Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Smik_4.747.343ON84584539220.0
YDL164C (CDC9)7.343ON75575631910.0
Skud_4.937.343ON75575631620.0
Suva_4.827.343ON75575631480.0
NCAS0A141107.343ON75373326100.0
CAGL0I03410g7.343ON72472025330.0
NDAI0A019407.343ON76560825300.0
TDEL0C020407.343ON70561425280.0
KNAG0C037407.343ON72762724890.0
KAFR0B008307.343ON71063324710.0
ZYRO0F11572g7.343ON73172224150.0
Kpol_2001.717.343ON72661823640.0
SAKL0F10912g7.343ON69361323610.0
Kwal_56.246167.343ON71561023130.0
KLTH0H01408g7.343ON72361022640.0
TPHA0D045707.343ON73663422280.0
KLLA0D12496g7.343ON70061321660.0
ACL155W7.343ON69771921150.0
TBLA0E020507.343ON72061520800.0
TPHA0M002606.18ON9664232721e-23
Smik_15.1746.18ON9452392622e-22
ACR008W6.18ON9814042569e-22
TBLA0G010406.18ON9722402471e-20
YOR005C (DNL4)6.18ON9442682462e-20
KNAG0F028706.18ON9542672452e-20
CAGL0E02695g6.18ON9463792452e-20
NCAS0D026506.18ON9502402442e-20
ZYRO0C07854g6.18ON9443992362e-19
TDEL0G045106.18ON9694092362e-19
Skud_15.1666.18ON9472392344e-19
Suva_15.1806.18ON9482422326e-19
KLLA0D01089g6.18ON9073722273e-18
KLTH0C11286g6.18ON9512372247e-18
Kpol_1032.76.18ON9652242166e-17
Kwal_56.224146.18ON9632592122e-16
KAFR0A050506.18ON9482372122e-16
NDAI0I022606.18ON9672682085e-16
TPHA0M014603.329ON626142781.3
KLLA0E01805gsingletonON32265724.3
TBLA0D006407.387ON1142122744.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Smik_4.74
         (845 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Smik_4.74 Chr4 complement(141744..144281) [2538 bp, 845 aa] {ON}...  1515   0.0  
YDL164C Chr4 complement(164987..167254) [2268 bp, 755 aa] {ON}  ...  1233   0.0  
Skud_4.93 Chr4 complement(160642..162909) [2268 bp, 755 aa] {ON}...  1222   0.0  
Suva_4.82 Chr4 complement(152544..154811) [2268 bp, 755 aa] {ON}...  1217   0.0  
NCAS0A14110 Chr1 (2774465..2776726) [2262 bp, 753 aa] {ON} Anc_7...  1009   0.0  
CAGL0I03410g Chr9 complement(289606..291780) [2175 bp, 724 aa] {...   980   0.0  
NDAI0A01940 Chr1 complement(432302..434599) [2298 bp, 765 aa] {O...   979   0.0  
TDEL0C02040 Chr3 complement(352579..354696) [2118 bp, 705 aa] {O...   978   0.0  
KNAG0C03740 Chr3 (737968..740151) [2184 bp, 727 aa] {ON} Anc_7.3...   963   0.0  
KAFR0B00830 Chr2 (157155..159287) [2133 bp, 710 aa] {ON} Anc_7.3...   956   0.0  
ZYRO0F11572g Chr6 (949236..951431) [2196 bp, 731 aa] {ON} simila...   934   0.0  
Kpol_2001.71 s2001 (195103..197283) [2181 bp, 726 aa] {ON} (1951...   915   0.0  
SAKL0F10912g Chr6 complement(854430..856511) [2082 bp, 693 aa] {...   914   0.0  
Kwal_56.24616 s56 (1076178..1078325) [2148 bp, 715 aa] {ON} YDL1...   895   0.0  
KLTH0H01408g Chr8 complement(129752..131923) [2172 bp, 723 aa] {...   876   0.0  
TPHA0D04570 Chr4 (996539..998749) [2211 bp, 736 aa] {ON} Anc_7.3...   862   0.0  
KLLA0D12496g Chr4 complement(1059684..1061786) [2103 bp, 700 aa]...   838   0.0  
ACL155W Chr3 (81492..83585) [2094 bp, 697 aa] {ON} Syntenic homo...   819   0.0  
TBLA0E02050 Chr5 (498038..500200) [2163 bp, 720 aa] {ON} Anc_7.3...   805   0.0  
TPHA0M00260 Chr13 complement(50326..53226) [2901 bp, 966 aa] {ON...   109   1e-23
Smik_15.174 Chr15 complement(301851..304688) [2838 bp, 945 aa] {...   105   2e-22
ACR008W Chr3 (368913..371858) [2946 bp, 981 aa] {ON} Syntenic ho...   103   9e-22
TBLA0G01040 Chr7 complement(258966..261884) [2919 bp, 972 aa] {O...   100   1e-20
YOR005C Chr15 complement(334509..337343) [2835 bp, 944 aa] {ON} ...    99   2e-20
KNAG0F02870 Chr6 (543177..546041) [2865 bp, 954 aa] {ON} Anc_6.1...    99   2e-20
CAGL0E02695g Chr5 complement(254591..257431) [2841 bp, 946 aa] {...    99   2e-20
NCAS0D02650 Chr4 (508606..511458) [2853 bp, 950 aa] {ON} Anc_6.1...    99   2e-20
ZYRO0C07854g Chr3 (595546..598380) [2835 bp, 944 aa] {ON} simila...    96   2e-19
TDEL0G04510 Chr7 (819479..822388) [2910 bp, 969 aa] {ON} Anc_6.1...    96   2e-19
Skud_15.166 Chr15 complement(294550..297393) [2844 bp, 947 aa] {...    95   4e-19
Suva_15.180 Chr15 complement(308983..311829) [2847 bp, 948 aa] {...    94   6e-19
KLLA0D01089g Chr4 complement(97438..100161) [2724 bp, 907 aa] {O...    92   3e-18
KLTH0C11286g Chr3 (926742..929597) [2856 bp, 951 aa] {ON} simila...    91   7e-18
Kpol_1032.7 s1032 complement(12295..15192) [2898 bp, 965 aa] {ON...    88   6e-17
Kwal_56.22414 s56 complement(117198..120089) [2892 bp, 963 aa] {...    86   2e-16
KAFR0A05050 Chr1 (1003515..1006361) [2847 bp, 948 aa] {ON} Anc_6...    86   2e-16
NDAI0I02260 Chr9 complement(514711..517614) [2904 bp, 967 aa] {O...    85   5e-16
TPHA0M01460 Chr13 (311871..313751) [1881 bp, 626 aa] {ON} Anc_3....    35   1.3  
KLLA0E01805g Chr5 complement(173125..174093) [969 bp, 322 aa] {O...    32   4.3  
TBLA0D00640 Chr4 (168893..172321) [3429 bp, 1142 aa] {ON} Anc_7....    33   4.4  

>Smik_4.74 Chr4 complement(141744..144281) [2538 bp, 845 aa] {ON}
           YDL164C (REAL)
          Length = 845

 Score = 1515 bits (3922), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 747/845 (88%), Positives = 747/845 (88%)

Query: 1   MTLYKISNRIXXXXXXXXXXXXXXXPSLILMYTFIEMTDGIFHLTRKRVKMKFKRNILSD 60
           MTLYKISNRI               PSLILMYTFIEMTDGIFHLTRKRVKMKFKRNILSD
Sbjct: 1   MTLYKISNRISAATACFTCASALSSPSLILMYTFIEMTDGIFHLTRKRVKMKFKRNILSD 60

Query: 61  LHSSVLVHGKYNDFGDLYKSILQRCFINYMRRLLGGLLISSTHXXXXXXXXXXXXXXXXX 120
           LHSSVLVHGKYNDFGDLYKSILQRCFINYMRRLLGGLLISSTH                 
Sbjct: 61  LHSSVLVHGKYNDFGDLYKSILQRCFINYMRRLLGGLLISSTHPLILRLPLSMSSSLPSS 120

Query: 121 AGKKPKQATLARFFTSMKNKPSGNTSPPDKSAKHMLQXXXXXXXXXXXRNVKKSXXXXXX 180
           AGKKPKQATLARFFTSMKNKPSGNTSPPDKSAKHMLQ           RNVKKS      
Sbjct: 121 AGKKPKQATLARFFTSMKNKPSGNTSPPDKSAKHMLQDSVDDDSSVGVRNVKKSQQVAVA 180

Query: 181 XXXXXXPFMXXXXXXXXXXXXXXXGADLSQKFQGLGPKVEDFEMNSNDSDHYSSNIPYSD 240
                 PFM               GADLSQKFQGLGPKVEDFEMNSNDSDHYSSNIPYSD
Sbjct: 181 QAATVQPFMSSFPSSLPSSAPSSSGADLSQKFQGLGPKVEDFEMNSNDSDHYSSNIPYSD 240

Query: 241 VCEVFNQIEAISSRLEIIRICSDFFIKVMKQSSKNLIPTTYLFINRLGPDYXXXXXXXXX 300
           VCEVFNQIEAISSRLEIIRICSDFFIKVMKQSSKNLIPTTYLFINRLGPDY         
Sbjct: 241 VCEVFNQIEAISSRLEIIRICSDFFIKVMKQSSKNLIPTTYLFINRLGPDYEAGLELGLG 300

Query: 301 XXXXMKTISESCGKSMSQIKLKYKEIGDLGEIAMGARNVQPTMFKPKPLTVGEVFKNLRT 360
               MKTISESCGKSMSQIKLKYKEIGDLGEIAMGARNVQPTMFKPKPLTVGEVFKNLRT
Sbjct: 301 ENLLMKTISESCGKSMSQIKLKYKEIGDLGEIAMGARNVQPTMFKPKPLTVGEVFKNLRT 360

Query: 361 IAKTQGKDSQLRKIKLIKRMLTACQGVEAKFLIRSLESKLRIGLAEKTVLISLSKALLLH 420
           IAKTQGKDSQLRKIKLIKRMLTACQGVEAKFLIRSLESKLRIGLAEKTVLISLSKALLLH
Sbjct: 361 IAKTQGKDSQLRKIKLIKRMLTACQGVEAKFLIRSLESKLRIGLAEKTVLISLSKALLLH 420

Query: 421 DENRENSADKDIPMDVLESAQQKIRDAFCQVPNYEIVINSCLEHGIMNLDKYCTLRPGIP 480
           DENRENSADKDIPMDVLESAQQKIRDAFCQVPNYEIVINSCLEHGIMNLDKYCTLRPGIP
Sbjct: 421 DENRENSADKDIPMDVLESAQQKIRDAFCQVPNYEIVINSCLEHGIMNLDKYCTLRPGIP 480

Query: 481 LKPMLAKPTKAINEVLDRFQGETFTSEYKYDGERAQVHLLNDGTMRIYSRNGENMTERYP 540
           LKPMLAKPTKAINEVLDRFQGETFTSEYKYDGERAQVHLLNDGTMRIYSRNGENMTERYP
Sbjct: 481 LKPMLAKPTKAINEVLDRFQGETFTSEYKYDGERAQVHLLNDGTMRIYSRNGENMTERYP 540

Query: 541 EIKITDFIQDLDITKNLILDCEAVAWDKDQAKILPFQVLSTRKRKDVELNDVKVRVCLFA 600
           EIKITDFIQDLDITKNLILDCEAVAWDKDQAKILPFQVLSTRKRKDVELNDVKVRVCLFA
Sbjct: 541 EIKITDFIQDLDITKNLILDCEAVAWDKDQAKILPFQVLSTRKRKDVELNDVKVRVCLFA 600

Query: 601 FDILCHNDERLINMSLRERREYLTKVTKVVPGEFQYATQIITNNLDELQKFLDESVNHSC 660
           FDILCHNDERLINMSLRERREYLTKVTKVVPGEFQYATQIITNNLDELQKFLDESVNHSC
Sbjct: 601 FDILCHNDERLINMSLRERREYLTKVTKVVPGEFQYATQIITNNLDELQKFLDESVNHSC 660

Query: 661 EGLMVKMLDGSESHYEPSKRSRNWLKLKKDYLEGVGDSLDLCVLXXXXXXXXXXXXXXXF 720
           EGLMVKMLDGSESHYEPSKRSRNWLKLKKDYLEGVGDSLDLCVL               F
Sbjct: 661 EGLMVKMLDGSESHYEPSKRSRNWLKLKKDYLEGVGDSLDLCVLGAYYGRGKRTGTYGGF 720

Query: 721 LLGCYNQDTGEFETCCKIGTGFSDEMLQLLHARLTPTIIDGPKATYVFDSSAEPDVWFEP 780
           LLGCYNQDTGEFETCCKIGTGFSDEMLQLLHARLTPTIIDGPKATYVFDSSAEPDVWFEP
Sbjct: 721 LLGCYNQDTGEFETCCKIGTGFSDEMLQLLHARLTPTIIDGPKATYVFDSSAEPDVWFEP 780

Query: 781 TTLFEVLTADLSLSPIYKAGSTTFDKGVSLRFPRFLRIREDKGVEDATSSDQIVELYENQ 840
           TTLFEVLTADLSLSPIYKAGSTTFDKGVSLRFPRFLRIREDKGVEDATSSDQIVELYENQ
Sbjct: 781 TTLFEVLTADLSLSPIYKAGSTTFDKGVSLRFPRFLRIREDKGVEDATSSDQIVELYENQ 840

Query: 841 SHVQN 845
           SHVQN
Sbjct: 841 SHVQN 845

>YDL164C Chr4 complement(164987..167254) [2268 bp, 755 aa] {ON}
           CDC9DNA ligase found in the nucleus and mitochondria, an
           essential enzyme that joins Okazaki fragments during DNA
           replication; also acts in nucleotide excision repair,
           base excision repair, and recombination
          Length = 755

 Score = 1233 bits (3191), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 612/756 (80%), Positives = 639/756 (84%), Gaps = 1/756 (0%)

Query: 90  MRRLLGGLLISSTHXXXXXXXXXXXXXXXXXAGKKPKQATLARFFTSMKNKPSGNTSPPD 149
           MRRLL G L+SS                   AGKKPKQATLARFFTSMKNKP+  T  P 
Sbjct: 1   MRRLLTGCLLSSARPLKSRLPLLMSSSLPSSAGKKPKQATLARFFTSMKNKPTEGTPSPK 60

Query: 150 KSAKHMLQXXXXXXXXXXXRNVKKSXXXXXXXXXXXXPFMXXXXXXXXXXXXXXXGADLS 209
           KS+KHML+              KK               M                AD  
Sbjct: 61  KSSKHMLEDRMDNVSGEEEYATKKLKQTAVTHTVAAPSSMGSNFSSIPSSAPSSGVADSP 120

Query: 210 QKFQGLGPKVEDFEMNSNDSDHYSSNIPYSDVCEVFNQIEAISSRLEIIRICSDFFIKVM 269
           Q+ Q L  +VED  ++SN++DHYSSNIPYS+VCEVFN+IEAISSRLEIIRICSDFFIK+M
Sbjct: 121 QQSQRLVGEVED-ALSSNNNDHYSSNIPYSEVCEVFNKIEAISSRLEIIRICSDFFIKIM 179

Query: 270 KQSSKNLIPTTYLFINRLGPDYXXXXXXXXXXXXXMKTISESCGKSMSQIKLKYKEIGDL 329
           KQSSKNLIPTTYLFINRLGPDY             MKTISE+CGKSMSQIKLKYK+IGDL
Sbjct: 180 KQSSKNLIPTTYLFINRLGPDYEAGLELGLGENLLMKTISETCGKSMSQIKLKYKDIGDL 239

Query: 330 GEIAMGARNVQPTMFKPKPLTVGEVFKNLRTIAKTQGKDSQLRKIKLIKRMLTACQGVEA 389
           GEIAMGARNVQPTMFKPKPLTVGEVFKNLR IAKTQGKDSQL+K+KLIKRMLTAC+G+EA
Sbjct: 240 GEIAMGARNVQPTMFKPKPLTVGEVFKNLRAIAKTQGKDSQLKKMKLIKRMLTACKGIEA 299

Query: 390 KFLIRSLESKLRIGLAEKTVLISLSKALLLHDENRENSADKDIPMDVLESAQQKIRDAFC 449
           KFLIRSLESKLRIGLAEKTVLISLSKALLLHDENRE+S DKD+PMDVLESAQQKIRDAFC
Sbjct: 300 KFLIRSLESKLRIGLAEKTVLISLSKALLLHDENREDSPDKDVPMDVLESAQQKIRDAFC 359

Query: 450 QVPNYEIVINSCLEHGIMNLDKYCTLRPGIPLKPMLAKPTKAINEVLDRFQGETFTSEYK 509
           QVPNYEIVINSCLEHGIMNLDKYCTLRPGIPLKPMLAKPTKAINEVLDRFQGETFTSEYK
Sbjct: 360 QVPNYEIVINSCLEHGIMNLDKYCTLRPGIPLKPMLAKPTKAINEVLDRFQGETFTSEYK 419

Query: 510 YDGERAQVHLLNDGTMRIYSRNGENMTERYPEIKITDFIQDLDITKNLILDCEAVAWDKD 569
           YDGERAQVHLLNDGTMRIYSRNGENMTERYPEI ITDFIQDLD TKNLILDCEAVAWDKD
Sbjct: 420 YDGERAQVHLLNDGTMRIYSRNGENMTERYPEINITDFIQDLDTTKNLILDCEAVAWDKD 479

Query: 570 QAKILPFQVLSTRKRKDVELNDVKVRVCLFAFDILCHNDERLINMSLRERREYLTKVTKV 629
           Q KILPFQVLSTRKRKDVELNDVKV+VCLFAFDILC+NDERLIN SL+ERREYLTKVTKV
Sbjct: 480 QGKILPFQVLSTRKRKDVELNDVKVKVCLFAFDILCYNDERLINKSLKERREYLTKVTKV 539

Query: 630 VPGEFQYATQIITNNLDELQKFLDESVNHSCEGLMVKMLDGSESHYEPSKRSRNWLKLKK 689
           VPGEFQYATQI TNNLDELQKFLDESVNHSCEGLMVKML+G ESHYEPSKRSRNWLKLKK
Sbjct: 540 VPGEFQYATQITTNNLDELQKFLDESVNHSCEGLMVKMLEGPESHYEPSKRSRNWLKLKK 599

Query: 690 DYLEGVGDSLDLCVLXXXXXXXXXXXXXXXFLLGCYNQDTGEFETCCKIGTGFSDEMLQL 749
           DYLEGVGDSLDLCVL               FLLGCYNQDTGEFETCCKIGTGFSDEMLQL
Sbjct: 600 DYLEGVGDSLDLCVLGAYYGRGKRTGTYGGFLLGCYNQDTGEFETCCKIGTGFSDEMLQL 659

