Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Smik_4.767.341ON80804031e-52
YDL160C-A (MHF2)7.341ON80803241e-40
Suva_4.847.341ON81802953e-36
Skud_4.957.341ON79802842e-34
KNAG0C038107.341ON82791444e-13
ZYRO0F11528g7.341ON121821465e-13
TDEL0C020607.341ON88631366e-12
TPHA0F029107.341ON108981361e-11
NDAI0A019507.341ON122851335e-11
KLTH0H01452g7.341ON86611271e-10
SAKL0F10956g7.341ON86811254e-10
Kwal_YGOB_Anc_7.3417.341ON86801228e-10
Kpol_530.377.341ON88811229e-10
NCAS0A140807.341ON78801202e-09
CAGL0I03432g7.341ON149671232e-09
KAFR0B009007.341ON78811183e-09
Ecym_45207.341ON91621142e-08
TBLA0E004707.341ON116831101e-07
ACL158W7.341ON95621063e-07
KLLA0C16709g7.341ON7963881e-04
KNAG0D027005.54ON56350621.4
SAKL0F00968g3.561ON96149586.1
Smik_15.1726.14ON47853569.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Smik_4.76
         (80 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Smik_4.76 Chr4 complement(146162..146401) [240 bp, 80 aa] {ON} Y...   159   1e-52
YDL160C-A Chr4 complement(169366..169608) [243 bp, 80 aa] {ON}  ...   129   1e-40
Suva_4.84 Chr4 complement(156977..157219) [243 bp, 81 aa] {ON} Y...   118   3e-36
Skud_4.95 Chr4 complement(164983..165219) [237 bp, 79 aa] {ON} Y...   114   2e-34
KNAG0C03810 Chr3 complement(748315..748563) [249 bp, 82 aa] {ON}...    60   4e-13
ZYRO0F11528g Chr6 (946636..947001) [366 bp, 121 aa] {ON} some si...    61   5e-13
TDEL0C02060 Chr3 complement(356665..356931) [267 bp, 88 aa] {ON}...    57   6e-12
TPHA0F02910 Chr6 (644434..644760) [327 bp, 108 aa] {ON} Anc_7.34...    57   1e-11
NDAI0A01950 Chr1 (434811..435179) [369 bp, 122 aa] {ON} Anc_7.34...    56   5e-11
KLTH0H01452g Chr8 complement(134324..134584) [261 bp, 86 aa] {ON...    54   1e-10
SAKL0F10956g Chr6 complement(858747..859007) [261 bp, 86 aa] {ON...    53   4e-10
Kwal_YGOB_Anc_7.341 s56 (1073424..1073684) [261 bp, 86 aa] {ON} ...    52   8e-10
Kpol_530.37 s530 complement(86462..86728) [267 bp, 88 aa] {ON} c...    52   9e-10
NCAS0A14080 Chr1 (2768035..2768271) [237 bp, 78 aa] {ON}               51   2e-09
CAGL0I03432g Chr9 complement(292162..292611) [450 bp, 149 aa] {O...    52   2e-09
KAFR0B00900 Chr2 complement(167674..167910) [237 bp, 78 aa] {ON}...    50   3e-09
Ecym_4520 Chr4 (1036442..1036717) [276 bp, 91 aa] {ON} similar t...    49   2e-08
TBLA0E00470 Chr5 (86619..86969) [351 bp, 116 aa] {ON} Anc_7.341 ...    47   1e-07
ACL158W Chr3 (78852..79139) [288 bp, 95 aa] {ON} Syntenic homolo...    45   3e-07
KLLA0C16709g Chr3 (1463056..1463295) [240 bp, 79 aa] {ON} conser...    39   1e-04
KNAG0D02700 Chr4 (486330..488021) [1692 bp, 563 aa] {ON} Anc_5.5...    28   1.4  
SAKL0F00968g Chr6 (84333..87218) [2886 bp, 961 aa] {ON} highly s...    27   6.1  
Smik_15.172 Chr15 (298772..300208) [1437 bp, 478 aa] {ON} YOR003...    26   9.1  

>Smik_4.76 Chr4 complement(146162..146401) [240 bp, 80 aa] {ON}
          YDL160C-A (REAL)
          Length = 80

