Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Smik_5.21na 1ON1611618591e-119
YEL066W (HPA3)na 1ON1791617741e-106
Skud_5.22na 1ON1611617311e-100
Suva_5.1na 1ON1611616985e-95
KAFR0D02290singletonON1621604694e-60
Skud_16.497na 2ON1551524684e-60
Suva_16.525na 2ON1551504563e-58
YPR193C (HPA2)na 2ON1561524563e-58
NCAS0A09820na 2ON1501504321e-54
NDAI0C02350na 2ON1581484172e-52
Smik_16.457na 2ON1591524164e-52
SAKL0B12606gsingletonON1551504033e-50
KNAG0B02050singletonON1531513948e-49
KNAG0B02060singletonON1541503479e-42
KLTH0E14806g3.331ON17495730.21
ZYRO0D10912g8.697ON16491680.91
SAKL0H06006g8.697ON169103680.95
KLLA0A12089gsingletonON181155671.3
YPL070W (MUK1)8.537ON61242681.3
Smik_16.1658.537ON61342681.7
TBLA0G035208.69ON211744672.0
Ecym_61898.183ON48458653.7
TBLA0A061906.221ON550101644.9
KLLA0D02530g4.309ON70733645.2
Kwal_26.88778.697ON16271625.5
AAL102C8.697ON15980625.8
TPHA0D042908.183ON49652636.2
Kwal_27.125343.331ON17464626.8
TDEL0A064208.697ON16725618.9
KLTH0D11748g8.697ON162103609.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Smik_5.21
         (161 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Smik_5.21 Chr5 (29109..29594) [486 bp, 161 aa] {ON} YEL066W (REAL)    335   e-119
YEL066W Chr5 (26667..27206) [540 bp, 179 aa] {ON}  HPA3D-Amino a...   302   e-106
Skud_5.22 Chr5 (25901..26386) [486 bp, 161 aa] {ON} YEL066W (REAL)    286   e-100
Suva_5.1 Chr5 (2428..2913) [486 bp, 161 aa] {ON} YEL066W (REAL)       273   5e-95
KAFR0D02290 Chr4 complement(464557..465045) [489 bp, 162 aa] {ON}     185   4e-60
Skud_16.497 Chr16 complement(865054..865521) [468 bp, 155 aa] {O...   184   4e-60
Suva_16.525 Chr16 complement(905109..905576) [468 bp, 155 aa] {O...   180   3e-58
YPR193C Chr16 complement(922909..923379) [471 bp, 156 aa] {ON}  ...   180   3e-58
NCAS0A09820 Chr1 (1963035..1963487) [453 bp, 150 aa] {ON}             171   1e-54
NDAI0C02350 Chr3 complement(535450..535926) [477 bp, 158 aa] {ON}     165   2e-52
Smik_16.457 Chr16 complement(785830..786309) [480 bp, 159 aa] {O...   164   4e-52
SAKL0B12606g Chr2 (1089114..1089581) [468 bp, 155 aa] {ON} simil...   159   3e-50
KNAG0B02050 Chr2 (392828..393289) [462 bp, 153 aa] {ON}               156   8e-49
KNAG0B02060 Chr2 (393547..394011) [465 bp, 154 aa] {ON}               138   9e-42
KLTH0E14806g Chr5 (1316897..1317421) [525 bp, 174 aa] {ON} simil...    33   0.21 
ZYRO0D10912g Chr4 (921315..921809) [495 bp, 164 aa] {ON} similar...    31   0.91 
SAKL0H06006g Chr8 complement(532245..532754) [510 bp, 169 aa] {O...    31   0.95 
KLLA0A12089g Chr1 (1052066..1052611) [546 bp, 181 aa] {ON} simil...    30   1.3  
YPL070W Chr16 (420948..422786) [1839 bp, 612 aa] {ON}  MUK1Cytop...    31   1.3  
Smik_16.165 Chr16 (304145..305986) [1842 bp, 613 aa] {ON} YPL070...    31   1.7  
TBLA0G03520 Chr7 complement(934734..941087) [6354 bp, 2117 aa] {...    30   2.0  
Ecym_6189 Chr6 complement(348408..349862) [1455 bp, 484 aa] {ON}...    30   3.7  
TBLA0A06190 Chr1 (1520461..1522113) [1653 bp, 550 aa] {ON} Anc_6...    29   4.9  
KLLA0D02530g Chr4 complement(212703..214826) [2124 bp, 707 aa] {...    29   5.2  
Kwal_26.8877 s26 (987655..988143) [489 bp, 162 aa] {ON} YOR253W ...    28   5.5  
AAL102C Chr1 complement(163467..163946) [480 bp, 159 aa] {ON} Sy...    28   5.8  
TPHA0D04290 Chr4 (926466..927956) [1491 bp, 496 aa] {ON} Anc_8.1...    29   6.2  
Kwal_27.12534 s27 (1264793..1265317) [525 bp, 174 aa] {ON} YPR05...    28   6.8  
TDEL0A06420 Chr1 (1124798..1125301) [504 bp, 167 aa] {ON} Anc_8....    28   8.9  
KLTH0D11748g Chr4 (960571..961059) [489 bp, 162 aa] {ON} similar...    28   9.6  

>Smik_5.21 Chr5 (29109..29594) [486 bp, 161 aa] {ON} YEL066W (REAL)
          Length = 161

