Query: 152 IESQAVNI-TRFAVGGCFYQLGLTGIILILEVIASDFSNLNWR 193
           I+  +V    ++ +G     +G   I ++  ++ S+ S  N R
Sbjct: 162 IQIASVKAWYQYMIGRIVAGIGCGLIAILSPMLISEVSPKNMR 204

>NDAI0F01940 Chr6 (471792..473447) [1656 bp, 551 aa] {ON} 
          Length = 551

 Score = 33.9 bits (76), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 26/104 (25%), Positives = 48/104 (46%), Gaps = 1/104 (0%)

Query: 91  RYTFQAYATSSYSQHSLLSTVNCIKTVIAAVGQIFFARLSDIFGRFSIMIVSVIFYSVGT 150
           R+  +    S Y     +  +  I  +  A+G +F  RL D  GR   ++V+V  Y VG 
Sbjct: 79  RFGSKHRDGSHYLSKVRIGLLVSIFNIGCAIGSVFLGRLGDTIGRRKGIVVAVSIYMVGI 138

Query: 151 IIESQAVNI-TRFAVGGCFYQLGLTGIILILEVIASDFSNLNWR 193
           +I+  +V    ++ +G     LG   I ++  ++ S+ S  + R
Sbjct: 139 VIQIASVKKWFQYLIGRIISGLGAGCIAVLSPMLISEVSPKHLR 182

>KNAG0J00260 Chr10 (37950..39602) [1653 bp, 550 aa] {ON} Anc_8.843
           YMR279C
          Length = 550

 Score = 33.9 bits (76), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 17/58 (29%), Positives = 33/58 (56%), Gaps = 1/58 (1%)

Query: 296 GCVLVPFTLAGGLKEEWKSAHIIVPEVIGWVVVLPLYMLWEMKYSRHPLTPWDLIKDR 353
           G +L  F    G  + W   +II   ++  V +L  + ++E+K+++ PL P ++IK+R
Sbjct: 282 GMILFNFVWNQGPIDGWNKGYIIALLIVS-VFLLIAFFIYEIKFAKSPLLPPEVIKNR 338

>YML123C Chr13 complement(24037..25800) [1764 bp, 587 aa] {ON}
           PHO84High-affinity inorganic phosphate (Pi) transporter
           and low-affinity manganese transporter; regulated by
           Pho4p and Spt7p; mutation confers resistance to
           arsenate; exit from the ER during maturation requires
           Pho86p; cells overexpressing Pho84p accumulate heavy
           metals but do not develop symptoms of metal toxicity
          Length = 587

 Score = 33.9 bits (76), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 31/98 (31%), Positives = 46/98 (46%), Gaps = 15/98 (15%)

Query: 105 HSLLSTVNCIKTVIAAVGQIFFARLSDIFGRFSIMIVSVIFYSVGTIIE-----SQAVNI 159
            +LL     + TVI   GQ  F  L+DI GR  I  + +I   V TI++     S A+N 
Sbjct: 104 QTLLKVSTSVGTVI---GQFGFGTLADIVGRKRIYGMELIIMIVCTILQTTVAHSPAIN- 159

Query: 160 TRFAVGGCFYQ----LGLTGIILILEVIASDFSNLNWR 193
             F     FY+    +G+ G   +  +I S+F+   WR
Sbjct: 160 --FVAVLTFYRIVMGIGIGGDYPLSSIITSEFATTKWR 195

>Kwal_26.6686 s26 complement(23884..25593) [1710 bp, 569 aa] {ON}
           YIL171W (HXT12) - hexose permease [contig 381] FULL
          Length = 569

 Score = 33.9 bits (76), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 19/68 (27%), Positives = 39/68 (57%), Gaps = 1/68 (1%)

Query: 120 AVGQIFFARLSDIFGRFSIMIVSVIFYSVGTIIESQAVNI-TRFAVGGCFYQLGLTGIIL 178
           A G +   +L DI+GR   +++ ++ Y VGTII+  A +   ++ +G   Y  G+ G+ +
Sbjct: 129 AFGGLTLPKLGDIYGRRLGLMIVIVLYVVGTIIQISAQDKWYQYFIGKIIYGWGVGGVSV 188

Query: 179 ILEVIASD 186
           +  ++ S+
Sbjct: 189 LAPMLISE 196

>TBLA0B10150 Chr2 (2445764..2447479) [1716 bp, 571 aa] {ON} 
          Length = 571

 Score = 33.9 bits (76), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 40/185 (21%), Positives = 79/185 (42%), Gaps = 14/185 (7%)

Query: 98  ATSSYSQHSLLSTVN----CIKTVIAAVGQIFFARLSDIFGRFSIMIVSVIFYSVGTIIE 153
           +T+ Y +H L          I  +  A+G +    + DI+GR   +I++ I +  G +IE
Sbjct: 101 STNKYGEHYLSKARTGLLVSIFNIGCAIGSVTLGNIGDIYGRRLGLIIATIIFVAGVVIE 160

Query: 154 SQAVNI-TRFAVGGCFYQLGLTGIILILEVIASDFSNLNWR-----LLALFIPALPFIIN 207
             +++   ++ +G     +G+  ++++  ++ S+ S    R        L I    F+ +
Sbjct: 161 IASIDKWYQYFIGRIISGVGMGVVVILSPMLISEVSPKELRGAMVSSFQLMITLGMFLGD 220

Query: 208 TWISGDVTSAIGTNWKWGIGMWAFILPLACIPLGICML--HMRYLARKHAKDRLKPEFEA 265
               G    +  T W+ G+G+  F   L C+  G+  +    R+L  K   +  K     
Sbjct: 221 CTEYGTKKYSNSTQWRVGLGL-QFAWSL-CMVGGMLFVPESPRFLVEKGKIEEAKRSVAI 278

Query: 266 LNKLK 270
            NKL 
Sbjct: 279 SNKLN 283

>KNAG0C05190 Chr3 (1014564..1016258) [1695 bp, 564 aa] {ON} 
          Length = 564

 Score = 33.9 bits (76), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 39/166 (23%), Positives = 67/166 (40%), Gaps = 24/166 (14%)

Query: 119 AAVGQIFFARLSDIFGRFSIMIVSVIFYSVGTIIESQAVNI-TRFAVGGCFYQLGLTGII 177
            A+G I  ++  D++GR   +I+ V  Y VG +I+   +N   ++ +G     LG+ GI 
Sbjct: 120 CAIGGIILSKAGDMYGRKKGLIIVVSIYIVGIVIQIATINKWYQYFIGRIISGLGVGGIS 179

Query: 178 LILEVIASDFSNLNWRLLALFIPALPFIINTWISGDVTSAIGTNWKWGIGMWAFILPLAC 237
           ++  ++ S+ S  + R     +     +I   I     +  GT        W        
Sbjct: 180 VLSPMLISEVSPKHLR--GTLVSCFQLMITLGIFLGYCTNYGTKKYSNSTQWR------- 230

Query: 238 IPLGICM---LHM-----------RYLARKHAKDRLKPEFEALNKL 269
           +PLG+C    L M           RYL  K+  +  K      NK+
Sbjct: 231 VPLGLCFAWALFMIGGMTFVPESPRYLLEKNLIEEAKHSISISNKV 276

>KNAG0E02560 Chr5 (506517..508253) [1737 bp, 578 aa] {ON} Anc_2.473
           YMR088C
          Length = 578

 Score = 33.9 bits (76), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 20/93 (21%), Positives = 44/93 (47%)

Query: 73  LFFSLFLIAYAYGLDGNIRYTFQAYATSSYSQHSLLSTVNCIKTVIAAVGQIFFARLSDI 132
           +  SL+L ++   LDG +         + +++      +     +     Q  + +LSDI
Sbjct: 44  ILLSLWLGSFVSALDGTVVANIMNSIAAEFAESDKKQWIATSYLLTNTAFQPLYGKLSDI 103