Query: 750 LHARLTPTIIDGPKATYVFDSSAEPDVWFEPTTLFEVLTADLSLSPIYKAGSTTFDKGVS 809
           LH RLTPTIIDGPKAT+VFDSSAEPDVWFEPTTLFEVLTADLSLSPIYKAGS TFDKGVS
Sbjct: 660 LHDRLTPTIIDGPKATFVFDSSAEPDVWFEPTTLFEVLTADLSLSPIYKAGSATFDKGVS 719

Query: 810 LRFPRFLRIREDKGVEDATSSDQIVELYENQSHVQN 845
           LRFPRFLRIREDKGVEDATSSDQIVELYENQSH+QN
Sbjct: 720 LRFPRFLRIREDKGVEDATSSDQIVELYENQSHMQN 755

>Skud_4.93 Chr4 complement(160642..162909) [2268 bp, 755 aa] {ON}
           YDL164C (REAL)
          Length = 755

 Score = 1222 bits (3162), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 608/756 (80%), Positives = 640/756 (84%), Gaps = 1/756 (0%)

Query: 90  MRRLLGGLLISSTHXXXXXXXXXXXXXXXXXAGKKPKQATLARFFTSMKNKPSGNTSPPD 149
           MRRLL GLL S                    AGKKPKQATLARFF+SMKN+PSG++S P+
Sbjct: 1   MRRLLAGLLFSPARSLNPRLSLLMPPSLPSSAGKKPKQATLARFFSSMKNEPSGSSSSPE 60

Query: 150 KSAKHMLQXXXXXXXXXXXRNVKKSXXXXXXXXXXXXPFMXXXXXXXXXXXXXXXGADLS 209
           K+ KH L+              KK               M               G D+S
Sbjct: 61  KAPKHKLENNIDNNSSEGADATKKLKQVSTVQTLVAPSTMGSSPFSLPSSAPSSSGVDVS 120

Query: 210 QKFQGLGPKVEDFEMNSNDSDHYSSNIPYSDVCEVFNQIEAISSRLEIIRICSDFFIKVM 269
           Q+ +   P+VE  E +SND+DHYSSNIPYS+VCEVFN+IEAISSRLEIIRICSDFFIK+M
Sbjct: 121 QESREFTPQVEK-EPSSNDNDHYSSNIPYSEVCEVFNKIEAISSRLEIIRICSDFFIKIM 179

Query: 270 KQSSKNLIPTTYLFINRLGPDYXXXXXXXXXXXXXMKTISESCGKSMSQIKLKYKEIGDL 329
            QSSKNLIPTTYLFINRLGPDY             MKTISESCGKSMSQIKLKYKE+GDL
Sbjct: 180 NQSSKNLIPTTYLFINRLGPDYEAGLELGLGENLLMKTISESCGKSMSQIKLKYKEMGDL 239

Query: 330 GEIAMGARNVQPTMFKPKPLTVGEVFKNLRTIAKTQGKDSQLRKIKLIKRMLTACQGVEA 389
           GEIAMGARNVQPTMFKPK LTVGEVFKNLRTIAKTQGKDSQLRK+KLIKRMLTACQGVEA
Sbjct: 240 GEIAMGARNVQPTMFKPKALTVGEVFKNLRTIAKTQGKDSQLRKMKLIKRMLTACQGVEA 299

Query: 390 KFLIRSLESKLRIGLAEKTVLISLSKALLLHDENRENSADKDIPMDVLESAQQKIRDAFC 449
           KFLIRSLESKLRIGLAEKTVLISLSKALLLHDEN+ENS DK+IPMDVLESAQQ+IRDAFC
Sbjct: 300 KFLIRSLESKLRIGLAEKTVLISLSKALLLHDENKENSPDKEIPMDVLESAQQRIRDAFC 359

Query: 450 QVPNYEIVINSCLEHGIMNLDKYCTLRPGIPLKPMLAKPTKAINEVLDRFQGETFTSEYK 509
           QVPNYEIVINSCL HGIMNLDKYCTLRPGIPLKPMLAKPTKAINEVLDRFQGETFTSEYK
Sbjct: 360 QVPNYEIVINSCLNHGIMNLDKYCTLRPGIPLKPMLAKPTKAINEVLDRFQGETFTSEYK 419

Query: 510 YDGERAQVHLLNDGTMRIYSRNGENMTERYPEIKITDFIQDLDITKNLILDCEAVAWDKD 569
           YDGERAQVHLLNDGTMRIYSRNGENMTERYPEIKITDFIQDL+ TKNLILDCEAVAWDK+
Sbjct: 420 YDGERAQVHLLNDGTMRIYSRNGENMTERYPEIKITDFIQDLNSTKNLILDCEAVAWDKE 479

Query: 570 QAKILPFQVLSTRKRKDVELNDVKVRVCLFAFDILCHNDERLINMSLRERREYLTKVTKV 629
           Q KILPFQ+LSTRKRKDVEL+DVKV+VCLFAFDILC+NDERLIN SLRERRE+L KVTKV
Sbjct: 480 QKKILPFQILSTRKRKDVELHDVKVKVCLFAFDILCYNDERLINKSLRERREHLAKVTKV 539

Query: 630 VPGEFQYATQIITNNLDELQKFLDESVNHSCEGLMVKMLDGSESHYEPSKRSRNWLKLKK 689
           VPGEFQYATQIITNNLDELQKFLDESVN+SCEGLMVKMLDG ESHYEPSKRSRNWLKLKK
Sbjct: 540 VPGEFQYATQIITNNLDELQKFLDESVNNSCEGLMVKMLDGPESHYEPSKRSRNWLKLKK 599

Query: 690 DYLEGVGDSLDLCVLXXXXXXXXXXXXXXXFLLGCYNQDTGEFETCCKIGTGFSDEMLQL 749
           DYLEGVGDSLDLCVL               FLLGCYNQDTGEFETCCKIGTGFSDEMLQL
Sbjct: 600 DYLEGVGDSLDLCVLGAYYGRGKRTGTYGGFLLGCYNQDTGEFETCCKIGTGFSDEMLQL 659

Query: 750 LHARLTPTIIDGPKATYVFDSSAEPDVWFEPTTLFEVLTADLSLSPIYKAGSTTFDKGVS 809
           LH RLTPTIIDGPKAT+VFD+SAEPDVWFEPTTLFEVLTADLSLSPIYKAGS TFDKGVS
Sbjct: 660 LHERLTPTIIDGPKATFVFDASAEPDVWFEPTTLFEVLTADLSLSPIYKAGSATFDKGVS 719

Query: 810 LRFPRFLRIREDKGVEDATSSDQIVELYENQSHVQN 845
           LRFPRFLRIREDKGVEDATSSDQI+ELYENQSHVQN
Sbjct: 720 LRFPRFLRIREDKGVEDATSSDQIIELYENQSHVQN 755

>Suva_4.82 Chr4 complement(152544..154811) [2268 bp, 755 aa] {ON}
           YDL164C (REAL)
          Length = 755

 Score = 1217 bits (3148), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 603/756 (79%), Positives = 632/756 (83%), Gaps = 1/756 (0%)

Query: 90  MRRLLGGLLISSTHXXXXXXXXXXXXXXXXXAGKKPKQATLARFFTSMKNKPSGNTSPPD 149
           M R L GL+++S                   AGKKPKQATLARFFTSMKNKPSG +S P+
Sbjct: 1   MHRSLAGLILTSVRPSSSKLLLFMSSSLPSSAGKKPKQATLARFFTSMKNKPSGGSSSPE 60

Query: 150 KSAKHMLQXXXXXXXXXXXRNVKKSXXXXXXXXXXXXPFMXXXXXXXXXXXXXXXGADLS 209
           K+ KH ++             +KK               M               G D S
Sbjct: 61  KAVKHKIENGTNEISSEGASAIKKLKHLSAVQTPVEQSDMSSSSSPLPSSAPSSSGVDAS 120

Query: 210 QKFQGLGPKVEDFEMNSNDSDHYSSNIPYSDVCEVFNQIEAISSRLEIIRICSDFFIKVM 269
           QK + L PKVE+ E    D+DHYSSNIPYS+VCEVFN+IEAISSRLEIIRICSDFFIK+M
Sbjct: 121 QKSRELTPKVEE-EQGPIDNDHYSSNIPYSEVCEVFNEIEAISSRLEIIRICSDFFIKIM 179

Query: 270 KQSSKNLIPTTYLFINRLGPDYXXXXXXXXXXXXXMKTISESCGKSMSQIKLKYKEIGDL 329
           KQSSKNLIPTTYLFINRLGPDY             MKTISESCGKSM+QIKLKYKEIGDL
Sbjct: 180 KQSSKNLIPTTYLFINRLGPDYEPGLELGLGENLLMKTISESCGKSMNQIKLKYKEIGDL 239

Query: 330 GEIAMGARNVQPTMFKPKPLTVGEVFKNLRTIAKTQGKDSQLRKIKLIKRMLTACQGVEA 389
           GEIAMGARNVQPTMFKPKPLTVGEVFKNLR+IAKTQGKDSQLRK+KLIKRMLTACQGVEA
Sbjct: 240 GEIAMGARNVQPTMFKPKPLTVGEVFKNLRSIAKTQGKDSQLRKMKLIKRMLTACQGVEA 299

Query: 390 KFLIRSLESKLRIGLAEKTVLISLSKALLLHDENRENSADKDIPMDVLESAQQKIRDAFC 449
           KFLIRSLESKLRIGLAEKTVLISLSKALLLH  N ENS   DIPMDVLESAQQKIRDAFC
Sbjct: 300 KFLIRSLESKLRIGLAEKTVLISLSKALLLHGGNGENSHVNDIPMDVLESAQQKIRDAFC 359

Query: 450 QVPNYEIVINSCLEHGIMNLDKYCTLRPGIPLKPMLAKPTKAINEVLDRFQGETFTSEYK 509
           QVPNYEIVINSCLEHGIMNLDK+CTL+PGIPLKPMLAKPTKAINEVLDRFQGETFTSEYK
Sbjct: 360 QVPNYEIVINSCLEHGIMNLDKFCTLKPGIPLKPMLAKPTKAINEVLDRFQGETFTSEYK 419

Query: 510 YDGERAQVHLLNDGTMRIYSRNGENMTERYPEIKITDFIQDLDITKNLILDCEAVAWDKD 569
           YDGERAQVHLL+DGTMRIYSRNGENMTERYPEIKITDFIQDLD TKNLILDCEAVAWDK+
Sbjct: 420 YDGERAQVHLLDDGTMRIYSRNGENMTERYPEIKITDFIQDLDATKNLILDCEAVAWDKE 479

Query: 570 QAKILPFQVLSTRKRKDVELNDVKVRVCLFAFDILCHNDERLINMSLRERREYLTKVTKV 629
           Q KILPFQVLSTRKRKDVEL+DVKVRVCLFAFD+LCHN ERLIN SLRERRE LTKVTKV
Sbjct: 480 QGKILPFQVLSTRKRKDVELSDVKVRVCLFAFDVLCHNGERLINKSLRERRECLTKVTKV 539

Query: 630 VPGEFQYATQIITNNLDELQKFLDESVNHSCEGLMVKMLDGSESHYEPSKRSRNWLKLKK 689
           VPGEFQYATQI+T+NLDELQKFLDESVN SCEGLMVKML+G ESHYEPSKRSRNWLKLKK
Sbjct: 540 VPGEFQYATQIVTDNLDELQKFLDESVNQSCEGLMVKMLEGPESHYEPSKRSRNWLKLKK 599

Query: 690 DYLEGVGDSLDLCVLXXXXXXXXXXXXXXXFLLGCYNQDTGEFETCCKIGTGFSDEMLQL 749
           DYLEGVGDSLDLCVL               FLLGCYNQDTGEFETCCKIGTGFSDE LQ 
Sbjct: 600 DYLEGVGDSLDLCVLGAYYGRGKRTGTYGGFLLGCYNQDTGEFETCCKIGTGFSDESLQQ 659

Query: 750 LHARLTPTIIDGPKATYVFDSSAEPDVWFEPTTLFEVLTADLSLSPIYKAGSTTFDKGVS 809
           LH RLTPTIIDGPKAT+VFDSSAEPDVWFEPTTLFEVLTADLSLSPIYKAGSTTF KGVS
Sbjct: 660 LHERLTPTIIDGPKATFVFDSSAEPDVWFEPTTLFEVLTADLSLSPIYKAGSTTFAKGVS 719

Query: 810 LRFPRFLRIREDKGVEDATSSDQIVELYENQSHVQN 845
           LRFPRFLRIREDKGVEDATSS+QIVELYENQSHVQN
Sbjct: 720 LRFPRFLRIREDKGVEDATSSEQIVELYENQSHVQN 755

>NCAS0A14110 Chr1 (2774465..2776726) [2262 bp, 753 aa] {ON}
           Anc_7.343 YDL164C
          Length = 753

 Score = 1009 bits (2610), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 500/733 (68%), Positives = 577/733 (78%), Gaps = 17/733 (2%)

Query: 123 KKPKQATLARFFTSMKN-KPSGNTSPPDKSAKHMLQXXXXXXXXXXXRNVKK---SXXXX 178
           KK KQATLA+FF+SMKN KP+    P D +     +           +  ++        
Sbjct: 27  KKQKQATLAKFFSSMKNEKPADKKDPEDSTTTTTEKPSLSPYTANSKKTFEEILNRPASN 86

Query: 179 XXXXXXXXPFMXXXXXXXXXXXXXXXGADLS-QKFQGLG------PKVEDFEMNSNDSDH 231
                     +               G DL  QK +         P +E+   +S  +  
Sbjct: 87  LASSSQGVSDIASTPSIPNISTDESTGPDLKKQKLEESNLEPSKEPTIENVTQDS--TKP 144

Query: 232 YSSNIPYSDVCEVFNQIEAISSRLEIIRICSDFFIKVMKQSSKNLIPTTYLFINRLGPDY 291
           Y S+IPY +VC +F +IE+ SSRL II++CSDFFIK+MK++ +NLIP TYLFIN+LGPDY
Sbjct: 145 YFSSIPYREVCNLFQEIESTSSRLAIIKLCSDFFIKIMKENPQNLIPVTYLFINKLGPDY 204

Query: 292 XXXXXXXXXXXXXMKTISESCGKSMSQIKLKYKEIGDLGEIAMGARNVQPTMFKPKPLTV 351
                        MKTISESCGKS++Q++ KY+E+GDLG+IAM ARNVQPTMFKPKPLTV
Sbjct: 205 EPGLELGLGEGLLMKTISESCGKSLAQVRNKYRELGDLGQIAMDARNVQPTMFKPKPLTV 264

Query: 352 GEVFKNLRTIAKTQGKDSQLRKIKLIKRMLTACQGVEAKFLIRSLESKLRIGLAEKTVLI 411
           GEVF+NLR IAK++GKDSQ RKIKLIKRMLTAC+G EAKFLIRSLESKLRIGLAEKTVLI
Sbjct: 265 GEVFENLRLIAKSEGKDSQTRKIKLIKRMLTACEGTEAKFLIRSLESKLRIGLAEKTVLI 324

Query: 412 SLSKALLLHDENRENSADKDIPMDVLESAQQKIRDAFCQVPNYEIVINSCLEHGIMNLDK 471
           SLSKALL+H    E   +KD  M++LE+A+QKIRDAFCQVPNYEIVINSCL++GIM L+ 
Sbjct: 325 SLSKALLVH----ECKDNKDFDMELLETAEQKIRDAFCQVPNYEIVINSCLKYGIMELET 380

Query: 472 YCTLRPGIPLKPMLAKPTKAINEVLDRFQGETFTSEYKYDGERAQVHLLNDGTMRIYSRN 531
           +C+LRPGIPLKPMLAKPTKAINE+LDRFQGE FTSEYKYDGERAQVHLL+DGTMRIYSRN
Sbjct: 381 HCSLRPGIPLKPMLAKPTKAINEILDRFQGEIFTSEYKYDGERAQVHLLSDGTMRIYSRN 440

Query: 532 GENMTERYPEIKITDFIQDLDITKNLILDCEAVAWDKDQAKILPFQVLSTRKRKDVELND 591
           GENMTERYPEI I DFI D  +T  LILDCEAVAWD +Q KILPFQVLSTRKRKDV+L D
Sbjct: 441 GENMTERYPEIHIRDFIADPLVTSTLILDCEAVAWDNEQNKILPFQVLSTRKRKDVDLKD 500

Query: 592 VKVRVCLFAFDILCHNDERLINMSLRERREYLTKVTKVVPGEFQYATQIITNNLDELQKF 651
           VKV+VCLFAFDILCHNDE+LIN SLRERR+ L +VTK V GEFQYAT++ ++NLDELQKF
Sbjct: 501 VKVKVCLFAFDILCHNDEKLINKSLRERRQILQEVTKSVTGEFQYATEMTSSNLDELQKF 560

Query: 652 LDESVNHSCEGLMVKMLDGSESHYEPSKRSRNWLKLKKDYLEGVGDSLDLCVLXXXXXXX 711
           LD+SV+ SCEGLMVKMLDG ESHYEPSKRSRNWLKLKKDYLEG+GDSLDLCV+       
Sbjct: 561 LDQSVHDSCEGLMVKMLDGIESHYEPSKRSRNWLKLKKDYLEGIGDSLDLCVIGAYYGRG 620

Query: 712 XXXXXXXXFLLGCYNQDTGEFETCCKIGTGFSDEMLQLLHARLTPTIIDGPKATYVFDSS 771
                   FLLGCYNQDTGEFETCCKIGTGFSDEMLQ L+ RLTPT++DGPKAT+V+DSS
Sbjct: 621 KRTGMYGGFLLGCYNQDTGEFETCCKIGTGFSDEMLQQLYTRLTPTVLDGPKATFVYDSS 680

Query: 772 AEPDVWFEPTTLFEVLTADLSLSPIYKAGSTTFDKGVSLRFPRFLRIREDKGVEDATSSD 831
           AEPDVWFEPT LFEVLTADLSLSPIYKAGS+T+DKG+SLRFPRF+R REDKGVEDATSS+
Sbjct: 681 AEPDVWFEPTLLFEVLTADLSLSPIYKAGSSTYDKGISLRFPRFIRTREDKGVEDATSSE 740

Query: 832 QIVELYENQSHVQ 844
           QI+ELYENQ+H Q
Sbjct: 741 QIIELYENQAHTQ 753

>CAGL0I03410g Chr9 complement(289606..291780) [2175 bp, 724 aa] {ON}
           highly similar to uniprot|P04819 Saccharomyces
           cerevisiae YDL164c CDC9 DNA ligase
          Length = 724