 Score =  335 bits (859), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 161/161 (100%), Positives = 161/161 (100%)

Query: 1   MSNKEFEKMTSDRIVVRAIEPKDEDAWHKLWKEYQGFQKTDMPLEVATTNFARFLDPTVK 60
           MSNKEFEKMTSDRIVVRAIEPKDEDAWHKLWKEYQGFQKTDMPLEVATTNFARFLDPTVK
Sbjct: 1   MSNKEFEKMTSDRIVVRAIEPKDEDAWHKLWKEYQGFQKTDMPLEVATTNFARFLDPTVK 60

Query: 61  LWGALAFDTETGNAIGFAHYLSHLTSWHVEEVIYMNDLYVTEHARIKGVGRKLIEFVYKR 120
           LWGALAFDTETGNAIGFAHYLSHLTSWHVEEVIYMNDLYVTEHARIKGVGRKLIEFVYKR
Sbjct: 61  LWGALAFDTETGNAIGFAHYLSHLTSWHVEEVIYMNDLYVTEHARIKGVGRKLIEFVYKR 120

Query: 121 ADELGTPAVYWVTDHYNHRAQLLYTKVAYKTDKVLYKRTGY 161
           ADELGTPAVYWVTDHYNHRAQLLYTKVAYKTDKVLYKRTGY
Sbjct: 121 ADELGTPAVYWVTDHYNHRAQLLYTKVAYKTDKVLYKRTGY 161

>YEL066W Chr5 (26667..27206) [540 bp, 179 aa] {ON}  HPA3D-Amino acid
           N-acetyltransferase, catalyzes N-acetylation of D-amino
           acids through ordered bi-bi mechanism in which
           acetyl-CoA is first substrate bound and CoA is last
           product liberated; similar to Hpa2p, acetylates histones
           weakly in vitro
          Length = 179

 Score =  302 bits (774), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 143/161 (88%), Positives = 153/161 (95%)

Query: 1   MSNKEFEKMTSDRIVVRAIEPKDEDAWHKLWKEYQGFQKTDMPLEVATTNFARFLDPTVK 60
           MSN+E EKM +DRIVV+AIEPKDE+AW+KLWKEYQGFQKT MP EVATT FARF+DPTVK
Sbjct: 19  MSNEEPEKMVNDRIVVKAIEPKDEEAWNKLWKEYQGFQKTVMPPEVATTTFARFIDPTVK 78

Query: 61  LWGALAFDTETGNAIGFAHYLSHLTSWHVEEVIYMNDLYVTEHARIKGVGRKLIEFVYKR 120
           LWGALAFDTETG+AIGFAHYL+HLTSWHVEEV+YMNDLYVTE AR+KGVGRKLIEFVY R
Sbjct: 79  LWGALAFDTETGDAIGFAHYLNHLTSWHVEEVVYMNDLYVTERARVKGVGRKLIEFVYSR 138

Query: 121 ADELGTPAVYWVTDHYNHRAQLLYTKVAYKTDKVLYKRTGY 161
           ADELGTPAVYWVTDHYNHRAQLLYTKVAYKTDKVLYKR GY
Sbjct: 139 ADELGTPAVYWVTDHYNHRAQLLYTKVAYKTDKVLYKRNGY 179

>Skud_5.22 Chr5 (25901..26386) [486 bp, 161 aa] {ON} YEL066W (REAL)
          Length = 161

 Score =  286 bits (731), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 137/161 (85%), Positives = 146/161 (90%)

Query: 1   MSNKEFEKMTSDRIVVRAIEPKDEDAWHKLWKEYQGFQKTDMPLEVATTNFARFLDPTVK 60
           MS KE EKM +DRIVVRAIE  DE+AW+KLW +YQGFQK  MP EV  T+FARFLDPTVK
Sbjct: 1   MSEKESEKMANDRIVVRAIEAGDEEAWNKLWVQYQGFQKIVMPPEVGKTSFARFLDPTVK 60

Query: 61  LWGALAFDTETGNAIGFAHYLSHLTSWHVEEVIYMNDLYVTEHARIKGVGRKLIEFVYKR 120
           LWGALA DTETG+AIG AHYLSHLTSWHVEEV+Y+NDLYVTEHARIKGVGRKLIEFVYK 
Sbjct: 61  LWGALAIDTETGDAIGLAHYLSHLTSWHVEEVLYLNDLYVTEHARIKGVGRKLIEFVYKH 120

Query: 121 ADELGTPAVYWVTDHYNHRAQLLYTKVAYKTDKVLYKRTGY 161
           ADELGTPAVYWVTDHYNHRAQLLYTKV YKTDKV+YKRTGY
Sbjct: 121 ADELGTPAVYWVTDHYNHRAQLLYTKVGYKTDKVVYKRTGY 161

>Suva_5.1 Chr5 (2428..2913) [486 bp, 161 aa] {ON} YEL066W (REAL)
          Length = 161

 Score =  273 bits (698), Expect = 5e-95,   Method: Compositional matrix adjust.
 Identities = 128/161 (79%), Positives = 145/161 (90%)

Query: 1   MSNKEFEKMTSDRIVVRAIEPKDEDAWHKLWKEYQGFQKTDMPLEVATTNFARFLDPTVK 60
           M++ E EK+T+DRIVVRAIEP+DE+ W++LW EYQGFQK  MP EVA T FARFLDP VK
Sbjct: 1   MASTESEKITNDRIVVRAIEPRDEEDWNRLWVEYQGFQKIVMPSEVARTTFARFLDPQVK 60