 Score =  159 bits (403), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 80/80 (100%), Positives = 80/80 (100%)

Query: 1  MLSKEALVKILSQNNCGKDIEISDEVIPMIQKYLDIFIEEAALRSLQSHKDINKEHDKKD 60
          MLSKEALVKILSQNNCGKDIEISDEVIPMIQKYLDIFIEEAALRSLQSHKDINKEHDKKD
Sbjct: 1  MLSKEALVKILSQNNCGKDIEISDEVIPMIQKYLDIFIEEAALRSLQSHKDINKEHDKKD 60

Query: 61 PLELSHQDLERVVGVLLMDM 80
          PLELSHQDLERVVGVLLMDM
Sbjct: 61 PLELSHQDLERVVGVLLMDM 80

>YDL160C-A Chr4 complement(169366..169608) [243 bp, 80 aa] {ON}
          MHF2Protein of unknown function; ortholog of human
          MHF2, and component of the heterotetrameric MHF
          histone-fold complex that in humans interacts with both
          DNA and Mph1p ortholog FANCM to stabilize and remodel
          blocked replication forks and repair damaged DNA; mhf2
          srs2 double mutants are MMS hypersensitive
          Length = 80

 Score =  129 bits (324), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 63/80 (78%), Positives = 71/80 (88%)

Query: 1  MLSKEALVKILSQNNCGKDIEISDEVIPMIQKYLDIFIEEAALRSLQSHKDINKEHDKKD 60
          MLSKEAL+KILSQN  G D++I+DEV+PMIQKYLDIFI+EA LRSLQSHKDIN E   K 
Sbjct: 1  MLSKEALIKILSQNEGGNDMKIADEVVPMIQKYLDIFIDEAVLRSLQSHKDINGERGDKS 60

Query: 61 PLELSHQDLERVVGVLLMDM 80
          PLELSHQDLER+VG+LLMDM
Sbjct: 61 PLELSHQDLERIVGLLLMDM 80

>Suva_4.84 Chr4 complement(156977..157219) [243 bp, 81 aa] {ON}
          YDL160C-A (REAL)
          Length = 81

 Score =  118 bits (295), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 59/80 (73%), Positives = 69/80 (86%)

Query: 1  MLSKEALVKILSQNNCGKDIEISDEVIPMIQKYLDIFIEEAALRSLQSHKDINKEHDKKD 60
          +L KEA++KILSQNN  K+I+I D+VIPMIQKYL+IFIEEAALRSLQSHKD +  HD   
Sbjct: 2  ILPKEAIIKILSQNNSDKNIKIDDKVIPMIQKYLEIFIEEAALRSLQSHKDSSGAHDGDG 61

Query: 61 PLELSHQDLERVVGVLLMDM 80
          PLELSH DLER+VG+LLMDM
Sbjct: 62 PLELSHLDLERIVGLLLMDM 81

>Skud_4.95 Chr4 complement(164983..165219) [237 bp, 79 aa] {ON}
          YDL160C-A (REAL)
          Length = 79

 Score =  114 bits (284), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 59/80 (73%), Positives = 68/80 (85%), Gaps = 1/80 (1%)

Query: 1  MLSKEALVKILSQNNCGKDIEISDEVIPMIQKYLDIFIEEAALRSLQSHKDINKEHDKKD 60
          MLSK+AL+KILSQNN  KDI+I D+V+PMIQ YLDIFIEEAALRSLQS KD +  H +  
Sbjct: 1  MLSKDALIKILSQNNFRKDIKIDDKVLPMIQNYLDIFIEEAALRSLQSQKDASGGH-RDG 59

Query: 61 PLELSHQDLERVVGVLLMDM 80
          PLELSH DLER+VG+LLMDM
Sbjct: 60 PLELSHLDLERIVGLLLMDM 79

>KNAG0C03810 Chr3 complement(748315..748563) [249 bp, 82 aa] {ON}
          Anc_7.341 YDL160C-A
          Length = 82

 Score = 60.1 bits (144), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 30/79 (37%), Positives = 54/79 (68%), Gaps = 6/79 (7%)