 Score =  980 bits (2533), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 485/720 (67%), Positives = 559/720 (77%), Gaps = 24/720 (3%)

Query: 126 KQATLARFFTSMKNKPSGNTSPPDKSAKHMLQXXXXXXXXXXXRNVKKSXXXXXXXXXXX 185
           +QATLARFF+S+K    G     DK  +                +  KS           
Sbjct: 29  RQATLARFFSSVKKDADG-----DKKGEQADVKTAAVDLNSHEVDANKS----------- 72

Query: 186 XPFMXXXXXXXXXXXXXXXGADLSQKFQGLGPKVEDFEMNSNDSDHYSSNIPYSDVCEVF 245
            P                 G    ++ +G        +++S     +   +PYSD+C +F
Sbjct: 73  -PLKKMKLESTGSLTATKNGNQGKEEHEGTPIASTPRQVDSK----FFCKVPYSDLCNLF 127

Query: 246 NQIEAISSRLEIIRICSDFFIKVMKQSSKNLIPTTYLFINRLGPDYXXXXXXXXXXXXXM 305
            +IE  SSRL II++CSDFFIK+MK+  +NLIP TYLFIN+LGPDY             M
Sbjct: 128 EEIEGTSSRLAIIKLCSDFFIKIMKEDPQNLIPVTYLFINKLGPDYEPGLELGLGENLLM 187

Query: 306 KTISESCGKSMSQIKLKYKEIGDLGEIAMGARNVQPTMFKPKPLTVGEVFKNLRTIAKTQ 365
           KTISESCGKSM QIK +Y+EIGDLG+IA+ ARNVQPTMFKPKPL VGEVF+NL+TIAK+Q
Sbjct: 188 KTISESCGKSMQQIKNQYREIGDLGQIALEARNVQPTMFKPKPLVVGEVFENLKTIAKSQ 247

Query: 366 GKDSQLRKIKLIKRMLTACQGVEAKFLIRSLESKLRIGLAEKTVLISLSKALLLHDENRE 425
           GKDSQ +K+KLIKRMLTACQG EAKFLIRSLESKLRIGLAEKTVLI+LSKALL+HDE   
Sbjct: 248 GKDSQTKKMKLIKRMLTACQGTEAKFLIRSLESKLRIGLAEKTVLIALSKALLIHDEKYS 307

Query: 426 NSADKDIPMDVLESAQQKIRDAFCQVPNYEIVINSCLEHGIMNLDKYCTLRPGIPLKPML 485
           N   K+  MDV+E A+QKIRDAFCQVPNYE+VIN+CL++GIM LD++CT++PGIPLKPML
Sbjct: 308 N---KEPSMDVVEQAEQKIRDAFCQVPNYELVINACLDYGIMKLDEHCTIQPGIPLKPML 364

Query: 486 AKPTKAINEVLDRFQGETFTSEYKYDGERAQVHLLNDGTMRIYSRNGENMTERYPEIKIT 545
           AKPTKAINEVLDRFQG+TFTSEYKYDGERAQVHLL DGTMRIYSRNGENMTERYPEI+I 
Sbjct: 365 AKPTKAINEVLDRFQGQTFTSEYKYDGERAQVHLLKDGTMRIYSRNGENMTERYPEIQIK 424

Query: 546 DFIQDLDITKNLILDCEAVAWDKDQAKILPFQVLSTRKRKDVELNDVKVRVCLFAFDILC 605
           DF+ D   T +LILDCEAVAWDK+Q KILPFQVL+TRKRKDV +N+VKVRVCLFAFDIL 
Sbjct: 425 DFLADPASTTSLILDCEAVAWDKEQNKILPFQVLTTRKRKDVNINEVKVRVCLFAFDILL 484

Query: 606 HNDERLINMSLRERREYLTKVTKVVPGEFQYATQIITNNLDELQKFLDESVNHSCEGLMV 665
           HND RLIN  L +RRE L +VTK V GEFQYATQ+ T+NLDELQKFLDESV +SCEGLMV
Sbjct: 485 HNDMRLINEPLSKRREVLHEVTKPVEGEFQYATQMTTSNLDELQKFLDESVKNSCEGLMV 544

Query: 666 KMLDGSESHYEPSKRSRNWLKLKKDYLEGVGDSLDLCVLXXXXXXXXXXXXXXXFLLGCY 725
           KM+DG ES+YEPSKRSRNWLKLKKDYLEGVGDSLDLCVL               FLLGCY
Sbjct: 545 KMMDGVESYYEPSKRSRNWLKLKKDYLEGVGDSLDLCVLGAYFGRGKRTGTYGGFLLGCY 604

Query: 726 NQDTGEFETCCKIGTGFSDEMLQLLHARLTPTIIDGPKATYVFDSSAEPDVWFEPTTLFE 785
           N D+ +FETCCKIGTGFS+EMLQ L+ +L+PT+IDGPK TYVFDSSAEPDVWFEPT LFE
Sbjct: 605 NADSEDFETCCKIGTGFSEEMLQTLYEKLSPTVIDGPKGTYVFDSSAEPDVWFEPTMLFE 664

Query: 786 VLTADLSLSPIYKAGSTTFDKGVSLRFPRFLRIREDKGVEDATSSDQIVELYENQSHVQN 845
           VLTADLSLSPIYKAGS+ +DKG+SLRFPRFLRIR+DK VEDATSS+QI+E+Y+NQSHV N
Sbjct: 665 VLTADLSLSPIYKAGSSVYDKGISLRFPRFLRIRDDKSVEDATSSEQIIEMYQNQSHVAN 724

>NDAI0A01940 Chr1 complement(432302..434599) [2298 bp, 765 aa] {ON}
           Anc_7.343 YDL164C
          Length = 765

 Score =  979 bits (2530), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 468/608 (76%), Positives = 526/608 (86%), Gaps = 5/608 (0%)

Query: 236 IPYSDVCEVFNQIEAISSRLEIIRICSDFFIKVMKQSSKNLIPTTYLFINRLGPDYXXXX 295
           IPY +VC++F +IE  SSRL II++CSDF IK+MKQ  +NLIP TYLFIN+LGPDY    
Sbjct: 159 IPYKEVCQLFQEIETTSSRLSIIKLCSDFLIKIMKQDPQNLIPVTYLFINKLGPDYEPGL 218

Query: 296 XXXXXXXXXMKTISESCGKSMSQIKLKYKEIGDLGEIAMGARNVQPTMFKPKPLTVGEVF 355
                    MKTISESCGKS++QI+ +Y+E+GDLG+IA+ ARNVQPTMFKPKPLTVGEVF
Sbjct: 219 ELGLGEGLLMKTISESCGKSLTQIRAQYRELGDLGQIALEARNVQPTMFKPKPLTVGEVF 278

Query: 356 KNLRTIAKTQGKDSQLRKIKLIKRMLTACQ-GVEAKFLIRSLESKLRIGLAEKTVLISLS 414
            NL+ IAK  GKDSQ +KIKLIKRMLTAC+ GVEAKFLIRSLESKLRIGLAEKTVLISLS
Sbjct: 279 NNLKMIAKAAGKDSQTKKIKLIKRMLTACEDGVEAKFLIRSLESKLRIGLAEKTVLISLS 338

Query: 415 KALLLHDENRENSADKDIPMDVLESAQQKIRDAFCQVPNYEIVINSCLEHGIMNLDKYCT 474
           KALL+    +E  A+KD  M++LE+A+ KIRDAFCQVPNYEIVINSCL++GIMNL+++C+
Sbjct: 339 KALLV----KEFDANKDFDMELLETAEGKIRDAFCQVPNYEIVINSCLQYGIMNLNEHCS 394

Query: 475 LRPGIPLKPMLAKPTKAINEVLDRFQGETFTSEYKYDGERAQVHLLNDGTMRIYSRNGEN 534
           LRPGIPLKPMLAKPTKAINE+LDRFQGETFTSEYKYDGERAQVHLL DGTMRIYSRNGEN
Sbjct: 395 LRPGIPLKPMLAKPTKAINEILDRFQGETFTSEYKYDGERAQVHLLEDGTMRIYSRNGEN 454

Query: 535 MTERYPEIKITDFIQDLDITKNLILDCEAVAWDKDQAKILPFQVLSTRKRKDVELNDVKV 594
           MTERYPEI I DF++D + TK LILDCEAVAWDK+Q KILPFQVLSTRKRKDV   DVKV
Sbjct: 455 MTERYPEIHIGDFVKDRNETKTLILDCEAVAWDKEQQKILPFQVLSTRKRKDVLAKDVKV 514

Query: 595 RVCLFAFDILCHNDERLINMSLRERREYLTKVTKVVPGEFQYATQIITNNLDELQKFLDE 654
           RVCLFAFDILCHN  +LIN SL+ERRE L +VT   PGEFQYAT++ T+NLDELQKFLD+
Sbjct: 515 RVCLFAFDILCHNSNKLINYSLKERREILHRVTTPAPGEFQYATELTTSNLDELQKFLDQ 574

Query: 655 SVNHSCEGLMVKMLDGSESHYEPSKRSRNWLKLKKDYLEGVGDSLDLCVLXXXXXXXXXX 714
           SVN SCEGLMVKML+G ESHYEPSKRSRNWLKLKKDYLEG+GDSLDLCVL          
Sbjct: 575 SVNDSCEGLMVKMLEGEESHYEPSKRSRNWLKLKKDYLEGIGDSLDLCVLGAYYGRGKRT 634

Query: 715 XXXXXFLLGCYNQDTGEFETCCKIGTGFSDEMLQLLHARLTPTIIDGPKATYVFDSSAEP 774
                FLLGCYN +TGEFETCCKIGTGFSDEMLQ LH +L  T+IDGPKATY++DSSAEP
Sbjct: 635 GTYGGFLLGCYNDNTGEFETCCKIGTGFSDEMLQQLHEKLKATVIDGPKATYIYDSSAEP 694

Query: 775 DVWFEPTTLFEVLTADLSLSPIYKAGSTTFDKGVSLRFPRFLRIREDKGVEDATSSDQIV 834
           DVWFEP+ LFEVLTADLSLSPIYKAGS+ +DKGVSLRFPRF+RIREDKGVEDATSS+QI+
Sbjct: 695 DVWFEPSLLFEVLTADLSLSPIYKAGSSAYDKGVSLRFPRFIRIREDKGVEDATSSEQII 754

Query: 835 ELYENQSH 842
           ELYENQSH
Sbjct: 755 ELYENQSH 762

>TDEL0C02040 Chr3 complement(352579..354696) [2118 bp, 705 aa] {ON}
           Anc_7.343 YDL164C
          Length = 705

 Score =  978 bits (2528), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 468/614 (76%), Positives = 524/614 (85%), Gaps = 4/614 (0%)

Query: 230 DHYSSNIPYSDVCEVFNQIEAISSRLEIIRICSDFFIKVMKQSSKNLIPTTYLFINRLGP 289
           D Y S +PYSDVC VF +IE  SSRL II+ICS+FF ++MK + +NLIPTTYLFINRLGP
Sbjct: 95  DLYYSKVPYSDVCNVFQEIEGTSSRLSIIKICSEFFSRIMKDNPQNLIPTTYLFINRLGP 154

Query: 290 DYXXXXXXXXXXXXXMKTISESCGKSMSQIKLKYKEIGDLGEIAMGARNVQPTMFKPKPL 349
           DY             MKTISE+CGKS+ Q+K +Y+E+GDLG+IA+ ARNVQPTMFKPKPL
Sbjct: 155 DYEPGLELGLGEGLLMKTISEACGKSLVQVKNRYREMGDLGQIALEARNVQPTMFKPKPL 214

Query: 350 TVGEVFKNLRTIAKTQGKDSQLRKIKLIKRMLTACQGVEAKFLIRSLESKLRIGLAEKTV 409
           TVGEVF+NLR IA +QGKDSQ RKIKLIKRMLTAC+GVEAKFLIRSLESKLRIGLAEKTV
Sbjct: 215 TVGEVFENLRAIAHSQGKDSQTRKIKLIKRMLTACEGVEAKFLIRSLESKLRIGLAEKTV 274

Query: 410 LISLSKALLLHDENRENSADKDIPMDVLESAQQKIRDAFCQVPNYEIVINSCLEHGIMNL 469
           LISLSKALL +    E    K+  M+++E A+ KIRDAFCQVPNYEIVIN+CL++GIM L
Sbjct: 275 LISLSKALLTN----EGETGKEPSMELVEQAEAKIRDAFCQVPNYEIVINACLDYGIMEL 330

Query: 470 DKYCTLRPGIPLKPMLAKPTKAINEVLDRFQGETFTSEYKYDGERAQVHLLNDGTMRIYS 529
           DK+C LRPGIPLKPMLAKPTK+I EVLDRFQG+TFTSEYKYDGERAQVHLL DGTMRIYS
Sbjct: 331 DKHCRLRPGIPLKPMLAKPTKSITEVLDRFQGQTFTSEYKYDGERAQVHLLEDGTMRIYS 390

Query: 530 RNGENMTERYPEIKITDFIQDLDITKNLILDCEAVAWDKDQAKILPFQVLSTRKRKDVEL 589
           RNGENMTERYPEI I DF+ DL+ TK LILDCEAVAWDK Q KILPFQVLSTRKRKDVE 
Sbjct: 391 RNGENMTERYPEISIRDFVADLEHTKTLILDCEAVAWDKVQQKILPFQVLSTRKRKDVEA 450

Query: 590 NDVKVRVCLFAFDILCHNDERLINMSLRERREYLTKVTKVVPGEFQYATQIITNNLDELQ 649
            DVKVRVCLFAFDI+CHN ER IN SLRERRE L +VTK V GEFQYA ++ T++++ELQ
Sbjct: 451 KDVKVRVCLFAFDIICHNGERQINKSLRERRELLAQVTKPVAGEFQYAVELTTSSVEELQ 510

Query: 650 KFLDESVNHSCEGLMVKMLDGSESHYEPSKRSRNWLKLKKDYLEGVGDSLDLCVLXXXXX 709
           KFLD+SV  SCEGLMVKMLDG ESHYEPSKRSRNWLKLKKDYL+GVGDSLDLCVL     
Sbjct: 511 KFLDQSVKDSCEGLMVKMLDGPESHYEPSKRSRNWLKLKKDYLDGVGDSLDLCVLGAYYG 570

Query: 710 XXXXXXXXXXFLLGCYNQDTGEFETCCKIGTGFSDEMLQLLHARLTPTIIDGPKATYVFD 769
                     FLLGCYNQD+GEFETCCKIGTGFSDEMLQ L+ R + T +DGPKATYVFD
Sbjct: 571 RGKRTGTYGGFLLGCYNQDSGEFETCCKIGTGFSDEMLQQLYERFSKTTLDGPKATYVFD 630

Query: 770 SSAEPDVWFEPTTLFEVLTADLSLSPIYKAGSTTFDKGVSLRFPRFLRIREDKGVEDATS 829
           SSAEPDVWFEPTTLFEVLTADLSLSP+YKAG++T+DKGVSLRFPRF+R+R+DK VEDATS
Sbjct: 631 SSAEPDVWFEPTTLFEVLTADLSLSPVYKAGASTYDKGVSLRFPRFVRLRDDKSVEDATS 690

Query: 830 SDQIVELYENQSHV 843
           S QIVELY++QSHV
Sbjct: 691 SAQIVELYQDQSHV 704

>KNAG0C03740 Chr3 (737968..740151) [2184 bp, 727 aa] {ON} Anc_7.343
           YDL164C
          Length = 727

 Score =  963 bits (2489), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 459/627 (73%), Positives = 532/627 (84%), Gaps = 6/627 (0%)

Query: 218 KVEDFEMNSNDSDHYSSNIPYSDVCEVFNQIEAISSRLEIIRICSDFFIKVMKQSSKNLI 277
           K++D    +ND+  + S +PY+D+C +F +IE ISSRL II++CS F I VMK   +NLI
Sbjct: 106 KIQD---ENNDTKEFYSTVPYADLCNLFQEIEGISSRLAIIKLCSSFLISVMKLDPRNLI 162

Query: 278 PTTYLFINRLGPDYXXXXXXXXXXXXXMKTISESCGKSMSQIKLKYKEIGDLGEIAMGAR 337
           P TYLFIN+LGPDY             +KTI+ESCG+S+ QIK KY EIGDLG+IA+ AR
Sbjct: 163 PMTYLFINKLGPDYMPGLELGLGENLLIKTIAESCGRSLQQIKTKYHEIGDLGQIALEAR 222

Query: 338 NVQPTMFKPKPLTVGEVFKNLRTIAKTQGKDSQLRKIKLIKRMLTACQGVEAKFLIRSLE 397
            VQPTMFKPKPLTVGEVF+NL++IA +QGKDSQ +KIKLIKRMLT+CQGVEAKFLIRSLE
Sbjct: 223 KVQPTMFKPKPLTVGEVFQNLKSIASSQGKDSQTKKIKLIKRMLTSCQGVEAKFLIRSLE 282

Query: 398 SKLRIGLAEKTVLISLSKALLLHDENRENSADKDIPMDVLESAQQKIRDAFCQVPNYEIV 457
           SKLRIGLAEKTVLISLSKALL+++      +DKDI M+ +E+A+QKIRDAFCQVPNYE+V
Sbjct: 283 SKLRIGLAEKTVLISLSKALLVYEYGE---SDKDIDMETVENAEQKIRDAFCQVPNYEVV 339

Query: 458 INSCLEHGIMNLDKYCTLRPGIPLKPMLAKPTKAINEVLDRFQGETFTSEYKYDGERAQV 517
           I+SCL+HGIMNLD++C+LRP IPLKPMLAKPTK+I+E+ DRFQ + FT EYKYDGERAQV
Sbjct: 340 IDSCLKHGIMNLDQHCSLRPAIPLKPMLAKPTKSISEIFDRFQDQKFTCEYKYDGERAQV 399

Query: 518 HLLNDGTMRIYSRNGENMTERYPEIKITDFIQDLDITKNLILDCEAVAWDKDQAKILPFQ 577
           HLL DGTMRIYSRNGENMTERYPEI I DF+ DL  TK+LILDCEAVAWDK+Q KILPFQ
Sbjct: 400 HLLEDGTMRIYSRNGENMTERYPEIHIRDFVTDLSHTKSLILDCEAVAWDKEQNKILPFQ 459

Query: 578 VLSTRKRKDVELNDVKVRVCLFAFDILCHNDERLINMSLRERREYLTKVTKVVPGEFQYA 637
           VLSTRKRKDV++N++KVRVCLFAFDIL HNDE+LIN SL+ERR+ L  +TK V GEFQ+A
Sbjct: 460 VLSTRKRKDVDINEIKVRVCLFAFDILLHNDEKLINKSLQERRDILHSITKEVTGEFQFA 519

