Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Smik_4.757.342ON46046017340.0
Skud_4.947.342ON44746215050.0
Suva_4.837.342ON46246914390.0
YDL161W (ENT1)7.342ON45446114280.0
TDEL0C020507.342ON5012477641e-95
KNAG0C038007.342ON4472447024e-87
NCAS0H006707.342ON4832566942e-85
SAKL0F10934g7.342ON4982526892e-84
CAGL0A03872g7.342ON5102546883e-84
ZYRO0F11550g7.342ON5382466782e-82
TPHA0D045607.342ON4872476715e-82
Kpol_2001.707.342ON5332456747e-82
KAFR0L014607.342ON5502636661e-80
NDAI0D006107.342ON4862666533e-79
Skud_12.2707.342ON6262756633e-79
Suva_10.3007.342ON6182636623e-79
Smik_12.2647.342ON6122656552e-78
KAFR0B008907.342ON4142406325e-77
Kwal_56.246107.342ON5082636301e-75
YLR206W (ENT2)7.342ON6132676352e-75
TBLA0E004807.342ON5992736081e-71
KLTH0H01430g7.342ON5022615872e-69
KLLA0C16731g7.342ON4782495801e-68
Ecym_47317.342ON5142575437e-63
TBLA0E020407.342ON7012545101e-56
ACL157C7.342ON5152564895e-55
KNAG0B026507.342ON6461404852e-53
Kwal_47.168574.346ON3821432482e-22
NDAI0D032004.346ON4351432484e-22
KLTH0D16896g4.346ON4011432474e-22
Kpol_1001.24.346ON4181432458e-22
Suva_12.2164.346ON4101432458e-22
TDEL0D007104.346ON3751432431e-21
TBLA0E047604.346ON4261432441e-21
SAKL0G17952g4.346ON4151432412e-21
Skud_10.3494.346ON4101432394e-21
KNAG0M003804.346ON4031432395e-21
YJR125C (ENT3)4.346ON4081432385e-21
Smik_10.4184.346ON4091432387e-21
KAFR0B067404.346ON3991432361e-20
KLLA0B04587g4.346ON4001432361e-20
ZYRO0B14784g4.346ON4241432333e-20
NCAS0A062104.346ON4231432324e-20
AER155C4.346ON3641432297e-20
TPHA0B004004.346ON3991432218e-19
Ecym_11334.346ON3921432182e-18
CAGL0H04323g4.346ON4121432121e-17
SAKL0H25762g4.17ON2621471911e-15
Kwal_55.206114.17ON2541461831e-14
TBLA0B062204.346ON3391431692e-12
Kpol_388.54.17ON2681441602e-11
TDEL0G017404.17ON2571441583e-11
Ecym_84074.17ON2541451565e-11
KLTH0E05874g4.17ON2551401503e-10
TPHA0F002304.17ON2801421433e-09
ZYRO0G07876g4.17ON2591391423e-09
Suva_10.354.17ON2471341397e-09
KLLA0D03949g4.17ON2251411315e-08
TBLA0G006504.17ON4231441331e-07
ACL061C4.17ON2341351263e-07
Skud_12.304.17ON2471341202e-06
NCAS0C058404.17ON2671391167e-06
KAFR0I014604.17ON2751581033e-04
CAGL0E03806g4.17ON2601031015e-04
YLL038C (ENT4)4.17ON247103999e-04
Smik_12.194.17ON247103970.002
KNAG0J028704.17ON329153960.003
NDAI0H002804.17ON310150960.003
YHR161C (YAP1801)5.84ON63750900.021
SAKL0H02530g5.84ON66946860.065
Skud_8.2255.84ON62165850.078
KLLA0D16654g8.335ON399167830.13
Smik_8.2455.84ON62772800.29
NCAS0B036608.335ON416113770.66
KLLA0A05522g5.84ON56785751.2
CAGL0E01199g8.335ON41298741.5
Kpol_344.88.335ON384168722.7
ZYRO0F13684g8.335ON40798713.7
KAFR0K015603.433ON101976705.7
Kwal_YGOB_27.112618.335ON40498696.2
KLTH0G11902g8.335ON399131687.0
NDAI0J009308.335ON418113679.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Smik_4.75
         (460 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Smik_4.75 Chr4 (144483..145865) [1383 bp, 460 aa] {ON} YDL161W (...   672   0.0  
Skud_4.94 Chr4 (163372..164715) [1344 bp, 447 aa] {ON} YDL161W (...   584   0.0  
Suva_4.83 Chr4 (155278..156666) [1389 bp, 462 aa] {ON} YDL161W (...   558   0.0  
YDL161W Chr4 (167714..169078) [1365 bp, 454 aa] {ON}  ENT1Epsin-...   554   0.0  
TDEL0C02050 Chr3 (355071..356576) [1506 bp, 501 aa] {ON} Anc_7.3...   298   1e-95
KNAG0C03800 Chr3 (746891..748234) [1344 bp, 447 aa] {ON} Anc_7.3...   275   4e-87
NCAS0H00670 Chr8 (117595..119046) [1452 bp, 483 aa] {ON} Anc_7.342    271   2e-85
SAKL0F10934g Chr6 (856966..858462) [1497 bp, 498 aa] {ON} some s...   270   2e-84
CAGL0A03872g Chr1 complement(392922..394454) [1533 bp, 510 aa] {...   269   3e-84
ZYRO0F11550g Chr6 complement(947131..948747) [1617 bp, 538 aa] {...   265   2e-82
TPHA0D04560 Chr4 complement(994552..996015) [1464 bp, 487 aa] {O...   263   5e-82
Kpol_2001.70 s2001 complement(192214..193815) [1602 bp, 533 aa] ...   264   7e-82
KAFR0L01460 Chr12 complement(270433..272085) [1653 bp, 550 aa] {...   261   1e-80
NDAI0D00610 Chr4 (133678..135138) [1461 bp, 486 aa] {ON} Anc_7.3...   256   3e-79
Skud_12.270 Chr12 (501192..503072) [1881 bp, 626 aa] {ON} YLR206...   259   3e-79
Suva_10.300 Chr10 (527412..529268) [1857 bp, 618 aa] {ON} YLR206...   259   3e-79
Smik_12.264 Chr12 (501598..503436) [1839 bp, 612 aa] {ON} YLR206...   256   2e-78
KAFR0B00890 Chr2 (166365..167609) [1245 bp, 414 aa] {ON} Anc_7.3...   248   5e-77
Kwal_56.24610 s56 complement(1073855..1075381) [1527 bp, 508 aa]...   247   1e-75
YLR206W Chr12 (554578..556419) [1842 bp, 613 aa] {ON}  ENT2Epsin...   249   2e-75
TBLA0E00480 Chr5 complement(88019..89818) [1800 bp, 599 aa] {ON}...   238   1e-71
KLTH0H01430g Chr8 (132738..134246) [1509 bp, 502 aa] {ON} some s...   230   2e-69
KLLA0C16731g Chr3 complement(1463616..1465052) [1437 bp, 478 aa]...   228   1e-68
Ecym_4731 Chr4 (1427875..1429419) [1545 bp, 514 aa] {ON} similar...   213   7e-63
TBLA0E02040 Chr5 complement(494899..497004) [2106 bp, 701 aa] {O...   201   1e-56
ACL157C Chr3 complement(79325..80872) [1548 bp, 515 aa] {ON} Syn...   192   5e-55
KNAG0B02650 Chr2 (511995..513935) [1941 bp, 646 aa] {ON} Anc_7.3...   191   2e-53
Kwal_47.16857 s47 (145176..146324) [1149 bp, 382 aa] {ON} YJR125...   100   2e-22
NDAI0D03200 Chr4 complement(764129..765436) [1308 bp, 435 aa] {O...   100   4e-22
KLTH0D16896g Chr4 complement(1395711..1396916) [1206 bp, 401 aa]...   100   4e-22
Kpol_1001.2 s1001 (8057..9313) [1257 bp, 418 aa] {ON} (8057..931...    99   8e-22
Suva_12.216 Chr12 complement(334254..335486) [1233 bp, 410 aa] {...    99   8e-22
TDEL0D00710 Chr4 (127174..128301) [1128 bp, 375 aa] {ON} Anc_4.3...    98   1e-21
TBLA0E04760 Chr5 complement(1226806..1228086) [1281 bp, 426 aa] ...    99   1e-21
SAKL0G17952g Chr7 complement(1555520..1556767) [1248 bp, 415 aa]...    97   2e-21
Skud_10.349 Chr10 complement(613398..614630) [1233 bp, 410 aa] {...    97   4e-21
KNAG0M00380 Chr13 (56675..57886) [1212 bp, 403 aa] {ON} Anc_4.34...    97   5e-21
YJR125C Chr10 complement(654737..655963) [1227 bp, 408 aa] {ON} ...    96   5e-21
Smik_10.418 Chr10 complement(643833..645062) [1230 bp, 409 aa] {...    96   7e-21
KAFR0B06740 Chr2 (1406075..1407274) [1200 bp, 399 aa] {ON} Anc_4...    96   1e-20
KLLA0B04587g Chr2 (411097..412299) [1203 bp, 400 aa] {ON} simila...    96   1e-20
ZYRO0B14784g Chr2 complement(1205944..1207218) [1275 bp, 424 aa]...    94   3e-20
NCAS0A06210 Chr1 complement(1229758..1231029) [1272 bp, 423 aa] ...    94   4e-20
AER155C Chr5 complement(929042..930136) [1095 bp, 364 aa] {ON} S...    93   7e-20
TPHA0B00400 Chr2 (83356..84555) [1200 bp, 399 aa] {ON} Anc_4.346...    90   8e-19
Ecym_1133 Chr1 (274069..275247) [1179 bp, 392 aa] {ON} similar t...    89   2e-18
CAGL0H04323g Chr8 (407884..409122) [1239 bp, 412 aa] {ON} simila...    86   1e-17
SAKL0H25762g Chr8 (2256842..2257630) [789 bp, 262 aa] {ON} some ...    78   1e-15
Kwal_55.20611 s55 complement(489968..490732) [765 bp, 254 aa] {O...    75   1e-14
TBLA0B06220 Chr2 (1466908..1467927) [1020 bp, 339 aa] {ON} Anc_4...    70   2e-12
Kpol_388.5 s388 complement(17825..18631) [807 bp, 268 aa] {ON} c...    66   2e-11
TDEL0G01740 Chr7 (342371..343144) [774 bp, 257 aa] {ON} Anc_4.17...    65   3e-11
Ecym_8407 Chr8 (843359..844123) [765 bp, 254 aa] {ON} similar to...    65   5e-11
KLTH0E05874g Chr5 complement(530814..531581) [768 bp, 255 aa] {O...    62   3e-10
TPHA0F00230 Chr6 complement(43589..44431) [843 bp, 280 aa] {ON} ...    60   3e-09
ZYRO0G07876g Chr7 complement(636468..637247) [780 bp, 259 aa] {O...    59   3e-09
Suva_10.35 Chr10 complement(70188..70931) [744 bp, 247 aa] {ON} ...    58   7e-09
KLLA0D03949g Chr4 (333566..334243) [678 bp, 225 aa] {ON} similar...    55   5e-08
TBLA0G00650 Chr7 (140678..141949) [1272 bp, 423 aa] {ON} Anc_4.1...    56   1e-07
ACL061C Chr3 complement(256803..257507) [705 bp, 234 aa] {ON} Sy...    53   3e-07
Skud_12.30 Chr12 complement(56967..57710) [744 bp, 247 aa] {ON} ...    51   2e-06
NCAS0C05840 Chr3 (1202292..1203095) [804 bp, 267 aa] {ON} Anc_4....    49   7e-06
KAFR0I01460 Chr9 (304865..305692) [828 bp, 275 aa] {ON} Anc_4.17...    44   3e-04
CAGL0E03806g Chr5 (356594..357376) [783 bp, 260 aa] {ON} similar...    44   5e-04
YLL038C Chr12 complement(65775..66518) [744 bp, 247 aa] {ON}  EN...    43   9e-04
Smik_12.19 Chr12 complement(50134..50877) [744 bp, 247 aa] {ON} ...    42   0.002
KNAG0J02870 Chr10 (549107..550096) [990 bp, 329 aa] {ON} Anc_4.1...    42   0.003
NDAI0H00280 Chr8 complement(48177..49109) [933 bp, 310 aa] {ON} ...    42   0.003
YHR161C Chr8 complement(420373..422286) [1914 bp, 637 aa] {ON}  ...    39   0.021
SAKL0H02530g Chr8 (250148..252157) [2010 bp, 669 aa] {ON} weakly...    38   0.065
Skud_8.225 Chr8 complement(391820..393685) [1866 bp, 621 aa] {ON...    37   0.078
KLLA0D16654g Chr4 complement(1413507..1414706) [1200 bp, 399 aa]...    37   0.13 
Smik_8.245 Chr8 complement(397342..399225) [1884 bp, 627 aa] {ON...    35   0.29 
NCAS0B03660 Chr2 complement(653627..654877) [1251 bp, 416 aa] {O...    34   0.66 
KLLA0A05522g Chr1 (507778..509481) [1704 bp, 567 aa] {ON} simila...    33   1.2  
CAGL0E01199g Chr5 (108041..109279) [1239 bp, 412 aa] {ON} simila...    33   1.5  
Kpol_344.8 s344 complement(20765..21919) [1155 bp, 384 aa] {ON} ...    32   2.7  
ZYRO0F13684g Chr6 complement(1125731..1126954) [1224 bp, 407 aa]...    32   3.7  
KAFR0K01560 Chr11 (324725..327784) [3060 bp, 1019 aa] {ON} Anc_3...    32   5.7  
Kwal_YGOB_27.11261 s27 complement(716644..717033,717035..717859)...    31   6.2  
KLTH0G11902g Chr7 (1002588..1003787) [1200 bp, 399 aa] {ON} simi...    31   7.0  
NDAI0J00930 Chr10 (209579..210835) [1257 bp, 418 aa] {ON} Anc_8....    30   9.5  

>Smik_4.75 Chr4 (144483..145865) [1383 bp, 460 aa] {ON} YDL161W
           (REAL)
          Length = 460

 Score =  672 bits (1734), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 344/460 (74%), Positives = 344/460 (74%)

Query: 1   MSKQFVRSAKNLVKGYSSTQVLVRNATSNDNHQVSKDSLIELAEKSYDSADFFEIMDMLD 60
           MSKQFVRSAKNLVKGYSSTQVLVRNATSNDNHQVSKDSLIELAEKSYDSADFFEIMDMLD
Sbjct: 1   MSKQFVRSAKNLVKGYSSTQVLVRNATSNDNHQVSKDSLIELAEKSYDSADFFEIMDMLD 60

Query: 61  KRLNDKGKYWRHIAKALTVLDYLIRFGSENCVLWCKENLYIIKTLKEFRHEDDEGIDQGQ 120
           KRLNDKGKYWRHIAKALTVLDYLIRFGSENCVLWCKENLYIIKTLKEFRHEDDEGIDQGQ
Sbjct: 61  KRLNDKGKYWRHIAKALTVLDYLIRFGSENCVLWCKENLYIIKTLKEFRHEDDEGIDQGQ 120

Query: 121 IVRVKSKELTALLSDDERLNEERNMNIXXXXXXXXXXXXXXXXXXDNDNDLQRALDASRM 180
           IVRVKSKELTALLSDDERLNEERNMNI                  DNDNDLQRALDASRM
Sbjct: 121 IVRVKSKELTALLSDDERLNEERNMNIKGRNRKGRSRRGTGRSSNDNDNDLQRALDASRM 180

Query: 181 TAXXXXXXXXXXXXXXTALQLSKEEEELKRXXXXXXXXXXXXXXXXXPMYYDIFGNPITP 240
           TA              TALQLSKEEEELKR                 PMYYDIFGNPITP
Sbjct: 181 TAEEDEKRRKMDEDYETALQLSKEEEELKRLQDLQRMQQLQTQQQQQPMYYDIFGNPITP 240

Query: 241 EEYAQFXXXXXXXXXXXXXXXXXPLYYDVFGNPITPEELAXXXXXXXXXXXXXXXXXXXX 300
           EEYAQF                 PLYYDVFGNPITPEELA                    
Sbjct: 241 EEYAQFQLQQQQQLQQQQLQQQQPLYYDVFGNPITPEELAQFQQQQQQQQQQQQQYLASV 300

Query: 301 XXXXXGIPNNPFSKSEQKSGIEEQGQSSTVDSSMXXXXXXXXXXEPLTQTRTGNQSMTDK 360
                GIPNNPFSKSEQKSGIEEQGQSSTVDSSM          EPLTQTRTGNQSMTDK
Sbjct: 301 QQQQQGIPNNPFSKSEQKSGIEEQGQSSTVDSSMQQQQQQQKQQEPLTQTRTGNQSMTDK 360

Query: 361 YNKLNELLATGTGIDTFGNVGDARVPAQHTKTGTFINSQGTGYKQVSNDPKYNPFLSGQY 420
           YNKLNELLATGTGIDTFGNVGDARVPAQHTKTGTFINSQGTGYKQVSNDPKYNPFLSGQY
Sbjct: 361 YNKLNELLATGTGIDTFGNVGDARVPAQHTKTGTFINSQGTGYKQVSNDPKYNPFLSGQY 420

Query: 421 TGLPSTNVVPTQTGYGFGXXXXXXXXXXXXXXXGYALIDL 460
           TGLPSTNVVPTQTGYGFG               GYALIDL
Sbjct: 421 TGLPSTNVVPTQTGYGFGNQPQQQSQNNHLNNQGYALIDL 460

>Skud_4.94 Chr4 (163372..164715) [1344 bp, 447 aa] {ON} YDL161W
           (REAL)
          Length = 447

 Score =  584 bits (1505), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 310/462 (67%), Positives = 326/462 (70%), Gaps = 17/462 (3%)

Query: 1   MSKQFVRSAKNLVKGYSSTQVLVRNATSNDNHQVSKDSLIELAEKSYDSADFFEIMDMLD 60
           MSKQFVRSAKNLVKGYSSTQVLVRNATSNDNHQVSKDSLIELAEKSYDSADFFEIMDMLD
Sbjct: 1   MSKQFVRSAKNLVKGYSSTQVLVRNATSNDNHQVSKDSLIELAEKSYDSADFFEIMDMLD 60

Query: 61  KRLNDKGKYWRHIAKALTVLDYLIRFGSENCVLWCKENLYIIKTLKEFRHEDDEGIDQGQ 120
           KRLNDKGKYWRHIAKALTVLDYLIRFGSENCVLWCKENLYIIKTLKEFRHEDDEG+DQGQ
Sbjct: 61  KRLNDKGKYWRHIAKALTVLDYLIRFGSENCVLWCKENLYIIKTLKEFRHEDDEGVDQGQ 120

Query: 121 IVRVKSKELTALLSDDERLNEERNMNIXXXXXXXXXXXXXXXXXXDNDNDLQRALDASRM 180
           IVRVK+KELT LLSDDERLNEERNMNI                  D D+DLQRA+DASRM
Sbjct: 121 IVRVKAKELTTLLSDDERLNEERNMNIKGRSRKGRKRRGTGRNDED-DDDLQRAIDASRM 179

Query: 181 TAXXXXXXXXXXXXXXTALQLSKEEEELKR-XXXXXXXXXXXXXXXXXPMYYDIFGNPIT 239
           TA              TALQLSKEEEELKR                  PMYYDIFGNPIT
Sbjct: 180 TAEEDERRRKQDEDYETALQLSKEEEELKRLQDLQRMQQVHAQQQQQQPMYYDIFGNPIT 239

Query: 240 PEEYAQFXXXXXXXXXXXXXXXXXPLYYDVFGNPITPEELAXXXXXXXXXXXXXXXXXXX 299
           PEEYAQF                  +YYDVFGNPI+PEELA                   
Sbjct: 240 PEEYAQFQLQQQQQQLQQQQQQQEAMYYDVFGNPISPEELAHFQQQQYIASLQQQQQ--- 296

Query: 300 XXXXXXGIP-NNPFSKSEQKSGIEEQGQSSTVDSSMXXXXXXXXXXEPLTQTRTGNQSMT 358
                  +P NNPF+K  Q+   ++Q QS    SSM          +PLTQTRTGNQSMT
Sbjct: 297 -------VPSNNPFAKPNQEVTSQKQDQSFMASSSM----QQQQQQQPLTQTRTGNQSMT 345

Query: 359 DKYNKLNELLATGTGIDTFGNVGDARVPAQHTKTGTFINSQGTGYKQVSNDPKYNPFLSG 418
           DKY KLNELLATGTGIDTFGNVGD+RVPAQHTKTGTFINSQGTGY+QVSNDPK NPFL+ 
Sbjct: 346 DKYGKLNELLATGTGIDTFGNVGDSRVPAQHTKTGTFINSQGTGYRQVSNDPKQNPFLNS 405

Query: 419 QYTGLPSTNVVPTQTGYGFGXXXXXXXXXXXXXXXGYALIDL 460
           QYTGLPSTN+VPTQTGYGFG               GY LIDL
Sbjct: 406 QYTGLPSTNIVPTQTGYGFGNQPQQQSQNNRSNSQGYTLIDL 447

>Suva_4.83 Chr4 (155278..156666) [1389 bp, 462 aa] {ON} YDL161W
           (REAL)
          Length = 462

 Score =  558 bits (1439), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 302/469 (64%), Positives = 320/469 (68%), Gaps = 16/469 (3%)