Query: 61  LWGALAFDTETGNAIGFAHYLSHLTSWHVEEVIYMNDLYVTEHARIKGVGRKLIEFVYKR 120
           LWGALAFDT TG+AIGF HYLSH+T+W VEEV+YMNDLYVTE ARIKGVGRKLIEFVYK 
Sbjct: 61  LWGALAFDTVTGSAIGFVHYLSHITAWQVEEVVYMNDLYVTETARIKGVGRKLIEFVYKH 120

Query: 121 ADELGTPAVYWVTDHYNHRAQLLYTKVAYKTDKVLYKRTGY 161
           ADELGTP+VYWVTDH+NHRAQLLYTKVAYKT+KV+YKR G+
Sbjct: 121 ADELGTPSVYWVTDHFNHRAQLLYTKVAYKTEKVVYKRVGH 161

>KAFR0D02290 Chr4 complement(464557..465045) [489 bp, 162 aa] {ON} 
          Length = 162

 Score =  185 bits (469), Expect = 4e-60,   Method: Compositional matrix adjust.
 Identities = 81/160 (50%), Positives = 115/160 (71%)

Query: 2   SNKEFEKMTSDRIVVRAIEPKDEDAWHKLWKEYQGFQKTDMPLEVATTNFARFLDPTVKL 61
           +N+  E   ++ I VR ++  D+++W +LW  +  FQ+T +P E    NF RF+DP V +
Sbjct: 3   TNQGTESTENNDITVRLVDKDDKNSWKELWTLFMEFQQTSLPEEQEELNFRRFIDPEVNM 62

Query: 62  WGALAFDTETGNAIGFAHYLSHLTSWHVEEVIYMNDLYVTEHARIKGVGRKLIEFVYKRA 121
           W ALA D  +G AIG A++ SH+++W + ++IY+NDLYV E  R +G+GRKLI+FVY+ A
Sbjct: 63  WSALAIDEASGRAIGMANFFSHMSTWDLTDIIYLNDLYVREDVRTRGIGRKLIDFVYEHA 122

Query: 122 DELGTPAVYWVTDHYNHRAQLLYTKVAYKTDKVLYKRTGY 161
           D++GTP VYW TD +NHRAQLLYTKV  +T KV+YKR GY
Sbjct: 123 DKMGTPKVYWWTDEHNHRAQLLYTKVGKRTPKVVYKRIGY 162

>Skud_16.497 Chr16 complement(865054..865521) [468 bp, 155 aa] {ON}
           YPR193C (REAL)
          Length = 155

 Score =  184 bits (468), Expect = 4e-60,   Method: Compositional matrix adjust.
 Identities = 80/152 (52%), Positives = 107/152 (70%)

Query: 10  TSDRIVVRAIEPKDEDAWHKLWKEYQGFQKTDMPLEVATTNFARFLDPTVKLWGALAFDT 69
           T D ++VR +   D++ W  LW+ +Q F     P E+   NF RFLDP VK+W A+A D+
Sbjct: 4   TGDSVIVRFVTEDDKEGWQGLWRSFQDFYSVSFPNELDEFNFKRFLDPNVKMWAAVAVDS 63

Query: 70  ETGNAIGFAHYLSHLTSWHVEEVIYMNDLYVTEHARIKGVGRKLIEFVYKRADELGTPAV 129
            +G  IG  ++LSH+T+W  ++ +Y+NDLYV E +R+KGVGR+LI+FVY+ AD+L TP V
Sbjct: 64  TSGKIIGMINFLSHMTTWDFKDKVYINDLYVDESSRVKGVGRELIQFVYEEADKLDTPNV 123

Query: 130 YWVTDHYNHRAQLLYTKVAYKTDKVLYKRTGY 161
           YW TD  NHRAQLLYTK+ YK  K LYKR GY
Sbjct: 124 YWCTDESNHRAQLLYTKIGYKAPKSLYKRNGY 155

>Suva_16.525 Chr16 complement(905109..905576) [468 bp, 155 aa] {ON}
           YPR193C (REAL)
          Length = 155

 Score =  180 bits (456), Expect = 3e-58,   Method: Compositional matrix adjust.
 Identities = 78/150 (52%), Positives = 106/150 (70%)

Query: 12  DRIVVRAIEPKDEDAWHKLWKEYQGFQKTDMPLEVATTNFARFLDPTVKLWGALAFDTET 71
           D +VVR +   D+D W +LW+ YQ F K   P E+   NF RFLDPTVK+W A+A +  +
Sbjct: 6   DSVVVRLVTEDDKDGWQRLWRSYQDFYKVSFPNELDDFNFERFLDPTVKMWAAVAVNGSS 65

Query: 72  GNAIGFAHYLSHLTSWHVEEVIYMNDLYVTEHARIKGVGRKLIEFVYKRADELGTPAVYW 131
           G  IG  ++ SH+++W  ++ IY+NDLYV  ++R+KGVGRKLI+ VY+ AD+L TP+VYW
Sbjct: 66  GEVIGMINFFSHMSTWDFKDKIYINDLYVDGNSRVKGVGRKLIQLVYEEADKLETPSVYW 125