Query: 133 FGRFSIMIVSVIFYSVGTIIESQAVNITRFAVG 165
            GR   +I +  F+++G ++   A N+T+F++ 
Sbjct: 104 TGRKVAVITAHFFFALGCLLTCFAQNVTQFSIA 136

>TDEL0H04480 Chr8 complement(774396..776108) [1713 bp, 570 aa] {ON} 
          Length = 570

 Score = 33.9 bits (76), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 16/37 (43%), Positives = 23/37 (62%)

Query: 122 GQIFFARLSDIFGRFSIMIVSVIFYSVGTIIESQAVN 158
           G I    LS+ FGR   +++S IFY+VG I+ + A N
Sbjct: 153 GSILLTPLSETFGRKKALVMSCIFYTVGAIVCAAAGN 189

>Kwal_26.7755 s26 (500034..501713) [1680 bp, 559 aa] {ON} YMR088C -
           1:1 [contig 55] FULL
          Length = 559

 Score = 33.9 bits (76), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 29/119 (24%), Positives = 53/119 (44%), Gaps = 6/119 (5%)

Query: 51  DPGVYNI---EIYAEMYSRPLYRVALFFSLFLIAYAYGLDGNIRYTFQAYATSSYSQHSL 107
           D  V++I   E + +  + P  +  +  SL+L ++   LDG I           + +   
Sbjct: 19  DNNVHSILEKEYHEQNLNLP--KTPILVSLWLGSFLVALDGTIVANVMNRIAEEFQESDK 76

Query: 108 LSTVNCIKTVIAAVGQIFFARLSDIF-GRFSIMIVSVIFYSVGTIIESQAVNITRFAVG 165
              +     +     Q  + +LSD+  GR    +V+  F+ +G +I   A N+T+FAVG
Sbjct: 77  KQWIATSFLLTNTAFQPLYGKLSDVATGRKGAALVAQFFFCLGLVISCFAQNVTQFAVG 135

>Kwal_55.19582 s55 (35002..36705) [1704 bp, 567 aa] {ON} YNR072W
           (HXT17) - Putative hexose transporter [contig 159] FULL
          Length = 567

 Score = 33.9 bits (76), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 21/68 (30%), Positives = 39/68 (57%), Gaps = 1/68 (1%)

Query: 120 AVGQIFFARLSDIFGRFSIMIVSVIFYSVGTIIESQAVNI-TRFAVGGCFYQLGLTGIIL 178
           A+G +  ++L DIFGR   ++  V  Y VGTII+  A +   ++ +G   Y  G+ G+ +
Sbjct: 126 ALGGLTLSKLGDIFGRRLALMFVVGVYVVGTIIQISASDKWYQYFIGKIIYGWGVGGVSV 185

Query: 179 ILEVIASD 186
           +  ++ S+
Sbjct: 186 LAPMLISE 193

>KAFR0D00750 Chr4 complement(150046..151719) [1674 bp, 557 aa] {ON} 
          Length = 557

 Score = 33.9 bits (76), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 24/91 (26%), Positives = 48/91 (52%), Gaps = 4/91 (4%)

Query: 104 QHSLLSTVNCIKTVIAAVGQIFFARLSDIFGRFSIMIVSVIFYSVGTIIESQAVNI-TRF 162
           +  L+ ++ CI     A+G I F++L D +GR   +++  I Y VG +I   +++   ++
Sbjct: 103 RTGLIVSIFCIG---CAIGGIVFSKLGDQYGRRIALVIVTIVYMVGILISIASIDKWYQY 159

Query: 163 AVGGCFYQLGLTGIILILEVIASDFSNLNWR 193
            +G     LG+ GI +   ++ S+ S  + R
Sbjct: 160 FIGRIIAGLGVGGIAVYSPLLISEVSPKHLR 190

>NCAS0B00220 Chr2 complement(20530..22407) [1878 bp, 625 aa] {ON}
           Anc_8.858
          Length = 625

 Score = 33.5 bits (75), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 29/100 (29%), Positives = 47/100 (47%), Gaps = 15/100 (15%)

Query: 103 SQHSLLSTVNCIKTVIAAVGQIFFARLSDIFGRFSIMIVSVIFYSVGTIIE-----SQAV 157
           S  +LL     + TVI   GQ+ F  ++D+ GR  I  + +I   + TI++     S  +
Sbjct: 136 STATLLKVSTSVGTVI---GQVGFGTMADVIGRKKIYGMELILMIITTILQCTTGSSPGI 192

Query: 158 NITRFAVGGCFYQ----LGLTGIILILEVIASDFSNLNWR 193
           N   F     FY+    +G+ G   +  +I S+FS   WR
Sbjct: 193 N---FVAVLTFYRILMGIGIGGDYPLSSIITSEFSTTKWR 229

>KLTH0H05456g Chr8 (484160..485866) [1707 bp, 568 aa] {ON} similar
           to uniprot|Q04301 Saccharomyces cerevisiae YMR088C VBA1
           Permease of basic amino acids in the vacuolar membrane
          Length = 568

 Score = 33.5 bits (75), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 27/121 (22%), Positives = 52/121 (42%)

Query: 73  LFFSLFLIAYAYGLDGNIRYTFQAYATSSYSQHSLLSTVNCIKTVIAAVGQIFFARLSDI 132
           +  SL+L      +DG I  T      S + + S ++ V     +     Q  + + SD+
Sbjct: 50  ILLSLWLNTSICAVDGTIISTTMNEIASIFQEASKVTWVATAYMLTTCAVQPLYGKTSDL 109

Query: 133 FGRFSIMIVSVIFYSVGTIIESQAVNITRFAVGGCFYQLGLTGIILILEVIASDFSNLNW 192
            GR   ++ + + + VG ++   A  I    V      +G +G+  +  +I SD + L+ 
Sbjct: 110 LGRKKCLLFAEVVFIVGLVMCGAARTIEELIVARAICGVGGSGLGAMCNIILSDLAPLSQ 169

Query: 193 R 193
           R
Sbjct: 170 R 170

>ZYRO0C00374g Chr3 (23229..24923) [1695 bp, 564 aa] {ON} similar to
           uniprot|P30605 Saccharomyces cerevisiae YDR497C ITR1
          Length = 564

 Score = 33.5 bits (75), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 18/60 (30%), Positives = 32/60 (53%)

Query: 109 STVNCIKTVIAAVGQIFFARLSDIFGRFSIMIVSVIFYSVGTIIESQAVNITRFAVGGCF 168
           S V+ +  + A  G I     S++ GR + +++S  FY++G II + A+N+     G  F
Sbjct: 134 SLVSSLMPLGAVAGSILLTPFSEMLGRKTSLVISCGFYTMGAIICAAALNVQTMYAGRFF 193

>TPHA0I00380 Chr9 (72432..74168) [1737 bp, 578 aa] {ON} Anc_8.858
           YML123C
          Length = 578

 Score = 33.5 bits (75), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 31/102 (30%), Positives = 46/102 (45%), Gaps = 19/102 (18%)

Query: 103 SQHSLLSTVNCIKTVIAAVGQIFFARLSDIFGRFSIMIVSVIFYSVGTII-----ESQAV 157
           S  +LL     + TV    GQ+ F  L+D+ GR  I  + +I   V TI+     +S AV
Sbjct: 90  STTTLLKVSTSVGTVF---GQVGFGTLADVVGRKKIYGLELIVVIVTTILQCTAGQSPAV 146

Query: 158 NIT------RFAVGGCFYQLGLTGIILILEVIASDFSNLNWR 193
           N        R  +G     +G+ G   +  +I S+FS   WR
Sbjct: 147 NFVAILTTYRIVMG-----IGIGGDYPLSSIITSEFSTTKWR 183

>TBLA0F01600 Chr6 complement(399573..401276) [1704 bp, 567 aa] {ON} 
          Length = 567