Query: 1   MSKQFVRSAKNLVKGYSSTQVLVRNATSNDNHQVSKDSLIELAEKSYDSADFFEIMDMLD 60
           MSKQ VRSAKNLVKGYSSTQVLVRNATSNDN+QVSKDSLIELAEKSYDSADFFEIMDMLD
Sbjct: 1   MSKQLVRSAKNLVKGYSSTQVLVRNATSNDNNQVSKDSLIELAEKSYDSADFFEIMDMLD 60

Query: 61  KRLNDKGKYWRHIAKALTVLDYLIRFGSENCVLWCKENLYIIKTLKEFRHEDDEGIDQGQ 120
           KRLNDKGKYWRHIAKALTVLDYLIRFGSENCVLWCKENLYIIKTLKEFRH+DDEG DQGQ
Sbjct: 61  KRLNDKGKYWRHIAKALTVLDYLIRFGSENCVLWCKENLYIIKTLKEFRHDDDEGTDQGQ 120

Query: 121 IVRVKSKELTALLSDDERLNEERNMNIXXXXXXXXXXXXXXXXXXDNDNDLQRALDASRM 180
           IVRVK+KELT+LLSD+ERLNEERNMNI                  D D+DLQRA+DASRM
Sbjct: 121 IVRVKAKELTSLLSDEERLNEERNMNIKGRNRGGRRRRRTNRSSED-DDDLQRAIDASRM 179

Query: 181 TAXXXXXXXXXXXXXXTALQLSKEEEELKR-XXXXXXXXXXXXXXXXXPMYYDIFGNPIT 239
           TA              TALQLSKEEEELKR                  PMY DIFGNPIT
Sbjct: 180 TADEDERRRKQDEDYETALQLSKEEEELKRLQDLQRIQAQQQQQQQQQPMYCDIFGNPIT 239

Query: 240 PEEYA---QFXXXXXXXXXXXXXXXXXPLYYDVFGNPITPEELAXXXXXXXXXXXXXXXX 296
           PEEYA                      P+YYD+FGNPI+PEELA                
Sbjct: 240 PEEYAQFQLEQQQQQLLQLQQQQQQQQPMYYDMFGNPISPEELA------QFQQEQQQQL 293

Query: 297 XXXXXXXXXGIPNNPFSKSEQKSGIEEQGQSSTVDSSM-----XXXXXXXXXXEPLTQTR 351
                       NNPF+K  Q++  + Q Q S   SSM               EPLTQTR
Sbjct: 294 YLSSLQQQQATSNNPFAKPNQEASPQRQDQPSMNTSSMPQQQQQQQQQQQQQQEPLTQTR 353

Query: 352 TGNQSMTDKYNKLNELLATGTGIDTFGNVGDARVPAQHTKTGTFINSQGTGYKQVSNDPK 411
           TGNQSMTDKY+KLNELL TGTGIDTFGN GD RVPAQHTKTGTFINSQGTGY+QVSNDPK
Sbjct: 354 TGNQSMTDKYSKLNELLGTGTGIDTFGNFGDTRVPAQHTKTGTFINSQGTGYRQVSNDPK 413

Query: 412 YNPFLSGQYTGLPSTNVVPTQTGYGFGXXXXXXXXXXXXXXXGYALIDL 460
           +NPFL+ QYTGLPSTNVVP QTGYGFG               GYALIDL
Sbjct: 414 HNPFLNSQYTGLPSTNVVPAQTGYGFGNQPQQQSQTNGTNSQGYALIDL 462

>YDL161W Chr4 (167714..169078) [1365 bp, 454 aa] {ON}
           ENT1Epsin-like protein involved in endocytosis and actin
           patch assembly and functionally redundant with Ent2p;
           binds clathrin via a clathrin-binding domain motif at
           C-terminus
          Length = 454

 Score =  554 bits (1428), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 304/461 (65%), Positives = 324/461 (70%), Gaps = 8/461 (1%)

Query: 1   MSKQFVRSAKNLVKGYSSTQVLVRNATSNDNHQVSKDSLIELAEKSYDSADFFEIMDMLD 60
           MSKQFVRSAKNLVKGYSSTQVLVRNATSNDNHQVSKDSLIELAEKSYDSADFFEIMDMLD
Sbjct: 1   MSKQFVRSAKNLVKGYSSTQVLVRNATSNDNHQVSKDSLIELAEKSYDSADFFEIMDMLD 60

Query: 61  KRLNDKGKYWRHIAKALTVLDYLIRFGSENCVLWCKENLYIIKTLKEFRHEDDEGIDQGQ 120
           KRLNDKGKYWRHIAKALTV+DYLIRFGSENCVLWC+ENLYIIKTLKEFRHEDDEGIDQGQ
Sbjct: 61  KRLNDKGKYWRHIAKALTVIDYLIRFGSENCVLWCRENLYIIKTLKEFRHEDDEGIDQGQ 120

Query: 121 IVRVKSKELTALLSDDERLNEERNMNIXXXXXXXXXXXXXXXXXXDNDNDLQRALDASRM 180
           IVRVK+KELTALLSDDERLNEERNMNI                  +ND+DLQRA+ ASR+
Sbjct: 121 IVRVKAKELTALLSDDERLNEERNMNI-KGRNRKGRRRRGTGRSDENDDDLQRAISASRL 179

Query: 181 TAXXXXXXXXXXXXXXTALQLSKEEEELKR-XXXXXXXXXXXXXXXXXPMYYDIFGNPIT 239
           TA              TALQLSKEEEELKR                  PMYYDIFGNPIT
Sbjct: 180 TAEEDERRRKQDEDYETALQLSKEEEELKRLQDLQRMQQQQGQQQLQQPMYYDIFGNPIT 239

Query: 240 PEEYAQFXXXXXXXXXXXXXXXXXPLYYDVFGNPITPEELAXXXXXXXXXXXXXXXXXXX 299
           PEEYAQ                  P+YYDVFGNPITPEELA                   
Sbjct: 240 PEEYAQ-FQLQQQQQQQQQQLQQQPMYYDVFGNPITPEELAQFQQQQQLQEQQYLASMQQ 298

Query: 300 XXXXXXGIPNNPFSKSEQKSGIEEQGQSSTVDSSMXXXXXXXXXXEPLTQTRTGNQSMTD 359
                    NNPF+KSEQ S   ++ Q   V +S           EPL Q RTGNQSMTD
Sbjct: 299 QQQAMS---NNPFAKSEQSSSSPKRNQ--LVAASSPQQLQQQKQQEPLIQNRTGNQSMTD 353

Query: 360 KYNKLNELLATGTGIDTFGNVGDARVPAQHTKTGTFINSQGTGYKQVSNDPKYNPFLSGQ 419
           KY+KLNELLATGTGIDTFGNVG+AR+PAQHTKTGTFINSQGTGY+QVS+DP +NPFL+ Q
Sbjct: 354 KYSKLNELLATGTGIDTFGNVGEARIPAQHTKTGTFINSQGTGYRQVSDDPNHNPFLNSQ 413

Query: 420 YTGLPSTNVVPTQTGYGFGXXXXXXXXXXXXXXXGYALIDL 460
           YTGLPST+VVPTQTGYGFG               GY LIDL
Sbjct: 414 YTGLPSTSVVPTQTGYGFGNQSQQQSQNNGSNNRGYTLIDL 454

>TDEL0C02050 Chr3 (355071..356576) [1506 bp, 501 aa] {ON} Anc_7.342
           YLR206W
          Length = 501

 Score =  298 bits (764), Expect = 1e-95,   Method: Compositional matrix adjust.
 Identities = 155/247 (62%), Positives = 174/247 (70%), Gaps = 5/247 (2%)

Query: 1   MSKQFVRSAKNLVKGYSSTQVLVRNATSNDNHQVSKDSLIELAEKSYDSADFFEIMDMLD 60
           MSKQFVRSAKN+VKGYSS QVLVRNAT+N++   S D L ELAEK+YDS +FFEIMDM+D
Sbjct: 1   MSKQFVRSAKNVVKGYSSAQVLVRNATANESEGPSVDELDELAEKTYDSVEFFEIMDMID 60

Query: 61  KRLNDKGKYWRHIAKALTVLDYLIRFGSENCVLWCKENLYIIKTLKEFRHEDDEGIDQGQ 120
           KRLNDKGKYWRHIAK+LTVLDYL+RFGSENCVLWC+ENLY+IKTL EFR++DD G+DQGQ
Sbjct: 61  KRLNDKGKYWRHIAKSLTVLDYLVRFGSENCVLWCRENLYVIKTLMEFRNDDDGGVDQGQ 120

Query: 121 IVRVKSKELTALLSDDERLNEERNMNIXXXXXXXXXXXXXXXXXXDNDNDLQRALDASRM 180
           I+RVK+KELT LLSDDERL EER MN                     D+DLQRALD SR+
Sbjct: 121 IIRVKAKELTNLLSDDERLREEREMNRKGRKNGTRRRRRTTGEQDGFDDDLQRALDESRL 180

Query: 181 TAXXXXXXXXXXXXX----XTALQLSKEEEELKRXXXXXXXXXXXXXXXXXPMYYDIFGN 236
           TA                   ALQLSKEEEELKR                   YYDIFGN
Sbjct: 181 TAEEDERRRKMLGSEDDDLQAALQLSKEEEELKRLQEMQKLQQQQTQQQPS-QYYDIFGN 239

Query: 237 PITPEEY 243
           PI+PEEY
Sbjct: 240 PISPEEY 246

 Score =  154 bits (388), Expect = 8e-41,   Method: Compositional matrix adjust.
 Identities = 67/89 (75%), Positives = 79/89 (88%)

Query: 350 TRTGNQSMTDKYNKLNELLATGTGIDTFGNVGDARVPAQHTKTGTFINSQGTGYKQVSND 409
            RTG+ +MT+KY +LN+LLATGTGIDTFGN GDAR+PAQHTKTGTFINSQGTGY+QV+ +
Sbjct: 389 VRTGDLAMTEKYGELNKLLATGTGIDTFGNTGDARIPAQHTKTGTFINSQGTGYRQVTGE 448

Query: 410 PKYNPFLSGQYTGLPSTNVVPTQTGYGFG 438
           PK NPFL  QYTG+PS+N+VP  TGYGFG
Sbjct: 449 PKKNPFLQSQYTGIPSSNIVPAHTGYGFG 477

>KNAG0C03800 Chr3 (746891..748234) [1344 bp, 447 aa] {ON} Anc_7.342
           YLR206W
          Length = 447

 Score =  275 bits (702), Expect = 4e-87,   Method: Compositional matrix adjust.
 Identities = 136/244 (55%), Positives = 170/244 (69%), Gaps = 5/244 (2%)

Query: 5   FVRSAKNLVKGYSSTQVLVRNATSNDNHQVSKDSLIELAEKSYDSADFFEIMDMLDKRLN 64
            +RSAKN+VKGYS T+VLVR+AT+N++   S++ L +LA+KSY+S +FFEI+DMLDKR+N
Sbjct: 1   MLRSAKNIVKGYSDTEVLVRDATANNSTNPSRELLDDLADKSYNSVEFFEILDMLDKRIN 60

Query: 65  DKGKYWRHIAKALTVLDYLIRFGSENCVLWCKENLYIIKTLKEFRHEDDEGIDQGQIVRV 124
           DKGKYWRH+AKALTVLDYL+RFGSENCV+WC+ENLYIIKTL+EF HED  G D+G+I+RV
Sbjct: 61  DKGKYWRHVAKALTVLDYLVRFGSENCVIWCQENLYIIKTLREFSHEDAGGEDEGKIIRV 120

Query: 125 KSKELTALLSDDERLNEERNMNIXXXXXXXXXXXXXXXXXXDNDNDLQRALDASRMTAXX 184
           K+KELT+LL D+ERL EER MNI                   +D DLQRA++ S+ TA  
Sbjct: 121 KAKELTSLLMDEERLKEERAMNIRRRGGPKRRSGGSRERNNRSDEDLQRAIEESKRTAEE 180

Query: 185 XXXX----XXXXXXXXTALQLSKEEEELKR-XXXXXXXXXXXXXXXXXPMYYDIFGNPIT 239
                            ALQLS+EEE+L+R                  PMYYD+FGNPIT
Sbjct: 181 EERRRRNGASSEADRQAALQLSREEEDLRRLQEQARLAQQQQQQQQQQPMYYDVFGNPIT 240

Query: 240 PEEY 243
           PEEY
Sbjct: 241 PEEY 244

 Score =  168 bits (426), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 79/130 (60%), Positives = 100/130 (76%), Gaps = 3/130 (2%)

Query: 309 NNPFSKSEQKSGIEEQGQSSTVDSSMXXXXXXXXXXEPLTQTRTGNQSMTDKYNKLNELL 368
           NNPF+ +   +  +    +ST  +            +PLTQTR+GNQ+++DKY+ LN LL
Sbjct: 300 NNPFALN---NATQPSAPASTTAARPAAIETPATQTKPLTQTRSGNQAISDKYSALNNLL 356

Query: 369 ATGTGIDTFGNVGDARVPAQHTKTGTFINSQGTGYKQVSNDPKYNPFLSGQYTGLPSTNV 428
           A+GTGIDTFGN G+ R+PAQHT+TGTFINSQGTGY+QV+ND K NPFL+GQYTGLPSTN+
Sbjct: 357 ASGTGIDTFGNTGEQRIPAQHTQTGTFINSQGTGYRQVNNDDKPNPFLNGQYTGLPSTNI 416

Query: 429 VPTQTGYGFG 438
           VPTQTG+GFG
Sbjct: 417 VPTQTGFGFG 426

>NCAS0H00670 Chr8 (117595..119046) [1452 bp, 483 aa] {ON} Anc_7.342
          Length = 483

 Score =  271 bits (694), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 153/256 (59%), Positives = 176/256 (68%), Gaps = 13/256 (5%)

Query: 1   MSKQFVRSAKNLVKGYSSTQVLVRNATSNDNHQVSKDSLIELAEKSYDSADFFEIMDMLD 60
           MSKQFVRSAKN+VKGYS+TQVLVR+ATSND    S + L ELA++S+DS DFFEIMDMLD
Sbjct: 1   MSKQFVRSAKNMVKGYSTTQVLVRDATSNDASNPSFELLYELAQRSFDSVDFFEIMDMLD 60

Query: 61  KRLNDKGKYWRHIAKALTVLDYLIRFGSENCVLWCKENLYIIKTLKEFRHEDDEGIDQGQ 120
           KRLNDKGKYWRH+AK+LTVLDYL+RFGSENCVLWCKENLYIIKTL+EFRHEDD G DQGQ
Sbjct: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCKENLYIIKTLREFRHEDDGGADQGQ 120

Query: 121 IVRVKSKELTALLSDDERLNEERNMNIXXX-----XXXXXXXXXXXXXXXDNDND-LQRA 174
           I+RVK+KELT+LL D+ERL EER +N+                       D D D LQRA
Sbjct: 121 IIRVKAKELTSLLLDEERLKEERTINLKNRRDGDMKGRRRRRGTRNGRGNDEDQDELQRA 180

Query: 175 LDASRMTAXXXXXXXXXXXX-------XXTALQLSKEEEELKRXXXXXXXXXXXXXXXXX 227
           L+ SR+TA                     TALQLSKEEEELK+                 
Sbjct: 181 LEESRLTAEEDERRRRQMAQYDDQDPDLQTALQLSKEEEELKKLQEMQRLQQQQGQMNQP 240

Query: 228 PMYYDIFGNPITPEEY 243
             Y+DIFGNPI+P+EY
Sbjct: 241 QGYFDIFGNPISPDEY 256

 Score =  162 bits (409), Expect = 7e-44,   Method: Compositional matrix adjust.
 Identities = 78/115 (67%), Positives = 90/115 (78%), Gaps = 4/115 (3%)

Query: 350 TRTGNQSMTDKYNKLNELLATGTGIDTFGNVGDARVPAQHTKTGTFINSQGTGYKQVSND 409
           TRTGNQS+TDKY++LN LLATGTGIDTFGN G+ R+PAQHT+TGTFINSQGTGY+QV+ND
Sbjct: 369 TRTGNQSITDKYSQLNTLLATGTGIDTFGNTGEQRIPAQHTQTGTFINSQGTGYRQVTND 428

Query: 410 PKYNPFLSGQYTGLPSTNVVPTQTGYGFGXXXXXXXXXXXXXX----XGYALIDL 460
           PK NPFL+ QYTGLPSTN+V TQTGYGFG                   G++LIDL
Sbjct: 429 PKNNPFLNSQYTGLPSTNIVSTQTGYGFGNAPSQQQQQQQQQQQRPDQGFSLIDL 483

>SAKL0F10934g Chr6 (856966..858462) [1497 bp, 498 aa] {ON} some
           similarities with uniprot|Q12518 Saccharomyces
           cerevisiae YDL161W ENT1
          Length = 498

 Score =  270 bits (689), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 145/252 (57%), Positives = 171/252 (67%), Gaps = 11/252 (4%)

Query: 1   MSKQFVRSAKNLVKGYSSTQVLVRNATSNDNHQVSKDSLIELAEKSYDSADFFEIMDMLD 60
           MSK  +R+AKN+V GYSS QVLVRNATSN+    + D L ELAEK+YD+ +FFEIMDMLD
Sbjct: 1   MSKALLRTAKNVVNGYSSVQVLVRNATSNEPTGPTVDQLDELAEKTYDNVEFFEIMDMLD 60

Query: 61  KRLNDKGKYWRHIAKALTVLDYLIRFGSENCVLWCKENLYIIKTLKEFRHEDDEGIDQGQ 120
           KRLNDKGK WRH+AK+LTVLDYL+R+GSENCVLW +ENLYIIKTL+EF HED+ G+D GQ
Sbjct: 61  KRLNDKGKNWRHVAKSLTVLDYLVRYGSENCVLWSQENLYIIKTLREFMHEDEMGVDHGQ 120

Query: 121 IVRVKSKELTALLSDDERLNEERNMNIXXXXXXXXXXXXXXXXXXDNDNDLQRALDASRM 180
           I+RVK+KELT+LL D+ERL EERNM                    + D+DLQRAL+ SR+
Sbjct: 121 IIRVKAKELTSLLRDEERLTEERNM--RKKRRGKTRRPERSRGGEEYDDDLQRALEESRL 178

Query: 181 TAXXXXXXXXXXXXX------XTALQLSKEEEELKRXXX---XXXXXXXXXXXXXXPMYY 231
           TA                    TALQLSKEEEEL+R                    PMYY
Sbjct: 179 TAEEEERRRRTDSGSNDDDDFQTALQLSKEEEELRRLRNLQMQQQQTAMFQQQQQQPMYY 238

Query: 232 DIFGNPITPEEY 243
           D+FGNPITPEEY
Sbjct: 239 DVFGNPITPEEY 250

 Score =  150 bits (379), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 70/93 (75%), Positives = 80/93 (86%), Gaps = 1/93 (1%)

Query: 347 LTQTRTGNQSMTDKYNKLNELLATGTGIDTFGNVGDARVPAQHTKTGTFINSQGTGYKQV 406
           L  TRTGNQS++ KYN LN LLA+GTG+DTFGN G  R+PAQHT+TG FINSQGTGYKQV
Sbjct: 371 LNPTRTGNQSISQKYNDLNNLLASGTGLDTFGNTGQTRIPAQHTRTGNFINSQGTGYKQV 430

Query: 407 SND-PKYNPFLSGQYTGLPSTNVVPTQTGYGFG 438
           +ND PK NPFL+ QYTGLPST+VVP+ TGYGFG
Sbjct: 431 TNDQPKNNPFLAAQYTGLPSTSVVPSYTGYGFG 463

 Score = 34.3 bits (77), Expect = 0.70,   Method: Compositional matrix adjust.
 Identities = 13/13 (100%), Positives = 13/13 (100%)

Query: 266 YYDVFGNPITPEE 278
           YYDVFGNPITPEE
Sbjct: 237 YYDVFGNPITPEE 249

>CAGL0A03872g Chr1 complement(392922..394454) [1533 bp, 510 aa] {ON}
           highly similar to uniprot|Q05785 Saccharomyces
           cerevisiae YLR206w ENT2
          Length = 510

 Score =  269 bits (688), Expect = 3e-84,   Method: Compositional matrix adjust.
 Identities = 143/254 (56%), Positives = 170/254 (66%), Gaps = 14/254 (5%)

Query: 1   MSKQFVRSAKNLVKGYSSTQVLVRNATSNDNHQVSKDSLIELAEKSYDSADFFEIMDMLD 60
           M  Q VRSAKN+VKGYSSTQV+VR+AT+ND+   S   L +LA+K+YD+ +FFEIMDMLD
Sbjct: 1   MPSQLVRSAKNMVKGYSSTQVMVRDATANDSTSPSVGVLEDLADKTYDTVEFFEIMDMLD 60

Query: 61  KRLNDKGKYWRHIAKALTVLDYLIRFGSENCVLWCKENLYIIKTLKEFRHEDD-EGIDQG 119
           KRLNDKGKYWRH+AK+LTVLDYL+RFGSENCVLWCKENLYIIKTL+EFRHED+  G D+G
Sbjct: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCKENLYIIKTLREFRHEDEVSGSDEG 120

Query: 120 QIVRVKSKELTALLSDDERLNEERNMNIXXXXXXXXXXXXXXXXXXDN------DNDLQR 173
           QI+RVK+KELT+LL+DDERL EER +N                           D+DLQ+
Sbjct: 121 QIIRVKAKELTSLLTDDERLREERALNRANRRNGDAKRRRRRSRSRSTSYRNAYDDDLQK 180