Query: 132 VTDHYNHRAQLLYTKVAYKTDKVLYKRTGY 161
            TD  N+ AQLLYTK+ YK  K +YKR GY
Sbjct: 126 CTDESNYSAQLLYTKIGYKAHKTIYKRNGY 155

>YPR193C Chr16 complement(922909..923379) [471 bp, 156 aa] {ON}
           HPA2Tetrameric histone acetyltransferase with similarity
           to Gcn5p, Hat1p, Elp3p, and Hpa3p; acetylates histones
           H3 and H4 in vitro and exhibits autoacetylation activity
          Length = 156

 Score =  180 bits (456), Expect = 3e-58,   Method: Compositional matrix adjust.
 Identities = 77/152 (50%), Positives = 106/152 (69%)

Query: 10  TSDRIVVRAIEPKDEDAWHKLWKEYQGFQKTDMPLEVATTNFARFLDPTVKLWGALAFDT 69
           + D I VR +   D++ W +LWK YQ F +   P ++   NF RFLDP +K+W A+A ++
Sbjct: 5   SEDNITVRFVTENDKEGWQRLWKSYQDFYEVSFPDDLDDFNFGRFLDPNIKMWAAVAVES 64

Query: 70  ETGNAIGFAHYLSHLTSWHVEEVIYMNDLYVTEHARIKGVGRKLIEFVYKRADELGTPAV 129
            +   IG  ++ +H+T+W  ++ IY+NDLYV E++R+KG G KLI+FVY  AD+LGTP+V
Sbjct: 65  SSEKIIGMINFFNHMTTWDFKDKIYINDLYVDENSRVKGAGGKLIQFVYDEADKLGTPSV 124

Query: 130 YWVTDHYNHRAQLLYTKVAYKTDKVLYKRTGY 161
           YW TD  NHRAQLLY KV YK  K+LYKR GY
Sbjct: 125 YWCTDESNHRAQLLYVKVGYKAPKILYKRKGY 156

>NCAS0A09820 Chr1 (1963035..1963487) [453 bp, 150 aa] {ON} 
          Length = 150

 Score =  171 bits (432), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 76/150 (50%), Positives = 107/150 (71%)

Query: 9   MTSDRIVVRAIEPKDEDAWHKLWKEYQGFQKTDMPLEVATTNFARFLDPTVKLWGALAFD 68
           M+ ++I+VR +   DE+ W +LWK YQ   +  +  EVA  NF  FL+P V++W A+A +
Sbjct: 1   MSEEKIIVRPVSLNDEEDWKRLWKHYQEHYEVHLSEEVAERNFKNFLEPGVEMWAAIAIN 60

Query: 69  TETGNAIGFAHYLSHLTSWHVEEVIYMNDLYVTEHARIKGVGRKLIEFVYKRADELGTPA 128
           TETG  IG  +YL HLT+W +   + ++DL+V E +RIKGVGRKL+E+V+  AD++G   
Sbjct: 61  TETGVPIGMVNYLHHLTTWDIRGKMLLHDLFVEEGSRIKGVGRKLMEYVFHEADKMGIEI 120

Query: 129 VYWVTDHYNHRAQLLYTKVAYKTDKVLYKR 158
           VYW TDHYNHRAQLLYTK+ +K  KV+Y+R
Sbjct: 121 VYWTTDHYNHRAQLLYTKIGHKNSKVIYER 150

>NDAI0C02350 Chr3 complement(535450..535926) [477 bp, 158 aa] {ON} 
          Length = 158

 Score =  165 bits (417), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 76/148 (51%), Positives = 99/148 (66%)

Query: 14  IVVRAIEPKDEDAWHKLWKEYQGFQKTDMPLEVATTNFARFLDPTVKLWGALAFDTETGN 73
           +V+R I+  D+D W  LWK+YQ      M  ++    F RFLDP VK+W A A +T T  
Sbjct: 7   VVIRPIQETDKDDWLLLWKQYQKCYNRTMKEDIPLLTFERFLDPEVKMWAAFAINTTTNK 66

Query: 74  AIGFAHYLSHLTSWHVEEVIYMNDLYVTEHARIKGVGRKLIEFVYKRADELGTPAVYWVT 133
            IG   YL H T+W+++  I+++DL+V E  R+KGVGRKL+EFVY  +D +  P VYW T
Sbjct: 67  PIGMVTYLHHFTTWNLDGKIFLHDLFVQEDQRVKGVGRKLMEFVYDASDRMDVPFVYWTT 126

Query: 134 DHYNHRAQLLYTKVAYKTDKVLYKRTGY 161
           D +NHRAQLLYTKV  KT KVLY+R GY
Sbjct: 127 DDFNHRAQLLYTKVGKKTSKVLYERGGY 154

>Smik_16.457 Chr16 complement(785830..786309) [480 bp, 159 aa] {ON}
           YPR193C (REAL)
          Length = 159

 Score =  164 bits (416), Expect = 4e-52,   Method: Compositional matrix adjust.
 Identities = 72/152 (47%), Positives = 101/152 (66%)

Query: 10  TSDRIVVRAIEPKDEDAWHKLWKEYQGFQKTDMPLEVATTNFARFLDPTVKLWGALAFDT 69
           + D I++R +   D++ W +LWK YQ F K     ++   NF RFLD  +K+W A+A + 
Sbjct: 8   SEDNIIIRFVTENDKEGWQRLWKSYQKFYKVSFSNDLDDFNFNRFLDSNIKMWTAVAVER 67