Query: 638 TQIITNNLDELQKFLDESVNHSCEGLMVKMLDGSESHYEPSKRSRNWLKLKKDYLEGVGD 697
           T++ T NL+ELQ FLD+SV +SCEGLMVKML+G ESHYEPSKRSRNWLKLKKDYL GVGD
Sbjct: 520 TEMTTTNLEELQSFLDQSVKNSCEGLMVKMLEGEESHYEPSKRSRNWLKLKKDYLAGVGD 579

Query: 698 SLDLCVLXXXXXXXXXXXXXXXFLLGCYNQDTGEFETCCKIGTGFSDEMLQLLHARLTPT 757
           SLDLCVL               FLLGCYNQDTGEFET CKIGTGFSDE+LQ LH RL  T
Sbjct: 580 SLDLCVLGAYFGRGKRTGNYGGFLLGCYNQDTGEFETACKIGTGFSDEVLQQLHERLKST 639

Query: 758 IIDGPKATYVFDSSAEPDVWFEPTTLFEVLTADLSLSPIYKAGSTTFDKGVSLRFPRFLR 817
           +ID PKATYVFD SAEPDVWFEPT LFEVLTADLSLSP+YKAGS+T+DKGVSLRFPRFLR
Sbjct: 640 VIDLPKATYVFDPSAEPDVWFEPTLLFEVLTADLSLSPVYKAGSSTYDKGVSLRFPRFLR 699

Query: 818 IREDKGVEDATSSDQIVELYENQSHVQ 844
           +REDKGVEDATSS+QIVE+YENQ+++Q
Sbjct: 700 LREDKGVEDATSSEQIVEMYENQANLQ 726

>KAFR0B00830 Chr2 (157155..159287) [2133 bp, 710 aa] {ON} Anc_7.343
           YDL164C
          Length = 710

 Score =  956 bits (2471), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 456/633 (72%), Positives = 536/633 (84%), Gaps = 10/633 (1%)

Query: 217 PKVEDFEMNSNDSDH------YSSNIPYSDVCEVFNQIEAISSRLEIIRICSDFFIKVMK 270
           PK+   E +  DS        +  +IPY+DVC +F +IE ISSRL+II++CS+FF K MK
Sbjct: 80  PKLSPIESSKTDSSETTVKQEFVCDIPYADVCVLFQEIENISSRLQIIKLCSEFFTKAMK 139

Query: 271 QSSKNLIPTTYLFINRLGPDYXXXXXXXXXXXXXMKTISESCGKSMSQIKLKYKEIGDLG 330
           Q++ NLIP TYLFIN+LGPDY             MKTISESCGKS+ Q+KL YK+IGDLG
Sbjct: 140 QNTANLIPLTYLFINKLGPDYEMGLELGLGENLLMKTISESCGKSLQQVKLDYKDIGDLG 199

Query: 331 EIAMGARNVQPTMFKPKPLTVGEVFKNLRTIAKTQGKDSQLRKIKLIKRMLTACQGVEAK 390
            IAM ARNVQPTMFKPKPLTVG VF+NL+ IAK+ GKDSQL+KI+LIK++LTAC+G+EAK
Sbjct: 200 TIAMNARNVQPTMFKPKPLTVGYVFQNLKLIAKSSGKDSQLKKIRLIKKLLTACKGIEAK 259

Query: 391 FLIRSLESKLRIGLAEKTVLISLSKALLLHDENRENSADKDIPMDVLESAQQKIRDAFCQ 450
           +LIRSLESKLRIGLAEK+VLISLSKALL+++ N  N+ D D  M+++E A+QKIRDAFCQ
Sbjct: 260 YLIRSLESKLRIGLAEKSVLISLSKALLINEYN--NTLDPD--MELIEKAEQKIRDAFCQ 315

Query: 451 VPNYEIVINSCLEHGIMNLDKYCTLRPGIPLKPMLAKPTKAINEVLDRFQGETFTSEYKY 510
           +PNYEIVINSCL++GIMNLD++C+LRPGIPLKPMLAKPTK I EV DRFQ   FTSEYKY
Sbjct: 316 IPNYEIVINSCLKYGIMNLDEHCSLRPGIPLKPMLAKPTKTIMEVFDRFQNIHFTSEYKY 375

Query: 511 DGERAQVHLLNDGTMRIYSRNGENMTERYPEIKITDFIQDLDITKNLILDCEAVAWDKDQ 570
           DGERAQVHL+NDG+MRIYSRNGENMTERYPEI +TDFI+DL++TK+LI+DCEAVAWD+++
Sbjct: 376 DGERAQVHLMNDGSMRIYSRNGENMTERYPEINVTDFIKDLNLTKSLIIDCEAVAWDREE 435

Query: 571 AKILPFQVLSTRKRKDVELNDVKVRVCLFAFDILCHNDERLINMSLRERREYLTKVTKVV 630
            KILPFQVLSTRKRKDV++ D+KVR+CLFAFDILCHNDE+LIN SLRERRE L  VT+ V
Sbjct: 436 KKILPFQVLSTRKRKDVDIKDIKVRICLFAFDILCHNDEKLINKSLRERREILHSVTREV 495

Query: 631 PGEFQYATQIITNNLDELQKFLDESVNHSCEGLMVKMLDGSESHYEPSKRSRNWLKLKKD 690
            GEF YA ++ TNNLDELQ FLD+SV  SCEGLMVK+LDG +SHYEPSKRSRNWLKLKKD
Sbjct: 496 HGEFTYAKELSTNNLDELQLFLDQSVKDSCEGLMVKVLDGEDSHYEPSKRSRNWLKLKKD 555

Query: 691 YLEGVGDSLDLCVLXXXXXXXXXXXXXXXFLLGCYNQDTGEFETCCKIGTGFSDEMLQLL 750
           YL+GVGDSLDLCVL               FLLGCYNQDTGEFET CKIGTGFSDE+LQ L
Sbjct: 556 YLDGVGDSLDLCVLGAFYGRGKRTGTYGGFLLGCYNQDTGEFETACKIGTGFSDEVLQSL 615

Query: 751 HARLTPTIIDGPKATYVFDSSAEPDVWFEPTTLFEVLTADLSLSPIYKAGSTTFDKGVSL 810
           + RL  T IDGPKATY++DSSA+PDVWFEPT LFEVLTADLS+SPIYKAG++T+ KG+SL
Sbjct: 616 YDRLKSTTIDGPKATYIYDSSAQPDVWFEPTLLFEVLTADLSMSPIYKAGASTYSKGISL 675

Query: 811 RFPRFLRIREDKGVEDATSSDQIVELYENQSHV 843
           RFPRF+R+REDK VE+ATSS+QI+ELYENQSHV
Sbjct: 676 RFPRFIRLREDKSVEEATSSEQIIELYENQSHV 708

>ZYRO0F11572g Chr6 (949236..951431) [2196 bp, 731 aa] {ON} similar
           to uniprot|P04819 Saccharomyces cerevisiae YDL164C CDC9
           DNA ligase found in the nucleus and mitochondria an
           essential enzyme that joins Okazaki fragments during DNA
           replication also acts in nucleotide excision repair base
           excision repair and recombination
          Length = 731

 Score =  934 bits (2415), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 466/722 (64%), Positives = 545/722 (75%), Gaps = 19/722 (2%)

Query: 123 KKPKQATLARFFTSMKNKPSGNTSPPDKSAKHMLQXXXXXXXXXXXRNVKK-SXXXXXXX 181
           K+ KQATLA+FF+S+K++     SP  K+A                 NVK+ S       
Sbjct: 27  KQAKQATLAKFFSSVKDR----NSPTKKNATPAFPTTT---------NVKRESPVRSNSN 73

Query: 182 XXXXXPFMXXXXXXXXXXXXXXXGADLSQKFQGLGPKVEDFEMNSNDSDHYSSNIPYSDV 241
                P                   + +   + L  + +    + N+ D + S +PY+DV
Sbjct: 74  EKESSPMFDDSNGRSSACSSAGLEMESAPAPKKLKMESDSNSTSKNNQDDHFSTVPYADV 133

Query: 242 CEVFNQIEAISSRLEIIRICSDFFIKVMKQSSKNLIPTTYLFINRLGPDYXXXXXXXXXX 301
           C +F +IE+ SSRL II+ICSDFF +++K+ S+NL+PTTYLFIN+LGPDY          
Sbjct: 134 CNIFQEIESTSSRLSIIKICSDFFTQIVKEDSRNLVPTTYLFINKLGPDYEPGMELGLGE 193

Query: 302 XXXMKTISESCGKSMSQIKLKYKEIGDLGEIAMGARNVQPTMFKPKPLTVGEVFKNLRTI 361
              MKTISESCGKS++Q+K +Y+E+GDLG+IAM ARNVQPTMFKPKPLTVGEVF NLR I
Sbjct: 194 GLLMKTISESCGKSLAQVKNRYREMGDLGQIAMEARNVQPTMFKPKPLTVGEVFVNLRNI 253

Query: 362 AKTQGKDSQLRKIKLIKRMLTACQGVEAKFLIRSLESKLRIGLAEKTVLISLSKALLLHD 421
           A  QGKDSQ +KIKLIKRMLTACQGVEAKFLIRSLESKLRIGLAEKTVLISLS ALL H 
Sbjct: 254 ANAQGKDSQNKKIKLIKRMLTACQGVEAKFLIRSLESKLRIGLAEKTVLISLSNALLRH- 312

Query: 422 ENRENSADKDIPMDVLESAQQKIRDAFCQVPNYEIVINSCLEHGIMNLDKYCTLRPGIPL 481
              E   D +   + ++ A+Q IRDAFCQVPNYEIVIN+CLEHGI  L K+C L PGIPL
Sbjct: 313 ---EQGLDVEPSDEAVDKAEQSIRDAFCQVPNYEIVINTCLEHGISQLHKHCQLTPGIPL 369

Query: 482 KPMLAKPTKAINEVLDRFQGETFTSEYKYDGERAQVHLLNDGTMRIYSRNGENMTERYPE 541
           KPMLAKPTKAI EVLDRFQG+ F SEYKYDGERAQ+HLL DGTMRIYSRNGENMTERYPE
Sbjct: 370 KPMLAKPTKAITEVLDRFQGQLFVSEYKYDGERAQLHLLPDGTMRIYSRNGENMTERYPE 429

Query: 542 IKITDFIQDLDITKNLILDCEAVAWDKDQAKILPFQVLSTRKRKDVELNDVKVRVCLFAF 601
           I I DF+ D   T++LILDCEAVAWDK+Q KILPFQVLSTRKRKDV+  DVKVRVCLFAF
Sbjct: 430 IDIRDFLSDPS-TESLILDCEAVAWDKEQGKILPFQVLSTRKRKDVDAKDVKVRVCLFAF 488

Query: 602 DILCHNDERLINMSLRERREYLTKVTKVVPGEFQYATQIITNNLDELQKFLDESVNHSCE 661
           D+LCHN E LIN SLRER++ L KVTK V GEF+YA ++IT N++ELQ FLD+SV  SCE
Sbjct: 489 DLLCHNGEPLINKSLRERQDDLQKVTKPVDGEFRYANKLITANIEELQHFLDQSVKDSCE 548

Query: 662 GLMVKMLDGSESHYEPSKRSRNWLKLKKDYLEGVGDSLDLCVLXXXXXXXXXXXXXXXFL 721
           GLMVKMLDG ESHYEPSKRSRNWLKLKKDYL GVGDSLDLCVL               FL
Sbjct: 549 GLMVKMLDGPESHYEPSKRSRNWLKLKKDYLNGVGDSLDLCVLGAYYGRGKRTGTYGGFL 608

Query: 722 LGCYNQDTGEFETCCKIGTGFSDEMLQLLHARLTPTIIDGPKATYVFDSSAEPDVWFEPT 781
           LGCYNQDTGE+ETCCKIGTGFS+E+LQ L+ RL PT ++ P A YV+DS+ +PDVWFEPT
Sbjct: 609 LGCYNQDTGEYETCCKIGTGFSEELLQQLYDRLKPTAMEAPAAFYVYDSAQQPDVWFEPT 668

Query: 782 TLFEVLTADLSLSPIYKAGSTTFDKGVSLRFPRFLRIREDKGVEDATSSDQIVELYENQS 841
            LFEVL ADLSLSP+YKAGS  +DKG+SLRFPRFLRIR+DK VE+ATSS+Q+V+LYE Q+
Sbjct: 669 LLFEVLAADLSLSPVYKAGSAQYDKGISLRFPRFLRIRDDKSVEEATSSEQVVDLYEAQA 728

Query: 842 HV 843
           H+
Sbjct: 729 HL 730

>Kpol_2001.71 s2001 (195103..197283) [2181 bp, 726 aa] {ON}
           (195103..197283) [2181 nt, 727 aa]
          Length = 726

 Score =  915 bits (2364), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 444/618 (71%), Positives = 505/618 (81%), Gaps = 8/618 (1%)

Query: 232 YSSNIPYSDVCEVFNQIEAISSRLEIIRICSDFFIKVMKQSSKNLIPTTYLFINRLGPDY 291
           + S +PY+D+CEVF ++E+ SSRL II+ICSDF IKVMKQ  +NL+P TYLFIN+LGPDY
Sbjct: 113 FFSTVPYADLCEVFQEVESTSSRLSIIKICSDFLIKVMKQDPQNLVPITYLFINKLGPDY 172

Query: 292 XXXXXXXXXXXXXMKTISESCGKSMSQIKLKYKEIGDLGEIAMGARNVQPTMFKPKPLTV 351
                        MKTISESCGKSM Q+K +Y+EIGDLG+IA  ARNVQPTMFKPKPLTV
Sbjct: 173 EPGLELGLGEGLLMKTISESCGKSMQQLKNQYREIGDLGQIAQDARNVQPTMFKPKPLTV 232

Query: 352 GEVFKNLRTIAKTQGKDSQLRKIKLIKRMLTACQGVEAKFLIRSLESKLRIGLAEKTVLI 411
           GEVF+NL+ IA++QGKDSQ RK++LIKRMLTAC+GVEAKFLIRSLESKLRIGLAEKTVLI
Sbjct: 233 GEVFQNLKDIAQSQGKDSQQRKMRLIKRMLTACKGVEAKFLIRSLESKLRIGLAEKTVLI 292

Query: 412 SLSKALLLHDENRENSADKDIPMDVLESAQQKIRDAFCQVPNYEIVINSCLEHGIMNLDK 471
           SLSKALLL+    E    KD  M+++E+A++KIRDAFCQVPNYEI+I SCL  GIM LD 
Sbjct: 293 SLSKALLLN----EYETSKDPSMELIETAEEKIRDAFCQVPNYEIIIQSCLNDGIMELDN 348

Query: 472 YCTLRPGIPLKPMLAKPTKAINEVLDRFQGETFTSEYKYDGERAQVHLLNDGTMRIYSRN 531
            C LRPGIPLKPMLAKPTKAINEVLD FQGE FT EYKYDGER QVHLL++G MRIYSRN
Sbjct: 349 NCKLRPGIPLKPMLAKPTKAINEVLDAFQGEEFTCEYKYDGERGQVHLLSNGEMRIYSRN 408

Query: 532 GENMTERYPEIKITDFI----QDLDITKNLILDCEAVAWDKDQAKILPFQVLSTRKRKDV 587
           GENMTERYPE+ I DF+     + D   +LILDCE VAWD +Q KILPFQVLSTRKRK V
Sbjct: 409 GENMTERYPELHIEDFLVKDESNTDKEVSLILDCEVVAWDNEQNKILPFQVLSTRKRKGV 468

Query: 588 ELNDVKVRVCLFAFDILCHNDERLINMSLRERREYLTKVTKVVPGEFQYATQIITNNLDE 647
           EL DVKVRVCLFAFDIL +N E LI  +LRERR+ L +VTK VPGEFQYAT +IT  LDE
Sbjct: 469 ELKDVKVRVCLFAFDILYYNGEGLITKTLRERRKILHEVTKCVPGEFQYATSLITAELDE 528

Query: 648 LQKFLDESVNHSCEGLMVKMLDGSESHYEPSKRSRNWLKLKKDYLEGVGDSLDLCVLXXX 707
           +QKFLD+++  SCEGLMVK+LDG ES YEPSKRSRNWLKLKKDYL GVGDSLDLCV+   
Sbjct: 529 IQKFLDQAIKDSCEGLMVKILDGEESRYEPSKRSRNWLKLKKDYLAGVGDSLDLCVMGAY 588

Query: 708 XXXXXXXXXXXXFLLGCYNQDTGEFETCCKIGTGFSDEMLQLLHARLTPTIIDGPKATYV 767
                       FLLGCYNQD+GE+ETCCKIGTGFSDEML  L+       I+ PK+ Y 
Sbjct: 589 YGKGKRTGTYGGFLLGCYNQDSGEYETCCKIGTGFSDEMLTKLYELFREEEIEVPKSFYN 648

Query: 768 FDSSAEPDVWFEPTTLFEVLTADLSLSPIYKAGSTTFDKGVSLRFPRFLRIREDKGVEDA 827
           FDSSAEPD+WFEP  LFEVLTADLSLSPIYKAGS T+DKG+SLRFPRFLRIR+DK VEDA
Sbjct: 649 FDSSAEPDIWFEPKVLFEVLTADLSLSPIYKAGSATYDKGISLRFPRFLRIRDDKSVEDA 708

Query: 828 TSSDQIVELYENQSHVQN 845
           TSSDQI+E+YENQSH+Q+
Sbjct: 709 TSSDQIIEMYENQSHIQS 726

>SAKL0F10912g Chr6 complement(854430..856511) [2082 bp, 693 aa] {ON}
           similar to uniprot|P04819 Saccharomyces cerevisiae
           YDL164C CDC9 DNA ligase found in the nucleus and
           mitochondria an essential enzyme that joins Okazaki
           fragments during DNA replication also acts in nucleotide
           excision repair base excision repair and recombination
          Length = 693

 Score =  914 bits (2361), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 430/613 (70%), Positives = 513/613 (83%), Gaps = 5/613 (0%)

Query: 232 YSSNIPYSDVCEVFNQIEAISSRLEIIRICSDFFIKVMKQSSKNLIPTTYLFINRLGPDY 291
           + S IPYSDVC +F++IE+ SSRL I++ICS+FF  V+KQ+  NL+P TYLFINRLGPDY
Sbjct: 85  HHSKIPYSDVCNIFSEIESTSSRLSIVKICSNFFYSVLKQNPSNLVPITYLFINRLGPDY 144

Query: 292 XXXXXXXXXXXXXMKTISESCGKSMSQIKLKYKEIGDLGEIAMGARNVQPTMFKPKPLTV 351
                        MKTI+ESCGKS+ Q++ KY+EIGDLGE+A  AR VQPTMFKPKPLTV
Sbjct: 145 EPGLELGLGEGLLMKTIAESCGKSLQQVRAKYREIGDLGEVAQEARAVQPTMFKPKPLTV 204