Query: 2  LSKEALVKILSQNNCGKDIEISDEVIPMIQKYLDIFIEEAALRSLQSHKDINKEHDKKDP 61
          +S+E L +IL+Q+   K   I D+ +  +QKY++ +++E  LRSL+ +KD+       +P
Sbjct: 9  ISRETLSRILTQSFKNKSTTIDDQALTSVQKYVETYVQEIILRSLE-NKDLG-----VNP 62

Query: 62 LELSHQDLERVVGVLLMDM 80
           EL+ +D+ER++G+LL+DM
Sbjct: 63 AELTERDIERILGLLLLDM 81

>ZYRO0F11528g Chr6 (946636..947001) [366 bp, 121 aa] {ON} some
           similarities with uniprot|Q3E829 Saccharomyces
           cerevisiae YDL160C-A Identified by homology to Ashbya
           gossypii
          Length = 121

 Score = 60.8 bits (146), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 55/82 (67%), Gaps = 3/82 (3%)

Query: 1   MLSKEALVKILS-QNNCGKDIEISDEVIPMIQKYLDIFIEEAALRSLQSHKDINKEHDKK 59
           M+ KE +V+IL  Q    +   I++E + M+QKYL++F+ EA  RS+ ++KD    H   
Sbjct: 41  MVPKETIVRILKLQAFEHESTTITEETVTMLQKYLEVFVREAVQRSV-ANKDSQGSHGDG 99

Query: 60  DP-LELSHQDLERVVGVLLMDM 80
           D  ++L+H+DLE++ G+LL+DM
Sbjct: 100 DGEIQLNHEDLEKITGMLLLDM 121

>TDEL0C02060 Chr3 complement(356665..356931) [267 bp, 88 aa] {ON}
          Anc_7.341 YDL160C-A
          Length = 88

 Score = 57.0 bits (136), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 26/63 (41%), Positives = 42/63 (66%), Gaps = 4/63 (6%)

Query: 22 ISDEVIPMIQKYLDIFIEEAALRSLQSHKDINKEHD----KKDPLELSHQDLERVVGVLL 77
          I+DE + M+QKY+++F+ EA LRS  + + I  EH       + + L+H+DLE + G+LL
Sbjct: 26 ITDETVGMMQKYMEVFVREAVLRSSANKEQIKVEHSGAQRNSNEIVLTHEDLENITGLLL 85

Query: 78 MDM 80
          +DM
Sbjct: 86 LDM 88

>TPHA0F02910 Chr6 (644434..644760) [327 bp, 108 aa] {ON} Anc_7.341
           YDL160C-A
          Length = 108

 Score = 57.0 bits (136), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 33/98 (33%), Positives = 56/98 (57%), Gaps = 19/98 (19%)

Query: 2   LSKEALVKILSQNNCGKDIEISDEVIPMIQKYLDIFIEEAALRSLQS--HKDINKEHDKK 59
           + K+ + +IL   + G++  IS E + ++QKY+++F+ EA LRS+++   K  N E  KK
Sbjct: 10  IPKDTIARILQLESFGEETRISAESVGILQKYMELFVREAVLRSIENREQKQSNIEALKK 69

Query: 60  DP-----------------LELSHQDLERVVGVLLMDM 80
            P                 +EL+H+DLE + G+LL+DM
Sbjct: 70  APAKANPDQLQTFQHSFNGIELTHEDLEEISGLLLLDM 107

>NDAI0A01950 Chr1 (434811..435179) [369 bp, 122 aa] {ON} Anc_7.341
           YDL160C-A
          Length = 122

 Score = 55.8 bits (133), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 34/85 (40%), Positives = 53/85 (62%), Gaps = 9/85 (10%)

Query: 5   EALVKIL-SQNNCGKDIEISDEVIPMIQKYLDIFIEEAALRSLQSH--------KDINKE 55
           E + KIL S++   KD  I+ E I MIQ+Y+D+FI+EA +RS ++          D    
Sbjct: 38  ETIEKILRSESFQNKDTTITKETILMIQRYMDLFIKEAVIRSYENKVATQVEDFDDEEDA 97