Query: 70  ETGNAIGFAHYLSHLTSWHVEEVIYMNDLYVTEHARIKGVGRKLIEFVYKRADELGTPAV 129
            +G  IG  ++ SH+T+W  ++ +Y+NDLYV   +R K  G KLIEFVY   D+LGTP+V
Sbjct: 68  SSGKNIGMINFFSHVTTWDFKDKVYVNDLYVDVGSRAKVTGVKLIEFVYGEIDKLGTPSV 127

Query: 130 YWVTDHYNHRAQLLYTKVAYKTDKVLYKRTGY 161
           YW TD  N+RAQLLYTK+ YK  K++YKR GY
Sbjct: 128 YWCTDESNYRAQLLYTKIGYKAPKIMYKRKGY 159

>SAKL0B12606g Chr2 (1089114..1089581) [468 bp, 155 aa] {ON} similar
           to uniprot|Q06592 Saccharomyces cerevisiae YPR193C HPA2
           Tetrameric histone acetyltransferase with similarity to
           Gcn5p, Hat1p, Elp3p, and Hpa3p
          Length = 155

 Score =  159 bits (403), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 77/150 (51%), Positives = 100/150 (66%)

Query: 10  TSDRIVVRAIEPKDEDAWHKLWKEYQGFQKTDMPLEVATTNFARFLDPTVKLWGALAFDT 69
             D ++VR +  +DE+ W +LWK Y  F K+ +P EVA  NF RFL P VK+W ALA DT
Sbjct: 6   CKDSVIVRLVGTEDEEEWKRLWKLYLVFYKSSLPEEVAELNFKRFLKPEVKMWSALAIDT 65

Query: 70  ETGNAIGFAHYLSHLTSWHVEEVIYMNDLYVTEHARIKGVGRKLIEFVYKRADELGTPAV 129
            T   IG  +Y  H  +W V++ I +NDLYV E+ R+KGVGR+LI  VY  A++L    V
Sbjct: 66  VTNKPIGMVNYFGHFHTWDVKDKILLNDLYVDENFRVKGVGRRLITHVYGHAEKLEIWNV 125

Query: 130 YWVTDHYNHRAQLLYTKVAYKTDKVLYKRT 159
           YW TD +NHRAQLLYTK+  +T KV Y+RT
Sbjct: 126 YWHTDFFNHRAQLLYTKIGERTTKVQYRRT 155

>KNAG0B02050 Chr2 (392828..393289) [462 bp, 153 aa] {ON} 
          Length = 153

 Score =  156 bits (394), Expect = 8e-49,   Method: Compositional matrix adjust.
 Identities = 72/151 (47%), Positives = 102/151 (67%), Gaps = 1/151 (0%)

Query: 9   MTSDRIVVRAIEPKDEDAWHKLWKEYQGFQKTDMPLEVATTNFARFLDPTVKLWGALAFD 68
           M SD I +R +   D++ W +LW  ++      +P  +   NF R +D +V +W A A D
Sbjct: 1   MASDSIAIRYVTDGDKEEWTRLWLGFRAHYDIPIPDGLGDANFKRIMDDSVDMWSAFAVD 60

Query: 69  TETGN-AIGFAHYLSHLTSWHVEEVIYMNDLYVTEHARIKGVGRKLIEFVYKRADELGTP 127
           T   +  IG  +++S  ++W + +++Y++DLYV E+ R++GVGRKLIEFVY  AD+ GTP
Sbjct: 61  TSRDDKPIGLVNWVSRPSTWDLTDIVYLHDLYVDENERVRGVGRKLIEFVYSEADKRGTP 120

Query: 128 AVYWVTDHYNHRAQLLYTKVAYKTDKVLYKR 158
            VYW TDHYNHRAQLLYTKVA KT KV+Y+R
Sbjct: 121 LVYWTTDHYNHRAQLLYTKVAKKTSKVIYER 151

>KNAG0B02060 Chr2 (393547..394011) [465 bp, 154 aa] {ON} 
          Length = 154

 Score =  138 bits (347), Expect = 9e-42,   Method: Compositional matrix adjust.
 Identities = 67/150 (44%), Positives = 90/150 (60%), Gaps = 2/150 (1%)

Query: 14  IVVRAIEPKDEDAWHKLWKEYQGFQKT--DMPLEVATTNFARFLDPTVKLWGALAFDTET 71
           + VR ++P D +   +L+  Y  F K+   +P      NF RFLDP  ++W A+A DT T
Sbjct: 5   VEVRYVQPGDREELARLFTLYLNFYKSLDKVPATQFDLNFKRFLDPKERMWAAVAIDTST 64

Query: 72  GNAIGFAHYLSHLTSWHVEEVIYMNDLYVTEHARIKGVGRKLIEFVYKRADELGTPAVYW 131
           G  IG   +  H ++W  E  I +NDLYV E +R+ GVGR L+EFV+   D++G   VYW
Sbjct: 65  GKHIGMVQWFHHTSTWEPEGCILLNDLYVDEDSRLGGVGRALMEFVFSEGDKIGVGNVYW 124