Query: 352 GEVFKNLRTIAKTQGKDSQLRKIKLIKRMLTACQGVEAKFLIRSLESKLRIGLAEKTVLI 411
           GEVF NL++IAK+QGKDSQ RKI+LIKRMLTACQGVEAKFLIRSLESKLRIGLAEKTVLI
Sbjct: 205 GEVFNNLKSIAKSQGKDSQTRKIQLIKRMLTACQGVEAKFLIRSLESKLRIGLAEKTVLI 264

Query: 412 SLSKALLLHDENRENSADKDIPMDVLESAQQKIRDAFCQVPNYEIVINSCLEHGIMNLDK 471
           SLSKALL ++ + E  +      +++E+A+Q++RDAFCQVPNYEIVIN+CLEHGIM ++K
Sbjct: 265 SLSKALLSYEHDGEEPSS-----ELVENAEQRVRDAFCQVPNYEIVINTCLEHGIMEVNK 319

Query: 472 YCTLRPGIPLKPMLAKPTKAINEVLDRFQGETFTSEYKYDGERAQVHLLNDGTMRIYSRN 531
           +C L+PGIPLKPMLAKP+K+I EVLDRF GE FT EYKYDGERAQVHLL DG+M IYSRN
Sbjct: 320 HCVLKPGIPLKPMLAKPSKSITEVLDRFHGEKFTCEYKYDGERAQVHLLPDGSMNIYSRN 379

Query: 532 GENMTERYPEIKITDFIQDLDITKNLILDCEAVAWDKDQAKILPFQVLSTRKRKDVELND 591
           GENMTERYPE+ I D++ D + T +LILDCEAVAWD +Q KILPFQ+LSTRKRK VE  D
Sbjct: 380 GENMTERYPELHIRDYLADPETTHSLILDCEAVAWDTEQGKILPFQILSTRKRKGVEAKD 439

Query: 592 VKVRVCLFAFDILCHNDERLINMSLRERREYLTKVTKVVPGEFQYATQIITNNLDELQKF 651
           VKVRVCLFAFD+LC+N + LIN SL ERREYL +V K V G+FQ+A ++ ++NL+++QK+
Sbjct: 440 VKVRVCLFAFDMLCYNGQSLINNSLLERREYLQRVLKPVTGQFQFANELNSSNLEDVQKY 499

Query: 652 LDESVNHSCEGLMVKMLDGSESHYEPSKRSRNWLKLKKDYLEGVGDSLDLCVLXXXXXXX 711
           L++SV  +CEGLMVK+L+G ESHYEPSKRSRNWLKLKKDYL+GVGDSLDLCVL       
Sbjct: 500 LEQSVKDACEGLMVKVLEGEESHYEPSKRSRNWLKLKKDYLQGVGDSLDLCVLGAYYGRG 559

Query: 712 XXXXXXXXFLLGCYNQDTGEFETCCKIGTGFSDEMLQLLHARLTPTIIDGPKATYVFDSS 771
                   FLLGCYNQDTGEFETCCKIGTGFSDEML  L+ +L P+ ++ PKA YV+DSS
Sbjct: 560 KRTGTYGGFLLGCYNQDTGEFETCCKIGTGFSDEMLVSLYEKLKPSSLEQPKAFYVYDSS 619

Query: 772 AEPDVWFEPTTLFEVLTADLSLSPIYKAGSTTFDKGVSLRFPRFLRIREDKGVEDATSSD 831
           AEPDVWFEPT LFEVLTADLSLSPIYKAG++ + KG+SLRFPRF+RIR+DK VEDATSS+
Sbjct: 620 AEPDVWFEPTMLFEVLTADLSLSPIYKAGNSAYGKGISLRFPRFIRIRDDKDVEDATSSE 679

Query: 832 QIVELYENQSHVQ 844
           QIVELYE+Q ++Q
Sbjct: 680 QIVELYESQVNLQ 692

>Kwal_56.24616 s56 (1076178..1078325) [2148 bp, 715 aa] {ON} YDL164C
           (CDC9) - DNA ligase [contig 161] FULL
          Length = 715

 Score =  895 bits (2313), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 421/610 (69%), Positives = 499/610 (81%), Gaps = 5/610 (0%)

Query: 234 SNIPYSDVCEVFNQIEAISSRLEIIRICSDFFIKVMKQSSKNLIPTTYLFINRLGPDYXX 293
           SN+ YS++C VFN+IE  SSRL+I+++CSDF   V+ ++ K+L+P TYL IN+LGPDY  
Sbjct: 110 SNVMYSEMCSVFNEIEGTSSRLQIVKLCSDFLYSVLTKTRKDLVPITYLLINKLGPDYQP 169

Query: 294 XXXXXXXXXXXMKTISESCGKSMSQIKLKYKEIGDLGEIAMGARNVQPTMFKPKPLTVGE 353
                      MKTISESCGKS+ Q+K +Y+E+GDLG IA  AR+VQPTMFKPKPLT G 
Sbjct: 170 GLELGLGEGLLMKTISESCGKSLQQVKARYRELGDLGRIAQEARSVQPTMFKPKPLTTGM 229

Query: 354 VFKNLRTIAKTQGKDSQLRKIKLIKRMLTACQGVEAKFLIRSLESKLRIGLAEKTVLISL 413
           VF NL+ IA+ QGKDSQLRK++LIK+MLTAC+GVEAKFLIRSLESKLRIGLAEK+VL++L
Sbjct: 230 VFANLQDIARAQGKDSQLRKVQLIKKMLTACEGVEAKFLIRSLESKLRIGLAEKSVLVAL 289

Query: 414 SKALLLHDENRENSADKDIPMDVLESAQQKIRDAFCQVPNYEIVINSCLEHGIMNLDKYC 473
           SKA+L H+        K+   D++++A+QKIRDAFCQVPNYEIVIN+ LEHGIM L+K+C
Sbjct: 290 SKAILTHEH-----GGKEPSSDLVDAAEQKIRDAFCQVPNYEIVINAALEHGIMELEKHC 344

Query: 474 TLRPGIPLKPMLAKPTKAINEVLDRFQGETFTSEYKYDGERAQVHLLNDGTMRIYSRNGE 533
            L PGIPLKPMLAKP+K+I+EVLDRFQG+ FT EYKYDGERAQVHLL DG+MRIYSRNGE
Sbjct: 345 VLTPGIPLKPMLAKPSKSISEVLDRFQGQRFTCEYKYDGERAQVHLLPDGSMRIYSRNGE 404

Query: 534 NMTERYPEIKITDFIQDLDITKNLILDCEAVAWDKDQAKILPFQVLSTRKRKDVELNDVK 593
           NMTERYPEI I+DF+   D T  LILDCEAVAWDKD+  ILPFQVLSTRKRK V   DVK
Sbjct: 405 NMTERYPEINISDFVAHPDETHTLILDCEAVAWDKDKNVILPFQVLSTRKRKGVVAEDVK 464

Query: 594 VRVCLFAFDILCHNDERLINMSLRERREYLTKVTKVVPGEFQYATQIITNNLDELQKFLD 653
           VRVCLFAFDILC+NDE LIN SL ERR YL ++ K VPGE Q A+++ T +LDE+Q +LD
Sbjct: 465 VRVCLFAFDILCYNDEPLINKSLAERRTYLERILKPVPGELQLASEVTTMSLDEMQLYLD 524

Query: 654 ESVNHSCEGLMVKMLDGSESHYEPSKRSRNWLKLKKDYLEGVGDSLDLCVLXXXXXXXXX 713
           +SV   CEGLMVK+LDG ESHYEPSKRSRNWLKLKKDYL+GVGDSLDLCVL         
Sbjct: 525 QSVKDCCEGLMVKVLDGEESHYEPSKRSRNWLKLKKDYLQGVGDSLDLCVLGAYYGRGKR 584

Query: 714 XXXXXXFLLGCYNQDTGEFETCCKIGTGFSDEMLQLLHARLTPTIIDGPKATYVFDSSAE 773
                 FLLGCYNQDTGEFETCCKIGTGFSDEMLQ L+ +L+PT I  PKA YV+  SA+
Sbjct: 585 TGTYGGFLLGCYNQDTGEFETCCKIGTGFSDEMLQNLYEKLSPTEIPEPKAFYVYSESAQ 644

Query: 774 PDVWFEPTTLFEVLTADLSLSPIYKAGSTTFDKGVSLRFPRFLRIREDKGVEDATSSDQI 833
           PDVW EP+ LFEVLTADLSLSP+YKAG +++ KG+SLRFPRF+RIR+DK VEDATSS+Q+
Sbjct: 645 PDVWLEPSMLFEVLTADLSLSPVYKAGGSSYGKGISLRFPRFIRIRDDKSVEDATSSEQV 704

Query: 834 VELYENQSHV 843
           +E YE+QSH+
Sbjct: 705 IEFYESQSHI 714

>KLTH0H01408g Chr8 complement(129752..131923) [2172 bp, 723 aa] {ON}
           similar to uniprot|P04819 Saccharomyces cerevisiae
           YDL164C CDC9 DNA ligase found in the nucleus and
           mitochondria an essential enzyme that joins Okazaki
           fragments during DNA replication also acts in nucleotide
           excision repair base excision repair and recombination
          Length = 723

 Score =  876 bits (2264), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 414/610 (67%), Positives = 493/610 (80%), Gaps = 5/610 (0%)

Query: 234 SNIPYSDVCEVFNQIEAISSRLEIIRICSDFFIKVMKQSSKNLIPTTYLFINRLGPDYXX 293
           S I Y+++C VFN+IE  SSRL+I+++C DF   V+ ++ K+++P TYL IN+LGPDY  
Sbjct: 118 SKILYAEMCNVFNEIEGTSSRLQIVKLCGDFLYSVLLKARKDIVPITYLLINKLGPDYQP 177

Query: 294 XXXXXXXXXXXMKTISESCGKSMSQIKLKYKEIGDLGEIAMGARNVQPTMFKPKPLTVGE 353
                      MKTISESCGKS+ QIK +Y+E+GDLG IA  AR VQPTMFKPKPLT GE
Sbjct: 178 GLELGLGEGLLMKTISESCGKSLQQIKARYRELGDLGRIAQEARAVQPTMFKPKPLTTGE 237

Query: 354 VFKNLRTIAKTQGKDSQLRKIKLIKRMLTACQGVEAKFLIRSLESKLRIGLAEKTVLISL 413
           VF NL+ IA++QGKDSQLRK++LIKRMLTACQG+EAKFLIRSLESKLRIGLAEK+VL++L
Sbjct: 238 VFSNLQAIARSQGKDSQLRKVQLIKRMLTACQGLEAKFLIRSLESKLRIGLAEKSVLVAL 297

Query: 414 SKALLLHDENRENSADKDIPMDVLESAQQKIRDAFCQVPNYEIVINSCLEHGIMNLDKYC 473
           SKALL ++ N      K+   +++++A+QKIRDAFCQVPNY+IVI + LEHGIM LDK+C
Sbjct: 298 SKALLTYEHN-----GKEPSSELVDTAEQKIRDAFCQVPNYQIVIETALEHGIMELDKHC 352

Query: 474 TLRPGIPLKPMLAKPTKAINEVLDRFQGETFTSEYKYDGERAQVHLLNDGTMRIYSRNGE 533
            L PGIPLKPMLAKP+K+I+EVLDRFQG+ FT EYKYDGERAQVHLL DG+MRIYSRNGE
Sbjct: 353 VLTPGIPLKPMLAKPSKSISEVLDRFQGQRFTCEYKYDGERAQVHLLPDGSMRIYSRNGE 412

Query: 534 NMTERYPEIKITDFIQDLDITKNLILDCEAVAWDKDQAKILPFQVLSTRKRKDVELNDVK 593
           NMTERYPEI+I+DFI D   T  LILDCEAVAWDK++  ILPFQVLSTRKRK V + DVK
Sbjct: 413 NMTERYPEIRISDFIADPARTHTLILDCEAVAWDKEKNTILPFQVLSTRKRKGVAVEDVK 472

Query: 594 VRVCLFAFDILCHNDERLINMSLRERREYLTKVTKVVPGEFQYATQIITNNLDELQKFLD 653
           VRVCLFAFDILC+NDE LI   L ERR  L +    VPGE Q A+++ T +LDELQ +LD
Sbjct: 473 VRVCLFAFDILCYNDEPLITRPLAERRACLERALVPVPGELQLASEVTTMSLDELQHYLD 532

Query: 654 ESVNHSCEGLMVKMLDGSESHYEPSKRSRNWLKLKKDYLEGVGDSLDLCVLXXXXXXXXX 713
           ++V   CEGLMVK+L+G ESHYEPSKRSRNWLKLKKDYL+GVGDSLDLCVL         
Sbjct: 533 QAVRDCCEGLMVKILEGEESHYEPSKRSRNWLKLKKDYLQGVGDSLDLCVLGAYYGRGKR 592

Query: 714 XXXXXXFLLGCYNQDTGEFETCCKIGTGFSDEMLQLLHARLTPTIIDGPKATYVFDSSAE 773
                 FLLGCYNQD+GE+ETCCKIGTGFS+EMLQ L  RL+PT I  PKA YV   SA 
Sbjct: 593 TGTYGGFLLGCYNQDSGEYETCCKIGTGFSEEMLQTLFDRLSPTAIPTPKAFYVHSESAP 652

Query: 774 PDVWFEPTTLFEVLTADLSLSPIYKAGSTTFDKGVSLRFPRFLRIREDKGVEDATSSDQI 833
           PDVWFEPT LFEVLTADLSLSP+YKAG++++ KG+SLRFPRF+R+R+DK  E+ATSS+Q+
Sbjct: 653 PDVWFEPTLLFEVLTADLSLSPVYKAGTSSYGKGISLRFPRFIRLRDDKTPEEATSSEQV 712

Query: 834 VELYENQSHV 843
           VE YE+QSHV
Sbjct: 713 VEFYESQSHV 722

>TPHA0D04570 Chr4 (996539..998749) [2211 bp, 736 aa] {ON} Anc_7.343
           YDL164C
          Length = 736

 Score =  862 bits (2228), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 422/634 (66%), Positives = 496/634 (78%), Gaps = 18/634 (2%)

Query: 230 DHYSSNIPYSDVCEVFNQIEAISSRLEIIRICSDFFIKVMKQSSKNLIPTTYLFINRLGP 289
           D   S + YS+VC +F QIE  SSRL II++CS+FFI+V+K +  ++I   YLFINRLGP
Sbjct: 103 DQTKSTVLYSEVCNLFQQIEETSSRLAIIKLCSEFFIRVIKNNPSDIIIVAYLFINRLGP 162

Query: 290 DYXXXXXXXXXXXXXMKTISESCGKSMSQIKLKYKEIGDLGEIAMGARNVQPTMFKPKPL 349
           DY             +KTISE+ GKS+ QIKL+ KE GDLG IA  ARN+QPTMFKPKPL
Sbjct: 163 DYEPGLELGLGENLLIKTISEAYGKSIKQIKLELKETGDLGTIARDARNIQPTMFKPKPL 222

Query: 350 TVGEVFKNLRTIAKTQGKDSQLRKIKLIKRMLTACQGVEAKFLIRSLESKLRIGLAEKTV 409
           T+ +VF NL+ IA   GKDSQLRKIKLIK+ML+A +G+EAKFLIRSLESKLRIGLAEKTV
Sbjct: 223 TISDVFNNLKKIASATGKDSQLRKIKLIKQMLSASKGLEAKFLIRSLESKLRIGLAEKTV 282

Query: 410 LISLSKALLLHDENRENSADK----DI-PMDVLESAQQKIRDAFCQVPNYEIVINSCLEH 464
           LISLSKALLLH+  +E    K    D+  MD++E A+ K+R+A CQVPNYEIVIN CL+ 
Sbjct: 283 LISLSKALLLHEHWKEKGESKFDEEDVESMDLIEQAEAKLREAHCQVPNYEIVINLCLQD 342

Query: 465 GIMNLDKYCTLRPGIPLKPMLAKPTKAINEVLDRFQGETFTSEYKYDGERAQVHLLNDGT 524
           GI+N+DK CTLRPGIPLKPMLAKPTKAI EVL+ FQG+ F SEYKYDGERAQVHLL  G 
Sbjct: 343 GILNIDKTCTLRPGIPLKPMLAKPTKAITEVLNAFQGKEFISEYKYDGERAQVHLLEGGE 402

Query: 525 MRIYSRNGENMTERYPEIKITDFI-------------QDLDITKNLILDCEAVAWDKDQA 571
           MRIYSRNGENMTERYPE+ + DF+               +   K++ILDCE VAWD +Q 
Sbjct: 403 MRIYSRNGENMTERYPELDVKDFLCVVKAITNDQEGENAIQPVKDIILDCEVVAWDVEQK 462

Query: 572 KILPFQVLSTRKRKDVELNDVKVRVCLFAFDILCHNDERLINMSLRERREYLTKVTKVVP 631
           KILPFQVL+TRKRK+V+L DVKVRVCLFAFD+L  N+E +IN SLRER+E L KVT +VP
Sbjct: 463 KILPFQVLTTRKRKNVDLKDVKVRVCLFAFDLLYLNNEGMINKSLRERQEILRKVTVLVP 522

Query: 632 GEFQYATQIITNNLDELQKFLDESVNHSCEGLMVKMLDGSESHYEPSKRSRNWLKLKKDY 691
           GEFQYAT +IT+++DELQ FLD++V +SCEGLMVKMLDG ESHYEPSKRSRNWLKLKKDY
Sbjct: 523 GEFQYATSLITSDMDELQTFLDQAVKNSCEGLMVKMLDGEESHYEPSKRSRNWLKLKKDY 582

Query: 692 LEGVGDSLDLCVLXXXXXXXXXXXXXXXFLLGCYNQDTGEFETCCKIGTGFSDEMLQLLH 751
           L+GVGDSLDL V+               FLLGCYN+DT EFETCCKIGTGFSDEML  LH
Sbjct: 583 LDGVGDSLDLVVMGAYFGKGKRTGSYGGFLLGCYNEDTQEFETCCKIGTGFSDEMLGNLH 642

Query: 752 ARLTPTIIDGPKATYVFDSSAEPDVWFEPTTLFEVLTADLSLSPIYKAGSTTFDKGVSLR 811
             L PT ID P  TY++DSSAEPDVWF+   LFEVLTADLSLSP+YKAG++ +DKG+SLR
Sbjct: 643 TLLQPTEIDNPPMTYIYDSSAEPDVWFQAKVLFEVLTADLSLSPVYKAGNSRYDKGISLR 702