 Score = 33.5 bits (75), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 44/195 (22%), Positives = 75/195 (38%), Gaps = 21/195 (10%)

Query: 95  QAYATSSYSQHSLLSTVN-----CIKTVIAAVGQIFFARLSDIFGRFSIMIVSVIFYSVG 149
           Q + T +      LST+       I  +  A+G +F  +L D++GR   +I     + VG
Sbjct: 105 QRFGTKNEDGVLYLSTIRMGLLVSIFNIGCAIGSVFLGKLGDLYGRRWGLIFGTSIFVVG 164

Query: 150 TIIESQAVN------ITRFAVGGCFYQLGLTGIILILEVIASDFSNLNWRLLALFIPALP 203
            II+  +V+      I R   G     + +   +LI EV   +          L I    
Sbjct: 165 VIIQIASVSKWFQYFIGRIIAGIGMGVIAVLSPMLISEVAPKELRGAMVSCYQLMITFGI 224

Query: 204 FIINTWISGDVTSAIGTNWKWGIG---MWAFIL--PLACIPLGICMLHMRYLARKHAKDR 258
           F+ N    G  +      W+  +G   +W  I+   +  +P        RYL +++  + 
Sbjct: 225 FLGNCCNYGTKSYQNSKQWRIAVGLQFLWCIIMVSGMTFVP-----ESPRYLVQQNMFEE 279

Query: 259 LKPEFEALNKLKWKS 273
            K      NKL  +S
Sbjct: 280 AKESIAISNKLSKES 294

>TBLA0A03430 Chr1 complement(827449..829143) [1695 bp, 564 aa] {ON} 
          Length = 564

 Score = 33.1 bits (74), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 21/79 (26%), Positives = 41/79 (51%), Gaps = 1/79 (1%)

Query: 116 TVIAAVGQIFFARLSDIFGRFSIMIVSVIFYSVGTIIESQAVNI-TRFAVGGCFYQLGLT 174
            V  ++G  F  RL D++GR   +I++   + VGTII+  +V    ++ +G     +G  
Sbjct: 117 NVGCSIGSFFLGRLGDMYGRRIGLIIATTIFIVGTIIQVASVKAWYQYMIGRIVAGVGCG 176

Query: 175 GIILILEVIASDFSNLNWR 193
            I ++  ++ S+ S  + R
Sbjct: 177 VIAMLSPMLISEVSPKHLR 195

>ZYRO0G21890g Chr7 complement(1801391..1803121) [1731 bp, 576 aa]
           {ON} weakly similar to uniprot|Q04301 Saccharomyces
           cerevisiae YMR088C VBA1 Permease of basic amino acids in
           the vacuolar membrane
          Length = 576

 Score = 33.1 bits (74), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 24/109 (22%), Positives = 50/109 (45%)

Query: 85  GLDGNIRYTFQAYATSSYSQHSLLSTVNCIKTVIAAVGQIFFARLSDIFGRFSIMIVSVI 144
            LDG I  T      S + Q S+++ V     +     Q  + ++SDI GR   ++   +
Sbjct: 74  ALDGTIVSTTVNDIASQFQQASMVTWVATAYLLTTTAVQPLYGKISDIIGRRKCLLFGEV 133

Query: 145 FYSVGTIIESQAVNITRFAVGGCFYQLGLTGIILILEVIASDFSNLNWR 193
            +++G ++ + A  I + A+      +G +G   +  ++ +D   L+ R
Sbjct: 134 IFALGVLLCNFANTIPQLAIARAICGIGGSGNSAMGNIMLNDILPLSVR 182

>NDAI0B03060 Chr2 complement(775021..776817) [1797 bp, 598 aa] {ON} 
          Length = 598

 Score = 33.1 bits (74), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 21/71 (29%), Positives = 34/71 (47%), Gaps = 4/71 (5%)

Query: 88  GNIRYTFQAYATSSYSQHSLLSTVNCIKTVIAAVGQIFFARLSDIFGRFSIMIVSVIFYS 147
           G++      Y  S      L+S VN    +  A+G I  ++  D++GR   + +  + Y 
Sbjct: 130 GHLDTAVNTYVLSRVRLGLLVSIVN----IGCAIGGIVLSKAGDVYGRRKGLTIVTMVYM 185

Query: 148 VGTIIESQAVN 158
           VG II+  AVN
Sbjct: 186 VGIIIQISAVN 196

>Kwal_14.728 s14 complement(11659..13365) [1707 bp, 568 aa] {ON}
           YKR105C - Hypothetical ORF [contig 245] FULL
          Length = 568

 Score = 33.1 bits (74), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 79/360 (21%), Positives = 141/360 (39%), Gaps = 27/360 (7%)

Query: 120 AVGQIFFARLSDIFGRFSIMIVSVIFYSVGTIIESQAVNITRFAVGGCFYQLGLTGIILI 179
           A+  + + R+S   G    ++  ++ +  G++I + A ++     G     +G +G+  +
Sbjct: 92  ALFSLLWGRISANLGPRISIVACIVLFEAGSLISALARSMNMLIAGRVVSGVGGSGLQTL 151

Query: 180 LEVIASDFSNLNWRLLALFIPALPFIINTWISGDVTSAIGTNWKWGIGMWAFILPLACIP 239
             VI     +   R L L +    F I + I   +  A  T+  W    W F + L   P
Sbjct: 152 SLVIGCQLVDEKSRPLVLSLLNCTFAIASIIGPFIGGAFTTHVTW---RWCFYINL---P 205

Query: 240 LG-ICMLHMRYLARKHAKDRL---KPEFEALNKLKWKSFCIDIAFWKL----DIIGMLLI 291
           +G + +L        H ++ L   K  F+ + K K  S     A  +L    DI+   L 
Sbjct: 206 IGGVAILTFLCFYNPHNENLLEEGKKAFKRVLKFKPTSLFSSKAMHQLLFGFDIVSFALF 265

Query: 292 TVFFGCVLVPFTLAGGLKEEWKSAHII----VPEVIGWVVVLPLYMLWEMKYSRH---PL 344
           T  +   L+  T  GG    W S  +I    V  ++  + +   + L+E   S+    PL
Sbjct: 266 TAGWVLFLLALTF-GGQSYSWDSGVVISFLVVGILLILLSLFYDFKLFEAMKSQENIRPL 324

Query: 345 TPWDLIKDRGXXXXXXXXXXXXXXWYMQGDYMYTVL-VVAVHESIKSATRITSLYSFVSV 403
             W L+                  + +Q  Y      +V    + K+   +  +   VS 
Sbjct: 325 LCWRLMSQPTIVLSNFSGFFSTVAYNVQMIYSVQFFQLVYGFTAWKAGLHLIPI--LVST 382

Query: 404 IVGTIL-GFILIKVRRTKPFIIFGISCWIVSFGLLVHYRGDSGAHSGIIGSLCLLGFGAG 462
           +V +I+ G +  K    KP ++FG +  ++  GL+      S  H+  IG L L G   G
Sbjct: 383 VVFSIMSGVLTKKTGHIKPLLVFGSAMGVLGGGLMTLLNNTSTKHTQ-IGVLILPGVALG 441

>CAGL0B02475g Chr2 (236029..237771) [1743 bp, 580 aa] {ON} highly
           similar to uniprot|P25297 Saccharomyces cerevisiae
           YML123c PHO84
          Length = 580

 Score = 33.1 bits (74), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 31/102 (30%), Positives = 46/102 (45%), Gaps = 19/102 (18%)

Query: 103 SQHSLLSTVNCIKTVIAAVGQIFFARLSDIFGRFSI-------MIVSVIFYSVGTIIESQ 155
           S  +LL     + TVI   GQ+ F  ++DI GR  I       MI + I  +  TI  S 
Sbjct: 103 STQTLLKVSTSVGTVI---GQLGFGTMADIVGRKKIYGLELIVMIATTILQT--TIGRSP 157