Query: 174 ALDASRMTAXXXXXXXXXXXXXX-------TALQLSKEEEELKRXXXXXXXXXXXXXXXX 226
           AL+ SRMTA                      ALQLSKEEEELK+                
Sbjct: 181 ALEESRMTAEEEEARRREQAQYENQDPDLLAALQLSKEEEELKKLQDMQRMQELQAQQQQ 240

Query: 227 XPMYYDIFGNPITP 240
             +YYDIFGNPI+P
Sbjct: 241 QNVYYDIFGNPISP 254

 Score =  164 bits (416), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 73/90 (81%), Positives = 85/90 (94%)

Query: 349 QTRTGNQSMTDKYNKLNELLATGTGIDTFGNVGDARVPAQHTKTGTFINSQGTGYKQVSN 408
           +TRTGNQS++DKY++LN LLA+GTGIDTFGN G+AR+PAQHTKTGTFINSQGTGYKQV+N
Sbjct: 360 KTRTGNQSISDKYSELNNLLASGTGIDTFGNTGEARIPAQHTKTGTFINSQGTGYKQVTN 419

Query: 409 DPKYNPFLSGQYTGLPSTNVVPTQTGYGFG 438
           +PK NPFLS QYTGLPSTN+VP+ TGYGFG
Sbjct: 420 EPKNNPFLSSQYTGLPSTNIVPSHTGYGFG 449

>ZYRO0F11550g Chr6 complement(947131..948747) [1617 bp, 538 aa] {ON}
           some similarities with uniprot|Q12518 Saccharomyces
           cerevisiae YDL161W ENT1
          Length = 538

 Score =  265 bits (678), Expect = 2e-82,   Method: Compositional matrix adjust.
 Identities = 142/246 (57%), Positives = 164/246 (66%), Gaps = 7/246 (2%)

Query: 1   MSKQFVRSAKNLVKGYSSTQVLVRNATSNDNHQVSKDSLIELAEKSYDSADFFEIMDMLD 60
           M  QFVRSAKN +KGY+S QVLVR+AT+N+    S D L ELA +SYDS +FFEIMDM+D
Sbjct: 1   MPTQFVRSAKNALKGYTSAQVLVRDATANEVEGPSVDMLDELAHRSYDSVEFFEIMDMID 60

Query: 61  KRLNDKGKYWRHIAKALTVLDYLIRFGSENCVLWCKENLYIIKTLKEFRHEDDEGIDQGQ 120
           KRLNDKGKYWRH+AK+LTVLDYL+RFGSENCVLWC+ENLYIIKTL+EFRH+DD   D GQ
Sbjct: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCRENLYIIKTLREFRHDDDGTQDGGQ 120

Query: 121 IVRVKSKELTALLSDDERLNEERNMNIXXXXXXXXXXXXXXXXXXDNDNDLQRALDASRM 180
           I+RVK+KELT LL DDERL  ER  +                     D+++QRALDASR+
Sbjct: 121 IIRVKAKELTNLLMDDERLRMERGED-KGAPPRMMSPSPPTPRRNSYDSEMQRALDASRL 179

Query: 181 TAXXXXXXXXXXXXX----XTALQLSKEEEELKR-XXXXXXXXXXXXXXXXXPM-YYDIF 234
           TA                  TALQLSKEEEELKR                  P  YYDIF
Sbjct: 180 TAEEDERRRKTLNNEDADLETALQLSKEEEELKRLQELQKAQQDQQRLSQMQPQGYYDIF 239

Query: 235 GNPITP 240
           GNPI+P
Sbjct: 240 GNPISP 245

 Score =  156 bits (394), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 68/94 (72%), Positives = 83/94 (88%)

Query: 345 EPLTQTRTGNQSMTDKYNKLNELLATGTGIDTFGNVGDARVPAQHTKTGTFINSQGTGYK 404
           +P+   RTGNQS++DKYN LN+LLA  TG+DTFGNVGDAR+PAQHTKTGTFINSQGTG+K
Sbjct: 418 QPMQPVRTGNQSISDKYNDLNQLLAQPTGVDTFGNVGDARIPAQHTKTGTFINSQGTGFK 477

Query: 405 QVSNDPKYNPFLSGQYTGLPSTNVVPTQTGYGFG 438
           Q SN+PK NPFL  Q+TG+P+++VVP+ TGYGFG
Sbjct: 478 QYSNEPKKNPFLPTQFTGIPTSSVVPSHTGYGFG 511

>TPHA0D04560 Chr4 complement(994552..996015) [1464 bp, 487 aa] {ON}
           Anc_7.342 YLR206W
          Length = 487

 Score =  263 bits (671), Expect = 5e-82,   Method: Compositional matrix adjust.
 Identities = 144/247 (58%), Positives = 165/247 (66%), Gaps = 12/247 (4%)

Query: 1   MSKQFVRSAKNLVKGYSSTQVLVRNATSNDNHQVSKDSLIELAEKSYDSADFFEIMDMLD 60
           MS QFVRS KN+VKGYSSTQVLVRNAT+N+    + D L ++AEK+YDSADFFEIMDMLD
Sbjct: 1   MSNQFVRSMKNVVKGYSSTQVLVRNATANEGTGPNIDLLADIAEKTYDSADFFEIMDMLD 60

Query: 61  KRLNDKGKYWRHIAKALTVLDYLIRFGSENCVLWCKENLYIIKTLKEFRHEDDE--GIDQ 118
           KRLNDKGKYW+HIAK+LTVLDYL+RFGSENCVLWCKENLY+IKTL EFR+ED+   G+DQ
Sbjct: 61  KRLNDKGKYWKHIAKSLTVLDYLVRFGSENCVLWCKENLYLIKTLTEFRYEDENSGGVDQ 120

Query: 119 GQIVRVKSKELTALLSDDERLNEERNMNIXXXXXXXXXXXXXXXXXXDNDNDLQRALDAS 178
           GQI+RVK+KELTALL DD    E                         +D DLQRAL+ S
Sbjct: 121 GQIIRVKAKELTALLMDD----ERLREERRLNNRRDRNRNRRPPARNGSDEDLQRALEES 176

Query: 179 RMTAXXXXXXXXXX---XXXXTALQLSKEEEELKRXXXXXXXXXXXXXXXXXPMYYDIFG 235
           R TA                  ALQLSKEEEELKR                 P+YYD+FG
Sbjct: 177 RRTAEEDERKRRLNQDDSDLQAALQLSKEEEELKR---LQELQSSMHMQQQQPVYYDVFG 233

Query: 236 NPITPEE 242
           NPI+ EE
Sbjct: 234 NPISYEE 240

 Score =  153 bits (387), Expect = 8e-41,   Method: Compositional matrix adjust.
 Identities = 67/88 (76%), Positives = 80/88 (90%)

Query: 351 RTGNQSMTDKYNKLNELLATGTGIDTFGNVGDARVPAQHTKTGTFINSQGTGYKQVSNDP 410
           RTGN+ MT+KYN+LN+LLA+GTGIDTFGN G+ R+PAQHT+TGTFINSQGTGY+Q S + 
Sbjct: 375 RTGNKEMTNKYNELNQLLASGTGIDTFGNTGETRIPAQHTQTGTFINSQGTGYRQQSGES 434

Query: 411 KYNPFLSGQYTGLPSTNVVPTQTGYGFG 438
           K NPFLS QYTGLPS+N++PTQTGYGFG
Sbjct: 435 KVNPFLSNQYTGLPSSNIIPTQTGYGFG 462

>Kpol_2001.70 s2001 complement(192214..193815) [1602 bp, 533 aa]
           {ON} complement(192214..193815) [1602 nt, 534 aa]
          Length = 533

 Score =  264 bits (674), Expect = 7e-82,   Method: Compositional matrix adjust.
 Identities = 145/245 (59%), Positives = 170/245 (69%), Gaps = 10/245 (4%)

Query: 1   MSKQFVRSAKNLVKGYSSTQVLVRNATSNDNHQVSKDSLIELAEKSYDSADFFEIMDMLD 60
           M KQFVRSAKN+VKGYSSTQV+VRNATSND+     D+L  LAEK+YDS +FFEIMDMLD
Sbjct: 1   MPKQFVRSAKNVVKGYSSTQVMVRNATSNDSGGPDIDTLDALAEKTYDSVEFFEIMDMLD 60

Query: 61  KRLNDKGKYWRHIAKALTVLDYLIRFGSENCVLWCKENLYIIKTLKEFRHEDDEGIDQGQ 120
           KRLNDKGKYW+HIAK+LTVLDYL+RFGSENCVLWCKENLYII+TLKEF + DD   DQGQ
Sbjct: 61  KRLNDKGKYWKHIAKSLTVLDYLVRFGSENCVLWCKENLYIIQTLKEFSYIDDSDHDQGQ 120

Query: 121 IVRVKSKELTALLSDDERLNEERNMNIXXXXXXXXXXXXXXXXXXDNDNDLQRALDASRM 180
           I+RVK+KELT+LL+D+ERL +ER MN                    +D++LQRA++ S+ 
Sbjct: 121 IIRVKAKELTSLLNDEERLRDERGMNRRGGRRERARPRRRPS----DDDELQRAIEESKR 176

Query: 181 TA----XXXXXXXXXXXXXXTALQLSKEEEELK--RXXXXXXXXXXXXXXXXXPMYYDIF 234
           TA                  TALQLSKEEEELK  +                 PMYYDIF
Sbjct: 177 TAEDDDRRRRMRDDEEADLQTALQLSKEEEELKRLQELQRLQQQQQQQQQQQQPMYYDIF 236

Query: 235 GNPIT 239
           GNPI+
Sbjct: 237 GNPIS 241

 Score =  162 bits (409), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 71/89 (79%), Positives = 83/89 (93%)

Query: 350 TRTGNQSMTDKYNKLNELLATGTGIDTFGNVGDARVPAQHTKTGTFINSQGTGYKQVSND 409
           TRTGNQ +TDK+ +LN+LLA+GTGIDTFGN G+AR+PAQHTKTGTFINSQGTGY+QV+ND
Sbjct: 383 TRTGNQDITDKFGELNQLLASGTGIDTFGNTGEARIPAQHTKTGTFINSQGTGYRQVTND 442

Query: 410 PKYNPFLSGQYTGLPSTNVVPTQTGYGFG 438
           PK NPFL+ QYTGLPSTN+VP+ TGYGFG
Sbjct: 443 PKNNPFLNSQYTGLPSTNIVPSHTGYGFG 471

>KAFR0L01460 Chr12 complement(270433..272085) [1653 bp, 550 aa] {ON}
           Anc_7.342 YLR206W
          Length = 550

 Score =  261 bits (666), Expect = 1e-80,   Method: Compositional matrix adjust.
 Identities = 145/263 (55%), Positives = 174/263 (66%), Gaps = 17/263 (6%)

Query: 1   MSKQFVRSAKNLVKGYSSTQVLVRNATSNDNHQVSKDSLIELAEKSYDSADFFEIMDMLD 60
           MSKQFVRSAKN++KGYSSTQVLVR+ATSNDN   + D+L ++A +SYDS DFFEIMDMLD
Sbjct: 1   MSKQFVRSAKNVMKGYSSTQVLVRDATSNDNRVTNIDTLDDIASRSYDSVDFFEIMDMLD 60

Query: 61  KRLNDKGKYWRHIAKALTVLDYLIRFGSENCVLWCKENLYIIKTLKEFRHEDDEGIDQGQ 120
           KRLNDKGKYW+HI K+LTVLDYL+RFGSENCVLWCKENLY+IKTL+EFR+EDD GIDQGQ
Sbjct: 61  KRLNDKGKYWKHIVKSLTVLDYLVRFGSENCVLWCKENLYVIKTLREFRYEDDTGIDQGQ 120

Query: 121 IVRVKSKELTALLSDDERLNEERNMNIXXXXXXXXXXXXXXXXXXD------NDNDLQRA 174
           I+RVK+KELT+LL D+ERL EER  N                          +D+DLQR 
Sbjct: 121 IIRVKAKELTSLLQDEERLREERRFNNRRNRRNNRSANRSRATSRSQSNIGPDDDDLQRV 180

Query: 175 LDASRMTAXXXXXXXXXXXXX-------XTALQLSKEEEELKR----XXXXXXXXXXXXX 223
           ++ S+ TA                      ALQLSKEEEELK                  
Sbjct: 181 IEESKKTAEEDERRRKELARYDEEDPEFQAALQLSKEEEELKNLQDLQRQQQQLQMLQQQ 240

Query: 224 XXXXPMYYDIFGNPITPEEYAQF 246
                +YYD+FGNPI+ +EY ++
Sbjct: 241 QTSANVYYDVFGNPISYDEYMEY 263

 Score =  143 bits (361), Expect = 9e-37,   Method: Compositional matrix adjust.
 Identities = 65/89 (73%), Positives = 78/89 (87%), Gaps = 1/89 (1%)

Query: 351 RTGNQSMTDKYNKLNELLATGTGIDTFGNVGDARVPAQHTKTGTFINSQGTGYKQVSND- 409
           RTGN+ +T+KY++LN LLA GTG+DTFGN G  R+PAQHTKTGTFINSQGTGYKQV+N+ 
Sbjct: 389 RTGNEEITEKYSELNNLLAQGTGVDTFGNTGQERIPAQHTKTGTFINSQGTGYKQVTNER 448

Query: 410 PKYNPFLSGQYTGLPSTNVVPTQTGYGFG 438
            K NPFL+ QYTGLPS+N+VP+ TGYGFG
Sbjct: 449 SKNNPFLNTQYTGLPSSNIVPSSTGYGFG 477

>NDAI0D00610 Chr4 (133678..135138) [1461 bp, 486 aa] {ON} Anc_7.342
           YDL161W
          Length = 486

 Score =  256 bits (653), Expect = 3e-79,   Method: Compositional matrix adjust.
 Identities = 139/266 (52%), Positives = 171/266 (64%), Gaps = 24/266 (9%)

Query: 1   MSKQFVRSAKNLVKGYSSTQVLVRNATSNDNHQVSKDSLIELAEKSYDSADFFEIMDMLD 60
           MSKQFVRSAKN++KGYS+TQVLVR+ATSND+   S + L E++++S+DS DFFEIMDMLD
Sbjct: 1   MSKQFVRSAKNMMKGYSTTQVLVRDATSNDSSNPSFEILYEISKRSFDSVDFFEIMDMLD 60

Query: 61  KRLNDKGKYWRHIAKALTVLDYLIRFGSENCVLWCKENLYIIKTLKEFRHEDDEGIDQGQ 120
           KRLNDKGKYW+HIAK+LTVLDYL+RFGSENCVLWCK+NLYIIKTLKEF+ EDD  +D+  
Sbjct: 61  KRLNDKGKYWKHIAKSLTVLDYLVRFGSENCVLWCKQNLYIIKTLKEFKLEDD-NVDESS 119

Query: 121 IVRVKSKELTALLSDDERLNEERNMNIXXXXXXXXXXXX-----XXXXXXDNDNDLQRAL 175
           I+RVK+KELTALL DDERL EER++N+                        +D DLQ+AL
Sbjct: 120 IIRVKAKELTALLQDDERLKEERSINLKNNRRSERKNRSRRGTNATRRGTKSDEDLQKAL 179

Query: 176 DASRMTAXXXXXXXXXXXX-------XXTALQLS-----------KEEEELKRXXXXXXX 217
           + SR+TA                     TALQLS            +  +  +       
Sbjct: 180 EESRITAEEDERRRRELAQYDNQDTDYQTALQLSKEEEELKKLQELQRLQQLQQQQQQQM 239

Query: 218 XXXXXXXXXXPMYYDIFGNPITPEEY 243
                      +YYDIFGNPI+PEEY
Sbjct: 240 QFQQQPQQQEQVYYDIFGNPISPEEY 265

 Score =  155 bits (393), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 70/89 (78%), Positives = 81/89 (91%), Gaps = 1/89 (1%)

Query: 350 TRTGNQSMTDKYNKLNELLATGTGIDTFGNVGDARVPAQHTKTGTFINSQGTGYKQVSND 409
           TRTGNQS++DKYN+LN LLA+GTGIDTFGN GD R+PAQHT+TGTFINSQGTGYKQ+ ND
Sbjct: 368 TRTGNQSISDKYNELNNLLASGTGIDTFGNTGDQRIPAQHTQTGTFINSQGTGYKQIVND 427

Query: 410 P-KYNPFLSGQYTGLPSTNVVPTQTGYGF 437
           P K NPFL+ QYTGLPS+N+VP+ TGYGF
Sbjct: 428 PVKKNPFLNNQYTGLPSSNIVPSHTGYGF 456

 Score = 33.5 bits (75), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 11/14 (78%), Positives = 14/14 (100%)

Query: 265 LYYDVFGNPITPEE 278
           +YYD+FGNPI+PEE
Sbjct: 251 VYYDIFGNPISPEE 264

>Skud_12.270 Chr12 (501192..503072) [1881 bp, 626 aa] {ON} YLR206W
           (REAL)
          Length = 626

 Score =  259 bits (663), Expect = 3e-79,   Method: Compositional matrix adjust.
 Identities = 137/275 (49%), Positives = 173/275 (62%), Gaps = 33/275 (12%)

Query: 1   MSKQFVRSAKNLVKGYSSTQVLVRNATSNDNHQVSKDSLIELAEKSYDSADFFEIMDMLD 60
           M KQFVRSAKN+VKGYSSTQVLVR+AT+ND+   S D+L +LA++SYDS DFFEIMDMLD
Sbjct: 1   MPKQFVRSAKNMVKGYSSTQVLVRDATANDSRTPSIDTLDDLAQRSYDSVDFFEIMDMLD 60

Query: 61  KRLNDKGKYWRHIAKALTVLDYLIRFGSENCVLWCKENLYIIKTLKEFRHEDDEGIDQGQ 120
           KRLNDKGKYWRH+AK+LTVLDYL+RFGSENCVLWC+EN Y+IKTL+EFRHE++ G D+GQ
Sbjct: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENESGFDEGQ 120

Query: 121 IVRVKSKELTALLSDDERLNEERNMNIXXXXXXXXXXXXXXXXXXDND---------NDL 171
           I+RVK+KEL +LL+DDERL EER+MN                    ++         ++L
Sbjct: 121 IIRVKAKELVSLLNDDERLREERSMNTRNRGANKAPRPGPRRQRTGSNPRDSSPSYQDEL 180

Query: 172 QRALDASRMTAXXXXXXXXXXXXX-------XTALQLS----------------KEEEEL 208
           ++ L+ SR+TA                      ALQLS                K+++ L
Sbjct: 181 EKVLEESRITAQEDEQRRRELAQYDDEDPDFQAALQLSKEEEELKQLQELQRLQKQQQPL 240

Query: 209 KRXXXXXXXXXXXXXXXXXPMYYDIFGNPITPEEY 243
            +                 P YYDIFGNPI+ +EY
Sbjct: 241 SQ-MPVPVQQQQQQQQQQLPAYYDIFGNPISQDEY 274

 Score =  171 bits (434), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 78/93 (83%), Positives = 87/93 (93%)

Query: 346 PLTQTRTGNQSMTDKYNKLNELLATGTGIDTFGNVGDARVPAQHTKTGTFINSQGTGYKQ 405
           PL QTRTGNQS++DKYN LN LLATGTG+DTFGN G+AR+PAQHTKTGTFINSQGTGYKQ
Sbjct: 450 PLEQTRTGNQSISDKYNDLNVLLATGTGLDTFGNTGEARIPAQHTKTGTFINSQGTGYKQ 509

Query: 406 VSNDPKYNPFLSGQYTGLPSTNVVPTQTGYGFG 438
           V+++PK NPFLS QYTGLPSTN+VPTQTGYGFG
Sbjct: 510 VTSEPKNNPFLSNQYTGLPSTNIVPTQTGYGFG 542

>Suva_10.300 Chr10 (527412..529268) [1857 bp, 618 aa] {ON} YLR206W
           (REAL)
          Length = 618

 Score =  259 bits (662), Expect = 3e-79,   Method: Compositional matrix adjust.
 Identities = 144/263 (54%), Positives = 170/263 (64%), Gaps = 24/263 (9%)

Query: 1   MSKQFVRSAKNLVKGYSSTQVLVRNATSNDNHQVSKDSLIELAEKSYDSADFFEIMDMLD 60
           MSKQFVRSAKN+VKGYSSTQVLVR+AT+ND    S D+L +LA++SYDS DFFEIMDMLD
Sbjct: 1   MSKQFVRSAKNMVKGYSSTQVLVRDATANDPRTPSIDTLDDLAQRSYDSVDFFEIMDMLD 60

Query: 61  KRLNDKGKYWRHIAKALTVLDYLIRFGSENCVLWCKENLYIIKTLKEFRHEDDEGIDQGQ 120
           KRLNDKGKYWRH+AK+LTVLDYL+RFGSENCVLWC+EN Y+IKTL+EFRHE++ G D+GQ
Sbjct: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENESGFDEGQ 120

Query: 121 IVRVKSKELTALLSDDERLNEERNMNIXXXXXXXXXXXXXXXXXXDN------------- 167
           I+RVK+KEL +LL+DDERL EER MN                                  
Sbjct: 121 IIRVKAKELVSLLNDDERLREERTMNTRNRRTNKTARPTPTPRPRRQRTRSNLYDSPPTY 180