Query: 132 VTDHYNHRAQLLYTKVAYKTDKVLYKRTGY 161
            TD  NHRAQLLYTKV Y + +  Y R GY
Sbjct: 125 HTDTSNHRAQLLYTKVGYLSSQCRYVRNGY 154

>KLTH0E14806g Chr5 (1316897..1317421) [525 bp, 174 aa] {ON} similar
           to uniprot|Q03503 Saccharomyces cerevisiae YPR051W MAK3
           Catalytic subunit of N-terminal acetyltransferase of the
           NatC type required for replication of dsRNA virus
          Length = 174

 Score = 32.7 bits (73), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 24/95 (25%), Positives = 44/95 (46%), Gaps = 5/95 (5%)

Query: 65  LAFDTETGNAIGF--AHYLSHLTSWHVEEVIYMNDLYVTEHARIKGVGRKLIEFVYKRAD 122
           LAF  +T N +G     Y +H  +       Y+  L V +  R +G+ +KL+E   ++  
Sbjct: 49  LAFSNDTENPVGCVVCKYETHRGARLRG---YIGMLAVDQKYRRRGIAKKLVEQAIQKMQ 105

Query: 123 ELGTPAVYWVTDHYNHRAQLLYTKVAYKTDKVLYK 157
           E+G   +   T+  N  A  LY  + +   K +++
Sbjct: 106 EIGCDEIMLETEVENTTALQLYEGMGFIRLKRMFR 140

>ZYRO0D10912g Chr4 (921315..921809) [495 bp, 164 aa] {ON} similar to
           uniprot|Q08689 Saccharomyces cerevisiae YOR253W NAT5
           Subunit of the N-terminal acetyltransferase NatA (Nat1p
           Ard1p Nat5p) N-terminally acetylates many proteins which
           influences multiple processes such as the cell cycle
           heat-shock resistance mating sporulation and telomeric
           silencing
          Length = 164

 Score = 30.8 bits (68), Expect = 0.91,   Method: Compositional matrix adjust.
 Identities = 26/91 (28%), Positives = 41/91 (45%)

Query: 62  WGALAFDTETGNAIGFAHYLSHLTSWHVEEVIYMNDLYVTEHARIKGVGRKLIEFVYKRA 121
           +  LAF +E       A  +++     +   +Y+  L V EH   KG+G KL+E+V   A
Sbjct: 50  FAQLAFYSEVAVGAVKAKLIANKKGGILPHGMYIEVLAVLEHYSGKGIGTKLLEYVESEA 109

Query: 122 DELGTPAVYWVTDHYNHRAQLLYTKVAYKTD 152
            +    A+Y      N RA   Y K  ++ D
Sbjct: 110 KKHYQHALYVHVASDNVRAITWYKKRGFEQD 140

>SAKL0H06006g Chr8 complement(532245..532754) [510 bp, 169 aa] {ON}
           similar to uniprot|Q08689 Saccharomyces cerevisiae
           YOR253W NAT5 Subunit of the N-terminal acetyltransferase
           NatA (Nat1p Ard1p Nat5p) N-terminally acetylates many
           proteins which influences multiple processes such as the
           cell cycle heat-shock resistance mating sporulation and
           telomeric silencing
          Length = 169

 Score = 30.8 bits (68), Expect = 0.95,   Method: Compositional matrix adjust.
 Identities = 28/103 (27%), Positives = 42/103 (40%), Gaps = 16/103 (15%)

Query: 61  LWGALAFDTETGNAIGFAHYLSHLTSWHVEEVIYMNDLYVTEHARIKGVGRKLIEFVYKR 120
            +  LA+  ET  A   A  L       +   +Y+  L V    R KG+G KL+EF+ ++
Sbjct: 54  FFSKLAYYGETAVAAVKAKLLPSSKGGVLPAGVYIEVLAVLSAYRDKGIGSKLLEFIEQQ 113

Query: 121 ADELGTPAVYWVTDHYNHRAQLLYTKVAYKTDKVL--YKRTGY 161
                        DH+ H    +Y  VA      L  YK+ G+
Sbjct: 114 CK-----------DHFQHD---IYVHVATDNSVALEWYKKKGF 142

>KLLA0A12089g Chr1 (1052066..1052611) [546 bp, 181 aa] {ON} similar
           to uniprot|Q5WCY3 Bacillus clausii ABC3243 paiA
           Septation and degradation transcriptional repressor of
           sporulation
          Length = 181

 Score = 30.4 bits (67), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 38/155 (24%), Positives = 60/155 (38%), Gaps = 16/155 (10%)

Query: 8   KMTSDRIVVRAIEPKDEDAWHKLWK----EYQGFQKTDMPLEVATTNFARFLDPTVKL-- 61
           KMTSD + +R   P D D    L +    E  G   T+  LE        F D  +K   
Sbjct: 7   KMTSD-LTIRQCTPDDIDILKALCRTTFWETFGADNTEENLEAMFEE--SFNDAVLKKEI 63

Query: 62  ------WGALAFDTETGNAIGFAHYLSHLTSWHVEEVIYMNDLYVTEHARIKGVGRKLIE 115
                    L FD E    I    + S       E  + +  +Y+ +  + KG+GR L++
Sbjct: 64  LDEHSHICLLFFDNEAAAFIKVNDHKSQTEDMGTE-YVELQRIYILQKYQGKGLGRVLMD 122