Query: 812 FPRFLRIREDKGVEDATSSDQIVELYENQSHVQN 845
           FPRFLRIREDK V D T+S+ I+E YE+QSH+QN
Sbjct: 703 FPRFLRIREDKDVTDGTTSEDIIEFYESQSHIQN 736

>KLLA0D12496g Chr4 complement(1059684..1061786) [2103 bp, 700 aa]
           {ON} similar to uniprot|P04819 Saccharomyces cerevisiae
           YDL164C CDC9 DNA ligase found in the nucleus and
           mitochondria an essential enzyme that joins Okazaki
           fragments during DNA replication also acts in nucleotide
           excision repair base excision repair and recombination,
          Length = 700

 Score =  838 bits (2166), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 401/613 (65%), Positives = 481/613 (78%), Gaps = 5/613 (0%)

Query: 232 YSSNIPYSDVCEVFNQIEAISSRLEIIRICSDFFIKVMKQSSKNLIPTTYLFINRLGPDY 291
           + SNIP++++C+ F  IE  SSRL I  ICS F   V+++  ++L+P TYLFI++LGPDY
Sbjct: 93  FHSNIPFAELCDTFQAIEVTSSRLAITAICSKFLYSVLERDPESLVPITYLFIHKLGPDY 152

Query: 292 XXXXXXXXXXXXXMKTISESCGKSMSQIKLKYKEIGDLGEIAMGARNVQPTMFKPKPLTV 351
                        +KTISE+CGKS+ QI+ KY+EIGDLGEIAM ARNVQPTMFKPKPLTV
Sbjct: 153 EPGLELGLGESLLIKTISEACGKSIQQIRNKYREIGDLGEIAMQARNVQPTMFKPKPLTV 212

Query: 352 GEVFKNLRTIAKTQGKDSQLRKIKLIKRMLTACQGVEAKFLIRSLESKLRIGLAEKTVLI 411
           GEVF NL +IAK+ GKDSQ RK  LIK+MLTAC+G EAKFLIRSLESKLRIGLAEKTVLI
Sbjct: 213 GEVFNNLVSIAKSNGKDSQSRKGSLIKKMLTACKGYEAKFLIRSLESKLRIGLAEKTVLI 272

Query: 412 SLSKALLLHDENRENSADKDIPMDVLESAQQKIRDAFCQVPNYEIVINSCLEHGIMNLDK 471
           S+SKA+L H+ N +  +      +++E A+  IRDAFCQVPNYE++IN  L++GIMNL++
Sbjct: 273 SVSKAILTHEHNGQEPS-----TEMVEQAESLIRDAFCQVPNYEMIINVALQYGIMNLNQ 327

Query: 472 YCTLRPGIPLKPMLAKPTKAINEVLDRFQGETFTSEYKYDGERAQVHLLNDGTMRIYSRN 531
           +  LRPGIPL+PMLAKPTK+I+EVLDRFQG  FT EYKYDGERAQVHL  DG+M+IYSRN
Sbjct: 328 HIKLRPGIPLQPMLAKPTKSISEVLDRFQGTKFTCEYKYDGERAQVHLCRDGSMKIYSRN 387

Query: 532 GENMTERYPEIKITDFIQDLDITKNLILDCEAVAWDKDQAKILPFQVLSTRKRKDVELND 591
           GE+MTERYPEI +  +++DL  TK+ I+D EAVAWD++Q KILPFQVLSTRKRK VEL D
Sbjct: 388 GEDMTERYPEIDVKHYVKDLGATKSFIVDSEAVAWDQEQGKILPFQVLSTRKRKGVELKD 447

Query: 592 VKVRVCLFAFDILCHNDERLINMSLRERREYLTKVTKVVPGEFQYATQIITNNLDELQKF 651
           VKVRVCL+AFDILC NDE LIN S  ERR+ L        G+F +A ++ T N DELQK+
Sbjct: 448 VKVRVCLYAFDILCLNDEPLINKSFHERRQILLDTFNGTQGQFDFANELTTTNFDELQKY 507

Query: 652 LDESVNHSCEGLMVKMLDGSESHYEPSKRSRNWLKLKKDYLEGVGDSLDLCVLXXXXXXX 711
           LD+SV  SCEGLMVKML+G ESHYEPSKRSRNWLKLKKDYLEGVGDSLDL VL       
Sbjct: 508 LDQSVKDSCEGLMVKMLEGEESHYEPSKRSRNWLKLKKDYLEGVGDSLDLVVLGAYYGRG 567

Query: 712 XXXXXXXXFLLGCYNQDTGEFETCCKIGTGFSDEMLQLLHARLTPTIIDGPKATYVFDSS 771
                   FLLGCYN D+ EFETCCKIGTGFSDEMLQ L+ +L  T ++ P    ++DSS
Sbjct: 568 KRTGTYGGFLLGCYNLDSEEFETCCKIGTGFSDEMLQDLYTKLKDTTVEHPSTNVIYDSS 627

Query: 772 AEPDVWFEPTTLFEVLTADLSLSPIYKAGSTTFDKGVSLRFPRFLRIREDKGVEDATSSD 831
           A  DVWFEP+ LFEVLTADLSLSP+YKAG   F KG+SLRFPRF+RIR+DK V DATSSD
Sbjct: 628 APADVWFEPSMLFEVLTADLSLSPVYKAGFEAFGKGISLRFPRFVRIRDDKNVTDATSSD 687

Query: 832 QIVELYENQSHVQ 844
           Q++E YE+Q+H++
Sbjct: 688 QVIEFYESQAHMK 700

>ACL155W Chr3 (81492..83585) [2094 bp, 697 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YDL164C (CDC9)
          Length = 697

 Score =  819 bits (2115), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 411/719 (57%), Positives = 503/719 (69%), Gaps = 32/719 (4%)

Query: 126 KQATLARFFTSMKNKPSGNTSPP--DKSAKHMLQXXXXXXXXXXXRNVKKSXXXXXXXXX 183
           KQATL RFFT++K    G T+     KS     +             VK S         
Sbjct: 6   KQATLGRFFTALKRPQDGATAAATVKKSKVEAAECLAAPAGHEQDAEVKNSLPELADKPA 65

Query: 184 XXXPFMXXXXXXXXXXXXXXXGADLSQKFQGLGPKVEDFEMNSNDSDHYSSNIPYSDVCE 243
                                G  L Q    + P+ +    +S      S+++ Y+D+C 
Sbjct: 66  P--------------------GGVLPQAASAV-PRAQ----SSPVKPAASTSVMYADLCA 100

Query: 244 VFNQIEAISSRLEIIRICSDFFIKVMKQSSKNLIPTTYLFINRLGPDYXXXXXXXXXXXX 303
           VF  +EA SSRL I ++C+DF   V+K    +LIP TYLFINRLGPDY            
Sbjct: 101 VFEAVEATSSRLSITKLCADFMYSVLKCDPGHLIPVTYLFINRLGPDYEPGLELGLGEGI 160

Query: 304 XMKTISESCGKSMSQIKLKYKEIGDLGEIAMGARNVQPTMFKPKPLTVGEVFKNLRTIAK 363
            +KTIS++CGKS +Q++  Y+E GDLG +A  AR VQPTMFKPKPLTV +VF  L+ IA+
Sbjct: 161 LIKTISDACGKSAAQVRSSYRECGDLGTVAQQARVVQPTMFKPKPLTVRDVFSTLQAIAQ 220

Query: 364 TQGKDSQLRKIKLIKRMLTACQGVEAKFLIRSLESKLRIGLAEKTVLISLSKALLLHDEN 423
            +GKDSQ +KI+LIK+MLTACQG+EAK+LIRSLESKLRIGLAEKTVL++LSKA+L H+ +
Sbjct: 221 AEGKDSQGKKIRLIKKMLTACQGMEAKYLIRSLESKLRIGLAEKTVLVALSKAILTHEHD 280

Query: 424 RENSADKDIPMDVLESAQQKIRDAFCQVPNYEIVINSCLEHGIMNLDKYCTLRPGIPLKP 483
            +  + + +     ++A+  +RD FCQVPNYE++IN+ L++GIMNL ++C L PGIPLKP
Sbjct: 281 GKEPSPEQV-----DAAEALVRDTFCQVPNYEMIINAALQYGIMNLPQHCVLTPGIPLKP 335

Query: 484 MLAKPTKAINEVLDRFQGETFTSEYKYDGERAQVHLLNDGTMRIYSRNGENMTERYPEIK 543
           MLAKPTK+I EVLDRFQG+ FT EYKYDGERAQVHL+ DGT+RIYSRN ENMTERYPEI+
Sbjct: 336 MLAKPTKSITEVLDRFQGQRFTCEYKYDGERAQVHLMEDGTIRIYSRNSENMTERYPEIQ 395

Query: 544 ITDFIQDLDITKNLILDCEAVAWDKDQAKILPFQVLSTRKRKDVELNDVKVRVCLFAFDI 603
              F+ +   T++LI+DCEAVAWD ++ KILPFQVLSTRKRK VEL DVKVRVCLFAFD+
Sbjct: 396 FHQFLANPQTTRSLIIDCEAVAWDNEKQKILPFQVLSTRKRKGVELKDVKVRVCLFAFDL 455

Query: 604 LCHNDERLINMSLRERREYLTKVTKVVPGEFQYATQIITNNLDELQKFLDESVNHSCEGL 663
           L  N E L+  SL +RR++L  V KVVPGE Q+A +I T  L ELQ +L++SV+ SCEGL
Sbjct: 456 LYLNGESLLKCSLADRRKHLYSVLKVVPGELQFANEITTMELSELQTYLEQSVSASCEGL 515

Query: 664 MVKMLDGSESHYEPSKRSRNWLKLKKDYLEGVGDSLDLCVLXXXXXXXXXXXXXXXFLLG 723
           MVKMLDG ES YEPSKRSRNWLKLKKDYLEGVGDSLDL VL               FLLG
Sbjct: 516 MVKMLDGEESQYEPSKRSRNWLKLKKDYLEGVGDSLDLAVLGAYYGRGKRTGTYGGFLLG 575

Query: 724 CYNQDTGEFETCCKIGTGFSDEMLQLLHARLTPTIIDGPKATYVFDSSAEPDVWFEPTTL 783
           CYN D  EFETCCKIGTGFS+E+LQ LHA+L  T+I  P+    +D S+ PDVWFEP  L
Sbjct: 576 CYNPDLEEFETCCKIGTGFSEEVLQSLHAQLKDTVIAAPRGDVSYDDSSPPDVWFEPAML 635

Query: 784 FEVLTADLSLSPIYKAGSTTFDKGVSLRFPRFLRIREDKGVEDATSSDQIVELYENQSH 842
           FEVLTADLSLSP+YKAG   + KG+SLRFPRFLRIREDK V DATSSDQIVE Y+ Q++
Sbjct: 636 FEVLTADLSLSPVYKAGRDVYGKGISLRFPRFLRIREDKSVTDATSSDQIVEFYQRQAN 694

>TBLA0E02050 Chr5 (498038..500200) [2163 bp, 720 aa] {ON} Anc_7.343
           YDL164C
          Length = 720

 Score =  805 bits (2080), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 386/615 (62%), Positives = 479/615 (77%), Gaps = 8/615 (1%)

Query: 233 SSNIPYSDVCEVFNQIEAISSRLEIIRICSDFFIKVMKQSSKNLIPTTYLFINRLGPDYX 292
           +S++PY+D+C++F  IE+ SSRL I  +C+ FF + ++     L+P TYL IN+LGPDY 
Sbjct: 112 TSSLPYADLCQLFETIESESSRLTITNLCTAFFSRTLQLDPSLLVPVTYLCINKLGPDYS 171

Query: 293 XXXXXXXXXXXXMKTISESCGKSMSQIKLKYKEIGDLGEIAMGARNVQPT--MFKPKPLT 350
                       +K I  +CG S  Q+KL+Y+++GDLG++AM  R +QPT  MFK +PLT
Sbjct: 172 GVELGLGEGLL-LKAIGSACGVSQQQLKLQYRKLGDLGQLAMSTRVLQPTITMFKLEPLT 230

Query: 351 VGEVFKNLRTIAKTQGKDSQLRKIKLIKRMLTACQGVEAKFLIRSLESKLRIGLAEKTVL 410
           + +VF  L  IA +QGKDSQ +KI +IKR+LT+CQGVEAKFLIRSLESKLRIGLAEKTVL
Sbjct: 231 ITKVFDTLAKIAASQGKDSQNQKINMIKRLLTSCQGVEAKFLIRSLESKLRIGLAEKTVL 290

Query: 411 ISLSKALLLHDENRENSADKDIPMDVLESAQQKIRDAFCQVPNYEIVINSCLEHGIMNLD 470
            SL++AL++H++  +N  D D       +A+Q I+D+FCQ+PNYEI+I + L++G+  L 
Sbjct: 291 TSLARALVIHEKGNDNIQDDD-----YSNAEQIIKDSFCQIPNYEIIITTSLQYGVSQLA 345

Query: 471 KYCTLRPGIPLKPMLAKPTKAINEVLDRFQGETFTSEYKYDGERAQVHLLNDGTMRIYSR 530
            +  L PGIPLKPMLAKPTK+I+EVLD FQ   FTSEYKYDGERAQVHLL DG+MRIYSR
Sbjct: 346 SHIKLTPGIPLKPMLAKPTKSISEVLDTFQNIQFTSEYKYDGERAQVHLLPDGSMRIYSR 405

Query: 531 NGENMTERYPEIKITDFIQDLDITKNLILDCEAVAWDKDQAKILPFQVLSTRKRKDVELN 590
           NGE+MT+RYPE+ I D++ D   T  LILDCEAVAWD +  KILPFQVLSTRKRK V+L 
Sbjct: 406 NGEDMTQRYPELNIQDYLVDSTTTTQLILDCEAVAWDVELQKILPFQVLSTRKRKSVDLK 465

Query: 591 DVKVRVCLFAFDILCHNDERLINMSLRERREYLTKVTKVVPGEFQYATQIITNNLDELQK 650
           D+KVRVCLFAFDIL HN++ LIN +LRERR+ L  +TK  PG+FQ+AT++ T+NLDELQ 
Sbjct: 466 DIKVRVCLFAFDILRHNNDSLINNTLRERRDILHSITKPCPGQFQFATELTTSNLDELQT 525

Query: 651 FLDESVNHSCEGLMVKMLDGSESHYEPSKRSRNWLKLKKDYLEGVGDSLDLCVLXXXXXX 710
           FLD+++  SCEGLMVK LDG++SHYEPSKRSRNWLKLKKDYL+G+GDSLDLCVL      
Sbjct: 526 FLDKAIKDSCEGLMVKSLDGTDSHYEPSKRSRNWLKLKKDYLQGMGDSLDLCVLGAYYGR 585

Query: 711 XXXXXXXXXFLLGCYNQDTGEFETCCKIGTGFSDEMLQLLHARLTPTIIDGPKATYVFDS 770
                    FLL CYNQDT EFETCCKIGTGFSDEMLQ L+  L  T I+ P+A +VFDS
Sbjct: 586 GKRTGTYGGFLLACYNQDTEEFETCCKIGTGFSDEMLQTLYNGLKETAIESPRANFVFDS 645

Query: 771 SAEPDVWFEPTTLFEVLTADLSLSPIYKAGSTTFDKGVSLRFPRFLRIREDKGVEDATSS 830
           SAEPDVWF PT +FEVLTADLSLSPIYKAGST + KG+SLRFPRF+RIR DK V DATSS
Sbjct: 646 SAEPDVWFNPTMVFEVLTADLSLSPIYKAGSTVYGKGISLRFPRFIRIRTDKSVNDATSS 705

Query: 831 DQIVELYENQSHVQN 845
           +Q+++ YENQSH+Q+
Sbjct: 706 EQVIDFYENQSHLQS 720

>TPHA0M00260 Chr13 complement(50326..53226) [2901 bp, 966 aa] {ON}
           Anc_6.18 YOR005C
          Length = 966

 Score =  109 bits (272), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 109/423 (25%), Positives = 182/423 (43%), Gaps = 69/423 (16%)

Query: 481 LKPMLAKPTKAINEVLDRFQGETFTSEYKYDGERAQVHLLNDG-TMRIYSRNGENMTERY 539
            +P LAK      EVL R     FT E K DGER Q+H ++ G  ++ +SR G + T  Y
Sbjct: 264 FEPQLAKKVNLSYEVLSRRMNNKFTIEEKMDGERIQIHYMDYGHQIKYFSRRGNDYTYLY 323

Query: 540 PEIK----ITDFIQDLDITKNLILDCEAVAWDKDQAKILPFQVLSTRKRKDVELNDVKVR 595
            + K    I+ ++Q  +  K  ILD E V++DK +  ILPF ++ +     ++++ ++  
Sbjct: 324 GKDKSTATISKYLQLNEDVKECILDGEMVSYDKSRNCILPFGMVKSGAANSLKIDGLEND 383

Query: 596 VC---LFAFDILCHNDERLINMSLRERREYLTKVTKVVPGEFQYATQIITNNLDELQKFL 652
           +C      FD+L  N   L N+ L +R+EYL+ +        +     I ++ + ++  L
Sbjct: 384 LCSPLFIVFDVLFLNGSPLTNLPLYQRKEYLSNILTPKKSHIEILKFSIAHDSESIRSAL 443

Query: 653 DESVNHSCEGLMVKMLDGSESHYEPSKRSRNWLKLKKDYLEGVGDSLDLCVLXXXXXXXX 712
             +++   EG+++K  D   S Y    R+ +W+K+K +YLE  G++LDL V+        
Sbjct: 444 QAAISVGSEGIVLKKYD---SLYSVGDRNNDWIKVKPEYLEQFGENLDLIVIGRDPGKKD 500

Query: 713 XXXXXXXFL----------------LGCYNQDT---------------GEFETCCKIGTG 741
                   L                L   + D+                +F + C I  G
Sbjct: 501 SLMCGVAVLENEESYEKILQEEVITLTSDDDDSQNNIPEDKPIRTKRITKFISFCVIANG 560

Query: 742 FSDEMLQLLHARLTPTII----DGPKATYVFDSSAEPDVWFEP--TTLFEV----LTADL 791
            S+E  + +  +          + P   Y+   +  P  W  P  + + EV    L  + 
Sbjct: 561 ISNEEFKEIDRKTFGCWKKFSDEAPPTDYLEFGTRLPVEWINPHDSVVLEVKARSLENNE 620

Query: 792 SLSPIYKAGSTTFDKGVSLRFPRFLRIREDKGVEDA-TSSDQIV---------ELYENQS 841
           +L   +K G T +  G   R     RIR DK   D  T SD ++         ELY N S
Sbjct: 621 ALRDKFKTGYTLY--GAYCR-----RIRTDKDFNDCYTFSDLVIATNKKRSSSELYGNHS 673