Query: 168 DNDLQRALDASRMTAXXXXXXXXXXXXX-------XTALQLSKEEEELKRXXXXXXXXXX 220
            NDL++AL+ SR+TA                      ALQLSKEEEELK+          
Sbjct: 181 QNDLEKALEESRITAQEDELRRNEMAQYDDDDPDFQAALQLSKEEEELKQLQELQKQQQL 240

Query: 221 XXXXXXXPM----YYDIFGNPIT 239
                  P     YYDIFGNPI+
Sbjct: 241 QSQLQMPPQQQAAYYDIFGNPIS 263

 Score =  169 bits (427), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 77/93 (82%), Positives = 86/93 (92%)

Query: 346 PLTQTRTGNQSMTDKYNKLNELLATGTGIDTFGNVGDARVPAQHTKTGTFINSQGTGYKQ 405
           PLTQTRTGNQS++DKYN LN LLATGTG DTFGN G++R+PAQHTKTGTFINSQGTGYKQ
Sbjct: 433 PLTQTRTGNQSISDKYNDLNVLLATGTGADTFGNTGESRIPAQHTKTGTFINSQGTGYKQ 492

Query: 406 VSNDPKYNPFLSGQYTGLPSTNVVPTQTGYGFG 438
           V N+PK NPFL+ QYTGLPST++VPTQTGYGFG
Sbjct: 493 VVNEPKNNPFLNSQYTGLPSTSIVPTQTGYGFG 525

>Smik_12.264 Chr12 (501598..503436) [1839 bp, 612 aa] {ON} YLR206W
           (REAL)
          Length = 612

 Score =  256 bits (655), Expect = 2e-78,   Method: Compositional matrix adjust.
 Identities = 136/265 (51%), Positives = 169/265 (63%), Gaps = 26/265 (9%)

Query: 1   MSKQFVRSAKNLVKGYSSTQVLVRNATSNDNHQVSKDSLIELAEKSYDSADFFEIMDMLD 60
           MSKQFVRSAKN++KGYSSTQVLVR+AT+ND+   S D+L +LA++SYDS DFFEIMDMLD
Sbjct: 1   MSKQFVRSAKNMMKGYSSTQVLVRDATANDSRTPSIDTLDDLAQRSYDSVDFFEIMDMLD 60

Query: 61  KRLNDKGKYWRHIAKALTVLDYLIRFGSENCVLWCKENLYIIKTLKEFRHEDDEGIDQGQ 120
           KRLNDKGKYWRH+AK+LTVLDYL+RFGSENCVLWC+EN Y+IKTL+EFRHE++ G D+GQ
Sbjct: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENESGFDEGQ 120

Query: 121 IVRVKSKELTALLSDDERLNEERNMNIXXXXXXXXXXXXXXXXXXDND---------NDL 171
           I+RVK+KEL +LL+DDERL EER+MN                    ++         NDL
Sbjct: 121 IIRVKAKELVSLLNDDERLREERSMNTRNRRDRSAARPRPRRQRTRSNPHDSSPSYQNDL 180

Query: 172 QRALDASRMTAXXXXXXXXXXXXX-------XTALQLS----------KEEEELKRXXXX 214
           ++AL+ SR+TA                      ALQLS          + +    +    
Sbjct: 181 EKALEESRITAQEDEQRRRELAQYDDEDPDFQAALQLSKEEEELKQLQELQRLQNQQQSL 240

Query: 215 XXXXXXXXXXXXXPMYYDIFGNPIT 239
                        P YYDIFGNPI+
Sbjct: 241 SQMQVPVQQQQEQPAYYDIFGNPIS 265

 Score =  172 bits (437), Expect = 7e-47,   Method: Compositional matrix adjust.
 Identities = 79/93 (84%), Positives = 85/93 (91%)

Query: 346 PLTQTRTGNQSMTDKYNKLNELLATGTGIDTFGNVGDARVPAQHTKTGTFINSQGTGYKQ 405
           PL QTRTGNQS++DKYN LN LLATGTG DTFGN G+AR+PAQHTKTGTFINSQGTGYKQ
Sbjct: 425 PLKQTRTGNQSISDKYNDLNTLLATGTGTDTFGNTGEARIPAQHTKTGTFINSQGTGYKQ 484

Query: 406 VSNDPKYNPFLSGQYTGLPSTNVVPTQTGYGFG 438
           V N+PK NPFLS QYTGLPSTN+VPTQTGYGFG
Sbjct: 485 VINEPKNNPFLSNQYTGLPSTNIVPTQTGYGFG 517

>KAFR0B00890 Chr2 (166365..167609) [1245 bp, 414 aa] {ON} Anc_7.342
           YLR206W
          Length = 414

 Score =  248 bits (632), Expect = 5e-77,   Method: Compositional matrix adjust.
 Identities = 129/240 (53%), Positives = 161/240 (67%), Gaps = 9/240 (3%)

Query: 5   FVRSAKNLVKGYSSTQVLVRNATSNDNHQVSKDSLIELAEKSYDSADFFEIMDMLDKRLN 64
            +RSAKNLVKGYSSTQ LVR+ATSN +     D L ELAE +Y++ +FFEIMDMLDKR+N
Sbjct: 1   MLRSAKNLVKGYSSTQKLVRDATSNSHDNPPIDQLSELAEMTYNNMEFFEIMDMLDKRIN 60

Query: 65  DKGKYWRHIAKALTVLDYLIRFGSENCVLWCKENLYIIKTLKEFRHEDDEGIDQGQIVRV 124
            KGKYW+H+ K+L VLDYL+RFGSENCV+WCKENLYIIKTL+EF +ED+ G+DQGQ+VRV
Sbjct: 61  SKGKYWKHVIKSLIVLDYLVRFGSENCVIWCKENLYIIKTLREFTYEDESGMDQGQMVRV 120

Query: 125 KSKELTALLSDDERLNEERNMNIXXXXXXXXXXXXXXXXXXDNDNDLQRA-LDASRMTAX 183
           ++KELT+LL D+ERL EER +                    D+D+DL+RA  ++ R    
Sbjct: 121 RAKELTSLLMDEERLREERAL----NRRGGGNRRRAKSRNSDDDDDLERAKEESRRTARE 176

Query: 184 XXXXXXXXXXXXXTALQLSKEEEELKRXXXXXXXXXXXXXXXXXPMYYDIFGNPITPEEY 243
                         ALQL++EE+EL+                  PMYYDIFGNPITPEEY
Sbjct: 177 EEELRRRQEAERQFALQLNQEEQELR----ALQQLQQQQQQQQQPMYYDIFGNPITPEEY 232

 Score =  165 bits (418), Expect = 9e-46,   Method: Compositional matrix adjust.
 Identities = 91/194 (46%), Positives = 113/194 (58%), Gaps = 27/194 (13%)

Query: 264 PLYYDVFGNPITPEELAXXXXXXXXXXXXXXXXXXXXXXXXXGI---------------- 307
           P+YYD+FGNPITPEE                                             
Sbjct: 217 PMYYDIFGNPITPEEYLQFQQRQAALAQQQALLAQQEQQYWAQQQAAFLSQQQQQQQQPL 276

Query: 308 ---PNNPFSKSEQKSGIEEQGQSSTVDSSMXXXXXXXXXXEPLTQTRTGNQSMTDKYNKL 364
               NNPF+ + +K   +   + S +D+++           PL QTRTG+QS++DKY+ L
Sbjct: 277 ATGSNNPFALNNKKLQ-QHTPEPSVIDTTLNTQA-------PLKQTRTGSQSISDKYSAL 328

Query: 365 NELLATGTGIDTFGNVGDARVPAQHTKTGTFINSQGTGYKQVSNDPKYNPFLSGQYTGLP 424
           N LLATGTGIDTFGN G+ R+PAQHTKTGTFINSQGTGYKQVS +   N FL+ QYTGLP
Sbjct: 329 NTLLATGTGIDTFGNTGNQRIPAQHTKTGTFINSQGTGYKQVSTNGFNNVFLNSQYTGLP 388

Query: 425 STNVVPTQTGYGFG 438
           S+N+VP+QTGYGFG
Sbjct: 389 SSNIVPSQTGYGFG 402

>Kwal_56.24610 s56 complement(1073855..1075381) [1527 bp, 508 aa]
           {ON} YDL161W (ENT1) - Ent1p [contig 161] FULL
          Length = 508

 Score =  247 bits (630), Expect = 1e-75,   Method: Compositional matrix adjust.
 Identities = 140/263 (53%), Positives = 165/263 (62%), Gaps = 26/263 (9%)

Query: 1   MSKQFVRSAKNLVKGYSSTQVLVRNATSNDNHQVSKDSLIELAEKSYDSADFFEIMDMLD 60
           MSK  +R AKN+V GYS+TQVL+R ATSND    S D + E+AE+S+DS  FFEIMDMLD
Sbjct: 1   MSKSLIRKAKNVVNGYSTTQVLLREATSNDPEGPSLDIMDEIAERSWDSVSFFEIMDMLD 60

Query: 61  KRLNDKGKYWRHIAKALTVLDYLIRFGSENCVLWCKENLYIIKTLKEFRHEDDEGIDQGQ 120
           KRLNDKGK WRH+AK+LTVLDYL+R GSE+CV W KENLY+IKTL+EF HED+ GIDQGQ
Sbjct: 61  KRLNDKGKNWRHVAKSLTVLDYLVRCGSEHCVPWAKENLYVIKTLREFMHEDELGIDQGQ 120

Query: 121 IVRVKSKELTALLSDDERLNEERNMNIXXXXXXXXXXXXXXXXXXDNDNDLQRALDASRM 180
           IVRVK++ELTALL DDERL EER++                      D DLQRA++ SR+
Sbjct: 121 IVRVKARELTALLLDDERLREERSLRTKNRKPRRRPTAGSE------DEDLQRAMEESRL 174

Query: 181 TAXXXXXXXX--------XXXXXXTALQLSKEEEELKRXXXXXXXX------------XX 220
           TA                      TALQLSKEEEEL+R                      
Sbjct: 175 TAEQEEAERRRKLEIYDNSSDDLQTALQLSKEEEELRRLRELQMQQQMQQAQQQMFGLSQ 234

Query: 221 XXXXXXXPMYYDIFGNPITPEEY 243
                  PMYYD+FGNPI+ EEY
Sbjct: 235 QQTQAQQPMYYDVFGNPISAEEY 257

 Score =  154 bits (388), Expect = 9e-41,   Method: Compositional matrix adjust.
 Identities = 69/89 (77%), Positives = 80/89 (89%)

Query: 350 TRTGNQSMTDKYNKLNELLATGTGIDTFGNVGDARVPAQHTKTGTFINSQGTGYKQVSND 409
           TRTGNQS+T+K+++LN LLA+GTG+DTFGN G  R+PAQHTKTG FINSQGTGYKQVS+ 
Sbjct: 395 TRTGNQSITEKHSELNNLLASGTGLDTFGNTGQTRIPAQHTKTGNFINSQGTGYKQVSST 454

Query: 410 PKYNPFLSGQYTGLPSTNVVPTQTGYGFG 438
           PK+NPFL  QYTGLPSTNVVP+ TGYGFG
Sbjct: 455 PKHNPFLGQQYTGLPSTNVVPSYTGYGFG 483

 Score = 33.9 bits (76), Expect = 0.94,   Method: Compositional matrix adjust.
 Identities = 12/15 (80%), Positives = 14/15 (93%)

Query: 264 PLYYDVFGNPITPEE 278
           P+YYDVFGNPI+ EE
Sbjct: 242 PMYYDVFGNPISAEE 256

>YLR206W Chr12 (554578..556419) [1842 bp, 613 aa] {ON}
           ENT2Epsin-like protein required for endocytosis and
           actin patch assembly and functionally redundant with
           Ent1p; contains clathrin-binding motif at C-terminus
          Length = 613

 Score =  249 bits (635), Expect = 2e-75,   Method: Compositional matrix adjust.
 Identities = 135/267 (50%), Positives = 171/267 (64%), Gaps = 28/267 (10%)

Query: 1   MSKQFVRSAKNLVKGYSSTQVLVRNATSNDNHQVSKDSLIELAEKSYDSADFFEIMDMLD 60
           MSKQFVRSAKN++KGYSSTQVLVR+AT+ND+   S D+L +LA++SYDS DFFEIMDMLD
Sbjct: 1   MSKQFVRSAKNMMKGYSSTQVLVRDATANDSRTPSIDTLDDLAQRSYDSVDFFEIMDMLD 60

Query: 61  KRLNDKGKYWRHIAKALTVLDYLIRFGSENCVLWCKENLYIIKTLKEFRHEDDEGIDQGQ 120
           KRLNDKGKYWRH+AK+LTVLDYL+RFGSENCVLWC+EN Y+IKTL+EFRHE++ G D+GQ
Sbjct: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENESGFDEGQ 120

Query: 121 IVRVKSKELTALLSDDERLNEERNMNIXXXXXXXXXXXXXXXXXXDND---------NDL 171
           I+RVK+KEL +LL+D+ERL EER+MN                    ++         +DL
Sbjct: 121 IIRVKAKELVSLLNDEERLREERSMNTRNRRANRAARPRPRRQRTRSNPHDSSPSYQDDL 180

Query: 172 QRALDASRMTAXXXXXXXXXXXXX-------XTALQLSK------------EEEELKRXX 212
           ++AL+ SR+TA                      ALQLSK              ++ ++  
Sbjct: 181 EKALEESRITAQEDEQRRRELAQYDDEDPDFQAALQLSKEEEELKQLQELQRLQKQQQSL 240

Query: 213 XXXXXXXXXXXXXXXPMYYDIFGNPIT 239
                          P YYDIFGNPI+
Sbjct: 241 SQFQAPLQQQQPQQQPAYYDIFGNPIS 267

 Score =  173 bits (438), Expect = 4e-47,   Method: Compositional matrix adjust.
 Identities = 79/93 (84%), Positives = 87/93 (93%)

Query: 346 PLTQTRTGNQSMTDKYNKLNELLATGTGIDTFGNVGDARVPAQHTKTGTFINSQGTGYKQ 405
           PL QTRTGNQS++DKY+ LN LLATGTGIDTFGN G+AR+PAQHTKTGTFINSQGTGYKQ
Sbjct: 424 PLKQTRTGNQSISDKYSDLNTLLATGTGIDTFGNTGEARIPAQHTKTGTFINSQGTGYKQ 483

Query: 406 VSNDPKYNPFLSGQYTGLPSTNVVPTQTGYGFG 438
           V+N+PK NPFLS QYTGLPSTN+VPTQTGYGFG
Sbjct: 484 VTNEPKNNPFLSNQYTGLPSTNIVPTQTGYGFG 516

>TBLA0E00480 Chr5 complement(88019..89818) [1800 bp, 599 aa] {ON}
           Anc_7.342 YLR206W
          Length = 599

 Score =  238 bits (608), Expect = 1e-71,   Method: Compositional matrix adjust.
 Identities = 136/273 (49%), Positives = 170/273 (62%), Gaps = 30/273 (10%)

Query: 1   MSKQFVRSAKNLVKGYSSTQVLVRNATSNDNHQVSKDSLIELAEKSYDSADFFEIMDMLD 60
           MSKQF+RS KN+VKGYSSTQ+LVR+AT+ND +  S D L ++AEK+YDS DFFEIMDMLD
Sbjct: 1   MSKQFLRSTKNMVKGYSSTQILVRDATANDENTPSIDILDDIAEKTYDSVDFFEIMDMLD 60

Query: 61  KRLNDKGKYWRHIAKALTVLDYLIRFGSENCVLWCKENLYIIKTLKEFRHED----DEGI 116
           KRLNDKGKYW+H+AK+LTVLDYLIRFGSENCV WCKENLY+IKTLKEFR +D    + G 
Sbjct: 61  KRLNDKGKYWKHVAKSLTVLDYLIRFGSENCVFWCKENLYLIKTLKEFRVDDAIDYNTGY 120

Query: 117 DQGQIVRVKSKELTALLSDDERLNEERNMN------------IXXXXXXXXXXXXXXXXX 164
           DQGQIVRV++ ELT+LL DDERL EER+++            +                 
Sbjct: 121 DQGQIVRVRATELTSLLMDDERLREERSLHSRGGRRSAPPPRMAPQRRNTSRSDFNRQRA 180

Query: 165 XDN-DNDLQRALDASRMTAXXXXXXXXXXXXXX-----TALQLS--------KEEEELKR 210
            D+ D+DLQ+A++ S+ TA                   TALQLS         +E   ++
Sbjct: 181 DDHYDDDLQKAIEESKRTAEEDERRRRNREGDQEDDFETALQLSKEEEELKKLQELHAQQ 240

Query: 211 XXXXXXXXXXXXXXXXXPMYYDIFGNPITPEEY 243
                             +Y DIFGNPI+ EE+
Sbjct: 241 IALQNQQNATPTTQNVANVYTDIFGNPISYEEW 273

 Score =  162 bits (410), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 74/94 (78%), Positives = 81/94 (86%)

Query: 345 EPLTQTRTGNQSMTDKYNKLNELLATGTGIDTFGNVGDARVPAQHTKTGTFINSQGTGYK 404
           +P+ Q RTGNQ ++DKYN LN LLATGTGIDTFGN GD R+PAQHT TGTFINSQGTGYK
Sbjct: 465 QPIPQMRTGNQEISDKYNNLNTLLATGTGIDTFGNTGDMRIPAQHTATGTFINSQGTGYK 524

Query: 405 QVSNDPKYNPFLSGQYTGLPSTNVVPTQTGYGFG 438
           Q  NDPK NPF+S QYTGLPSTNVVP+ TGYGFG
Sbjct: 525 QYINDPKNNPFMSNQYTGLPSTNVVPSYTGYGFG 558

>KLTH0H01430g Chr8 (132738..134246) [1509 bp, 502 aa] {ON} some
           similarities with uniprot|Q12518 Saccharomyces
           cerevisiae YDL161W ENT1
          Length = 502

 Score =  230 bits (587), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 129/261 (49%), Positives = 155/261 (59%), Gaps = 24/261 (9%)

Query: 1   MSKQFVRSAKNLVKGYSSTQVLVRNATSNDNHQVSKDSLIELAEKSYDSADFFEIMDMLD 60
           MSK  +R AKN+V GYS+TQVL+R ATSND    S D + E+AE+S+DS  FFEIMDMLD
Sbjct: 1   MSKSLMRRAKNVVNGYSTTQVLLREATSNDPDGPSLDLMDEIAERSWDSVSFFEIMDMLD 60

Query: 61  KRLNDKGKYWRHIAKALTVLDYLIRFGSENCVLWCKENLYIIKTLKEFRHEDDEGIDQGQ 120
           KRLNDKGK WRH+AK+LTVLDYL+R GSE+CV W KENLYIIKTL+EF HED+ G+DQGQ
Sbjct: 61  KRLNDKGKNWRHVAKSLTVLDYLVRCGSEHCVPWAKENLYIIKTLREFTHEDETGVDQGQ 120

Query: 121 IVRVKSKELTALLSDDERLNEERNMNIXXXXXXXXXXXXXXXXXXDNDNDLQRALDASRM 180
           IVRVK++ELTALL D      E  +                      D+D+QRAL+ SRM
Sbjct: 121 IVRVKARELTALLQD------EERLREERELKGRNRRPRRRKNSDSYDDDMQRALEESRM 174

Query: 181 TAXXXXXXXXXXXXX--------XTALQLSK----------EEEELKRXXXXXXXXXXXX 222
           TA                      TALQLSK           + + +             
Sbjct: 175 TAEQEEAERRRKLEMYDNSADDLQTALQLSKEEEELRRLRELQMQQQMQQAQQQMFGLQQ 234

Query: 223 XXXXXPMYYDIFGNPITPEEY 243
                PMYYD+FGNPI+ EEY
Sbjct: 235 QQTQQPMYYDVFGNPISAEEY 255

 Score =  150 bits (380), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 71/91 (78%), Positives = 80/91 (87%), Gaps = 2/91 (2%)

Query: 350 TRTGNQSMTDKYNKLNELLATGTGIDTFGNVGDARVPAQHTKTGTFINSQGTGYKQVSND 409
           TRTGNQS+TDK++ LN LLA+GTG+DTFGN G  R+PAQHTKTGTFINSQGTGYKQVSN 
Sbjct: 387 TRTGNQSVTDKFSDLNNLLASGTGLDTFGNTGQTRIPAQHTKTGTFINSQGTGYKQVSNM 446

Query: 410 P--KYNPFLSGQYTGLPSTNVVPTQTGYGFG 438
           P  K+NPFL  QYTGLPST+VVP+ TGYGFG
Sbjct: 447 PQGKHNPFLGQQYTGLPSTSVVPSYTGYGFG 477

 Score = 33.9 bits (76), Expect = 0.79,   Method: Compositional matrix adjust.
 Identities = 12/15 (80%), Positives = 14/15 (93%)

Query: 264 PLYYDVFGNPITPEE 278
           P+YYDVFGNPI+ EE
Sbjct: 240 PMYYDVFGNPISAEE 254

>KLLA0C16731g Chr3 complement(1463616..1465052) [1437 bp, 478 aa]
           {ON} some similarities with uniprot|Q12518 Saccharomyces
           cerevisiae YDL161W ENT1
          Length = 478

 Score =  228 bits (580), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 129/249 (51%), Positives = 157/249 (63%), Gaps = 13/249 (5%)

Query: 1   MSKQFVRSAKNLVKGYSSTQVLVRNATSNDNHQVSKDSLIELAEKSYDSADFFEIMDMLD 60
           MSK F+RSAKNLV GYS  QVLVR+ATSND    S D L ELAE+++D+ +FFEIMDMLD
Sbjct: 1   MSKAFLRSAKNLVNGYSQAQVLVRSATSNDKDGPSVDQLEELAERTFDNVEFFEIMDMLD 60