Query: 116 FVYKRADELGTPAVYWVTDHYNHRAQLLYTKVAYK 150
            V+  A   G   ++     +N +A   Y K  ++
Sbjct: 123 KVHDIAQSYGKKKIWLGVWEHNQKAIDFYKKFGFE 157

>YPL070W Chr16 (420948..422786) [1839 bp, 612 aa] {ON}
           MUK1Cytoplasmic protein of unknown function containing a
           Vps9 domain; computational analysis of large-scale
           protein-protein interaction data suggests a possible
           role in transcriptional regulation
          Length = 612

 Score = 30.8 bits (68), Expect = 1.3,   Method: Composition-based stats.
 Identities = 14/42 (33%), Positives = 24/42 (57%), Gaps = 3/42 (7%)

Query: 3   NKEFEKMTSDRIVVRAIEPKDEDAWHKLWKEYQGFQKTDMPL 44
           N+EF   T D  V  +I   D+  + K WK+Y+G++  D+ +
Sbjct: 559 NREF---TGDLTVTASINGADKKEFQKSWKKYKGYKFEDLTI 597

>Smik_16.165 Chr16 (304145..305986) [1842 bp, 613 aa] {ON} YPL070W
           (REAL)
          Length = 613

 Score = 30.8 bits (68), Expect = 1.7,   Method: Composition-based stats.
 Identities = 14/42 (33%), Positives = 23/42 (54%), Gaps = 3/42 (7%)

Query: 3   NKEFEKMTSDRIVVRAIEPKDEDAWHKLWKEYQGFQKTDMPL 44
           N+EF   T D  V  +I   D   + K WK+Y+G++  D+ +
Sbjct: 560 NREF---TGDLTVTASINGADRKEFQKSWKKYKGYKFEDLTI 598

>TBLA0G03520 Chr7 complement(934734..941087) [6354 bp, 2117 aa] {ON}
           Anc_8.69 YFL007W
          Length = 2117

 Score = 30.4 bits (67), Expect = 2.0,   Method: Composition-based stats.
 Identities = 14/44 (31%), Positives = 24/44 (54%)

Query: 95  MNDLYVTEHARIKGVGRKLIEFVYKRADELGTPAVYWVTDHYNH 138
           +ND+    H  I  +G++LIEF+    DE+ +P +  +T    H
Sbjct: 857 LNDILRQSHEEILKIGKELIEFMIYVYDEISSPPLAVITSILVH 900

>Ecym_6189 Chr6 complement(348408..349862) [1455 bp, 484 aa] {ON}
           similar to Ashbya gossypii AFR012C
          Length = 484

 Score = 29.6 bits (65), Expect = 3.7,   Method: Composition-based stats.
 Identities = 14/58 (24%), Positives = 29/58 (50%), Gaps = 3/58 (5%)

Query: 9   MTSDRIVVRAIEPKDEDAWHKLWKEYQG---FQKTDMPLEVATTNFARFLDPTVKLWG 63
           +T  + +  A+ P +E  W K + +YQ    F++ +  + +    F  F++   +LWG
Sbjct: 119 ITEWKPITGAVPPMNEKDWEKEFAKYQASPEFKQLNSHITIEDFKFIYFMEWAHRLWG 176

>TBLA0A06190 Chr1 (1520461..1522113) [1653 bp, 550 aa] {ON}
           Anc_6.221 YPL208W
          Length = 550

 Score = 29.3 bits (64), Expect = 4.9,   Method: Composition-based stats.
 Identities = 25/101 (24%), Positives = 44/101 (43%), Gaps = 15/101 (14%)

Query: 25  DAWHKLWKEYQGFQKTDMPLEVATTNFARFLDPTVKLWGALAFDTETGNAIGFAHYLSHL 84
           D W K  ++YQ +Q+ +   E +  NF+ F      LW  L   + +     F  Y+ + 
Sbjct: 144 DEWFKFLEKYQNYQEFETQSETSWYNFSNF------LWAHLIITSRS-----FPEYIIN- 191

Query: 85  TSWHVEEVIYMNDLYVTEHARIKGV---GRKLIEFVYKRAD 122
            +   + V+ +  L +  H+    V   G K   F+YK+ D
Sbjct: 192 PNCPRDSVMLLPVLDLLNHSNYSKVEWDGNKGGNFIYKKLD 232

>KLLA0D02530g Chr4 complement(212703..214826) [2124 bp, 707 aa] {ON}
           similar to uniprot|Q06440 Saccharomyces cerevisiae
           YLR429W CRN1 Coronin cortical actin cytoskeletal
           component that associates with the Arp2p/Arp3p complex
           to regulate its activity
          Length = 707

 Score = 29.3 bits (64), Expect = 5.2,   Method: Composition-based stats.
 Identities = 15/33 (45%), Positives = 20/33 (60%), Gaps = 2/33 (6%)

Query: 45  EVATTNFARFLDPTVKLWGALAFDTETGNAIGF 77
           +VATT F+R  D  + +W   AF+ E GN  GF
Sbjct: 251 KVATTGFSRLSDRQIGVWD--AFNLEKGNLGGF 281

>Kwal_26.8877 s26 (987655..988143) [489 bp, 162 aa] {ON} YOR253W
           (ARD2) -  [contig 68] FULL
          Length = 162

 Score = 28.5 bits (62), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 21/71 (29%), Positives = 35/71 (49%), Gaps = 16/71 (22%)