Query: 156 AVNITRFAVGGCFYQ----LGLTGIILILEVIASDFSNLNWR 193
            +N   F     FY+    +G+ G   +  +I S+F+   WR
Sbjct: 158 GIN---FPAVLTFYRIVMGIGIGGDYPLSSIITSEFATTKWR 196

>Suva_4.2 Chr4 (4514..6226) [1713 bp, 570 aa] {ON} YDR497C (REAL)
          Length = 570

 Score = 33.1 bits (74), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 27/50 (54%)

Query: 109 STVNCIKTVIAAVGQIFFARLSDIFGRFSIMIVSVIFYSVGTIIESQAVN 158
           S V+ +  + A  G I     S+ FGR   + +S +FY+VG I+ + A N
Sbjct: 140 SLVSSLMPLGAVAGSILLTPFSEYFGRKKSLAISCVFYTVGAIVCAAASN 189

>CAGL0D02640g Chr4 (274285..275979) [1695 bp, 564 aa] {ON} highly
           similar to uniprot|P23585 Saccharomyces cerevisiae
           YMR011w HXT2 high-affinity hexose transporter or
           uniprot|P43581 Saccharomyces cerevisiae YFL011w HXT10 or
           uniprot|P39003 Saccharomyces cerevisiae YDR343c HXT6
          Length = 564

 Score = 33.1 bits (74), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 26/101 (25%), Positives = 45/101 (44%), Gaps = 1/101 (0%)

Query: 87  DGNIRYTFQAYATSSYSQHSLLSTVNCIKTVIAAVGQIFFARLSDIFGRFSIMIVSVIFY 146
           D   R+  QA   S Y        +  I  +  A+G +   RL D++GR   ++  +  Y
Sbjct: 91  DFKRRFGQQAADGSYYLSDVRTGLIVAIFNIGCAIGGLTLGRLGDMYGRRLGLMAVITVY 150

Query: 147 SVGTIIE-SQAVNITRFAVGGCFYQLGLTGIILILEVIASD 186
            VG +I+ S      ++ VG     LG+ GI ++   + S+
Sbjct: 151 VVGIVIQISSTTTWYQYFVGRIVSGLGVGGIAVLSPTLISE 191

>CAGL0D02662g Chr4 complement(278099..279793) [1695 bp, 564 aa] {ON}
           highly similar to uniprot|P23585 Saccharomyces
           cerevisiae YMR011w HXT2 high-affinity hexose transporter
           or uniprot|P43581 Saccharomyces cerevisiae YFL011w HXT10
           or uniprot|P39003 Saccharomyces cerevisiae YDR343c HXT6
          Length = 564

 Score = 33.1 bits (74), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 26/101 (25%), Positives = 45/101 (44%), Gaps = 1/101 (0%)

Query: 87  DGNIRYTFQAYATSSYSQHSLLSTVNCIKTVIAAVGQIFFARLSDIFGRFSIMIVSVIFY 146
           D   R+  QA   S Y        +  I  +  A+G +   RL D++GR   ++  +  Y
Sbjct: 91  DFKRRFGQQAADGSYYLSDVRTGLIVAIFNIGCAIGGLTLGRLGDMYGRRLGLMAVITVY 150

Query: 147 SVGTIIE-SQAVNITRFAVGGCFYQLGLTGIILILEVIASD 186
            VG +I+ S      ++ VG     LG+ GI ++   + S+
Sbjct: 151 VVGIVIQISSTTTWYQYFVGRIVSGLGVGGIAVLSPTLISE 191

>YCL069W Chr3 (9706..11082) [1377 bp, 458 aa] {ON}  VBA3Permease of
           basic amino acids in the vacuolar membrane
          Length = 458

 Score = 32.7 bits (73), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 75/335 (22%), Positives = 125/335 (37%), Gaps = 35/335 (10%)

Query: 164 VGGCFYQLGLTGIILILEVIASDFSNLNWRLLALFIPALPFIINTWISGDVTSAIGTNWK 223
           VG     +G +G+  +  VI         R L + I +  F +   +   +  A  T+  
Sbjct: 6   VGRVVASVGGSGLQTLCFVIGCTMVGERSRPLVISILSCAFAVAAIVGPIIGGAFTTHVT 65

Query: 224 WGIGMWAFILPLACIPLGICMLHMRYLAR-KHAKDRLKPEFEALNKLKWKSFCIDIAFWK 282
           W    W F + L    L I M  + Y A  K    ++K     ++   +  F   + F +
Sbjct: 66  W---RWCFYINLPIGGLAIIMFLLTYKAENKGILQQIKDAIGTISSFTFSKFRHQVNFKR 122

Query: 283 LDIIGMLLITVFFGCVL-----VPFTLA---GGLKEEWKSAHIIVPEVIGWVVVLPLYML 334
           L + G++    FFG  L     V F L    GG K  W S  +I   V+G V++    ++
Sbjct: 123 L-MNGIIFKFDFFGFALCSAGLVLFLLGLTFGGNKYSWNSGQVIAYLVLG-VLLFIFSLV 180

Query: 335 WEM-----------KYSRHPLTPWDLIKDRGXXXXXXXXXXXXXXWYMQGDYMYTV---L 380
           ++              S  PL    L+                  +   G  +Y+V    
Sbjct: 181 YDFFLFDKFNPEPDNISYRPLLLRRLVAKPAIIIINMVTFLLCTGY--NGQMIYSVQFFQ 238

Query: 381 VVAVHESIKSATRITSLYSFVSVIVGTILGFILIKVRRTKPFIIFGISCWIVSFGLLVHY 440
           ++    + K+   +  +    +VI     G I  K+   KP +IFG    ++  GL+   
Sbjct: 239 LIFASSAWKAGLHLIPIV-ITNVIAAIASGVITKKLGLVKPLLIFGGVLGVIGAGLMTLM 297

Query: 441 RGDSGAHSGIIGSLCLLGFGAGSFTYVTQASIQAS 475
              S   S  IG L L GF  G   +  QAS+ ++
Sbjct: 298 TNTS-TKSTQIGVLLLPGFSLG---FALQASLMSA 328

>Kpol_1053.24 s1053 (36161..38023) [1863 bp, 620 aa] {ON}
           (36161..38023) [1863 nt, 621 aa]
          Length = 620

 Score = 33.1 bits (74), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 43/165 (26%), Positives = 70/165 (42%), Gaps = 22/165 (13%)

Query: 119 AAVGQIFFARLSDIFGRFSIMIVSVIFYSVGTIIESQAVNITRFAVGGCFYQLGLTGIIL 178
           A +  IF    +DIFGR   +++S + + +G II+  A    +  VG      G+    L
Sbjct: 172 ALISSIFAGISADIFGRKPCILLSNLMFLIGAIIQVTAHTFWQMVVGRFIMGFGVGIGSL 231

Query: 179 ILEVIASDFSNLNWRLLALFIPALPFIINTWISGDVTSAIGTNWKWGIGM------WAFI 232
           I  +  S+ +  N R     I +L      W++G    A G     G G+      W  +
Sbjct: 232 IAPLYISEIAPKNIRGRLTVINSL------WLTGGQLIAYGC----GAGLSHVNNGWRIL 281

Query: 233 LPLACIPLGI---CMLHMRYLARKHAKDRLKPEFEALNKLKWKSF 274
           + L+ IP  I   C L +    R +    +K + E  NK+  KS+
Sbjct: 282 VGLSLIPTVIQFSCFLFLPDTPRFYV---MKGQLEKANKVLHKSY 323

>Kpol_1003.11 s1003 (33230..34975) [1746 bp, 581 aa] {ON}
           (33230..34975) [1746 nt, 582 aa]
          Length = 581

 Score = 32.7 bits (73), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 26/121 (21%), Positives = 49/121 (40%), Gaps = 5/121 (4%)