Query: 61  KRLNDKGKYWRHIAKALTVLDYLIRFGSENCVLWCKENLYIIKTLKEFRHEDD-EGIDQG 119
           KRLNDKG+ WRH+AK+LT LD+L+R GSENCV WCKENLYIIKTL+EF H D+   ID G
Sbjct: 61  KRLNDKGRNWRHVAKSLTCLDFLVRCGSENCVFWCKENLYIIKTLREFTHTDEFTEIDNG 120

Query: 120 QIVRVKSKELTALLSDDERLNEERNMNIXXXXXXXXXXXXXXXXXXDNDNDLQRALDASR 179
           +IVRVK+KELTALL D+ERL EER M +                     +DLQRAL+ SR
Sbjct: 121 EIVRVKAKELTALLRDEERLKEERMMRLKGRKRGGRKNRRDDNEDD---DDLQRALEESR 177

Query: 180 MTAXXXXXXXXXXXXX--XTALQLS-------KEEEELKRXXXXXXXXXXXXXXXXXPMY 230
           +TA                ++LQ +       +E   L++                 PMY
Sbjct: 178 ITAEEEERRRKQLMMQGDDSSLQAALELSKEEEELRRLQQLQAQQQAALWQQQQQQQPMY 237

Query: 231 YDIFGNPIT 239
           YDIFGNPI+
Sbjct: 238 YDIFGNPIS 246

 Score =  153 bits (386), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 67/95 (70%), Positives = 85/95 (89%), Gaps = 1/95 (1%)

Query: 345 EPLTQTRTGNQSMTDKYNKLNELLATGTGIDTFGNVGDARVPAQHTKTGTFINSQGTGYK 404
           +P+ + RTGNQS++DK+++LN LLA+GTGIDTFGN G+ RVPAQHTKTGTFINSQGTGYK
Sbjct: 354 KPVPKQRTGNQSISDKFSELNNLLASGTGIDTFGNTGETRVPAQHTKTGTFINSQGTGYK 413

Query: 405 QVSND-PKYNPFLSGQYTGLPSTNVVPTQTGYGFG 438
           Q++ND PK+NPFL+ QYTG+PS+ + P+ TGYGFG
Sbjct: 414 QITNDAPKHNPFLTSQYTGIPSSAIAPSYTGYGFG 448

>Ecym_4731 Chr4 (1427875..1429419) [1545 bp, 514 aa] {ON} similar to
           Ashbya gossypii ACL157C
          Length = 514

 Score =  213 bits (543), Expect = 7e-63,   Method: Compositional matrix adjust.
 Identities = 125/257 (48%), Positives = 154/257 (59%), Gaps = 20/257 (7%)

Query: 1   MSKQFVRSAKNLVKGYSSTQVLVRNATSNDNHQVSKDSLIELAEKSYDSADFFEIMDMLD 60
           MSKQ +RSAKN++ GYS  QVLVRNATSND +  S D + ELAE++Y + +FFEIM MLD
Sbjct: 1   MSKQLLRSAKNVMNGYSQAQVLVRNATSNDEYGPSLDQMEELAERTYSAVEFFEIMVMLD 60

Query: 61  KRLNDKGKYWRHIAKALTVLDYLIRFGSENCVLWCKENLYIIKTLKEFRHEDDE-GIDQG 119
           +RLNDK K WRH+AK+LTV DYL+R G+E CV W +EN++II+ L EF H D+  G D G
Sbjct: 61  RRLNDKPKNWRHVAKSLTVTDYLVRTGAEACVDWARENMFIIRKLTEFVHVDESSGTDHG 120

Query: 120 QIVRVKSKELTALLSDDERLNEERNMNIXXXXXXXXXXXXXXXXXXDNDNDLQRALDASR 179
           Q++RVK+KEL ALL DDERL EERN+ +                  D D  L+RAL+ SR
Sbjct: 121 QLIRVKAKELIALLRDDERLKEERNLRLGRGKKNPQNVPETNPDGVDPD--LKRALEESR 178

Query: 180 MTAXXXXXXXXXXXXX------XTALQLSKEEEELKRXXXXXXXXXXXXXXXXX------ 227
           +TA                     ALQLSKEEEEL++                       
Sbjct: 179 ITAEEEERRRKLAEKTEDAEELQAALQLSKEEEELRKLRELQQQREQQMAFWQQQQVQQV 238

Query: 228 -----PMYYDIFGNPIT 239
                PMYYDIFGNPIT
Sbjct: 239 QYQQQPMYYDIFGNPIT 255

 Score =  156 bits (394), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 74/112 (66%), Positives = 86/112 (76%), Gaps = 1/112 (0%)

Query: 350 TRTGNQSMTDKYNKLNELLATGTGIDTFGNVGDARVPAQHTKTGTFINSQGTGYKQVSND 409
           TRTGNQS++DKY +LN LLATGTGIDTFGN G AR+ +QHTKT TFINS GTG+KQVSN+
Sbjct: 403 TRTGNQSISDKYGELNALLATGTGIDTFGNTGQARISSQHTKTETFINSHGTGFKQVSNE 462

Query: 410 -PKYNPFLSGQYTGLPSTNVVPTQTGYGFGXXXXXXXXXXXXXXXGYALIDL 460
            PK+NPFL+ QYTGLPSTN+VP+ TGYGFG               G +LIDL
Sbjct: 463 PPKHNPFLTTQYTGLPSTNIVPSHTGYGFGNASSFQQTASKPNDQGMSLIDL 514

 Score = 31.6 bits (70), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 10/12 (83%), Positives = 12/12 (100%)

Query: 264 PLYYDVFGNPIT 275
           P+YYD+FGNPIT
Sbjct: 244 PMYYDIFGNPIT 255

>TBLA0E02040 Chr5 complement(494899..497004) [2106 bp, 701 aa] {ON}
           Anc_7.342 YLR206W
          Length = 701

 Score =  201 bits (510), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 109/254 (42%), Positives = 149/254 (58%), Gaps = 20/254 (7%)

Query: 1   MSKQFVRSAKNLVKGYSSTQVLVRNATSNDNHQVSKDSLIELAEKSYDSADFFEIMDMLD 60
           MS QFVRS KN+ KGYS TQVLVR+AT+N++   S D L +L E SYD+ +F +I  +LD
Sbjct: 1   MSHQFVRSTKNMFKGYSPTQVLVRDATANNDSGTSIDVLDQLGEMSYDTHEFRDIFSVLD 60

Query: 61  KRLNDKGKYWRHIAKALTVLDYLIRFGSENCVLWCKENLYIIKTLKEFRHEDDEGIDQGQ 120
           +R++DK KYWRH+AK+LTV+DYL+RFGSE CV W ++N   ++ L++F + D  GIDQGQ
Sbjct: 61  RRISDKPKYWRHVAKSLTVVDYLVRFGSEACVQWARDNARQLEILRDFYYSDSAGIDQGQ 120

Query: 121 IVRVKSKELTALLSDDERLNEERNMNIXXXXXXX------XXXXXXXXXXXDNDNDLQRA 174
           ++RVK+ EL  LL D ERL  ER MN+                        +++ D+ RA
Sbjct: 121 LIRVKAAELIDLLRDPERLATERGMNMRGRRNALPPRRMGPHRRPSMPRRPEDEEDVDRA 180

Query: 175 LDASRMTAXXXXXXXXXXXXXXT-----ALQLSKEEEELKRXXXXXXXXXXXXXXXXXPM 229
           L+ S+ TA                    A++LSKEE+ELKR                 P 
Sbjct: 181 LEESKKTAEEDEARRRKDQEREKQDLKEAVKLSKEEDELKR---------LQDEANNKPQ 231

Query: 230 YYDIFGNPITPEEY 243
           Y+D  GNPI+ EE+
Sbjct: 232 YFDENGNPISQEEW 245

 Score =  109 bits (272), Expect = 8e-25,   Method: Compositional matrix adjust.
 Identities = 52/83 (62%), Positives = 60/83 (72%)

Query: 347 LTQTRTGNQSMTDKYNKLNELLATGTGIDTFGNVGDARVPAQHTKTGTFINSQGTGYKQV 406
           L    TGN  ++ KY+ LN+LLA GTGIDTFGN G  R+PAQHTKTGTFINSQGTGYKQV
Sbjct: 591 LQPMHTGNSVISAKYSNLNQLLAQGTGIDTFGNEGATRIPAQHTKTGTFINSQGTGYKQV 650

Query: 407 SNDPKYNPFLSGQYTGLPSTNVV 429
           ++     P L  QYTGLP+   V
Sbjct: 651 TSSSSPIPLLPTQYTGLPAQTAV 673

>ACL157C Chr3 complement(79325..80872) [1548 bp, 515 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR206W
           (ENT2) and YDL161W (ENT1)
          Length = 515

 Score =  192 bits (489), Expect = 5e-55,   Method: Compositional matrix adjust.
 Identities = 120/256 (46%), Positives = 152/256 (59%), Gaps = 17/256 (6%)

Query: 1   MSKQFVRSAKNLVKGYSSTQVLVRNATSNDNHQVSKDSLIELAEKSYDSADFFEIMDMLD 60
           MSKQ +RSAKN+V GYS  Q+LVRNATSN+ +  S D + ELAE+SY + +FFEI+ MLD
Sbjct: 1   MSKQLLRSAKNVVNGYSPAQILVRNATSNEEYGPSMDQMEELAERSYSAVEFFEIVVMLD 60

Query: 61  KRLNDKGKYWRHIAKALTVLDYLIRFGSENCVLWCKENLYIIKTLKEFRHEDDE-GIDQG 119
           KRL+DK K+WRH+AK+LTV D+L+R G+E CV W +ENLY+ + L EF H D+  G+D G
Sbjct: 61  KRLSDKPKHWRHVAKSLTVTDFLVRTGAETCVDWARENLYLFRRLTEFYHVDESTGVDHG 120

Query: 120 QIVRVKSKELTALLSDDERLNEERNMNIXXXXXXXXXXXXXXXXXXDNDNDLQRALDASR 179
           QI+RVK++EL ALL D+ERL EERNM +                  D D DLQRAL+ SR
Sbjct: 121 QIIRVKARELVALLRDEERLREERNMRL--GRNPRNRQASVPPPAEDLDPDLQRALEESR 178

Query: 180 MTAXXXXXXXXXXXXXX-------TALQLS-------KEEEELKRXXXXXXXXXXXXXXX 225
           +TA                      ALQLS       K  E  ++               
Sbjct: 179 ITAEEEERRRREKTNQQQDNEELEVALQLSKEEEELRKLRELQQQREQQMALWQQQQQQQ 238

Query: 226 XXPMYYDIFGNPITPE 241
              MYYDIFGNPI+ E
Sbjct: 239 PQAMYYDIFGNPISLE 254

 Score =  155 bits (391), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 71/93 (76%), Positives = 83/93 (89%), Gaps = 1/93 (1%)

Query: 347 LTQTRTGNQSMTDKYNKLNELLATGTGIDTFGNVGDARVPAQHTKTGTFINSQGTGYKQV 406
           L  TRTGNQS+TDKY++LN LLA+GTG+DTFGN G  R+PAQHTKTGTFINSQGTGYKQV
Sbjct: 398 LQPTRTGNQSITDKYSELNTLLASGTGLDTFGNTGQTRIPAQHTKTGTFINSQGTGYKQV 457

Query: 407 SND-PKYNPFLSGQYTGLPSTNVVPTQTGYGFG 438
            N+ PK+NPF++ QYTGLPSTN+VP+ TGYGFG
Sbjct: 458 GNEPPKHNPFIATQYTGLPSTNMVPSHTGYGFG 490

>KNAG0B02650 Chr2 (511995..513935) [1941 bp, 646 aa] {ON} Anc_7.342
           YLR206W
          Length = 646

 Score =  191 bits (485), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 88/140 (62%), Positives = 113/140 (80%), Gaps = 1/140 (0%)

Query: 1   MSKQFVRSAKNLVKGYSSTQVLVRNATSNDNHQVSKDSLIELAEKSYDSADFFEIMDMLD 60
           MS+QFVRSAKN++KGYSSTQVLVR+AT+ND      D+L ++A  S+DS DFFEIMD+L+
Sbjct: 1   MSRQFVRSAKNVMKGYSSTQVLVRDATANDGRTPHLDTLEDIAGLSFDSVDFFEIMDVLE 60

Query: 61  KRLNDKGKYWRHIAKALTVLDYLIRFGSENCVLWCKENLYIIKTLKEFRHEDDE-GIDQG 119
           KRLND GKYWRHI K+LTVLDYL+RFGSE+C  W +++L+++K L+ FR  DD  G DQG
Sbjct: 61  KRLNDSGKYWRHIEKSLTVLDYLVRFGSEHCADWARDHLFLLKALRNFRFVDDGIGFDQG 120

Query: 120 QIVRVKSKELTALLSDDERL 139
           QIVRVK+++L  LL   E+L
Sbjct: 121 QIVRVKARDLVELLQSGEQL 140

 Score =  138 bits (347), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 64/97 (65%), Positives = 79/97 (81%), Gaps = 3/97 (3%)

Query: 345 EPLTQTRTGNQSMTDKYNKLNELLATGTGIDTFGNVGDARVPAQHTKTGTFINSQGTGYK 404
           +P+ +  TGNQ +T+KY++LN LLA GTG+DTFGN G  R+PAQHT+TGTFINSQGTG+K
Sbjct: 489 QPMPRMNTGNQEVTNKYSELNNLLAQGTGVDTFGNEGTQRIPAQHTQTGTFINSQGTGFK 548

Query: 405 QVSN---DPKYNPFLSGQYTGLPSTNVVPTQTGYGFG 438
           QV++   DP  NPFL+ QYTGLPST +VP  TGYGFG
Sbjct: 549 QVNSEGKDPNSNPFLNSQYTGLPSTGIVPAYTGYGFG 585

 Score = 33.5 bits (75), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 25/85 (29%), Positives = 35/85 (41%), Gaps = 11/85 (12%)

Query: 166 DNDNDLQRALDASRMTAXXXXXXXXXXX-------XXXTALQLSKEEEELKRXXXXXXXX 218
           ++D+DLQRA++ S+ T                       ALQLS+EEEELK         
Sbjct: 203 NDDDDLQRAIEESKRTVQEDEERRRQLSMYDEEDPEFQAALQLSREEEELKNLQHLQRLQ 262

Query: 219 XXXXXXXXXP----MYYDIFGNPIT 239
                          Y D+FGNP++
Sbjct: 263 QQQQQQQQQQQLNTAYLDVFGNPVS 287

>Kwal_47.16857 s47 (145176..146324) [1149 bp, 382 aa] {ON} YJR125C
           (ENT3) - Ent3p [contig 219] FULL
          Length = 382

 Score =  100 bits (248), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 54/143 (37%), Positives = 86/143 (60%), Gaps = 1/143 (0%)

Query: 2   SKQFVRSAKNLVKGYSSTQVLVRNATSNDNHQVSKDSLIELAEKSYDSADFFEIMDMLDK 61
           +K++ R A+N+V  Y+  +  VR AT+N+    S   + ++A+ +Y+  +  EI+ M+ +
Sbjct: 15  AKKYFRKAQNVVFNYTEMEAKVREATNNEPWGASSTLMEQIAQGTYNYREREEILGMIFR 74

Query: 62  RLNDK-GKYWRHIAKALTVLDYLIRFGSENCVLWCKENLYIIKTLKEFRHEDDEGIDQGQ 120
           R  +K    WR I KAL +LDYLIR G+E  +   + NL +IK L+ F + D +G DQG 
Sbjct: 75  RFTEKTASEWRQIYKALQLLDYLIRHGAERFIDDTRANLSLIKMLESFHYIDSQGRDQGI 134

Query: 121 IVRVKSKELTALLSDDERLNEER 143
            VR ++ EL  LL DD ++  ER
Sbjct: 135 NVRNRAHELALLLDDDAKVRAER 157

>NDAI0D03200 Chr4 complement(764129..765436) [1308 bp, 435 aa] {ON}
           Anc_4.346
          Length = 435

 Score =  100 bits (248), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 54/143 (37%), Positives = 88/143 (61%), Gaps = 1/143 (0%)

Query: 2   SKQFVRSAKNLVKGYSSTQVLVRNATSNDNHQVSKDSLIELAEKSYDSADFFEIMDMLDK 61
           +K++ R A+N+V  Y+  +  VR AT+N+    S   + ++A+ +Y+  + +EI+ M+ +
Sbjct: 15  AKKYFRKAQNVVFNYTEMESKVREATNNEPWGASSTLMEQIAQGTYNVRERYEIVGMIFR 74

Query: 62  RLNDK-GKYWRHIAKALTVLDYLIRFGSENCVLWCKENLYIIKTLKEFRHEDDEGIDQGQ 120
           R  +K G  WR I KAL +LDYLI+ GSE  +   + +L +I+ L+ F + D EG DQG 
Sbjct: 75  RFTEKAGSEWRQIYKALQLLDYLIKHGSEPFIDDVRSSLKLIQMLETFHYIDSEGRDQGI 134

Query: 121 IVRVKSKELTALLSDDERLNEER 143
            VR ++K L  LL DD  + +ER
Sbjct: 135 NVRNRAKLLVELLQDDSNIRQER 157

>KLTH0D16896g Chr4 complement(1395711..1396916) [1206 bp, 401 aa]
           {ON} similar to uniprot|P47160 Saccharomyces cerevisiae
           YJR125C ENT3 Protein containing an N-terminal epsin-like
           domain involved in clathrin recruitment and traffic
           between the Golgi and endosomes associates with the
           clathrin adaptor Gga2p
          Length = 401

 Score = 99.8 bits (247), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 53/143 (37%), Positives = 86/143 (60%), Gaps = 1/143 (0%)

Query: 2   SKQFVRSAKNLVKGYSSTQVLVRNATSNDNHQVSKDSLIELAEKSYDSADFFEIMDMLDK 61
           +K++ R A+N+V  Y+  +  VR AT+N+    S   + ++++ +Y+  +  EI+ M+ +
Sbjct: 15  AKKYFRKAQNMVFNYTEMEAKVREATNNEPWGASSTLMEQISQGTYNYREREEILGMIFR 74

Query: 62  RLNDK-GKYWRHIAKALTVLDYLIRFGSENCVLWCKENLYIIKTLKEFRHEDDEGIDQGQ 120
           R  +K    WR I KAL +LDYLIR G+E  +   + NL +IK L+ F + D +G DQG 
Sbjct: 75  RFTEKTASEWRQIYKALQLLDYLIRHGAERFIDDTRANLSLIKMLESFHYIDSQGRDQGI 134

Query: 121 IVRVKSKELTALLSDDERLNEER 143
            VR ++ EL  LL DD ++  ER
Sbjct: 135 NVRNRAHELVLLLDDDGKIRTER 157

>Kpol_1001.2 s1001 (8057..9313) [1257 bp, 418 aa] {ON} (8057..9313)
           [1257 nt, 419 aa]
          Length = 418

 Score = 99.0 bits (245), Expect = 8e-22,   Method: Compositional matrix adjust.
 Identities = 53/143 (37%), Positives = 89/143 (62%), Gaps = 1/143 (0%)

Query: 2   SKQFVRSAKNLVKGYSSTQVLVRNATSNDNHQVSKDSLIELAEKSYDSADFFEIMDMLDK 61
           +K++ R A+N++  Y+  +  VR AT+N+    S   + ++++ +Y+  +  EI+ M+ +
Sbjct: 15  AKKYFRKAQNVMFNYTEMEGKVREATNNEPWGASSTLMEQISQGTYNIREREEILSMIFR 74

Query: 62  RLNDK-GKYWRHIAKALTVLDYLIRFGSENCVLWCKENLYIIKTLKEFRHEDDEGIDQGQ 120
           R  +K    WR I KAL +L+YLI+ GSE  +   + +L +IK L+ F + D +G DQG 
Sbjct: 75  RFTEKTASEWRQIYKALQLLEYLIKHGSERFIDDVRSSLSLIKMLESFHYIDSQGRDQGI 134

Query: 121 IVRVKSKELTALLSDDERLNEER 143
            VR K++ LTALL DDE++  ER
Sbjct: 135 NVRNKAQSLTALLKDDEQIRAER 157

>Suva_12.216 Chr12 complement(334254..335486) [1233 bp, 410 aa] {ON}
           YJR125C (REAL)
          Length = 410

 Score = 99.0 bits (245), Expect = 8e-22,   Method: Compositional matrix adjust.
 Identities = 53/143 (37%), Positives = 87/143 (60%), Gaps = 1/143 (0%)

Query: 2   SKQFVRSAKNLVKGYSSTQVLVRNATSNDNHQVSKDSLIELAEKSYDSADFFEIMDMLDK 61
           +K++ R A+N+V  Y+  +  VR AT+N+    S   + ++++ +Y+  +  EI+ M+ +
Sbjct: 15  AKKYFRKAQNVVFNYTEMEGKVREATNNEPWGASSTLMDQISQGTYNFREREEILSMIFR 74

Query: 62  RLNDK-GKYWRHIAKALTVLDYLIRFGSENCVLWCKENLYIIKTLKEFRHEDDEGIDQGQ 120
           R  +K G  WR I KAL +LDYLI+ GSE  +   + ++ +IK L+ F + D +G DQG 
Sbjct: 75  RFTEKAGSEWRQIYKALQLLDYLIKHGSERFIDDTRSSINLIKILESFHYTDSQGRDQGI 134