Query: 93  IYMNDLYVTEHARIKGVGRKLIEFVYKRADELGTPAVYWVTDHYNHRAQLLYTKVAYKTD 152
           +Y+  L V E+ R KG+G +L+ FV ++  +           H+ H    LY  VA   +
Sbjct: 79  VYVQILAVLENYRGKGIGSQLLLFVEEQCKK-----------HFQHN---LYVHVATDNE 124

Query: 153 KVL--YKRTGY 161
           K L  Y++ G+
Sbjct: 125 KALSWYQKKGF 135

>AAL102C Chr1 complement(163467..163946) [480 bp, 159 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOR253W
          Length = 159

 Score = 28.5 bits (62), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 23/80 (28%), Positives = 35/80 (43%), Gaps = 4/80 (5%)

Query: 51  FARFLDPTVKLWGALAFDTETGNAIGFAHYLSHLTSWHVEEVIYMNDLYVTEHARIKGVG 110
           F+   D    L+  LAF  E   A+G     + +        + ++ L V E  R KGVG
Sbjct: 40  FSSKKDDKSTLYSQLAFYGEV--AVGAVK--ARIQDMRGHSAVVIDTLAVLEAYRGKGVG 95

Query: 111 RKLIEFVYKRADELGTPAVY 130
            KL+++V K        A+Y
Sbjct: 96  TKLLDYVEKETKPFQPRAIY 115

>TPHA0D04290 Chr4 (926466..927956) [1491 bp, 496 aa] {ON} Anc_8.183
           YER141W
          Length = 496

 Score = 28.9 bits (63), Expect = 6.2,   Method: Composition-based stats.
 Identities = 14/52 (26%), Positives = 29/52 (55%), Gaps = 3/52 (5%)

Query: 15  VVRAIEPKDEDAWHKLWKEYQG---FQKTDMPLEVATTNFARFLDPTVKLWG 63
           V  AI P +++ W K +++YQ    F++ +  +++    F  F++   +LWG
Sbjct: 132 VTGAIPPLNQEEWEKEFEKYQTSPEFKELNSHIDIDDFKFIFFMEWFHRLWG 183

>Kwal_27.12534 s27 (1264793..1265317) [525 bp, 174 aa] {ON} YPR051W
           (MAK3) - N-acetyltransferase [contig 260] FULL
          Length = 174

 Score = 28.5 bits (62), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 16/64 (25%), Positives = 31/64 (48%)

Query: 94  YMNDLYVTEHARIKGVGRKLIEFVYKRADELGTPAVYWVTDHYNHRAQLLYTKVAYKTDK 153
           Y+  L V +  R +G+ +KL+E   ++   +G   V   T+  N  A  LY  + +   K
Sbjct: 77  YIGMLAVAQTYRRRGIAKKLVEVAIEKMQAIGCDEVMLETEVENKAALKLYEGMGFIRLK 136

Query: 154 VLYK 157
            +++
Sbjct: 137 RMFR 140

>TDEL0A06420 Chr1 (1124798..1125301) [504 bp, 167 aa] {ON} Anc_8.697
           YOR253W
          Length = 167

 Score = 28.1 bits (61), Expect = 8.9,   Method: Compositional matrix adjust.
 Identities = 12/25 (48%), Positives = 17/25 (68%)

Query: 93  IYMNDLYVTEHARIKGVGRKLIEFV 117
           +Y+  L V EH R KG+G KL+ +V
Sbjct: 83  VYIEILVVLEHYRGKGIGGKLLSYV 107

>KLTH0D11748g Chr4 (960571..961059) [489 bp, 162 aa] {ON} similar to
           uniprot|Q08689 Saccharomyces cerevisiae YOR253W NAT5
           Subunit of the N-terminal acetyltransferase NatA (Nat1p
           Ard1p Nat5p) N-terminally acetylates many proteins which
           influences multiple processes such as the cell cycle
           heat-shock resistance mating sporulation and telomeric
           silencing
          Length = 162

 Score = 27.7 bits (60), Expect = 9.6,   Method: Compositional matrix adjust.
 Identities = 25/103 (24%), Positives = 43/103 (41%), Gaps = 16/103 (15%)

Query: 61  LWGALAFDTETGNAIGFAHYLSHLTSWHVEEVIYMNDLYVTEHARIKGVGRKLIEFVYKR 120
           L+  L +  E       A  +S+         +Y+    V E+ R KGVG +L++FV ++
Sbjct: 47  LFAQLGYYGEVAVGAVRAQLISNKNGGVKASGVYIQIFAVLENYRGKGVGSQLLKFVEEQ 106

Query: 121 ADELGTPAVYWVTDHYNHRAQLLYTKVAYKTDKVL--YKRTGY 161
                         H+ H    +Y  VA   +K +  Y+R G+
Sbjct: 107 CKA-----------HFQHN---IYVHVAVDNEKGIQWYQRKGF 135

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.320    0.135    0.420 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 18,340,505
Number of extensions: 753095
Number of successful extensions: 1880
Number of sequences better than 10.0: 34
Number of HSP's gapped: 1879
Number of HSP's successfully gapped: 34
Length of query: 161
Length of database: 53,481,399
Length adjustment: 101
Effective length of query: 60
Effective length of database: 41,900,133
Effective search space: 2514007980
Effective search space used: 2514007980
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 61 (28.1 bits)