Query: 56  HDKKDPLELSHQDLERVVGVLLMDM 80
            ++   +EL+H DLER+VG+LLM++
Sbjct: 98  DEEDKTIELTHLDLERIVGLLLMEL 122

>KLTH0H01452g Chr8 complement(134324..134584) [261 bp, 86 aa] {ON}
          weakly similar to uniprot|Q3E829 Saccharomyces
          cerevisiae YDL160c-a
          Length = 86

 Score = 53.5 bits (127), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 24/61 (39%), Positives = 43/61 (70%), Gaps = 2/61 (3%)

Query: 22 ISDEVIPMIQKYLDIFIEEAALRSLQSHKDINKEHDKK--DPLELSHQDLERVVGVLLMD 79
          I++  + ++  YL++F+ EA LRS+++ + +  EH  +  D + L+H+DLERV G+LL+D
Sbjct: 26 ITESTLSLVDAYLEVFVREALLRSIENKEQVKSEHQDQLGDQVVLTHKDLERVSGLLLLD 85

Query: 80 M 80
          M
Sbjct: 86 M 86

>SAKL0F10956g Chr6 complement(858747..859007) [261 bp, 86 aa] {ON}
          similar to uniprot|Q3E829 Saccharomyces cerevisiae
          YDL160C-A Putative protein of unknown function
          Length = 86

 Score = 52.8 bits (125), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 27/81 (33%), Positives = 50/81 (61%), Gaps = 2/81 (2%)

Query: 2  LSKEALVKILSQNNCGKD-IEISDEVIPMIQKYLDIFIEEAALRSLQSHKDINKEHDKKD 60
          L K+ + +I    +  +D   I+++ + +  KY+++F+ EA LRSL++ + +  E +  D
Sbjct: 6  LPKDTIARIFQTCSFTQDSTRITEDTVALTNKYIELFVREAVLRSLENKEKVKPETESLD 65

Query: 61 -PLELSHQDLERVVGVLLMDM 80
              LSH+DLE + G+LL+DM
Sbjct: 66 NGTVLSHEDLEEISGLLLLDM 86

>Kwal_YGOB_Anc_7.341 s56 (1073424..1073684) [261 bp, 86 aa] {ON}
          ANNOTATED BY YGOB -
          Length = 86

 Score = 51.6 bits (122), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 27/80 (33%), Positives = 49/80 (61%), Gaps = 3/80 (3%)

Query: 4  KEALVKILSQNNCGKD-IEISDEVIPMIQKYLDIFIEEAALRSLQSHKDINKEHDKK--D 60
          K+ + +I    +   D   I++  + ++ +YL+IF+ EA LRS+++   +  EH  +   
Sbjct: 7  KDTIARIFQTCSFQNDSTRITETTLTLVDEYLEIFVREAILRSIENKDQVKDEHQDQLGS 66

Query: 61 PLELSHQDLERVVGVLLMDM 80
           + L+H+DLERV G+LL+DM
Sbjct: 67 QVVLTHKDLERVSGLLLLDM 86

>Kpol_530.37 s530 complement(86462..86728) [267 bp, 88 aa] {ON}
          complement(86462..86728) [267 nt, 89 aa]
          Length = 88

 Score = 51.6 bits (122), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 25/81 (30%), Positives = 52/81 (64%), Gaps = 2/81 (2%)

Query: 2  LSKEALVKILSQNNCG-KDIEISDEVIPMIQKYLDIFIEEAALRSLQSHKDINKEHDKKD 60
          + KE + ++L  ++       I+++V+  +QKY+++F+ EA +RS+++   + +E+    
Sbjct: 7  IPKETIARLLETSSFEHSSTRITEDVVEGLQKYMELFVREAIMRSIETKAKLEEENSFTG 66

Query: 61 -PLELSHQDLERVVGVLLMDM 80
            +EL+H DLE + G+LL+DM
Sbjct: 67 VRVELTHTDLEEIAGLLLLDM 87

>NCAS0A14080 Chr1 (2768035..2768271) [237 bp, 78 aa] {ON}
          Length = 78

 Score = 50.8 bits (120), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 31/80 (38%), Positives = 51/80 (63%), Gaps = 5/80 (6%)