Query: 121 IVRVKSKELTALLSDDERLNEER 143
            VR + K L  LLSDD ++  ER
Sbjct: 135 NVRTRVKALVELLSDDSKIRAER 157

>TDEL0D00710 Chr4 (127174..128301) [1128 bp, 375 aa] {ON} Anc_4.346
           YJR125C
          Length = 375

 Score = 98.2 bits (243), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 54/143 (37%), Positives = 87/143 (60%), Gaps = 1/143 (0%)

Query: 2   SKQFVRSAKNLVKGYSSTQVLVRNATSNDNHQVSKDSLIELAEKSYDSADFFEIMDMLDK 61
           +K++ R A+N+V  Y+  +  VR AT+N+    S   + ++++ +Y+  +  EI+ M+ +
Sbjct: 15  AKKYFRRAQNVVFNYTDMEAKVREATNNEPWGASTTLMEQISQGTYNMREREEILGMIFR 74

Query: 62  RLNDK-GKYWRHIAKALTVLDYLIRFGSENCVLWCKENLYIIKTLKEFRHEDDEGIDQGQ 120
           RL +K    WR I KAL +LDYLIR  SE  +   + ++ +IK L+ F + D +G DQG 
Sbjct: 75  RLTEKRANEWRQIYKALQLLDYLIRHASERFIDDTRSSISLIKMLESFHYIDSQGRDQGI 134

Query: 121 IVRVKSKELTALLSDDERLNEER 143
            VR ++K L  LLSDDE +  ER
Sbjct: 135 NVRNRAKALAELLSDDETIRAER 157

>TBLA0E04760 Chr5 complement(1226806..1228086) [1281 bp, 426 aa]
           {ON} Anc_4.346 YJR125C
          Length = 426

 Score = 98.6 bits (244), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 50/143 (34%), Positives = 87/143 (60%), Gaps = 1/143 (0%)

Query: 2   SKQFVRSAKNLVKGYSSTQVLVRNATSNDNHQVSKDSLIELAEKSYDSADFFEIMDMLDK 61
           +K++ R A+N+V  Y+  +  VR AT+N+    S   + ++A+ +Y+  +  EI+ M+ +
Sbjct: 15  AKKYFRKAQNVVFNYTDMEAKVREATNNEPWGASSTLMEQIAQGTYNPREREEILSMILR 74

Query: 62  RLNDK-GKYWRHIAKALTVLDYLIRFGSENCVLWCKENLYIIKTLKEFRHEDDEGIDQGQ 120
           R  +K G  WR I KAL +L+YLI  G+E  +   + +L +I+ L+ F + D EG DQG 
Sbjct: 75  RFTEKSGNLWRQIYKALQLLEYLITHGAERFIDEARSSLGLIRMLESFHYVDSEGRDQGA 134

Query: 121 IVRVKSKELTALLSDDERLNEER 143
            VR +++ +T+LLS D+ +   R
Sbjct: 135 NVRSRAQAMTSLLSSDDAIRSAR 157

>SAKL0G17952g Chr7 complement(1555520..1556767) [1248 bp, 415 aa]
           {ON} similar to uniprot|P47160 Saccharomyces cerevisiae
           YJR125C ENT3 Protein containing an N-terminal epsin-like
           domain involved in clathrin recruitment and traffic
           between the Golgi and endosomes associates with the
           clathrin adaptor Gga2p
          Length = 415

 Score = 97.4 bits (241), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 51/143 (35%), Positives = 88/143 (61%), Gaps = 1/143 (0%)

Query: 2   SKQFVRSAKNLVKGYSSTQVLVRNATSNDNHQVSKDSLIELAEKSYDSADFFEIMDMLDK 61
           +K++ R A+N+V  Y+  +  VR AT+N+    S   + +++  +Y+  +  EI+ M+ +
Sbjct: 15  AKKYFRKAQNVVFNYTEMEAKVREATNNEPWGASSTLMEQISAGTYNYREREEILGMIFR 74

Query: 62  RLNDK-GKYWRHIAKALTVLDYLIRFGSENCVLWCKENLYIIKTLKEFRHEDDEGIDQGQ 120
           R  +K    WR I KAL +L+YLI+ GSE  +   + NL +IK L+ F + D +G DQG 
Sbjct: 75  RFTEKTASEWRQIYKALQLLEYLIKHGSERFIDDSRANLTLIKMLESFHYTDSQGRDQGI 134

Query: 121 IVRVKSKELTALLSDDERLNEER 143
            VR +++EL  LL++D+++  ER
Sbjct: 135 NVRNRAQELVKLLNNDDQIRAER 157

>Skud_10.349 Chr10 complement(613398..614630) [1233 bp, 410 aa] {ON}
           YJR125C (REAL)
          Length = 410

 Score = 96.7 bits (239), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 53/143 (37%), Positives = 87/143 (60%), Gaps = 1/143 (0%)

Query: 2   SKQFVRSAKNLVKGYSSTQVLVRNATSNDNHQVSKDSLIELAEKSYDSADFFEIMDMLDK 61
           +K++ R A+N+V  Y+  +  VR AT+N+    S   + ++++ +Y+  +  EI+ M+ +
Sbjct: 15  AKKYFRKAQNVVFNYTEMEGKVREATNNEPWGASSTLMDQISQGTYNFREREEILSMIFR 74

Query: 62  RLNDK-GKYWRHIAKALTVLDYLIRFGSENCVLWCKENLYIIKTLKEFRHEDDEGIDQGQ 120
           R  +K G  WR I KAL +LDYLI+ GSE  +   + ++ +IK L+ F + D +G DQG 
Sbjct: 75  RFTEKAGSEWRQIYKALQLLDYLIKHGSERFIDDTRSSINLIKILETFHYIDSQGRDQGI 134

Query: 121 IVRVKSKELTALLSDDERLNEER 143
            VR + K L  LLSDD ++  ER
Sbjct: 135 NVRTRVKTLIELLSDDNKIRAER 157

>KNAG0M00380 Chr13 (56675..57886) [1212 bp, 403 aa] {ON} Anc_4.346
           YJR125C
          Length = 403

 Score = 96.7 bits (239), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 52/143 (36%), Positives = 86/143 (60%), Gaps = 1/143 (0%)

Query: 2   SKQFVRSAKNLVKGYSSTQVLVRNATSNDNHQVSKDSLIELAEKSYDSADFFEIMDMLDK 61
           +K++ R A+N+V  ++  +  VR AT+N+    S   + ++A+ +Y+  +  E+M ML +
Sbjct: 15  AKKYFRKAQNVVFNFTEMESKVREATNNEPWGASSTLMEQIAQGTYNYKEREEVMMMLMR 74

Query: 62  RLNDK-GKYWRHIAKALTVLDYLIRFGSENCVLWCKENLYIIKTLKEFRHEDDEGIDQGQ 120
           R  +K G  WR I KAL +LDYLIR GSE  +   +  L I++ L+ F + D +G DQG 
Sbjct: 75  RFTEKAGSEWRQIYKALQLLDYLIRRGSEKFIDDVRAALRIVRLLESFHYIDSQGRDQGV 134

Query: 121 IVRVKSKELTALLSDDERLNEER 143
            VR ++K++  LL DD  + + R
Sbjct: 135 NVRNRAKQIVELLQDDAAVRDAR 157

>YJR125C Chr10 complement(654737..655963) [1227 bp, 408 aa] {ON}
           ENT3Protein containing an N-terminal epsin-like domain
           involved in clathrin recruitment and traffic between the
           Golgi and endosomes; associates with the clathrin
           adaptor Gga2p
          Length = 408

 Score = 96.3 bits (238), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 52/143 (36%), Positives = 87/143 (60%), Gaps = 1/143 (0%)

Query: 2   SKQFVRSAKNLVKGYSSTQVLVRNATSNDNHQVSKDSLIELAEKSYDSADFFEIMDMLDK 61
           +K++ R A+N+V  Y+  +  VR AT+N+    S   + ++++ +Y+  +  EI+ M+ +
Sbjct: 15  AKKYFRKAQNVVFNYTEMEGKVREATNNEPWGASSTLMDQISQGTYNFREREEILSMIFR 74

Query: 62  RLNDK-GKYWRHIAKALTVLDYLIRFGSENCVLWCKENLYIIKTLKEFRHEDDEGIDQGQ 120
           R  +K G  WR I KAL +LDYLI+ GSE  +   + ++ +I+ L+ F + D +G DQG 
Sbjct: 75  RFTEKAGSEWRQIYKALQLLDYLIKHGSERFIDDTRNSINLIRILETFHYIDSQGRDQGI 134

Query: 121 IVRVKSKELTALLSDDERLNEER 143
            VR + K L  LLSDD ++  ER
Sbjct: 135 NVRTRVKALIELLSDDNKIRAER 157

>Smik_10.418 Chr10 complement(643833..645062) [1230 bp, 409 aa] {ON}
           YJR125C (REAL)
          Length = 409

 Score = 96.3 bits (238), Expect = 7e-21,   Method: Compositional matrix adjust.
 Identities = 52/143 (36%), Positives = 87/143 (60%), Gaps = 1/143 (0%)

Query: 2   SKQFVRSAKNLVKGYSSTQVLVRNATSNDNHQVSKDSLIELAEKSYDSADFFEIMDMLDK 61
           +K++ R A+N+V  Y+  +  VR AT+N+    S   + ++++ +Y+  +  EI+ M+ +
Sbjct: 15  AKKYFRKAQNVVFNYTEMEGKVREATNNEPWGASSTLMDQISQGTYNFREREEILSMIFR 74

Query: 62  RLNDK-GKYWRHIAKALTVLDYLIRFGSENCVLWCKENLYIIKTLKEFRHEDDEGIDQGQ 120
           R  +K G  WR I KAL +LDYLI+ GSE  +   + ++ +I+ L+ F + D +G DQG 
Sbjct: 75  RFTEKAGSEWRQIYKALQLLDYLIKHGSERFIDDTRNSINLIRILETFHYIDSQGRDQGI 134

Query: 121 IVRVKSKELTALLSDDERLNEER 143
            VR + K L  LLSDD ++  ER
Sbjct: 135 NVRTRVKALIDLLSDDNKIRAER 157

>KAFR0B06740 Chr2 (1406075..1407274) [1200 bp, 399 aa] {ON}
           Anc_4.346 YJR125C
          Length = 399

 Score = 95.5 bits (236), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 53/143 (37%), Positives = 89/143 (62%), Gaps = 1/143 (0%)

Query: 2   SKQFVRSAKNLVKGYSSTQVLVRNATSNDNHQVSKDSLIELAEKSYDSADFFEIMDMLDK 61
           +K++ R A+N+V  Y+  +  VR AT+N+    S   + ++A+ +Y+  +  EI+ M+ +
Sbjct: 15  AKKYFRKAQNVVFNYTEMEGKVREATNNEPWGASSTLMEQIAQGTYNLREREEILGMIFR 74

Query: 62  RLNDK-GKYWRHIAKALTVLDYLIRFGSENCVLWCKENLYIIKTLKEFRHEDDEGIDQGQ 120
           R  +K G  WR I K+L +LDYLIR GSE  +   + ++ +I+ L+ F + D +G DQG 
Sbjct: 75  RFTEKAGSEWRQIYKSLQLLDYLIRRGSERFIDDVRSSIRLIELLETFHYIDSQGRDQGI 134

Query: 121 IVRVKSKELTALLSDDERLNEER 143
            VR ++K L  LLSDD ++ +ER
Sbjct: 135 NVRNRAKALGELLSDDTKIRQER 157

>KLLA0B04587g Chr2 (411097..412299) [1203 bp, 400 aa] {ON} similar
           to uniprot|P47160 Saccharomyces cerevisiae YJR125C ENT3
           Protein containing an N-terminal epsin-like domain
           involved in clathrin recruitment and traffic between the
           Golgi and endosomes associates with the clathrin adaptor
           Gga2p
          Length = 400

 Score = 95.5 bits (236), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 50/143 (34%), Positives = 86/143 (60%), Gaps = 1/143 (0%)

Query: 2   SKQFVRSAKNLVKGYSSTQVLVRNATSNDNHQVSKDSLIELAEKSYDSADFFEIMDMLDK 61
           +K++ R A+N+V  Y+  +  VR AT+N+    S   +  +A+ +Y+  +  EI+ M+ +
Sbjct: 15  AKKYFRKAQNVVFNYTEMEAKVREATNNEPWGASSTLMEHIAQGTYNYREREEILGMIFR 74

Query: 62  RLNDK-GKYWRHIAKALTVLDYLIRFGSENCVLWCKENLYIIKTLKEFRHEDDEGIDQGQ 120
           R  +K    WR I KAL +L+YL++ GSE  +   + NL ++K L+ F + D +G DQG 
Sbjct: 75  RFTEKTASEWRQIYKALQLLEYLVKHGSERFIDDVRTNLNLVKMLESFHYIDSQGRDQGI 134

Query: 121 IVRVKSKELTALLSDDERLNEER 143
            VR ++ +L  LL  DE++ +ER
Sbjct: 135 NVRNRASQLVKLLESDEQIRQER 157

>ZYRO0B14784g Chr2 complement(1205944..1207218) [1275 bp, 424 aa]
           {ON} similar to uniprot|P47160 Saccharomyces cerevisiae
           YJR125C ENT3 Protein containing an N-terminal epsin-like
           domain involved in clathrin recruitment and traffic
           between the Golgi and endosomes associates with the
           clathrin adaptor Gga2p
          Length = 424

 Score = 94.4 bits (233), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 51/143 (35%), Positives = 86/143 (60%), Gaps = 1/143 (0%)

Query: 2   SKQFVRSAKNLVKGYSSTQVLVRNATSNDNHQVSKDSLIELAEKSYDSADFFEIMDMLDK 61
           +K++ R A+N+V  Y+  +  VR AT+N+    S   +  +A+ +Y+  +  EI+ M+ +
Sbjct: 50  AKKYFRKAQNVVFNYTEMEAKVREATNNEPWGTSSTLMEYIAQGTYNLREREEILGMIFR 109

Query: 62  RLNDK-GKYWRHIAKALTVLDYLIRFGSENCVLWCKENLYIIKTLKEFRHEDDEGIDQGQ 120
           R  +K    WR I KAL +L+YLI+ GSE  +   + ++ ++K L+ F + D +G DQG 
Sbjct: 110 RFTEKTANEWRQIYKALQLLEYLIKHGSERFIDDTRCSISLLKMLESFHYVDSQGRDQGI 169

Query: 121 IVRVKSKELTALLSDDERLNEER 143
            VR ++K LT LL DD ++  ER
Sbjct: 170 NVRTRAKALTELLGDDNKIRAER 192

>NCAS0A06210 Chr1 complement(1229758..1231029) [1272 bp, 423 aa]
           {ON} Anc_4.346
          Length = 423

 Score = 94.0 bits (232), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 52/143 (36%), Positives = 85/143 (59%), Gaps = 1/143 (0%)

Query: 2   SKQFVRSAKNLVKGYSSTQVLVRNATSNDNHQVSKDSLIELAEKSYDSADFFEIMDMLDK 61
           +K++ R A+N+V  Y+  +  VR AT+N+    S   + ++A+ +Y+  +  EI+ M+ +
Sbjct: 15  AKKYFRKAQNVVFNYTEMEGKVREATNNEPWGASSTLMEQIAQGTYNIREREEILSMIFR 74

Query: 62  RLNDK-GKYWRHIAKALTVLDYLIRFGSENCVLWCKENLYIIKTLKEFRHEDDEGIDQGQ 120
           R  +K G  WR I KAL +LDYLI+ GSE  +   + ++ ++K L+ F + D EG DQG 
Sbjct: 75  RFTEKTGSEWRQIYKALQLLDYLIKHGSEKFIDDVRSSVAVLKLLQTFHYIDAEGRDQGI 134

Query: 121 IVRVKSKELTALLSDDERLNEER 143
            VR +   L  LL DD  + +ER
Sbjct: 135 NVRNRVTTLIELLRDDNSIRQER 157

>AER155C Chr5 complement(929042..930136) [1095 bp, 364 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YJR125C
           (ENT3)
          Length = 364

 Score = 92.8 bits (229), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 49/143 (34%), Positives = 86/143 (60%), Gaps = 1/143 (0%)

Query: 2   SKQFVRSAKNLVKGYSSTQVLVRNATSNDNHQVSKDSLIELAEKSYDSADFFEIMDMLDK 61
           +K++ R A+N++  Y+  +  VR AT+N+    S   + ++A+ +Y+  +  EI+ M+ +
Sbjct: 15  AKKYFRKAQNVMLNYTGMEAKVREATNNEPWGASSTLMTQIAQGTYNFREREEILAMILR 74

Query: 62  RLNDK-GKYWRHIAKALTVLDYLIRFGSENCVLWCKENLYIIKTLKEFRHEDDEGIDQGQ 120
           R  +K    WR I K++ +L+YL++ GSE  +   + NL +I+ L+ F + D +G DQG 
Sbjct: 75  RFLEKSANEWRQIYKSMQLLEYLVKHGSERFIDDVRSNLNLIRMLETFHYIDSQGRDQGI 134

Query: 121 IVRVKSKELTALLSDDERLNEER 143
            VR ++K L  LL DDE +  ER
Sbjct: 135 NVRNRTKALVKLLEDDELIRAER 157

>TPHA0B00400 Chr2 (83356..84555) [1200 bp, 399 aa] {ON} Anc_4.346
           YJR125C
          Length = 399

 Score = 89.7 bits (221), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 49/143 (34%), Positives = 85/143 (59%), Gaps = 1/143 (0%)

Query: 2   SKQFVRSAKNLVKGYSSTQVLVRNATSNDNHQVSKDSLIELAEKSYDSADFFEIMDMLDK 61
           +K++ R A+N++  Y+  +  VR AT+N+    S   + ++A+ +Y+  +  EI+ M+ +
Sbjct: 15  AKKYFRKAQNVMFNYTDMEAKVREATNNEPWGASSTLMKQIAQGTYNIREREEILGMVFR 74

Query: 62  RLNDK-GKYWRHIAKALTVLDYLIRFGSENCVLWCKENLYIIKTLKEFRHEDDEGIDQGQ 120
           R  +K    WR I K+L + DYLI+ GSE  +   + ++ +IK L+ F + D +G DQG 
Sbjct: 75  RYTEKTASEWRQIYKSLQLTDYLIKHGSERFIDDVRTSISLIKMLESFHYIDSQGRDQGI 134

Query: 121 IVRVKSKELTALLSDDERLNEER 143
            VR K++ L A L DD+ +  ER
Sbjct: 135 NVRNKAQSLVAFLKDDDLIRAER 157

>Ecym_1133 Chr1 (274069..275247) [1179 bp, 392 aa] {ON} similar to
           Ashbya gossypii AER155C
          Length = 392

 Score = 88.6 bits (218), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 48/143 (33%), Positives = 86/143 (60%), Gaps = 1/143 (0%)

Query: 2   SKQFVRSAKNLVKGYSSTQVLVRNATSNDNHQVSKDSLIELAEKSYDSADFFEIMDMLDK 61
           +K++ R A+N+V  Y+  +  VR AT+N++       + ++A+ +Y+  +  EI+ M+ +
Sbjct: 15  AKKYFRKAQNVVFNYTGMEAKVREATNNESWGAPSSLMAQIAQGTYNYRERKEILGMIFR 74

Query: 62  RLNDK-GKYWRHIAKALTVLDYLIRFGSENCVLWCKENLYIIKTLKEFRHEDDEGIDQGQ 120
           R  +K    WR I K++ +L+YLI  GSE  +   +  L +IK L+ F + D +G DQG 
Sbjct: 75  RFVEKTASEWRQIYKSVQLLEYLIYHGSEGFIDDVRSGLNLIKMLESFHYIDSQGRDQGI 134

Query: 121 IVRVKSKELTALLSDDERLNEER 143
            VR +++ L  LL++DE++  ER
Sbjct: 135 NVRNRTQALVQLLNNDEQIRIER 157

>CAGL0H04323g Chr8 (407884..409122) [1239 bp, 412 aa] {ON} similar
           to uniprot|P47160 Saccharomyces cerevisiae YJR125c ENT3
           cytoskeletal adaptor
          Length = 412

 Score = 86.3 bits (212), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 53/143 (37%), Positives = 88/143 (61%), Gaps = 1/143 (0%)

Query: 2   SKQFVRSAKNLVKGYSSTQVLVRNATSNDNHQVSKDSLIELAEKSYDSADFFEIMDMLDK 61
           +K++ R A+N+V  Y+  +  VR AT+N+    S   + ++A+ +Y+  +  EI+ M+ +
Sbjct: 15  AKKYFRKAQNVVYNYTDMESKVREATNNEPWGASSTLMEQIAQGTYNIREREEILGMIFR 74

Query: 62  RLNDK-GKYWRHIAKALTVLDYLIRFGSENCVLWCKENLYIIKTLKEFRHEDDEGIDQGQ 120
           R  +K G  WR I KAL +L+YLI+ GSE  +   + ++ I+K L+ F + D +G DQG 
Sbjct: 75  RFTEKSGSEWRQIYKALQLLEYLIKHGSERFIDDTRNSISIVKLLESFHYIDSQGRDQGV 134