Query: 842 HVQ 844
           H++
Sbjct: 674 HIK 676

>Smik_15.174 Chr15 complement(301851..304688) [2838 bp, 945 aa] {ON}
           YOR005C (REAL)
          Length = 945

 Score =  105 bits (262), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 73/239 (30%), Positives = 118/239 (49%), Gaps = 11/239 (4%)

Query: 474 TLRPGIPLKPMLAKPTKAINEVLDRFQGETFTSEYKYDGERAQVHLLNDG-TMRIYSRNG 532
           T++ G    P LAK      E + R     F  E K DGER QVH +N G ++R YSR G
Sbjct: 247 TIKVGFAFAPQLAKKVNLPYEKICRALHNDFLVEEKMDGERIQVHYMNYGKSVRFYSRRG 306

Query: 533 ENMTERY-PEIKITDFIQDLDITKNL---ILDCEAVAWDKDQAKILPFQVLSTRKRKDVE 588
            + T  Y   +        LD T N+   +LD E V +D  +  ILPF ++    +  + 
Sbjct: 307 IDYTYLYGASLSSGTISHHLDFTDNVRECVLDGEMVTFDARRKVILPFGLVKGSAKDALS 366

Query: 589 ---LNDVKVRVCLFAFDILCHNDERLINMSLRERREYLTKVTKVVPGEFQYATQIITNNL 645
              +N+V        FD+L  N   L  + L +R+EYL  +   V    +        N+
Sbjct: 367 FNSINNVDFHPLYVVFDLLYLNGTSLTPLPLHQRKEYLESILTPVKNVVEMVRTSRCYNV 426

Query: 646 DELQKFLDESVNHSCEGLMVKMLDGSESHYEPSKRSRNWLKLKKDYLEGVGDSLDLCVL 704
           + ++K L+ +++   EG+++K  + S   Y  + R+ NW+K+K +YLE  G++LDL ++
Sbjct: 427 ESIKKSLEVAISLGSEGVVLKYYNSS---YNVASRNNNWIKVKPEYLEEFGENLDLVII 482

>ACR008W Chr3 (368913..371858) [2946 bp, 981 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR005C (DNL4)
          Length = 981

 Score =  103 bits (256), Expect = 9e-22,   Method: Compositional matrix adjust.
 Identities = 102/404 (25%), Positives = 165/404 (40%), Gaps = 64/404 (15%)

Query: 474 TLRPGIPLKPMLAKPTKAINEVLDRFQGETFTSEYKYDGERAQVHLLNDG-TMRIYSRNG 532
           ++R G    P +A+  K   E +    G  F  E K DG+R QVH ++ G ++  +SRNG
Sbjct: 287 SVRIGYAFAPHMAQRVKIPYEKVSTKLGNDFYVEEKMDGDRIQVHYMDYGNSIAYFSRNG 346

Query: 533 ENMTERYPEIK----ITDFIQDLDITKNLILDCEAVAWDKDQAKILPFQVLSTRKRKDVE 588
            N T  Y E      I++ ++ ++  K  ILD E V++DK+   ILPF +  +     V 
Sbjct: 347 INYTYLYGENSSKGSISNHLKFVEGVKECILDGEMVSYDKEMQCILPFGLTKSGASHQVN 406

Query: 589 L-----NDVKVRVCLFAFDILCHNDERLINMSLRERREYLTKVTKVVPGEFQYATQIITN 643
                  +   R     FD+L  N + L N  + +R+EYL K+           +    +
Sbjct: 407 FETTGHTEPTYRPLYAVFDLLYLNGQLLTNQDVVKRKEYLEKILIPSKNVVHLLSGPRCS 466

Query: 644 NLDELQKFLDESVNHSCEGLMVKMLDGSESHYEPSKRSRNWLKLKKDYLEGVGDSLDLCV 703
           + + +   L  +V H  EG+++K    + S Y   KR  +W+K+K +YLE  G+++DL V
Sbjct: 467 DAEAITAALGAAVAHGSEGIVLKK---ARSKYSVGKRDDSWIKIKPEYLENFGENMDLVV 523

Query: 704 LXXXXXXXXXXXXXXXFLLGCYNQDTGE----------------------------FETC 735
           +               F+      D  E                            F + 
Sbjct: 524 I------GRDKGRKDSFICALAVTDDSEKNNPSSYESGSDSDSDSEPIIVQPKIEKFISF 577

Query: 736 CKIGTGFSDEMLQ----LLHARLTPTIIDGPKATYVFDSSAEPDVWFEP--TTLFEV--- 786
           C I  G S+E  +    L      P     P   +V   +  P  W +P  + + EV   
Sbjct: 578 CSIANGISNEEFKEIDRLTRGNWFPYDERKPPTDWVEFGTKTPREWIDPKNSVVLEVKAR 637

Query: 787 -LTADLSLSPIYKAGSTTFDKGVSLRFPRFLRIREDKGVEDATS 829
            +  + S S +YK GST ++           RIR DK    A++
Sbjct: 638 SIDNEESKSDLYKTGSTLYNAYCK-------RIRHDKNWSTAST 674

>TBLA0G01040 Chr7 complement(258966..261884) [2919 bp, 972 aa] {ON}
           Anc_6.18 YOR005C
          Length = 972

 Score = 99.8 bits (247), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 71/240 (29%), Positives = 121/240 (50%), Gaps = 13/240 (5%)

Query: 474 TLRPGIPLKPMLAKPTK-AINEVLDRFQGETFTSEYKYDGERAQVHLLNDG-TMRIYSRN 531
           +++ G    P LAK    + + + +R   + F  E K DGER Q+H +N G T++ +SR+
Sbjct: 268 SIKVGYIFAPQLAKRLMLSYDTISNRLNNDFFIEE-KMDGERIQLHYMNYGETVKFFSRH 326

Query: 532 GENMTERYPEIK----ITDFIQDLDITKNLILDCEAVAWDKDQAKILPFQVLSTRKRKDV 587
           G + T  Y   K    I  F++     K  +LD E V +D    K+LPF ++ +     +
Sbjct: 327 GTDYTYLYGNDKSAGTIAKFLRLHKNVKECVLDGEMVTFDSTSKKVLPFGLVKSSASSQL 386

Query: 588 ELNDV---KVRVCLFAFDILCHNDERLINMSLRERREYLTKVTKVVPGEFQYATQIITNN 644
              D+           FDIL  N   LI++ L +R+E+L  V        +  + I   +
Sbjct: 387 NKKDIDNDSFHPLFMVFDILYLNGSSLIDLPLFKRKEFLNTVLTPYKDYVEILSSIRCTD 446

Query: 645 LDELQKFLDESVNHSCEGLMVKMLDGSESHYEPSKRSRNWLKLKKDYLEGVGDSLDLCVL 704
             +++K LD +++   EG+++K      S Y P+ R  NW+K+K +YLE  G+++DL V+
Sbjct: 447 SIQIKKGLDAAISVGSEGIVLKQY---ISKYIPNARHNNWIKVKPEYLEEFGENMDLIVI 503

>YOR005C Chr15 complement(334509..337343) [2835 bp, 944 aa] {ON}
           DNL4DNA ligase required for nonhomologous end-joining
           (NHEJ), forms stable heterodimer with required cofactor
           Lif1p, interacts with Nej1p; involved in meiosis, not
           essential for vegetative growth
          Length = 944

 Score = 99.4 bits (246), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 70/268 (26%), Positives = 130/268 (48%), Gaps = 11/268 (4%)

Query: 445 RDAFCQVPNYEIVINSCLEHGIMNLDKYCTLRPGIPLKPMLAKPTKAINEVLDRFQGETF 504
           +D    + + ++V +   +  +   D   +++ G    P LAK      E + R   + F
Sbjct: 218 QDYLSVISDLKVVTSKLYDPKVRLKDDDLSIKVGFAFAPQLAKKVNLSYEKICRTLHDDF 277

Query: 505 TSEYKYDGERAQVHLLNDG-TMRIYSRNGENMTERY----PEIKITDFIQDLDITKNLIL 559
             E K DGER QVH +N G +++ +SR G + T  Y        I+  ++  D  K  +L
Sbjct: 278 LVEEKMDGERIQVHYMNYGESIKFFSRRGIDYTYLYGASLSSGTISQHLRFTDSVKECVL 337

Query: 560 DCEAVAWDKDQAKILPFQVLSTRKRKDV---ELNDVKVRVCLFAFDILCHNDERLINMSL 616
           D E V +D  +  ILPF ++    ++ +    +N+V        FD+L  N   L  + L
Sbjct: 338 DGEMVTFDAKRRVILPFGLVKGSAKEALSFNSINNVDFHPLYMVFDLLYLNGTSLTPLPL 397

Query: 617 RERREYLTKVTKVVPGEFQYATQIITNNLDELQKFLDESVNHSCEGLMVKMLDGSESHYE 676
            +R++YL  +   +    +         ++ ++K L+ +++   EG+++K  + S   Y 
Sbjct: 398 HQRKQYLNSILSPLKNIVEIVRSSRCYGVESIKKSLEVAISLGSEGVVLKYYNSS---YN 454

Query: 677 PSKRSRNWLKLKKDYLEGVGDSLDLCVL 704
            + R+ NW+K+K +YLE  G++LDL V+
Sbjct: 455 VASRNNNWIKVKPEYLEEFGENLDLIVI 482

>KNAG0F02870 Chr6 (543177..546041) [2865 bp, 954 aa] {ON} Anc_6.18
           YOR005C
          Length = 954

 Score = 99.0 bits (245), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 72/267 (26%), Positives = 133/267 (49%), Gaps = 11/267 (4%)

Query: 446 DAFCQVPNYEIVINSCLEHGIMNLDKYCTLRPGIPLKPMLAKPTKAINEVLDRFQGETFT 505
           D F  V +   V     E  +   ++  TL+ G    P LAK      E + +  G  F+
Sbjct: 220 DYFSVVSDLSSVTKKLYEPSVRLRNEDLTLKIGSAFAPHLAKRLNISYEKILKKLGSDFS 279

Query: 506 SEYKYDGERAQVHLLNDGT-MRIYSRNGENMTERY----PEIKITDFIQDLDITKNLILD 560
            E K DGER Q+H ++ G  ++  SR G + T  Y        I  +++  +  K  ILD
Sbjct: 280 IEEKMDGERIQIHYMDYGNEIKFLSRRGTDYTYLYGGDTSTGTIACYLKLNENVKECILD 339

Query: 561 CEAVAWDKDQAKILPFQVLSTRKRKDVE---LNDVKVRVCLFAFDILCHNDERLINMSLR 617
            E V +D+++  ILPF ++ +  +  +    +++        AFD++  N   L+++ L 
Sbjct: 340 GEMVTYDQEKQMILPFGLVKSSAKNFLSKESISNGSYHPLFMAFDLVYLNGTSLVDLPLY 399

Query: 618 ERREYLTKVTKVVPGEFQYATQIITNNLDELQKFLDESVNHSCEGLMVKMLDGSESHYEP 677
           +R++YL+K+     G     +    NNL+ + K L  +++   EG+++K L+   S Y  
Sbjct: 400 QRKDYLSKILTKCNGFVDIVSFARCNNLESITKSLAAAISVGSEGIILKKLN---SRYMV 456

Query: 678 SKRSRNWLKLKKDYLEGVGDSLDLCVL 704
           + R+ +W+K+K  YL+  G+++DL ++
Sbjct: 457 ASRNDSWIKIKPQYLKQFGENMDLIII 483

>CAGL0E02695g Chr5 complement(254591..257431) [2841 bp, 946 aa] {ON}
           similar to uniprot|Q08387 Saccharomyces cerevisiae
           YOR005c DNL4 DNA ligase IV
          Length = 946

 Score = 99.0 bits (245), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 92/379 (24%), Positives = 163/379 (43%), Gaps = 46/379 (12%)

Query: 478 GIPLKPMLAKPTKAINEVLDRFQGETFTSEYKYDGERAQVHLLNDGT-MRIYSRNGENMT 536
           G+   P LA       + +    G  F  E K DGER Q+H  N G+ ++ YSR   + T
Sbjct: 266 GLAFAPQLATKLHVSYQKIGEKLGWDFFIEEKMDGERIQMHYTNFGSDIKFYSRRATDYT 325

Query: 537 ERYPE-IKITDFIQDLDITKNL---ILDCEAVAWDKDQAKILPFQVLSTRKRKDVELNDV 592
             Y   +K       +++ KN+   +LDCE V +D +   +LPF ++ +  +  +  + +
Sbjct: 326 YLYGNNLKTGTLANFINLNKNVKDCVLDCEVVTFDSNNKIVLPFGMVKSSAKNMLSQDGI 385

Query: 593 KVR---VCLFAFDILCHNDERLINMSLRERREYLTKVTKVVPGEFQYATQIITNNLDELQ 649
             +     L  FD+L  N   L+++   +RREYL ++        +    I  N+   ++
Sbjct: 386 DTQGFHPLLMVFDVLYLNGATLVDLPYYKRREYLKQILTPTAHRIEIIKSIRANDEQMIK 445

Query: 650 KFLDESVNHSCEGLMVKMLDGSESHYEPSKRSRNWLKLKKDYLEGVGDSLDLCVLXXXXX 709
           K L+++++   EG+++K  D   S Y  + RS +W+K+K +YLE  G+++DL ++     
Sbjct: 446 KSLEKALSVGSEGIILKRYD---SRYVIASRSDDWIKIKPEYLEQFGENMDLVLM----- 497

Query: 710 XXXXXXXXXXFLLGC-------------YNQDTGE--------FETCCKIGTGFSDEMLQ 748
                      +LG               N  + E        F + C I  G S+E  +
Sbjct: 498 -GRDPSKKDSLMLGLLDYEEVIQDSPIMVNSQSSEENSQRFRGFVSLCIIANGISNEEYK 556

Query: 749 LLHARLTPTIIDG---PKATYVFDSSAEPDVWFEP--TTLFEVLTADLSLSPIYKAGSTT 803
            +  +      D    P   Y+   S  P  W +P  + + E+    L  +   ++    
Sbjct: 557 EIDRKTKGLWNDSEKIPPLEYMKFGSKVPRQWIDPKKSLILEIKARSLDNT---RSSERK 613

Query: 804 FDKGVSLRFPRFLRIREDK 822
           F  G +L      +IREDK
Sbjct: 614 FAAGCTLFGGYCRQIREDK 632

>NCAS0D02650 Chr4 (508606..511458) [2853 bp, 950 aa] {ON} Anc_6.18
           YOR005C
          Length = 950

 Score = 98.6 bits (244), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 74/240 (30%), Positives = 120/240 (50%), Gaps = 13/240 (5%)

Query: 474 TLRPGIPLKPMLAKPTKAINEVLDRFQGETFTSEYKYDGERAQVHLLNDG-TMRIYSRNG 532
            + PG    P LAK      E +       F  E K DGER Q+H  + G  ++ +SR G
Sbjct: 255 VINPGFAFAPQLAKKLSISYEKICMKLKNDFIIEEKMDGERIQLHYQDYGEKLKFFSRRG 314

Query: 533 ENMTERYPEIKITDFI-QDLDITKNL---ILDCEAVAWDKDQAKILPFQVLSTRKR---- 584
            + T  Y E     FI + L + K++   ILD E + +DK Q  ILPF ++ +  R    
Sbjct: 315 TDYTYLYGESIHDGFIGKHLKLNKDVKDCILDGEMITYDKTQNMILPFGLVKSSARSMLT 374

Query: 585 KDVELNDVKVRVCLFAFDILCHNDERLINMSLRERREYLTKVTKVVPGEFQYATQIITNN 644
           KD  +N+   +     FD++  N   L N+ L  R+EYL  +    P   +  +     N
Sbjct: 375 KDGIMNE-GYQPLFMVFDLIFMNGTSLANIPLNVRKEYLNGIFTPEPHIIELLSSYHRFN 433

Query: 645 LDELQKFLDESVNHSCEGLMVKMLDGSESHYEPSKRSRNWLKLKKDYLEGVGDSLDLCVL 704
            D ++K L+ +++   EG+++K  D   S Y  + R+ +W+K+K +YLE  G+++DL V+
Sbjct: 434 EDSIRKSLELAISMGSEGIVLKRYD---SRYTVASRNDDWIKVKPEYLEQFGENMDLIVI 490

>ZYRO0C07854g Chr3 (595546..598380) [2835 bp, 944 aa] {ON} similar
           to uniprot|Q08387 Saccharomyces cerevisiae YOR005C DNL4
           DNA ligase required for nonhomologous end- joining
           (NHEJ) forms stable heterodimer with required cofactor
           Lif1p catalyzes DNA ligation as part of a complex with
           Lif1p and Nej1p involved in meiosis not essential for
           vegetative growth
          Length = 944

 Score = 95.5 bits (236), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 97/399 (24%), Positives = 169/399 (42%), Gaps = 47/399 (11%)

Query: 478 GIPLKPMLAKPTK-AINEVLDRFQGETFTSEYKYDGERAQVHLLNDG-TMRIYSRNGENM 535
           G+P  P LAK    + ++V  R + + +  E K DGER Q+H ++ G  ++ +SR G + 
Sbjct: 253 GLPFAPFLAKRLYISYDKVALRLKSDFYIEE-KMDGERIQLHYMDYGRKLKWFSRRGNDY 311

Query: 536 TERYPEI----KITDFIQDLDITKNLILDCEAVAWDKDQAKILPFQVLSTRKRKDVELND 591
           T  Y E      +  ++Q     +  +LD E +++D ++  +LPF ++ +  R  +    
Sbjct: 312 TYLYGEDIGTGTVAKYLQLDPKVRECVLDGEMISFDTEENSVLPFGLVKSSARDSLTAEG 371

Query: 592 V---KVRVCLFAFDILCHNDERLINMSLRERREYLTKVTKVVPGEFQYATQIITNNLDEL 648
           +     R      D L  N   LIN+ L  R++YL+ +    P   +    +   +   +
Sbjct: 372 ILTQGYRPLYMVIDFLYLNGVSLINVPLNTRKQYLSAILNPCPHAVEIIQSMHCYDDTSI 431

Query: 649 QKFLDESVNHSCEGLMVKMLDGSESHYEPSKRSRNWLKLKKDYLEGVGDSLDLCVLXXXX 708
           +  L++++    EG+++K     +S YE   R+ NW+K+K +YLE  G++LDL V+    
Sbjct: 432 KSSLEKAIMMGSEGIILKHF---KSKYEIGARTDNWIKIKPEYLEQFGENLDLLVIGRDP 488