Query: 2  LSKEALVKILSQNNC-GKDIEISDEVIPMIQKYLDIFIEEAALRSLQSHKDINKEHDKKD 60
          + KE + +IL        D ++++E + MIQ+Y+++FI EA  RSL + +   KE  + D
Sbjct: 3  IPKETIAQILQLEAFENADTKMTEETLSMIQRYMELFIREAMCRSLDNKE---KELGQTD 59

Query: 61 PLELSHQDLERVVGVLLMDM 80
           + +  +DLERVVG+LL+DM
Sbjct: 60 IV-IDEKDLERVVGLLLLDM 78

>CAGL0I03432g Chr9 complement(292162..292611) [450 bp, 149 aa] {ON}
           some similarities with KLLA0C16709g Kluyveromyces lactis
           and DEHA0G05016g Debaryomyces hansenii and CA5994|IPF677
           Candida albicans
          Length = 149

 Score = 52.0 bits (123), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 26/67 (38%), Positives = 42/67 (62%), Gaps = 8/67 (11%)

Query: 18  KDIEISDEVIPMIQKYLDIFIEEAALRSLQSH----KDINKEHDKKDPLELSHQDLERVV 73
           K   I  +V+  +Q+Y+D+F  EA LRS++ H    + + +E DK    E++H DLE + 
Sbjct: 87  KKTRIESDVVDALQRYIDVFAREAVLRSIEHHDASQEGLEQEQDK----EITHTDLENIA 142

Query: 74  GVLLMDM 80
           G+LL+DM
Sbjct: 143 GLLLLDM 149

>KAFR0B00900 Chr2 complement(167674..167910) [237 bp, 78 aa] {ON}
          Anc_7.341 YDL160C-A
          Length = 78

 Score = 50.1 bits (118), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 30/81 (37%), Positives = 47/81 (58%), Gaps = 7/81 (8%)

Query: 2  LSKEALVKILSQ--NNCGKDIEISDEVIPMIQKYLDIFIEEAALRSLQSHKDINKEHDKK 59
          + KE + +IL    N  G++  I+ E +  + KY D+ IEE  LRSL+     NKE+  +
Sbjct: 3  IPKETISRILLNKLNENGENFSINTETVESVTKYTDVLIEEMVLRSLE-----NKENIAE 57

Query: 60 DPLELSHQDLERVVGVLLMDM 80
              L   DLE+++G+LL+DM
Sbjct: 58 ATPTLDVDDLEKIIGLLLLDM 78

>Ecym_4520 Chr4 (1036442..1036717) [276 bp, 91 aa] {ON} similar to
          Ashbya gossypii ACL158W
          Length = 91

 Score = 48.5 bits (114), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 24/62 (38%), Positives = 39/62 (62%), Gaps = 3/62 (4%)

Query: 22 ISDEVIPMIQKYLDIFIEEAALRSLQSHKDINKEHDKKDPLE---LSHQDLERVVGVLLM 78
          I+++ I + +KY+ +F+ EA LRSL++   + KE  K   +E   L H DLE + G+LL+
Sbjct: 30 ITEDTITLTEKYIKLFVREAVLRSLENKDKVKKEDGKGSLIEGPVLHHTDLEEISGILLL 89

Query: 79 DM 80
          D 
Sbjct: 90 DF 91

>TBLA0E00470 Chr5 (86619..86969) [351 bp, 116 aa] {ON} Anc_7.341
           YDL160C-A
          Length = 116

 Score = 47.0 bits (110), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 28/83 (33%), Positives = 46/83 (55%), Gaps = 21/83 (25%)

Query: 19  DIEISDEVIPMIQKYLDIFIEEAALRSLQSHKD-INKEHD--KKDP-------------- 61
           +  I+   +  +QKY+++FI EAALRSL++ ++ I+ E    K +P              
Sbjct: 34  NTRITKNTVTKLQKYMELFIREAALRSLENKEEQISNEKSAVKNEPGLEDTKIFNDNNKL 93

Query: 62  ----LELSHQDLERVVGVLLMDM 80
               +ELSH+ LE + G+LL+DM
Sbjct: 94  NDNDIELSHEALEAITGLLLLDM 116

>ACL158W Chr3 (78852..79139) [288 bp, 95 aa] {ON} Syntenic homolog
          of Saccharomyces cerevisiae YDL161CX; YDL161CX was
          overlooked in Saccharomyces cerevisiae
          Length = 95