Query: 121 IVRVKSKELTALLSDDERLNEER 143
            VR ++  LTALL+DD  +  ER
Sbjct: 135 NVRNRAAALTALLADDSSIRAER 157

>SAKL0H25762g Chr8 (2256842..2257630) [789 bp, 262 aa] {ON} some
           similarities with uniprot|Q07872 Saccharomyces
           cerevisiae YLL038C ENT4 Protein of unknown function
           contains an N-terminal epsin-like domain
          Length = 262

 Score = 78.2 bits (191), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 50/147 (34%), Positives = 83/147 (56%), Gaps = 12/147 (8%)

Query: 5   FVRSAKNLVKGYSSTQVLVRNATSNDNHQVSKDSLI-ELAEKSYDSADFFEIMDMLDKRL 63
           F+RS +N+  G S+T+V V+ AT +D +  +  +L+ E++  +Y +    EI  ++ +RL
Sbjct: 3   FIRSVRNM--GQSTTEVKVKKATDDDEYSGATGALMNEISVLTYSAKTLREITQVIHRRL 60

Query: 64  NDKGKYWR-------HIAKALTVLDYLIRFGSENCVLWCKENLYIIKTLKEFRHEDDEGI 116
           +  G Y +       HI K LT++ YLI  GS + V W ++  Y++ TL+EF    D+  
Sbjct: 61  S--GNYRKSSHRNAVHILKTLTLISYLINNGSNDFVSWIRQYAYLVDTLREFNVSADKDR 118

Query: 117 DQGQIVRVKSKELTALLSDDERLNEER 143
              + VR+ S +L+ LL DD  L E R
Sbjct: 119 KMAEQVRMLSIKLSKLLKDDLMLQERR 145

>Kwal_55.20611 s55 complement(489968..490732) [765 bp, 254 aa] {ON}
           YLL038C (ENT4) - Ent4p [contig 144] FULL
          Length = 254

 Score = 75.1 bits (183), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 49/146 (33%), Positives = 78/146 (53%), Gaps = 8/146 (5%)

Query: 5   FVRSAKNLVKGYSSTQVLVRNATSNDNHQVSKDSLI-ELAEKSYDSADFFEIMDMLDKRL 63
            +++ +N+  G SST+V  RNAT++D H  +  SL+ EL+  +Y      EI  ++ KRL
Sbjct: 3   LLKTVRNI--GQSSTEVKTRNATNDDEHNGATGSLMNELSVLTYSPRTLREITQVIRKRL 60

Query: 64  NDKGKYWRH-----IAKALTVLDYLIRFGSENCVLWCKENLYIIKTLKEFRHEDDEGIDQ 118
           +   +   H     + K LT++ YLI  GS+  V+W +  LY+I TLKEF          
Sbjct: 61  SGNSRMSSHKNAVHLLKTLTLIAYLINNGSDEFVVWIRSYLYLIDTLKEFNGGSRTKERM 120

Query: 119 GQIVRVKSKELTALLSDDERLNEERN 144
              +R  +  L A+L D+E L + R+
Sbjct: 121 ASQIRNLASSLAAILRDEELLRQRRS 146

>TBLA0B06220 Chr2 (1466908..1467927) [1020 bp, 339 aa] {ON}
           Anc_4.346 YJR125C
          Length = 339

 Score = 69.7 bits (169), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 46/143 (32%), Positives = 76/143 (53%), Gaps = 1/143 (0%)

Query: 2   SKQFVRSAKNLVKGYSSTQVLVRNATSNDNHQVSKDSLIELAEKSYDSADFFEIMDMLDK 61
           +K+F R A+N +   +  +  VR AT+ND    S   + ++   +++     +I++ML  
Sbjct: 15  AKKFFRMAENFLFNLTDMESKVREATNNDPWGTSVILMAQINAGTFEINQRADIINMLLN 74

Query: 62  RLNDK-GKYWRHIAKALTVLDYLIRFGSENCVLWCKENLYIIKTLKEFRHEDDEGIDQGQ 120
           R  +K G  WR I K++ +L YL+  GS   V   K NL +IK L  F   DD+G +Q  
Sbjct: 75  RFLEKNGSQWRQIYKSVLLLQYLLINGSTEFVSEVKLNLTLIKNLMLFEFIDDQGYNQSS 134

Query: 121 IVRVKSKELTALLSDDERLNEER 143
            +   ++ L  L++DD  LN+ R
Sbjct: 135 KISKATERLIELMTDDHLLNDLR 157

>Kpol_388.5 s388 complement(17825..18631) [807 bp, 268 aa] {ON}
           complement(17825..18631) [807 nt, 269 aa]
          Length = 268

 Score = 66.2 bits (160), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 46/144 (31%), Positives = 77/144 (53%), Gaps = 12/144 (8%)

Query: 8   SAKNLVKGYSSTQVLVRNATSNDNHQVSKDSLI-ELAEKSYDSADFFEIMDMLDKRLNDK 66
           S +N V+  S+T+  V+ AT ++    +  +L+ E++  +Y      EI+ +L KRL   
Sbjct: 6   SVRNFVQ--SATEAKVKEATDDNETSGATGTLMNEISVLTYSPKTLKEIIQVLKKRLTGS 63

Query: 67  GKY-----WRHIAKALTVLDYLIRFGSENCVLWCKENLYIIKTLKEFR--HEDDEGIDQG 119
            K        HI K +T++ YLI  GS + + W + N+ I + LK+F   HEDDE +   
Sbjct: 64  SKKSSHRNCVHILKTMTLISYLINNGSNDFIAWARSNIMIFEVLKDFEVIHEDDEKM--A 121

Query: 120 QIVRVKSKELTALLSDDERLNEER 143
           + +R  + +L  L++DDE L   R
Sbjct: 122 EQIRYIAGDLCILINDDELLEARR 145

>TDEL0G01740 Chr7 (342371..343144) [774 bp, 257 aa] {ON} Anc_4.17
           YLL038C
          Length = 257

 Score = 65.5 bits (158), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 46/144 (31%), Positives = 78/144 (54%), Gaps = 12/144 (8%)

Query: 8   SAKNLVKGYSSTQVLVRNATSNDNHQVSKDSLI-ELAEKSYDSADFFEIMDMLDKRLNDK 66
           S + LV+  S+T++ V+ AT  +    +  +L+ E++  +Y      EI+ ++ KRL   
Sbjct: 6   SVRTLVQ--STTELKVKQATDENESSGATGTLMNEISVLTYSPKTLKEIVQVVRKRLMGH 63

Query: 67  G-----KYWRHIAKALTVLDYLIRFGSENCVLWCKENLYIIKTLKEFRHED--DEGIDQG 119
           G     K   H+ K LT++ YL+  GS + + W + N+ ++  LKEF  +D  DE I  G
Sbjct: 64  GRRNSHKICIHLVKTLTLVTYLMNNGSNDFIAWVRGNMALVDCLKEFNVQDRNDEKI--G 121

Query: 120 QIVRVKSKELTALLSDDERLNEER 143
           Q +R  S++L  L+ DD+ L   R
Sbjct: 122 QQIRAMSQDLCTLIKDDDLLENRR 145

>Ecym_8407 Chr8 (843359..844123) [765 bp, 254 aa] {ON} similar to
           Ashbya gossypii ACL061C
          Length = 254

 Score = 64.7 bits (156), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 45/145 (31%), Positives = 75/145 (51%), Gaps = 8/145 (5%)

Query: 5   FVRSAKNLVKGYSSTQVLVRNATSNDNHQVSKDSLI-ELAEKSYDSADFFEIMDMLDKRL 63
           F+ S ++L  G SST V V+ AT +  H  +  SL+ E+A  +Y      EI  +L KRL
Sbjct: 3   FLSSVRHL--GSSSTTVKVKKATDDSEHNGAYGSLMNEIAILTYSPNTLREITQVLKKRL 60

Query: 64  -----NDKGKYWRHIAKALTVLDYLIRFGSENCVLWCKENLYIIKTLKEFRHEDDEGIDQ 118
                    K   ++ K LT++ +L+  GSE C+ W + +L +I++ ++F   D E    
Sbjct: 61  VGNYKKTPSKRAVNLLKTLTLIRFLVINGSEECIAWLRRHLVLIRSFQDFTLRDGEKKQM 120

Query: 119 GQIVRVKSKELTALLSDDERLNEER 143
              +++ S +L  LL+D   L + R
Sbjct: 121 VNQIQLLSCKLCQLLTDSNLLEDMR 145

>KLTH0E05874g Chr5 complement(530814..531581) [768 bp, 255 aa] {ON}
           similar to uniprot|Q07872 Saccharomyces cerevisiae
           YLL038C ENT4 Protein of unknown function contains an N-
           terminal epsin-like domain
          Length = 255

 Score = 62.4 bits (150), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 46/140 (32%), Positives = 74/140 (52%), Gaps = 14/140 (10%)

Query: 15  GYSSTQVLVRNATSNDNHQVSKDSLI-ELAEKSYDSADFFEIMDMLDKRL---NDKGKYW 70
           G S T++  +NAT++D +  +  SL+ E++  +Y S    EI  ++ KRL   N K  + 
Sbjct: 11  GQSQTEIKTKNATNDDEYSGATGSLMNEISVLTYSSRTLREITAVVRKRLSGNNRKSSHK 70

Query: 71  R--HIAKALTVLDYLIRFGSENCVLWCKENLYIIKTLKEF----RHEDDEGIDQGQIVRV 124
              HI K LT+  YLI  GS   V W +  +Y+I +LKEF    R ++   +     +R 
Sbjct: 71  NAVHILKTLTLTAYLINNGSNEFVAWIRSYVYLIDSLKEFTIGSRGQERMAVQ----IRS 126

Query: 125 KSKELTALLSDDERLNEERN 144
            +  L+ +L DDE L + R+
Sbjct: 127 LASTLSVILRDDELLRQRRS 146

>TPHA0F00230 Chr6 complement(43589..44431) [843 bp, 280 aa] {ON}
           Anc_4.17 YLL038C
          Length = 280

 Score = 59.7 bits (143), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 42/142 (29%), Positives = 74/142 (52%), Gaps = 8/142 (5%)

Query: 8   SAKNLVKGYSSTQVLVRNATSNDNHQVSKDSLI-ELAEKSYDSADFFEIMDMLDKRLN-- 64
           S +N V+  S T+  VR AT +D    +  +L+ E++  +Y      EI+ +L KRL   
Sbjct: 6   SVRNFVQ--SPTESKVRQATDDDETSGATGTLMNEISVLTYSPKTLKEIVQILKKRLTGY 63

Query: 65  ---DKGKYWRHIAKALTVLDYLIRFGSENCVLWCKENLYIIKTLKEFRHEDDEGIDQGQI 121
              +  K   HI K LT++ YLI  GS + + W + N+ + + LK F  ++ E    GQ 
Sbjct: 64  SKKNSHKNCVHILKTLTLITYLINNGSNDFIAWTRSNIMLFEYLKNFEVQNLEDEKMGQQ 123

Query: 122 VRVKSKELTALLSDDERLNEER 143
           +     ++  +++DD+ L ++R
Sbjct: 124 IVFICNDICNIINDDDMLEQKR 145

>ZYRO0G07876g Chr7 complement(636468..637247) [780 bp, 259 aa] {ON}
           similar to uniprot|Q07872 Saccharomyces cerevisiae
           YLL038C ENT4 Protein of unknown function contains an N-
           terminal epsin-like domain
          Length = 259

 Score = 59.3 bits (142), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 46/139 (33%), Positives = 72/139 (51%), Gaps = 10/139 (7%)

Query: 13  VKGYSSTQVLVRNATSNDNHQVSKDSLI-ELAEKSYDSADFFEIMDMLDKRLNDKGKYWR 71
           V G SST++ VR AT+ D    +  +L+ E++  +Y      EI  +L +RL+  G+   
Sbjct: 9   VFGPSSTELKVRKATNEDEKTGATGTLMNEISVLTYSPKTVREITQVLKRRLSSYGRRTS 68

Query: 72  H-----IAKALTVLDYLIRFGSENCVLWCKENLYIIKTLK--EFRHEDDEGIDQGQIVRV 124
           H     I KALT++ YLI  GSE  V W + NL   + LK  E   + DE +   + +R 
Sbjct: 69  HKNSIHIVKALTLILYLINNGSEEFVAWVRGNLIYFECLKSCEVSQKRDEPL--AKQIRS 126

Query: 125 KSKELTALLSDDERLNEER 143
            S ++   + DDE L  ++
Sbjct: 127 MSNQICDCVKDDELLENKK 145

>Suva_10.35 Chr10 complement(70188..70931) [744 bp, 247 aa] {ON}
           YLL038C (REAL)
          Length = 247

 Score = 58.2 bits (139), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 40/134 (29%), Positives = 69/134 (51%), Gaps = 7/134 (5%)

Query: 17  SSTQVLVRNATSNDNHQVSKDSLI-ELAEKSYDSADFFEIMDMLDKRL------NDKGKY 69
           S T+  V+ ATS D    +  +L+ E++  +Y      EI+ ++ KRL       +  + 
Sbjct: 13  SPTESKVKQATSEDETSGATGTLMNEISILTYSPKTVREIIQIVRKRLLLGQNRRNSHRS 72

Query: 70  WRHIAKALTVLDYLIRFGSENCVLWCKENLYIIKTLKEFRHEDDEGIDQGQIVRVKSKEL 129
              + K LT++ YL+  GS   + W K N+ +I+ L++F+ +D      G+ +R  S+ L
Sbjct: 73  CIQVMKTLTLVSYLMNNGSNEFIKWLKGNMILIEILEDFQAQDARDDRNGEEIRKLSRNL 132

Query: 130 TALLSDDERLNEER 143
             LL DDE L  +R
Sbjct: 133 HELLQDDELLERQR 146

>KLLA0D03949g Chr4 (333566..334243) [678 bp, 225 aa] {ON} similar to
           uniprot|Q07872 Saccharomyces cerevisiae YLL038C ENT4
           Protein of unknown function contains an N- terminal
           epsin- like domain
          Length = 225

 Score = 55.1 bits (131), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 40/141 (28%), Positives = 80/141 (56%), Gaps = 9/141 (6%)

Query: 15  GYSSTQVLVRNAT-SNDNHQVSKDSLIELAEKSYDSADFFEIMDMLDKRLNDKGKYWR-- 71
           G S+TQ+ V+ AT SN+++  +   + EL+  +Y      EI +++ KRL +     +  
Sbjct: 11  GQSTTQLKVKQATDSNESYGATGTLMNELSVLTYSEKSANEIYEVIRKRLMNGSSRLKNS 70

Query: 72  -----HIAKALTVLDYLIRFGSENCVLWCKENLYIIKTLKEFRHEDDEGIDQGQIVRVKS 126
                 + K LT+++YL+  GSE  VLW + +L  I+ LK++   +D+   + + ++  S
Sbjct: 71  HDSVVQVLKTLTLIEYLLYNGSEEFVLWMRRHLAYIEALKDYHCSNDKDKSKVKQIKSLS 130

Query: 127 KELTALLSDDERLNEERNMNI 147
           ++++  L +D+ L E+R ++I
Sbjct: 131 EDISKNLKEDDFL-EKRRLDI 150

>TBLA0G00650 Chr7 (140678..141949) [1272 bp, 423 aa] {ON} Anc_4.17
           YLL038C
          Length = 423

 Score = 55.8 bits (133), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 44/144 (30%), Positives = 74/144 (51%), Gaps = 9/144 (6%)

Query: 8   SAKNLVKGYSSTQVLVRNATS-NDNHQVSKDSLIELAEKSYDSADFFEIMDMLDKRLNDK 66
           S +N V+  S T++ VR AT  N+N   +   + E++  +Y +    EI+ +L KRL   
Sbjct: 6   SVRNFVQ--SPTELKVRTATDDNENSGATGTLMNEISVLTYSTKTNKEIVTVLKKRLTGY 63

Query: 67  GKYWRH-----IAKALTVLDYLIRFGSENCVLWCKENLYIIKTLKEFRHEDDEGIDQGQI 121
           GK   H     I K LT++ YL+  GS   + W  EN  + + +K F   D    ++  I
Sbjct: 64  GKKSSHRNCIHIIKTLTLIAYLMNNGSLEFIRWINENQLLFEVMKNFEVSDTIHDEKFAI 123

Query: 122 -VRVKSKELTALLSDDERLNEERN 144
            +R  S+ +  L+++ E L ++RN
Sbjct: 124 QIRDLSERILELINNRELLEQKRN 147

>ACL061C Chr3 complement(256803..257507) [705 bp, 234 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLL038C
           (ENT4)
          Length = 234

 Score = 53.1 bits (126), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 39/135 (28%), Positives = 63/135 (46%), Gaps = 6/135 (4%)

Query: 15  GYSSTQVLVRNATSNDNHQVSKDSLI-ELAEKSYDSADFFEIMDMLDKRLNDKG-----K 68
           G S T   VR AT ++    +  +LI E+   +Y      ++  +L KRL+        K
Sbjct: 11  GSSPTAAKVRKATDDNEFVGASSALISEITILTYSCKTLLDVTRVLKKRLSGNANKSSHK 70

Query: 69  YWRHIAKALTVLDYLIRFGSENCVLWCKENLYIIKTLKEFRHEDDEGIDQGQIVRVKSKE 128
              HI KALT+ +YLI  GSE+ V W +    +++ LK+F   ++        +R  S  
Sbjct: 71  NAVHILKALTLTNYLIANGSEDFVQWLQGCAVLLRRLKDFTTGNERDSHMASQIRSFSLS 130

Query: 129 LTALLSDDERLNEER 143
           L  L+ +   L + R
Sbjct: 131 LLELMQNPALLEDHR 145

>Skud_12.30 Chr12 complement(56967..57710) [744 bp, 247 aa] {ON}
           YLL038C (REAL)
          Length = 247

 Score = 50.8 bits (120), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 38/134 (28%), Positives = 67/134 (50%), Gaps = 7/134 (5%)

Query: 17  SSTQVLVRNATSNDNHQVSKDSLI-ELAEKSYDSADFFEIMDMLDKRL------NDKGKY 69
           S T+  V+ ATS D    +  +L+ E++  +Y      EI+ ++ KRL       +  + 
Sbjct: 13  SPTESKVKQATSEDETSGATGTLMNEISILTYSPKTVREIIQVIRKRLLLGQNRRNSHRN 72

Query: 70  WRHIAKALTVLDYLIRFGSENCVLWCKENLYIIKTLKEFRHEDDEGIDQGQIVRVKSKEL 129
              + K LT++ YL+  GS   + W K N+ +I+ L+ F  +D     + + +R  S+ L
Sbjct: 73  CIQVMKTLTLVSYLMNNGSNEFIKWLKGNMILIEILENFHIQDVRDERKREEIRKLSRNL 132

Query: 130 TALLSDDERLNEER 143
             LL DD  L ++R
Sbjct: 133 LELLQDDGLLEKQR 146

>NCAS0C05840 Chr3 (1202292..1203095) [804 bp, 267 aa] {ON} Anc_4.17
           YLL038C
          Length = 267

 Score = 49.3 bits (116), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 41/139 (29%), Positives = 67/139 (48%), Gaps = 8/139 (5%)

Query: 13  VKGY--SSTQVLVRNATSNDNHQVSKDSLI-ELAEKSYDSADFFEIMDMLDKRLNDKGKY 69
           VK +  S T+  V+ AT+ D    +  +L+ E++  +Y      EI+ +L KRL+   + 
Sbjct: 7   VKSFVQSPTESKVKQATNEDETMGATGTLMNEISVLTYSPKTLKEIVQVLKKRLSGYSRK 66

Query: 70  WRH-----IAKALTVLDYLIRFGSENCVLWCKENLYIIKTLKEFRHEDDEGIDQGQIVRV 124
             H     I K LT++ YLI  GS   V W + N  +I  L   + E  +    G  ++ 
Sbjct: 67  TSHKNCIFIIKTLTLMAYLINNGSNEFVAWIRNNSSLISNLISEKVEYPKDDKMGPEIKS 126

Query: 125 KSKELTALLSDDERLNEER 143
            + +L  L+ DD+ L E R
Sbjct: 127 IAADLMELIQDDDLLEERR 145

>KAFR0I01460 Chr9 (304865..305692) [828 bp, 275 aa] {ON} Anc_4.17
           YLL038C
          Length = 275

 Score = 44.3 bits (103), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 45/158 (28%), Positives = 77/158 (48%), Gaps = 24/158 (15%)

Query: 5   FVRSAKNLVKGYSSTQVLVRNATSNDNHQVSKDSLI-ELAEKSYDSADFFEIMDMLDKRL 63
           F  S +NLV  YS T++ VR AT  +    S  +L+ E++  +Y +    EI+ +L K+L
Sbjct: 3   FFNSVRNLV--YSQTELKVRQATDENEIIRSTGTLMNEISVLTYSAKTLKEIIGILKKKL 60

Query: 64  -------NDKG----KYWRHIAKALTVLDYLIRFGSENCVLWCKEN---LYIIKTLKEFR 109
                  N  G    K    + K  T++ YL+  GS + + W K N   L I+  +    
Sbjct: 61  SLLYGLKNGNGIISHKVCVQVLKTFTLISYLLNNGSNDFINWLKLNNGVLQILAKVDSNN 120

Query: 110 H----EDDEGIDQGQIVRVKSKELTALLSDDERLNEER 143
           H    ED   ++Q Q +   +K++  L++D++ L + R
Sbjct: 121 HITDDEDLHILNQAQKI---TKDIILLINDNKLLEKRR 155

>CAGL0E03806g Chr5 (356594..357376) [783 bp, 260 aa] {ON} similar to
           uniprot|Q07872 Saccharomyces cerevisiae YLL038c ENT4
          Length = 260