Query: 125 FFARLSDIFGRFSIMIVSVIFYSVGTIIESQAVNITRFAVGGCFYQLGLTGIILILEVIA 184
           F   L+D  GR  +++ S++ Y    I  + + N T+  V  C    G++ +I I   I 
Sbjct: 155 FMGGLADSLGRRPVVLFSILVYCCACIGLALSQNYTQIVVLRCLQAAGISPVIAINSGIC 214

Query: 185 SDFSNLNWRLLALFIPALPFIINTWISGDVTSAIGTNWKWGIGMWAFILPLACIPLGICM 244
            D +    R   +   +   +I +     + + + + W W    W        I  GIC+
Sbjct: 215 GDITTRAERGAYVGYVSGFIVIGSAFGALIGAGLSSTWGWRSIFWFLT-----IGSGICL 269

Query: 245 L 245
           +
Sbjct: 270 M 270

>KAFR0G00160 Chr7 (51436..53346) [1911 bp, 636 aa] {ON} 
          Length = 636

 Score = 32.7 bits (73), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 34/149 (22%), Positives = 66/149 (44%), Gaps = 15/149 (10%)

Query: 120 AVGQIFFARLSDIFGRFSIMIVSVIFYSVGTI--IESQAVNITRFAVGGCFYQLGLTGII 177
           AVG IF +++ DI+GR   +I   + Y +G +  I S      ++ +G     L + G +
Sbjct: 202 AVGGIFLSKIGDIYGRKIGIIFMNVIYIIGQLICITSMKHKWYQYTIGRIISGLAVGGFM 261

Query: 178 LILEVIASDFSNLNWRLLALFIPA--------LPFIINTWISGDVTSA-----IGTNWKW 224
            ++ +  ++ +  + R LA+ +          L +  N  +    T+A     +G  + W
Sbjct: 262 TLIPIFLAETAPKHLRGLAISVGMFMCTLGILLGYCANLGLKDYTTTAQWRIPLGLTFAW 321

Query: 225 GIGMWAFILPLACIPLGICMLHMRYLARK 253
            I ++A +L     P  +C      LA+K
Sbjct: 322 AILLFAGVLVTPESPRYLCECKKIELAKK 350

>Kwal_56.22285 s56 (26966..28669) [1704 bp, 567 aa] {ON} YNR072W
           (HXT17) - Putative hexose transporter [contig 187] FULL
          Length = 567

 Score = 32.7 bits (73), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 21/67 (31%), Positives = 38/67 (56%), Gaps = 1/67 (1%)

Query: 120 AVGQIFFARLSDIFGRFSIMIVSVIFYSVGTIIESQAVNI-TRFAVGGCFYQLGLTGIIL 178
           A+G +  ++L DIFGR   ++  V  Y VGTII+  A +   ++ +G   Y  G+ G+ +
Sbjct: 126 ALGGLTLSKLGDIFGRRLALMFVVGVYVVGTIIQISASDKWYQYFIGKIIYGWGVGGVSV 185

Query: 179 ILEVIAS 185
           +  ++ S
Sbjct: 186 LAPMLIS 192

>KLTH0B00330g Chr2 (29891..31591) [1701 bp, 566 aa] {ON} highly
           similar to uniprot|P54862 Saccharomyces cerevisiae
           YOL156W HXT11 Putative hexose transporter that is nearly
           identical to Hxt9p, has similarity to major facilitator
           superfamily (MFS) transporters and is involved in
           pleiotropic drug resistance
          Length = 566

 Score = 32.7 bits (73), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 29/123 (23%), Positives = 59/123 (47%), Gaps = 9/123 (7%)

Query: 120 AVGQIFFARLSDIFGRFSIMIVSVIFYSVGTIIE-SQAVNITRFAVGGCFYQLGLTGIIL 178
           A+G I  +++ D++GR   +I   I Y +G II+ S      ++ +G     LG+ GI +
Sbjct: 124 AIGGIVLSKIGDVYGRRIGLISVTIVYVIGIIIQISSTDKWYQYFIGRIISGLGVGGIAV 183

Query: 179 ILEVIASDFSNLNWRLLALFIPALPFIINTWIS-----GDVTSAIGTNWKWGIGM---WA 230
           +  ++ S+ S  + R + + +  L   +  ++      G       T W+ G+G+   WA
Sbjct: 184 LSPMLLSEVSPKHIRGMLVNLYQLLGTMGIFLGYCTNYGTKKYTDSTQWRVGLGLCFAWA 243

Query: 231 FIL 233
            ++
Sbjct: 244 MLM 246

>KLLA0F17776g Chr6 complement(1627198..1628859) [1662 bp, 553 aa]
           {ON} weakly similar to uniprot|Q04301 Saccharomyces
           cerevisiae YMR088C VBA1 Permease of basic amino acids in
           the vacuolar membrane
          Length = 553

 Score = 32.7 bits (73), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 29/113 (25%), Positives = 50/113 (44%), Gaps = 10/113 (8%)

Query: 41  SPAPSYIELIDPGVYNIEIYAEMYSRPLYRVA-LFFSLFLIAYAYGLDGNIRYTFQAYAT 99
           SP P   +L D   ++  +       PL  V  + F+LF+ +Y   LD  I  T      
Sbjct: 10  SPVP---QLPDQAAHDKNV------EPLRDVNWIVFALFVGSYLAALDTTIVTTLLPTIA 60

Query: 100 SSYSQHSLLSTVNCIKTVIAAVGQIFFARLSDIFGRFSIMIVSVIFYSVGTII 152
           S     + +S +     +  +  Q  + +LSD+FGR  ++I S + +  G I+
Sbjct: 61  SELDASNQMSWIATSYLLSCSAFQPLYGKLSDVFGRKPLLIWSNLCFGFGCIL 113

>TDEL0A02490 Chr1 (446429..448093) [1665 bp, 554 aa] {ON} Anc_2.473
           YMR088C
          Length = 554

 Score = 32.7 bits (73), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 23/102 (22%), Positives = 46/102 (45%)

Query: 64  YSRPLYRVALFFSLFLIAYAYGLDGNIRYTFQAYATSSYSQHSLLSTVNCIKTVIAAVGQ 123
           ++  L ++ +  SL+L ++   LDG I           +S+      +     +     Q
Sbjct: 28  HNLSLPKLPILTSLWLGSFVSSLDGTIVANIMNRVAEEFSESDKKQWIATSFLLTNTAFQ 87

Query: 124 IFFARLSDIFGRFSIMIVSVIFYSVGTIIESQAVNITRFAVG 165
             + +LSD+ GR   ++++  F  +G ++   A N+T FAV 
Sbjct: 88  PLYGKLSDVTGRKFALLMAYFFLVIGCLLTCLARNVTEFAVA 129

>KAFR0A02910 Chr1 (605168..606928) [1761 bp, 586 aa] {ON} Anc_8.858
           YML123C
          Length = 586

 Score = 32.7 bits (73), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 31/100 (31%), Positives = 49/100 (49%), Gaps = 15/100 (15%)

Query: 103 SQHSLLSTVNCIKTVIAAVGQIFFARLSDIFGR---FSIMIVSVIFYSV--GTIIESQAV 157
           S  +LL     + TVI   GQ+ F  L+DI GR   + + ++ +IF +V   T+  S  +
Sbjct: 96  STATLLKVSTSVGTVI---GQLGFGILADIVGRKKIYGLELIVMIFCTVLQCTLGHSPGI 152

Query: 158 NITRFAVGGCFYQ----LGLTGIILILEVIASDFSNLNWR 193
           N   F     FY+    +G+ G   +  +I S+FS   WR
Sbjct: 153 N---FVAVLTFYRVVMGIGIGGDYPLSSIITSEFSTTKWR 189

>Kpol_541.20 s541 (55476..57182) [1707 bp, 568 aa] {ON}
           (55476..57182) [1707 nt, 569 aa]
          Length = 568