 Score = 45.4 bits (106), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 21/62 (33%), Positives = 39/62 (62%), Gaps = 3/62 (4%)

Query: 22 ISDEVIPMIQKYLDIFIEEAALRSLQSHKDINKEHDKKDPLE---LSHQDLERVVGVLLM 78
          I+++ + ++++Y+ +FI EA LRSL++ + + +E       E   L H DLE + GVL++
Sbjct: 34 ITEDAVTLVERYMKLFIREAVLRSLENKEKVKQETRADSFAEGPVLQHTDLEEISGVLIL 93

Query: 79 DM 80
          D 
Sbjct: 94 DF 95

>KLLA0C16709g Chr3 (1463056..1463295) [240 bp, 79 aa] {ON}
          conserved hypothetical protein
          Length = 79

 Score = 38.5 bits (88), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 21/63 (33%), Positives = 37/63 (58%), Gaps = 6/63 (9%)

Query: 18 KDIEISDEVIPMIQKYLDIFIEEAALRSLQSHKDINKEHDKKDPLELSHQDLERVVGVLL 77
           +  I++E + +++ Y+++F+ E  LRSL++  D+    DK     +   DLE V G+LL
Sbjct: 22 SNTRITEECMQLLEPYIELFVREGVLRSLENKADM--LADKT----VDFVDLEAVAGLLL 75

Query: 78 MDM 80
          MD 
Sbjct: 76 MDF 78

>KNAG0D02700 Chr4 (486330..488021) [1692 bp, 563 aa] {ON} Anc_5.54
           YHR184W
          Length = 563

 Score = 28.5 bits (62), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 30/50 (60%), Gaps = 2/50 (4%)

Query: 33  YLDIFIE--EAALRSLQSHKDINKEHDKKDPLELSHQDLERVVGVLLMDM 80
           + +IFIE  +    S ++ +D++K++ +K  +ELSH D  R V VL   M
Sbjct: 315 FREIFIEFTQQVYNSTKNLEDVSKKYVEKSIMELSHIDERRTVEVLTKSM 364

>SAKL0F00968g Chr6 (84333..87218) [2886 bp, 961 aa] {ON} highly
           similar to uniprot|P33307 Saccharomyces cerevisiae
           YGL238W CSE1 Nuclear envelope protein that mediates the
           nuclear export of importin alpha (Srp1p) homolog of
           metazoan CAS protein required for accurate chromosome
           segregation
          Length = 961

 Score = 26.9 bits (58), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 15/49 (30%), Positives = 25/49 (51%), Gaps = 8/49 (16%)

Query: 30  IQKYLDIFIEEAALRSLQSH--------KDINKEHDKKDPLELSHQDLE 70
           I KY D+F  E A+ S+           ++ ++E  + DP+E   +DLE
Sbjct: 322 IPKYFDVFNNETAMNSITEQIILPNVTLRESDEELFEDDPIEFIRRDLE 370

>Smik_15.172 Chr15 (298772..300208) [1437 bp, 478 aa] {ON} YOR003W
           (REAL)
          Length = 478

 Score = 26.2 bits (56), Expect = 9.1,   Method: Composition-based stats.
 Identities = 14/53 (26%), Positives = 30/53 (56%), Gaps = 2/53 (3%)

Query: 17  GKDIEISDEVIPMIQKYLDIFIEEAALRSLQSHKDINKEHDKKDPLELSHQDL 69
           G D     E+IP   +Y+ +F E+ +++S++SH+ + +E       +L+  D+
Sbjct: 57  GLDNTHKTELIPY--RYIVVFNEDISIKSIESHRKMVQEAHSVSVSKLAEDDV 107

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.135    0.363 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 8,316,518
Number of extensions: 304394
Number of successful extensions: 1341
Number of sequences better than 10.0: 32
Number of HSP's gapped: 1326
Number of HSP's successfully gapped: 32
Length of query: 80
Length of database: 53,481,399
Length adjustment: 52
Effective length of query: 28
Effective length of database: 47,518,767
Effective search space: 1330525476
Effective search space used: 1330525476
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 59 (27.3 bits)