 Score = 43.5 bits (101), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 28/103 (27%), Positives = 56/103 (54%), Gaps = 8/103 (7%)

Query: 14  KGY--SSTQVLVRNATSNDNHQVSKDSLI-ELAEKSYDSADFFEIMDMLDKRLN-----D 65
           KG+  S T++ VR AT ++    +  +L+ E++  +Y      +++ ++ KRL+     +
Sbjct: 8   KGFLLSPTELKVRQATDDNELAGATGTLMNEISVLTYSKKTLKDVIQVIRKRLSGVNKRN 67

Query: 66  KGKYWRHIAKALTVLDYLIRFGSENCVLWCKENLYIIKTLKEF 108
             +   H+ K LT++ YL+  GS + + W K + Y+I+ L  F
Sbjct: 68  SHRTCLHVLKTLTLVSYLLNNGSNDFIAWLKSSKYVIEYLSSF 110

>YLL038C Chr12 complement(65775..66518) [744 bp, 247 aa] {ON}
           ENT4Protein of unknown function, contains an N-terminal
           epsin-like domain; proposed to be involved in the
           trafficking of Arn1p in the absence of ferrichrome
          Length = 247

 Score = 42.7 bits (99), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 28/103 (27%), Positives = 54/103 (52%), Gaps = 7/103 (6%)

Query: 17  SSTQVLVRNATSNDNHQVSKDSLI-ELAEKSYDSADFFEIMDMLDKRL------NDKGKY 69
           S T+  V+ AT+ D    +  +L+ E++  +Y      EI+ ++ KRL       +  + 
Sbjct: 13  SPTESKVKQATNEDETSGATGTLMNEISILTYSPKTVREIIQVIRKRLLLGQNRRNSHRN 72

Query: 70  WRHIAKALTVLDYLIRFGSENCVLWCKENLYIIKTLKEFRHED 112
              + K LT++ YL+  GS   + W K N+ +I+ L++F+ +D
Sbjct: 73  CIQVMKTLTLVSYLMNNGSNEFIKWLKGNMILIEILEDFQVQD 115

>Smik_12.19 Chr12 complement(50134..50877) [744 bp, 247 aa] {ON}
           YLL038C (REAL)
          Length = 247

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 27/103 (26%), Positives = 54/103 (52%), Gaps = 7/103 (6%)

Query: 17  SSTQVLVRNATSNDNHQVSKDSLI-ELAEKSYDSADFFEIMDMLDKRL------NDKGKY 69
           S T+  V+ AT+ D    +  +L+ E++  +Y      EI+ ++ KRL       +  + 
Sbjct: 13  SPTESKVKQATNEDETSGATGTLMNEISILTYSPKTVREIIQVVRKRLLLGQNRRNSHRN 72

Query: 70  WRHIAKALTVLDYLIRFGSENCVLWCKENLYIIKTLKEFRHED 112
              + K LT++ YL+  GS   + W K N+ +++ L++F+ +D
Sbjct: 73  CIQVMKTLTLVSYLMNNGSNEFIKWLKSNMILVEILEDFQVQD 115

>KNAG0J02870 Chr10 (549107..550096) [990 bp, 329 aa] {ON} Anc_4.17
           YLL038C
          Length = 329

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 40/153 (26%), Positives = 68/153 (44%), Gaps = 21/153 (13%)

Query: 8   SAKNLVKGYSSTQVLVRNATSNDNHQVSKDS----LIELAEKSYDSADFFEIMDMLDKRL 63
           S +N V   S+T++ V+ AT  D+ +V   S    + E++  +Y      EI  +L KR 
Sbjct: 6   SVRNFVN--STTELKVKQAT--DDSEVLSSSTGTVMNEISVLTYSPKTLKEIQSVLRKRF 61

Query: 64  NDKGKYWRHIA--------KALTVLDYLIRFGSENCVLWCKENLYIIKTLK-----EFRH 110
           +      R +         K LT++ +L+  GS   V W K N+   + L+     EF  
Sbjct: 62  HLMSTLPRKVLHRSCLIVLKTLTLILFLLNNGSNAFVSWIKSNVGAFEPLQNVPITEFSF 121

Query: 111 EDDEGIDQGQIVRVKSKELTALLSDDERLNEER 143
            D   +   + +R  + ++  L+ DD  L E R
Sbjct: 122 TDKADLPMYEQIRQSASDILQLIGDDNLLEERR 154

>NDAI0H00280 Chr8 complement(48177..49109) [933 bp, 310 aa] {ON}
           Anc_4.17 YLL038C
          Length = 310

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 38/150 (25%), Positives = 79/150 (52%), Gaps = 17/150 (11%)

Query: 8   SAKNLVKGYSSTQVLVRNATSNDNHQVSKDSLI-ELAEKSYDSADFFEIMDMLDKRLND- 65
           + KN V+  + T+  V+ AT ++    +  +L+ E++  +Y      +I+ ++ KRL+  
Sbjct: 6   TVKNFVQ--TPTESKVKQATDDNETTGATGTLMNEISVLTYSPKTLKDIIQVIKKRLSSA 63

Query: 66  --KGKYWRH-----IAKALTVLDYLIRFGSENCVLWCKENLYIIKTLKE---FRHEDDEG 115
               K   H     I K LT++ YLI  GS   + W + N Y+++ + +   F+ +D+  
Sbjct: 64  TSSNKKLSHKTSVYIIKTLTLISYLINNGSNEFIEWLRLNFYLVENITKKCNFQLQDNSA 123

Query: 116 IDQ--GQIVRVKSKELTALLSDDERLNEER 143
             +  GQI +V ++++T L++++  L + R
Sbjct: 124 DSKMIGQI-KVIAEDMTNLINNENLLEQRR 152

>YHR161C Chr8 complement(420373..422286) [1914 bp, 637 aa] {ON}
          YAP1801Protein involved in clathrin cage assembly;
          binds Pan1p and clathrin; homologous to Yap1802p,
          member of the AP180 protein family
          Length = 637

 Score = 39.3 bits (90), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 30/50 (60%), Gaps = 3/50 (6%)

Query: 51 DFFEIMDMLDKRLNDKGKYWRHIAKALTVLDYLIRFGSENCVL-WCKENL 99
          DF+EI+  LD R+ND    W  + K+L V+  +IR GS++  L +   NL
Sbjct: 36 DFYEIVKGLDSRINDTA--WTIVYKSLLVVHLMIREGSKDVALRYYSRNL 83

>SAKL0H02530g Chr8 (250148..252157) [2010 bp, 669 aa] {ON} weakly
          similar to uniprot|P53309 Saccharomyces cerevisiae
          YGR241C YAP1802 Yeast Assembly Polypeptide, member of
          AP180 protein family, binds Pan1p and clathrin; member
          of clathrin assembly polypeptide AP180 family and
          weakly similar to uniprot|P38856 Saccharomyces
          cerevisiae YHR161C YAP1801 Yeast Assembly Polypeptide
          member of AP180 protein family binds Pan1p and clathrin
          clathrin assembly protein
          Length = 669

 Score = 37.7 bits (86), Expect = 0.065,   Method: Compositional matrix adjust.
 Identities = 16/46 (34%), Positives = 27/46 (58%), Gaps = 2/46 (4%)

Query: 48 DSADFFEIMDMLDKRLNDKGKYWRHIAKALTVLDYLIRFGSENCVL 93
          DS++F EIM  L+ R+ND    W  + K+L V+  ++R G  +  +
Sbjct: 33 DSSEFMEIMKALESRINDTA--WTIVYKSLIVIHLMMRDGDRDVTI 76

>Skud_8.225 Chr8 complement(391820..393685) [1866 bp, 621 aa] {ON}
           YHR161C (REAL)
          Length = 621

 Score = 37.4 bits (85), Expect = 0.078,   Method: Compositional matrix adjust.
 Identities = 21/65 (32%), Positives = 33/65 (50%), Gaps = 7/65 (10%)

Query: 51  DFFEIMDMLDKRLNDKGKYWRHIAKALTVLDYLIRFGSENCVLWCKENLYIIKTLKEFRH 110
           DF+EI+  LD R+ND    W  + K L V+  ++R G ++  L      Y  + L+ F  
Sbjct: 36  DFYEIVKALDSRVNDTA--WTIVYKTLLVVHLMMREGKKDVALR-----YYSRNLEFFSI 88

Query: 111 EDDEG 115
           E+  G
Sbjct: 89  ENIRG 93

>KLLA0D16654g Chr4 complement(1413507..1414706) [1200 bp, 399 aa]
           {ON} similar to uniprot|Q6Q5U2 Saccharomyces cerevisiae
           YDR153C ENT5 Protein containing an N-terminal epsin-like
           domain involved in clathrin recruitment and traffic
           between the Golgi and endosomes associates with the
           clathrin adaptor Gga2p clathrin adaptor complex AP-1 and
           clathrin
          Length = 399

 Score = 36.6 bits (83), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 38/167 (22%), Positives = 71/167 (42%), Gaps = 29/167 (17%)

Query: 6   VRSAKNLVKGYSSTQVLVRNATSNDNHQVSKDSLIELAEKSYDSADFF-------EIMDM 58
            R A+N++  Y   Q+ +R AT+ D+   +   L ++    Y+ + F         ++D 
Sbjct: 20  ARFAQNVIVQYEPYQIDIRRATNTDSWGPTPKHLAKVMRHRYEVSMFLMTEYTLKRLVDH 79

Query: 59  LDKRLNDK-----------GKYWRHIAKALTVLDYLI----RFGSENCVLWCKENLYIIK 103
           + KR  +            G  WR + K L +L+YL+    R    + VL C +    I 
Sbjct: 80  MAKRPKNMYEKARKQYVNYGNEWRVVLKCLVLLEYLLMRSDRGKETDQVLSCLQAHKHIL 139

Query: 104 TLKEFRHEDDEGIDQGQI------VRVKSKELTALLSDDERLNEERN 144
           T +  ++  D   D G++      ++ K + +  L+ D   L  ER+
Sbjct: 140 TKETMQYRVDFSSD-GKMELHERGIKKKCEHIIQLIEDTSYLKRERS 185

>Smik_8.245 Chr8 complement(397342..399225) [1884 bp, 627 aa] {ON}
          YHR161C (REAL)
          Length = 627

 Score = 35.4 bits (80), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 21/72 (29%), Positives = 37/72 (51%), Gaps = 2/72 (2%)

Query: 22 LVRNATSNDNHQVSKDSLIELAEKSYDSADFFEIMDMLDKRLNDKGKYWRHIAKALTVLD 81
          LV+ AT   +    +  L  +   +    DF+EI+  L+ R+ND    W  + K+L V+ 
Sbjct: 7  LVKGATKIKSAPPKQKYLDPILLGTSSEEDFYEIVKGLNFRINDTA--WTIVYKSLLVVH 64

Query: 82 YLIRFGSENCVL 93
           +IR G+++  L
Sbjct: 65 LMIREGAKDVAL 76

>NCAS0B03660 Chr2 complement(653627..654877) [1251 bp, 416 aa] {ON}
           Anc_8.335 YDR153C
          Length = 416

 Score = 34.3 bits (77), Expect = 0.66,   Method: Compositional matrix adjust.
 Identities = 31/113 (27%), Positives = 46/113 (40%), Gaps = 24/113 (21%)

Query: 6   VRSAKNLVKGYSSTQVLVRNATSNDNHQVSKDSLIELAEKSYDSADFFEIMDMLDKRLND 65
            R A+N++  Y   QV +R AT+ D    +   L ++    Y     + +++   KRL D
Sbjct: 20  ARFAQNVIVQYEPYQVDIRRATNTDAWGPTPKHLSKVLRNRY-QVPLYLMVEYTLKRLVD 78

Query: 66  K-------------------GKYWRHIAKALTVLDYLIRFGSE----NCVLWC 95
                               G  WR + K L V+D+LI   SE    N VL C
Sbjct: 79  HIASRPKNFYEKARKEYVNYGAEWRVVLKCLVVIDFLILNVSEGDELNQVLSC 131

>KLLA0A05522g Chr1 (507778..509481) [1704 bp, 567 aa] {ON} similar
           to uniprot|P53309 Saccharomyces cerevisiae YGR241C
           YAP1802 Yeast Assembly Polypeptide, member of AP180
           protein family, binds Pan1p and clathrin; member of
           clathrin assembly polypeptide AP180 family
          Length = 567

 Score = 33.5 bits (75), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 25/85 (29%), Positives = 48/85 (56%), Gaps = 9/85 (10%)

Query: 51  DFFEIMDMLDKRLNDKGKYWRHIAKALTVLDYLIRFGSENCVL-WCKENL--YIIKTLKE 107
           DF EI++ L++R+ND    W  + K+L V   +IR G ++  L +   NL  + ++ L  
Sbjct: 36  DFGEIVNALEERINDSA--WTVVFKSLAVAHLMIRDGDKDIALKYFSRNLDFFELRGLAR 93

Query: 108 ---FRHEDDEGIDQGQI-VRVKSKE 128
               R  D + +D+ ++ ++V+S+E
Sbjct: 94  SYPARSGDVQALDRYRLYLKVRSEE 118

>CAGL0E01199g Chr5 (108041..109279) [1239 bp, 412 aa] {ON} similar
           to uniprot|Q03769 Saccharomyces cerevisiae YDR153c ENT5
          Length = 412

 Score = 33.1 bits (74), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 26/98 (26%), Positives = 41/98 (41%), Gaps = 20/98 (20%)

Query: 6   VRSAKNLVKGYSSTQVLVRNATSNDNHQVSKDSLIELAEKSYDSADFFEIMDMLDKRLND 65
            R A+N++  Y   QV VR AT+ D+   +   L ++    Y     + I + + KRL D
Sbjct: 20  ARFAQNVIVQYEPYQVDVRRATNTDSWGPTPKHLAKVLRNRY-QVPLYLITEYILKRLID 78

Query: 66  K-------------------GKYWRHIAKALTVLDYLI 84
                               G  WR + K L V++YL+
Sbjct: 79  HIAQRPKNLYEKARKDYVNYGSEWRVVLKCLVVIEYLL 116

>Kpol_344.8 s344 complement(20765..21919) [1155 bp, 384 aa] {ON}
           complement(20765..21919) [1155 nt, 385 aa]
          Length = 384

 Score = 32.3 bits (72), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 46/168 (27%), Positives = 71/168 (42%), Gaps = 29/168 (17%)

Query: 7   RSAKNLVKGYSSTQVLVRNATSNDNHQVSKDSLIELAEKSYDSADFF-------EIMDML 59
           R  +N++  Y   Q+ +R AT+ D    +   L ++    Y    +         I+D L
Sbjct: 21  RFMQNMIVQYEPYQIDIRRATNTDAWGPTTKHLQKVIRNKYSVPLYLMTEYVLKRIVDHL 80

Query: 60  DKR---LNDK--------GKYWRHIAKALTVLDYLIRFGSE----NCVLWCKENLY---- 100
            KR   L +K        G  WR I K L V++YL+   SE    N V  C EN      
Sbjct: 81  AKRPKNLYEKARKEYVNYGSEWRIILKCLIVIEYLLLNVSEPEELNQVKSCLENHKQIFN 140

Query: 101 --IIKTLKEFRHEDDEGIDQGQIVRVKSKELTALLSDDERLNEERNMN 146
             I+    EF ++    + +  I + K + +  L+ D E L EER+ N
Sbjct: 141 SNILNYKIEFCNDGKMEVHERGIQK-KCEVIINLVDDPEFLREERSKN 187

>ZYRO0F13684g Chr6 complement(1125731..1126954) [1224 bp, 407 aa]
           {ON} highly similar to uniprot|Q6Q5U2 Saccharomyces
           cerevisiae YDR153C ENT5 Protein containing an N-terminal
           epsin-like domain involved in clathrin recruitment and
           traffic between the Golgi and endosomes associates with
           the clathrin adaptor Gga2p clathrin adaptor complex AP-1
           and clathrin
          Length = 407

 Score = 32.0 bits (71), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 27/98 (27%), Positives = 41/98 (41%), Gaps = 20/98 (20%)

Query: 6   VRSAKNLVKGYSSTQVLVRNATSNDNHQVSKDSLIELAEKSYDSADFFEIMDMLDKRLND 65
            R A+N++  Y   QV VR AT+ D+   +   L ++    Y     + I +   KRL D
Sbjct: 20  ARFAQNMIVQYEPYQVDVRRATNTDSWGPTPKHLEKVLRNRY-QVPMYLITEYTLKRLID 78

Query: 66  K-------------------GKYWRHIAKALTVLDYLI 84
                               G  WR + K LTV++YL+
Sbjct: 79  HIATRPKNFYEKARKEYVNYGSEWRVVLKCLTVVEYLL 116

>KAFR0K01560 Chr11 (324725..327784) [3060 bp, 1019 aa] {ON}
           Anc_3.433 YGR094W
          Length = 1019

 Score = 31.6 bits (70), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 22/76 (28%), Positives = 35/76 (46%), Gaps = 2/76 (2%)

Query: 28  SNDNHQVSKDSLIELAEKSYDSADFFEIMDMLDKRLNDKGKYWRHIAKA-LTVLDYLIRF 86
           S +   + K  L  +AE S    D F++ D     L    ++WR I    +    Y++R 
Sbjct: 745 SGNETMIEKWILHTMAETSNTMNDCFKLRDFSGATLAIH-QFWRSICDVYIEYFKYILRS 803

Query: 87  GSENCVLWCKENLYII 102
           G+E  +  CKE LY +
Sbjct: 804 GTEAQIASCKETLYTV 819

>Kwal_YGOB_27.11261 s27 complement(716644..717033,717035..717859)
           [1215 bp, 404 aa] {ON} ANNOTATED BY YGOB -
          Length = 404

 Score = 31.2 bits (69), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 25/98 (25%), Positives = 39/98 (39%), Gaps = 20/98 (20%)

Query: 6   VRSAKNLVKGYSSTQVLVRNATSNDNHQVSKDSLIELAEKSYDSADFFEIMDMLDKRLND 65
            R A+N++  Y   QV +R AT+ D+   +   L ++    Y       + +   KRL D
Sbjct: 20  ARFAQNVIVQYEPYQVDIRRATNTDSWGPTPKHLFKVMRNKYQ-VPLHLMTEYTLKRLVD 78

Query: 66  K-------------------GKYWRHIAKALTVLDYLI 84
                               G  WR + K L VL+YL+
Sbjct: 79  HIASRPKNLYEKARKQYVNYGNEWRVVLKCLVVLEYLL 116

>KLTH0G11902g Chr7 (1002588..1003787) [1200 bp, 399 aa] {ON} similar
           to uniprot|Q6Q5U2 Saccharomyces cerevisiae YDR153C ENT5
           Protein containing an N-terminal epsin-like domain
           involved in clathrin recruitment and traffic between the
           Golgi and endosomes associates with the clathrin adaptor
           Gga2p clathrin adaptor complex AP-1 and clathrin
          Length = 399

 Score = 30.8 bits (68), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 34/131 (25%), Positives = 53/131 (40%), Gaps = 30/131 (22%)

Query: 6   VRSAKNLVKGYSSTQVLVRNATSNDNHQVSKDSLIELAEKSYDSADFFEIMDMLDKRLND 65
            R A+N++  Y   QV +R AT+ D+   +   L ++    Y       + +   KRL D
Sbjct: 20  ARFAQNVIVQYEPYQVDIRRATNTDSWGPTPKHLFKVMRNKYQ-VPLHLMTEYTLKRLVD 78

Query: 66  K-------------------GKYWRHIAKALTVLDYL---IRFGSE-----NCVLWCKEN 98
                               G  WR + K L VL+YL   +  GSE     +C+L  K  
Sbjct: 79  HIASRPKNFYEKARKQYVNYGSEWRVVLKCLVVLEYLLLNVDNGSELDQVTSCLLTHKHI 138

Query: 99  LYIIKTLKEFR 109
           L   + + +FR
Sbjct: 139 L--TRDVMQFR 147

>NDAI0J00930 Chr10 (209579..210835) [1257 bp, 418 aa] {ON} Anc_8.335
           YDR153C
          Length = 418

 Score = 30.4 bits (67), Expect = 9.5,   Method: Compositional matrix adjust.
 Identities = 30/113 (26%), Positives = 47/113 (41%), Gaps = 24/113 (21%)

Query: 6   VRSAKNLVKGYSSTQVLVRNATSNDNHQVSKDSLIELAEKSYDSADFFEIMDMLDKRLND 65
            R A+N++  Y   QV +R AT+ D    +   L ++    Y     + +++   KRL D
Sbjct: 20  ARFAQNVIVQYEPYQVDIRRATNTDAWGPTPKHLQKVLRNRY-QVPLYLMVEYTLKRLVD 78

Query: 66  K-------------------GKYWRHIAKALTVLDYL---IRFGSE-NCVLWC 95
                               G  WR + K LTV++YL   +  G E N V+ C
Sbjct: 79  HIAVKPKNFYERARKEYVNYGAEWRVVLKCLTVVEYLMLNVDDGDELNQVVRC 131

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.312    0.131    0.373 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 38,314,932
Number of extensions: 1469267
Number of successful extensions: 3422
Number of sequences better than 10.0: 93
Number of HSP's gapped: 3377
Number of HSP's successfully gapped: 131
Length of query: 460
Length of database: 53,481,399
Length adjustment: 113
Effective length of query: 347
Effective length of database: 40,524,141
Effective search space: 14061876927
Effective search space used: 14061876927
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 67 (30.4 bits)