 Score = 32.7 bits (73), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 30/100 (30%), Positives = 47/100 (47%), Gaps = 15/100 (15%)

Query: 103 SQHSLLSTVNCIKTVIAAVGQIFFARLSDIFGRFSIMIVSVIFYSVGTIIE-----SQAV 157
           S  +LL     + TVI   GQ+ F  ++DI GR  I  + +I     TI++     S AV
Sbjct: 103 STQTLLKVSTSVGTVI---GQVGFGIIADIVGRKKIYGLELIIVITATILQCTTGHSPAV 159

Query: 158 NITRFAVGGCFYQ----LGLTGIILILEVIASDFSNLNWR 193
           N   F     FY+    +G+ G   +  +I ++F+   WR
Sbjct: 160 N---FPAILTFYRIVMGIGIGGDYPLSSIITAEFATTKWR 196

>SAKL0E08778g Chr5 complement(716961..718763) [1803 bp, 600 aa] {ON}
           similar to uniprot|P40474 Saccharomyces cerevisiae
           YIL121W QDR2 Multidrug transporter required for
           resistance to quinidine barban cisplatin and bleomycin
           member of the major facilitator superfamily of
           transporters conferring multiple drug resistance
           (MFS-MDR)
          Length = 600

 Score = 32.3 bits (72), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 23/113 (20%), Positives = 44/113 (38%)

Query: 117 VIAAVGQIFFARLSDIFGRFSIMIVSVIFYSVGTIIESQAVNITRFAVGGCFYQLGLTGI 176
           ++  +  +    L+D  GR  I++ S+  Y+V  I  + A N        C    G++ +
Sbjct: 126 ILQGLAPMLMGGLADKVGRRPIVLCSIALYAVACIGLASAQNYGEVLFLRCLQSAGISPV 185

Query: 177 ILILEVIASDFSNLNWRLLALFIPALPFIINTWISGDVTSAIGTNWKWGIGMW 229
           + +   I  D +    R   L + A   +I +     + + I   W W    W
Sbjct: 186 VAVNNGIIGDITTKAERGGYLGLMAGTQVIGSAFGALIGAGITARWGWRAIFW 238

>TDEL0E00200 Chr5 complement(25701..27407) [1707 bp, 568 aa] {ON} 
          Length = 568

 Score = 32.3 bits (72), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 28/104 (26%), Positives = 52/104 (50%), Gaps = 5/104 (4%)

Query: 91  RYTFQAYATSSYSQHSLLSTVNCIKTVIAAVGQIFFARLSDIFGRFSIMIVSVIFYSVGT 150
           R+T   Y  S      ++S  N    V  A+G I  ++L DI+GR   ++  V+ Y VG 
Sbjct: 103 RHTDGTYYLSKVRTGLVVSIFN----VGCAMGGIILSKLGDIYGRKIGLMTVVVIYIVGI 158

Query: 151 IIESQAVNI-TRFAVGGCFYQLGLTGIILILEVIASDFSNLNWR 193
           +I+  + +   ++ +G     LG+ GI ++  ++ S+ S  + R
Sbjct: 159 LIQICSFDKWYQYFIGRIISGLGVGGIAVLSPMLISESSPKHLR 202

>KNAG0C05250 Chr3 (1024201..1025895) [1695 bp, 564 aa] {ON} 
          Length = 564

 Score = 32.3 bits (72), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 36/166 (21%), Positives = 67/166 (40%), Gaps = 24/166 (14%)

Query: 119 AAVGQIFFARLSDIFGRFSIMIVSVIFYSVGTIIESQAVNI-TRFAVGGCFYQLGLTGII 177
            A+G I  ++  D++GR   +++ ++ Y  G +I+   +N   ++ +G     LG+ GI 
Sbjct: 120 CAIGGIILSKAGDMYGRKKGLLIVLVIYIAGIVIQIATINKWYQYFIGRIISGLGVGGIS 179

Query: 178 LILEVIASDFSNLNWRLLALFIPALPFIINTWISGDVTSAIGTNWKWGIGMWAFILPLAC 237
           ++  ++ S+ S  + R     +     +I   I     +  GT        W        
Sbjct: 180 VLSPMLISEVSPKHLR--GTLVSCFQLMITLGIFLGYCTNYGTKKYSNSTQWR------- 230

Query: 238 IPLGICM---LHM-----------RYLARKHAKDRLKPEFEALNKL 269
           +PLG+C    L M           RYL  K+  +  K      NK+
Sbjct: 231 VPLGLCFAWALFMIGGMTFVPESPRYLLEKNLVEEAKHSISISNKV 276

>TBLA0A03700 Chr1 (925610..927328) [1719 bp, 572 aa] {ON} 
          Length = 572

 Score = 32.3 bits (72), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 14/34 (41%), Positives = 22/34 (64%)

Query: 120 AVGQIFFARLSDIFGRFSIMIVSVIFYSVGTIIE 153
           A+G  F  RL D++GR   +IV+ + + VG II+
Sbjct: 128 AIGCFFLGRLGDMYGRRIGLIVAAVIFIVGNIIQ 161

>KLLA0E09021g Chr5 (804915..806615) [1701 bp, 566 aa] {ON}
           uniprot|Q8NJ22 Kluyveromyces lactis KLLA0E08987g frt1
           Hexose transporter
          Length = 566

 Score = 32.3 bits (72), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 21/74 (28%), Positives = 38/74 (51%), Gaps = 3/74 (4%)

Query: 92  YTFQAYATSSYSQHSLLSTVNCIKTVIAAVGQIFFARLSDIFGRFSIMIVSVIFYSVGTI 151
           Y  +A    +  + SL+S++  +    A  G I    LS+ FGR   +++S IFY++G I
Sbjct: 118 YGMKASLKLTSDEDSLISSLMPLG---AVGGSILLTPLSEYFGRKVALVISCIFYTIGGI 174

Query: 152 IESQAVNITRFAVG 165
           + + A ++     G
Sbjct: 175 LCAAAQDVHTMYAG 188

>Kpol_1014.21 s1014 (34471..36069) [1599 bp, 532 aa] {ON}
           (34471..36069) [1599 nt, 533 aa]
          Length = 532

 Score = 32.3 bits (72), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 21/76 (27%), Positives = 42/76 (55%), Gaps = 1/76 (1%)

Query: 119 AAVGQIFFARLSDIFGRFSIMIVSVIFYSVGTIIES-QAVNITRFAVGGCFYQLGLTGII 177
           +A+G +  A+L D+FGR + +  ++ FY++G  I+     N  +F +G  F  L +  I 
Sbjct: 113 SAIGGLTLAKLGDLFGRKAGLFTALGFYNIGLFIQLINDHNWYQFFIGRIFTGLAVGSIA 172

Query: 178 LILEVIASDFSNLNWR 193
           +++ +  S+ + L  R
Sbjct: 173 VLVPMFISESAPLKIR 188

>Kwal_55.20064 s55 (235602..236315) [714 bp, 238 aa] {ON} YHR094C
           (HXT1) - High-affinity hexose (glucose) transporter
           [contig 156] PARTIAL
          Length = 238

 Score = 31.6 bits (70), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 24/100 (24%), Positives = 51/100 (51%), Gaps = 5/100 (5%)

Query: 99  TSSYSQHSLLSTVNCIKTVI----AAVGQIFFARLSDIFGRFSIMIVSVIFYSVGTIIES 154
           T+S  +H L +    +   I     A+G I   +L +++GR   + + V+ Y+VG II+ 
Sbjct: 101 TNSKGEHYLSNVRTGLMVSIFNIGCAIGGIVLGKLGEVYGRRLGLTIVVVIYAVGIIIQI 160

Query: 155 QAVNI-TRFAVGGCFYQLGLTGIILILEVIASDFSNLNWR 193
            +++   ++ +G     LG+  I ++  ++ S+ S  + R
Sbjct: 161 ASIDKWYQYFIGRIISGLGVGAITVLSPMLISEVSPKHLR 200

>KAFR0G03730 Chr7 (766728..766738,766802..767225) [435 bp, 144 aa]
           {ON} Anc_3.500 YPR153W Intron coordinates are guessed,
           not conserved begining when aligned with the rest of the
           pillar proteins.
          Length = 144

 Score = 30.8 bits (68), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 14/30 (46%), Positives = 21/30 (70%), Gaps = 3/30 (10%)

Query: 402 SVIVGTILGFILIKVRRTKPFIIFGISCWI 431
            VIVGT++GF++  + R     +FG+SCWI
Sbjct: 94  GVIVGTVMGFLVGTIYRAG---LFGMSCWI 120

>Kpol_467.24 s467 (55523..56632) [1110 bp, 370 aa] {ON}
           (55523..56632) [1110 nt, 370 aa]
          Length = 370

 Score = 32.0 bits (71), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 14/43 (32%), Positives = 26/43 (60%)

Query: 123 QIFFARLSDIFGRFSIMIVSVIFYSVGTIIESQAVNITRFAVG 165
           Q  + +LSDI GR   ++ ++ F+ +G  + S + NI +FA+ 
Sbjct: 86  QPLYGKLSDITGRKFALLTALSFFGLGCFLTSLSTNIKQFAIA 128

>TDEL0B00270 Chr2 (51265..53010) [1746 bp, 581 aa] {ON} Anc_8.858
           YML123C
          Length = 581

 Score = 32.0 bits (71), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 29/97 (29%), Positives = 45/97 (46%), Gaps = 9/97 (9%)

Query: 103 SQHSLLSTVNCIKTVIAAVGQIFFARLSDIFGRFSIMIVSVIFYSVGTIIESQAVNI--T 160
           S ++LL     + TVI   GQ+ F  ++DI GR  I  V +I     TI++  A +    
Sbjct: 99  SSNTLLKVSTSVGTVI---GQLGFGMMADIIGRKKIYGVELIIMIAATILQCTAGHAPGV 155

Query: 161 RFAVGGCFYQLGLTGIIL----ILEVIASDFSNLNWR 193
            F     FY++ +   I     +  +I S+FS   WR
Sbjct: 156 NFVAVLTFYRIIMGIGIGGDYPLSSIITSEFSTTKWR 192

>TBLA0E03800 Chr5 (956468..958294) [1827 bp, 608 aa] {ON} Anc_2.241
           YIL121W
          Length = 608

 Score = 32.0 bits (71), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 23/129 (17%), Positives = 52/129 (40%), Gaps = 5/129 (3%)

Query: 117 VIAAVGQIFFARLSDIFGRFSIMIVSVIFYSVGTIIESQAVNITRFAVGGCFYQLGLTGI 176
           +  A+       L+D  GR  +++ S++ Y    I  ++  N ++     C    G++ +
Sbjct: 146 IFQALSPTLMGGLADSLGRRPVVLSSIVLYFCACIGLARCTNYSQLIGLRCLQAAGISPV 205

Query: 177 ILILEVIASDFSNLNWRLLALFIPALPFIINTWISGDVTSAIGTNWKWGIGMWAFILPLA 236
           I +   I  D +    R   + + +   ++ T     + + + + W W    W  +    
Sbjct: 206 IAVNSGIMGDVTTKAERGGYMGLVSGTQVLGTAFGALIGAGLSSRWSWRSIFWFLV---- 261

Query: 237 CIPLGICML 245
            I  GIC++
Sbjct: 262 -IGSGICLI 269

>KAFR0D00740 Chr4 complement(142941..144647) [1707 bp, 568 aa] {ON} 
          Length = 568

 Score = 31.6 bits (70), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 21/75 (28%), Positives = 40/75 (53%), Gaps = 1/75 (1%)

Query: 120 AVGQIFFARLSDIFGRFSIMIVSVIFYSVGTIIESQAVNI-TRFAVGGCFYQLGLTGIIL 178
           A+G I F++L D +GR   +++  I Y VG +I   +++   ++ +G     LG+ GI +
Sbjct: 127 AIGGIAFSKLGDQYGRRIALVIVTIVYIVGIVISIASIDKWYQYFIGRIIAGLGVGGIAV 186

Query: 179 ILEVIASDFSNLNWR 193
              +  S+ S  + R
Sbjct: 187 YSPLFISEISPKHLR 201

>TBLA0A03400 Chr1 complement(810961..812685) [1725 bp, 574 aa] {ON}
           Anc_5.394 YHR092C
          Length = 574

 Score = 31.6 bits (70), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 19/68 (27%), Positives = 33/68 (48%)

Query: 90  IRYTFQAYATSSYSQHSLLSTVNCIKTVIAAVGQIFFARLSDIFGRFSIMIVSVIFYSVG 149
           IR+  +    + Y        +  I  V  A+G +   RL D++GR   +I++ I + VG
Sbjct: 100 IRFGTRRADGTYYLSKVRTGLIVSIFNVGCAIGCVALGRLGDMYGRRMGLIIASIIFIVG 159

Query: 150 TIIESQAV 157
            +IE  +V
Sbjct: 160 NVIEIASV 167

>Suva_13.467 Chr13 complement(807375..809006) [1632 bp, 543 aa] {ON}
           YMR279C (REAL)
          Length = 543

 Score = 31.6 bits (70), Expect = 7.5,   Method: Compositional matrix adjust.
 Identities = 35/141 (24%), Positives = 60/141 (42%), Gaps = 8/141 (5%)

Query: 282 KLDIIGMLLITVFFGCVLVPFTLAGGLKEEWKSAHIIVPEVIGWVVVLPLYMLWEMKYSR 341
            +D  G +L  +  G +L  F         W +A+II   +I  V  L  + ++E+KY++
Sbjct: 265 SMDWTGSVLAVI--GLILFNFVWNQAPTAGWGTAYIIALLIIS-VFFLVAFFVYEVKYAK 321

Query: 342 HPLTPWDLIKDRGXXXXXXXXXXXXXXWYMQGDYMYTVLVVAVHESIKSATRITSLYSFV 401
            PL P  + K+R               W   G + +  +   ++    S       Y FV
Sbjct: 322 VPLLPHAVTKNR---HMIMILLAVFLGWGSFGIWTFYYMSFQLNLRHYSPVWTGGTY-FV 377

Query: 402 SVIVGTILGFIL-IKVRRTKP 421
            VI GTI  F++ + ++R  P
Sbjct: 378 FVIFGTIAAFMVALSIKRVGP 398

>KNAG0A03790 Chr1 (496954..498321) [1368 bp, 455 aa] {ON} Anc_8.521
           YBR207W
          Length = 455

 Score = 31.6 bits (70), Expect = 7.6,   Method: Compositional matrix adjust.
 Identities = 14/61 (22%), Positives = 32/61 (52%)

Query: 103 SQHSLLSTVNCIKTVIAAVGQIFFARLSDIFGRFSIMIVSVIFYSVGTIIESQAVNITRF 162
           S+H     ++ + ++I +V  +FF R+  +  +F + + S+I+   G ++  QA     F
Sbjct: 150 SEHYYEGILSIVASLIISVMGLFFLRMGKLREKFRVKLGSIIYSESGNMLRGQADKTMSF 209

Query: 163 A 163
           +
Sbjct: 210 S 210

>YOL156W Chr15 (25273..26976) [1704 bp, 567 aa] {ON}  HXT11Putative
           hexose transporter that is nearly identical to Hxt9p,
           has similarity to major facilitator superfamily (MFS)
           transporters and is involved in pleiotropic drug
           resistance
          Length = 567

 Score = 31.6 bits (70), Expect = 7.7,   Method: Compositional matrix adjust.
 Identities = 19/68 (27%), Positives = 38/68 (55%), Gaps = 1/68 (1%)

Query: 120 AVGQIFFARLSDIFGRFSIMIVSVIFYSVGTIIESQAVNI-TRFAVGGCFYQLGLTGIIL 178
           A+G I  +++ DI+GR   +I     Y VG +I+  ++N   ++ +G     LG+ GI +
Sbjct: 123 AIGGIVLSKVGDIYGRRIGLITVTAIYVVGILIQITSINKWYQYFIGRIISGLGVGGIAV 182

Query: 179 ILEVIASD 186
           +  ++ S+
Sbjct: 183 LSPMLISE 190

>YJL219W Chr10 (19497..21200) [1704 bp, 567 aa] {ON}  HXT9Putative
           hexose transporter that is nearly identical to Hxt11p,
           has similarity to major facilitator superfamily (MFS)
           transporters, expression of HXT9 is regulated by
           transcription factors Pdr1p and Pdr3p
          Length = 567

 Score = 31.6 bits (70), Expect = 7.8,   Method: Compositional matrix adjust.
 Identities = 19/68 (27%), Positives = 38/68 (55%), Gaps = 1/68 (1%)

Query: 120 AVGQIFFARLSDIFGRFSIMIVSVIFYSVGTIIESQAVNI-TRFAVGGCFYQLGLTGIIL 178
           A+G I  +++ DI+GR   +I     Y VG +I+  ++N   ++ +G     LG+ GI +
Sbjct: 123 AIGGIVLSKVGDIYGRRIGLITVTAIYVVGILIQITSINKWYQYFIGRIISGLGVGGIAV 182

Query: 179 ILEVIASD 186
           +  ++ S+
Sbjct: 183 LSPMLISE 190

>NDAI0K00400 Chr11 (90040..91701) [1662 bp, 553 aa] {ON} 
          Length = 553

 Score = 31.6 bits (70), Expect = 8.1,   Method: Compositional matrix adjust.
 Identities = 21/70 (30%), Positives = 39/70 (55%), Gaps = 3/70 (4%)

Query: 277 DIAFWKLDIIGMLLITVFFGCVLVPFTLAGGLKEEWKSAHIIVPEVIGWVVVLPLYMLWE 336
           ++  + +D IG +L  +  G +L  F    G    W+ A+IIV  ++  V+ L  + ++E
Sbjct: 266 NVNGFTMDWIGSVLGVI--GLILFNFVWNQGPIVGWEKAYIIVLLIVS-VIFLIAFFVYE 322

Query: 337 MKYSRHPLTP 346
           +KY++ PL P
Sbjct: 323 IKYAKVPLLP 332

>AFR322C Chr6 complement(1017689..1019467) [1779 bp, 592 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGR138C
           (TPO2) and YPR156C (TPO3)
          Length = 592

 Score = 31.2 bits (69), Expect = 9.1,   Method: Compositional matrix adjust.
 Identities = 34/124 (27%), Positives = 58/124 (46%), Gaps = 13/124 (10%)

Query: 99  TSSYSQHSLLSTVNCIKTVIA-AVGQIFFARLSDIFGRFSIMIVSVIFYSVGTIIESQAV 157
           T  Y   + ++ ++C   V+   VGQ+ +A LSD++GR      S+  Y V  I  + A 
Sbjct: 179 TRKYDVSTEVAILSCSLVVLGYGVGQLVWAPLSDLYGRRITYFTSLFLYVVFNIPCAVAP 238

Query: 158 NITRFAVGGCFYQLGL---TGIILILEVIASDF-SNLNWRLLALFI------PALPFIIN 207
           NI    V  C +  G+   +G+ L+   +A  F ++L    +A F       P    +IN
Sbjct: 239 NIQTLLV--CRFICGVLSSSGLCLVGGSLADMFPADLRGLTIAFFAFAPYGGPVFAPLIN 296

Query: 208 TWIS 211
            +I+
Sbjct: 297 GFIA 300

>TBLA0A03440 Chr1 complement(832040..833551) [1512 bp, 503 aa] {ON} 
          Length = 503

 Score = 31.2 bits (69), Expect = 9.2,   Method: Compositional matrix adjust.
 Identities = 31/92 (33%), Positives = 49/92 (53%), Gaps = 9/92 (9%)

Query: 97  YATSSYSQHSLLSTVNC-IKTVIAAVGQ----IFFARLSDIFG-RFSIMIVSVIFYSVGT 150
           + ++S S    LS V   + T +  VGQ     F  R+ D++G RF I++ S+IF  VGT
Sbjct: 32  FGSTSGSGKRYLSKVRTGLLTSMFNVGQAIDCFFLGRIGDMYGRRFGIIVASIIFI-VGT 90

Query: 151 IIESQAVNI-TRFAVGGCFYQLGLTGIILILE 181
           +I+  +V    ++ +G     LG  G+I IL 
Sbjct: 91  VIQIVSVKAWYQYMIGRIVAGLG-CGLIAILS 121

>TPHA0C04790 Chr3 complement(1033653..1035323) [1671 bp, 556 aa]
           {ON} Anc_8.843 YMR279C
          Length = 556

 Score = 31.2 bits (69), Expect = 9.4,   Method: Compositional matrix adjust.
 Identities = 22/72 (30%), Positives = 37/72 (51%), Gaps = 3/72 (4%)

Query: 282 KLDIIGMLLITVFFGCVLVPFTLAGGLKEEWKSAHIIVPEVIGWVVVLPLYMLWEMKYSR 341
           K+D IG  +  V  G +L  F       + W  A+IIV  VI  V+++  + ++E+ Y+ 
Sbjct: 273 KMDWIGSAVGVV--GLLLFSFVWNQAPMDGWDKAYIIVLLVIS-VILIIAFFIYEINYAE 329

Query: 342 HPLTPWDLIKDR 353
            PL P  +  +R
Sbjct: 330 VPLLPKAITGNR 341

>TDEL0E02310 Chr5 (450790..452493) [1704 bp, 567 aa] {ON} Anc_5.394
           YHR092C
          Length = 567

 Score = 31.2 bits (69), Expect = 9.5,   Method: Compositional matrix adjust.
 Identities = 36/161 (22%), Positives = 68/161 (42%), Gaps = 16/161 (9%)

Query: 120 AVGQIFFARLSDIFGRFSIMIVSVIFYSVGTIIESQAVNI-TRFAVGGCFYQLGLTGIIL 178
           A+G I  +++ DI+GR   ++   + Y VG +I+  + +   ++ +G     LG+ GI +
Sbjct: 123 AIGGIILSKIGDIYGRRIGLVAVTVIYVVGILIQICSFDKWYQYFIGRIISGLGVGGIAV 182

Query: 179 ILEVIASDFSNLNWRLLALFIPALPFIINTWIS-----GDVTSAIGTNWKWGIGM---WA 230
           +  ++ S+ S    R   +    L   +  ++      G  T    T W+ G+G+   WA
Sbjct: 183 LSPMLISEVSPKQIRGTLVACYQLMITLGIFLGYCTNYGTKTYNDSTQWRVGLGLCFAWA 242

Query: 231 FIL--PLACIPLGICMLHMRYLARKHAKDRLKPEFEALNKL 269
             +   +  +P        RYL      +  K      NKL
Sbjct: 243 IFMIGGMLFVP-----ESPRYLVEHGNIEEAKRSLSRSNKL 278

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.327    0.141    0.440 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 59,790,668
Number of extensions: 2444087
Number of successful extensions: 8392
Number of sequences better than 10.0: 407
Number of HSP's gapped: 8257
Number of HSP's successfully gapped: 410
Length of query: 628
Length of database: 53,481,399
Length adjustment: 116
Effective length of query: 512
Effective length of database: 40,180,143
Effective search space: 20572233216
Effective search space used: 20572233216
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 69 (31.2 bits)