Query: 709 XXXXXXXXXXXFLLG-----------CYNQDTGE----------FETCCKIGTGFSDEML 747
                       L G             N D+ E          F + C I  G S E  
Sbjct: 489 GKKDSLMCGLAVLEGDEEPGAQSDKQVVNLDSEEEEEPRKAVKKFISFCTIANGISQEEF 548

Query: 748 QLLH----ARLTPTIIDGPKATYVFDSSAEPDVWFEP--TTLFEVLTADLSLSPIYKAGS 801
           + +      +   T    P     F S   P+ W  P  + + EV    L  +   ++  
Sbjct: 549 KQIERKTAGKWKNTEDHKPPKILEFGSKL-PEEWIYPEDSVVLEVKARSLDNT---ESSG 604

Query: 802 TTFDKGVSLRFPRFLRIREDKGVEDATSSDQIVELYENQ 840
             F  G +L      RIREDK   + T    + EL++ +
Sbjct: 605 RKFKVGCTLHGGYCRRIREDK---NWTECYTLYELWQER 640

>TDEL0G04510 Chr7 (819479..822388) [2910 bp, 969 aa] {ON} Anc_6.18
           YOR005C
          Length = 969

 Score = 95.5 bits (236), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 95/409 (23%), Positives = 167/409 (40%), Gaps = 55/409 (13%)

Query: 478 GIPLKPMLAKPTKAINEVLDRFQGETFTSEYKYDGERAQVHLLNDGT-MRIYSRNGENMT 536
           G    P LAK      E +       F  E K DGER QVH ++ G  +R  SR G + T
Sbjct: 268 GYAFVPQLAKKMTISYEKICTKLNNDFLIEEKMDGERIQVHYMDYGAKIRFLSRRGVDYT 327

Query: 537 ERYPEI----KITDFIQDLDITKNLILDCEAVAWDKDQAKILPFQVLSTRKRKDVELNDV 592
           + Y E      + +++      ++ +LD E + +D D+  +LPF ++ +  R+ +    +
Sbjct: 328 QLYGENLQSGTVANYLNFDSNVRDCVLDGEMITFDTDRNVVLPFGMVKSSARQALSTEGI 387

Query: 593 ---KVRVCLFAFDILCHNDERLINMSLRERREYLTKVTKVVPGEFQYATQIITNNLDELQ 649
                R  L   D++  N   LI + L +R+E+L +V K  P   +    +  +    ++
Sbjct: 388 CSQGHRPMLMVLDLVYLNGVSLIKLPLYQRKEFLNRVLKPCPHAVEILPYVRCSEHTAIR 447

Query: 650 KFLDESVNHSCEGLMVKMLDGSESHYEPSKRSRNWLKLKKDYLEGVGDSLDLCVLXXXXX 709
           K L++S++   EG+++K     ++ YE   R+  W+K+K +YLE  G++LDL ++     
Sbjct: 448 KSLEKSISMGSEGIVLK---SYKARYEIGARNDYWIKVKPEYLEQFGENLDLVIIGRTPG 504

Query: 710 XXXXXXXXXXFLLGCYNQDTGEFE------------------------------TCCKIG 739
                        G   +D  E E                              + C I 
Sbjct: 505 KKDSLMCGLAVYEG--EEDLNEIEAKRESAIVNLDSEGDELDDTDGKKIIKYFISFCVIA 562

Query: 740 TGFSDEMLQLLHARLTPTIIDG----PKATYVFDSSAEPDVWFEP--TTLFEVLTADLSL 793
            G S +  + +  +     +      P A  +   S  P+ W +P  + + EV    L  
Sbjct: 563 NGISQQEFKEIDRKTRGAWVKSDQRLPSADLLRFGSKIPEEWIDPKNSIMLEVKARSLDN 622

Query: 794 SPIYKAGSTTFDKGVSLRFPRFLRIREDKGVEDATSSDQIVELYENQSH 842
           +   ++    F  G +L      RIR+DK   D T      EL++ + H
Sbjct: 623 T---ESSKKKFAAGCTLHGGYCRRIRDDK---DWTGCYSFSELWQERLH 665

>Skud_15.166 Chr15 complement(294550..297393) [2844 bp, 947 aa] {ON}
           YOR005C (REAL)
          Length = 947

 Score = 94.7 bits (234), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 64/239 (26%), Positives = 118/239 (49%), Gaps = 11/239 (4%)

Query: 474 TLRPGIPLKPMLAKPTKAINEVLDRFQGETFTSEYKYDGERAQVHLLNDG-TMRIYSRNG 532
           +++ G    P LAK      E + R     F  E K DGER QVH +N G +++ +SR G
Sbjct: 247 SIKVGFAFAPQLAKKVSLPYEKICRALHNDFLIEEKMDGERIQVHYMNYGKSIKFFSRRG 306

Query: 533 ENMTERY----PEIKITDFIQDLDITKNLILDCEAVAWDKDQAKILPFQVLSTRKRKDVE 588
            + T  Y        I+ +++  +  K  +LD E V +D  +  ILPF ++    +  + 
Sbjct: 307 IDYTYLYGASLSSGTISQYLKLTNTVKECVLDGEMVTFDSTRKVILPFGLVKGSAKGVLS 366

Query: 589 LNDVK---VRVCLFAFDILCHNDERLINMSLRERREYLTKVTKVVPGEFQYATQIITNNL 645
            +D+     R     FD+L  N+  L  + L +R++YL+ +        +        ++
Sbjct: 367 CSDINNSDFRPLYMVFDLLYLNEISLAPLPLHQRKKYLSSILTPFKNVVEIVQSTRCYDV 426

Query: 646 DELQKFLDESVNHSCEGLMVKMLDGSESHYEPSKRSRNWLKLKKDYLEGVGDSLDLCVL 704
             ++  L+ +++   EG+++K  + S   Y  + R+ NW+K+K +YLE  G++LDL ++
Sbjct: 427 QSVKNSLEVAISLGSEGVVLKYYNSS---YNIASRNYNWIKVKPEYLEEFGENLDLIII 482

>Suva_15.180 Chr15 complement(308983..311829) [2847 bp, 948 aa] {ON}
           YOR005C (REAL)
          Length = 948

 Score = 94.0 bits (232), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 69/242 (28%), Positives = 121/242 (50%), Gaps = 17/242 (7%)

Query: 474 TLRPGIPLKPMLAKPTKAINEVLDRFQGETFTSEYKYDGERAQVHLLNDG-TMRIYSRNG 532
           +++ G    P LAK      E +       F  E K DGER QVH +N G +++ +SR G
Sbjct: 247 SIKVGFAFAPQLAKKVNLSYEKICHALRNDFFVEEKMDGERIQVHYMNYGKSIKFFSRRG 306

Query: 533 ENMTERYP----EIKITDFIQDLDITKNLILDCEAVAWDKDQAKILPFQVLSTRKRKDVE 588
            + T  Y        I+ +++  D  K  +LD E V +D  +  ILPF ++    ++ + 
Sbjct: 307 IDYTYLYGVNLLSGTISQYLKFSDSVKECVLDGEMVTFDAMRKVILPFGLVKGSAKEALS 366

Query: 589 LNDVK---VRVCLFAFDILCHNDERLINMSLRERREYLTKV---TKVVPGEFQYATQIIT 642
            ND+           FD+L  N   L  + L +R+EYL+ +   +K V    +Y+     
Sbjct: 367 FNDINNNDFHPLYMVFDLLYLNGTSLTPLPLYQRKEYLSSILIPSKSVVEIVRYSR---C 423

Query: 643 NNLDELQKFLDESVNHSCEGLMVKMLDGSESHYEPSKRSRNWLKLKKDYLEGVGDSLDLC 702
            + + ++K L+ +++   EG+++K    S   Y  + R+ NW+K+K +YLE  G++LDL 
Sbjct: 424 YDAESVKKSLEVAISLGSEGVVLKHYSSS---YNVASRNNNWIKVKPEYLEEFGENLDLI 480

Query: 703 VL 704
           ++
Sbjct: 481 II 482

>KLLA0D01089g Chr4 complement(97438..100161) [2724 bp, 907 aa] {ON}
           similar to uniprot|Q08387 Saccharomyces cerevisiae
           YOR005C DNL4 DNA ligase required for nonhomologous end-
           joining (NHEJ) forms stable heterodimer with required
           cofactor Lif1p catalyzes DNA ligation as part of a
           complex with Lif1p and Nej1p involved in meiosis not
           essential for vegetative growth
          Length = 907

 Score = 92.0 bits (227), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 91/372 (24%), Positives = 160/372 (43%), Gaps = 35/372 (9%)

Query: 481 LKPMLAKPTKAINEVLDRFQGETFTSEYKYDGERAQVHLLNDG-TMRIYSRNGENMTERY 539
            +P LAK T    E +       F  E K DGER Q+H +N G  ++  SR G + +  Y
Sbjct: 247 FEPQLAKRTHLSYERVASKLQHDFIIEEKMDGERLQIHYINYGEQIKYLSRRGVDFSYLY 306

Query: 540 PEIKITDFIQ-DLDI---TKNLILDCEAVAWDKDQAKILPFQVLSTRKRKDV--ELNDV- 592
            E   +  I   L +    K+ ILD E + +D ++  +LPF ++ +     +  EL  + 
Sbjct: 307 GENSSSGPISPSLKLHFNVKDCILDGEMITYDTEKDIVLPFGLVKSSAMNQIQSELAGIA 366

Query: 593 ---KVRVCLFAFDILCHNDERLINMSLRERREYLTKVTKVVPGEFQYATQIITNNLDELQ 649
                +    AFD++  N + L N++L  R++YLTK+   V    +    +   N + ++
Sbjct: 367 PTESYKPLFVAFDLVYLNGKSLTNLALERRKDYLTKILTPVERSVEIIQYMKAINAEAIK 426

Query: 650 KFLDESVNHSCEGLMVKMLDGSESHYEPSKRSRNWLKLKKDYLEGVGDSLDLCVLXXXXX 709
             L+++++   EG+++K L    S Y    R+ +W+K+K +YLE  G+++DL ++     
Sbjct: 427 DSLEQAISMGSEGIVLKHL---HSKYFVGSRNTDWIKIKPEYLEQFGENMDLLII----- 478

Query: 710 XXXXXXXXXXFLLGCYNQDTGE------FETCCKIGTGFSDEMLQLLHARLTPTII---- 759
                     F  G    D  E      F + C I  G S+E  + +  +          
Sbjct: 479 -GREQGKKDSFFCGLSISDPNEVAEKPRFISFCTIANGLSNEEFKDIERKTWGKWHIFSE 537

Query: 760 DGPKATYVFDSSAEPDVWFEP--TTLFEVLTADLSLSPIYKAGSTTFDKGVSLRFPRFLR 817
           D P    +   +  P  W  P  + + EV    +      ++    +  G +L F    +
Sbjct: 538 DPPSPNLLGFGTKVPYEWIHPEDSVVLEVKARAIDTK---ESEKRKYRSGCTLHFGYCKQ 594

Query: 818 IREDKGVEDATS 829
           IR DK  +   S
Sbjct: 595 IRYDKDWKTVAS 606

>KLTH0C11286g Chr3 (926742..929597) [2856 bp, 951 aa] {ON} similar
           to uniprot|Q08387 Saccharomyces cerevisiae YOR005C DNL4
           DNA ligase required for nonhomologous end- joining
           (NHEJ) forms stable heterodimer with required cofactor
           Lif1p catalyzes DNA ligation as part of a complex with
           Lif1p and Nej1p involved in meiosis not essential for
           vegetative growth
          Length = 951

 Score = 90.9 bits (224), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 65/237 (27%), Positives = 117/237 (49%), Gaps = 13/237 (5%)

Query: 478 GIPLKPMLAKPTKAINEVLDRFQGETFTSEYKYDGERAQVHLLNDGT-MRIYSRNGENMT 536
           G    P LAK      E +       F  E K DGER Q+H +N G+ ++  SR G + +
Sbjct: 262 GHAFAPHLAKRLHVSYERICSKLKHDFILEEKMDGERIQLHYVNGGSVLKFLSRRGIDFS 321

Query: 537 ERY-PEIK---ITDFIQDLDITKNLILDCEAVAWDKDQAKILPFQVLSTRKRKDVELNDV 592
             Y  E+    I+ +++     ++ +LD E V++DK +  ILPF ++ +    ++  ++V
Sbjct: 322 HLYGQEVARGVISQYLKLKSDVRDCVLDGEMVSYDKKRKIILPFGIVKSAAVDELINSEV 381

Query: 593 K-----VRVCLFAFDILCHNDERLINMSLRERREYLTKVTKVVPGEFQYATQIITNNLDE 647
                  R     FD++  N   L  + L  R+EYL ++   VP   +    I   +   
Sbjct: 382 GNENDGYRPLYMVFDLVYLNGVSLTKVPLHIRKEYLKEILSPVPDVVEILKGIRACDAKA 441

Query: 648 LQKFLDESVNHSCEGLMVKMLDGSESHYEPSKRSRNWLKLKKDYLEGVGDSLDLCVL 704
           ++ F+  ++    EG++VK    + S YE   R+ +W+K+K +Y E +G+++DL V+
Sbjct: 442 IKNFMQRAIEMGSEGVIVKQ---ASSTYEVGARNDHWVKIKPEYFEDLGETMDLVVI 495

>Kpol_1032.7 s1032 complement(12295..15192) [2898 bp, 965 aa] {ON}
           complement(12295..15192) [2898 nt, 966 aa]
          Length = 965

 Score = 87.8 bits (216), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 62/224 (27%), Positives = 115/224 (51%), Gaps = 12/224 (5%)

Query: 489 TKAINEVLDRFQGETFTSEYKYDGERAQVHLLNDGT-MRIYSRNGENMTERYPEIK---- 543
           T + + +  R + + F  E K DGER Q+H +N G  ++  SR G + +  Y + +    
Sbjct: 285 TYSYDTIARRLKNDFFIEE-KMDGERIQLHYMNYGAKLKFLSRRGLDYSYLYGDNRNNGA 343

Query: 544 ITDFIQDLDITKNLILDCEAVAWDKDQAKILPFQVLSTRKRKDVELNDVK---VRVCLFA 600
           I  ++      K  ILD E V +D  +  ILPF ++ +   + + ++D++         A
Sbjct: 344 IGRYLNFHKDVKECILDGEMVTYDSVKNCILPFGLVKSSAMQSLSVSDIEPDGYHPLYMA 403

Query: 601 FDILCHNDERLINMSLRERREYLTKVTKVVPGEFQYATQIITNNLDELQKFLDESVNHSC 660
           FD++  N   L  + L +R+ YL K+    P   +    +  N+   ++  L++++    
Sbjct: 404 FDLVYLNGSSLSTLPLHQRKNYLDKLLIPCPDFVEILPALHCNDSSLIKSSLEKAIELGS 463

Query: 661 EGLMVKMLDGSESHYEPSKRSRNWLKLKKDYLEGVGDSLDLCVL 704
           EG+++K  D   S Y  +KRS +W+K+K +YLE  G+++DL V+
Sbjct: 464 EGIILKRFD---SQYLVAKRSDDWIKIKPEYLEQFGENMDLIVI 504

>Kwal_56.22414 s56 complement(117198..120089) [2892 bp, 963 aa] {ON}
           YOR005C (DNL4) - ATP dependent DNA ligase [contig 185]
           FULL
          Length = 963

 Score = 86.3 bits (212), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 67/259 (25%), Positives = 126/259 (48%), Gaps = 14/259 (5%)

Query: 457 VINSCLEHGIMNLDK-YCTLRPGIPLKPMLAKPTKAINEVLDRFQGETFTSEYKYDGERA 515
           V++  L +  M L K   ++  G    P LAK      E +     + F  E K DGER 
Sbjct: 254 VLSETLWNPTMRLGKNELSINIGRAFAPHLAKRLHLSYERVCAKLKQDFIIEEKMDGERI 313

Query: 516 QVHLLNDGT-MRIYSRNGENMTERYPEI----KITDFIQDLDITKNLILDCEAVAWDKDQ 570
           Q+H +  G  +R  SR G + T  Y +      I+  ++  +  ++ +LD E V++DK++
Sbjct: 314 QLHYIERGAKIRFLSRRGTDFTHLYGDSLEHGVISQHLKFKNDVQDCVLDGEMVSFDKEK 373

Query: 571 AKILPFQVLSTRKRKDVELNDVKV-----RVCLFAFDILCHNDERLINMSLRERREYLTK 625
             +LPF ++ +   +++  +D KV     R     FD++  N   L  + L  R+ YL  
Sbjct: 374 NVVLPFGIVKSTAMEELMNSDTKVDTDGYRPLYMIFDLVYLNGVSLTRLPLHLRKSYLRS 433

Query: 626 VTKVVPGEFQYATQIITNNLDELQKFLDESVNHSCEGLMVKMLDGSESHYEPSKRSRNWL 685
           +   V    +  + +  +  + ++  L+ ++    EG+++K      S YE   R+ +W+
Sbjct: 434 ILSPVANIVEILSDVRASEPNAIKVSLERAIEMGSEGIILKQFS---SPYEIGARNDSWI 490

Query: 686 KLKKDYLEGVGDSLDLCVL 704
           K+K +Y E +G+++DL V+
Sbjct: 491 KIKPEYFEELGETMDLVVI 509

>KAFR0A05050 Chr1 (1003515..1006361) [2847 bp, 948 aa] {ON} Anc_6.18
           YOR005C
          Length = 948

 Score = 86.3 bits (212), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 66/237 (27%), Positives = 119/237 (50%), Gaps = 15/237 (6%)

Query: 478 GIPLKPMLAKP-TKAINEVLDRFQGETFTSEYKYDGERAQVHLLNDGT-MRIYSRNGENM 535
           G    P LAK  + + +++  + + + F  E K DGER Q+H ++ G  ++  SR G + 
Sbjct: 251 GYAFAPHLAKKLSISYDKICKKLKNDFFIEE-KMDGERIQIHYMDYGNDIKFLSRRGVDY 309

Query: 536 TERYPEIKITDFIQ-----DLDITKNLILDCEAVAWDKDQAKILPFQVLSTRKRKDV--- 587
           T  Y E   T  I      + D+ K  +LD E V +D+DQ  +LPF ++ +     +   
Sbjct: 310 TYLYGENLSTGTIACYLKLNRDV-KECVLDGEMVTYDEDQDILLPFGMVKSAAMNALTKE 368

Query: 588 ELNDVKVRVCLFAFDILCHNDERLINMSLRERREYLTKVTKVVPGEFQYATQIITNNLDE 647
           E++       L  FD++  N   L+   L +R++YL  V +      Q       +N + 
Sbjct: 369 EISGQDYHPLLMVFDLVFLNGSSLVEFPLYQRKDYLASVLEPYRARVQIVNFTRCSNENI 428

Query: 648 LQKFLDESVNHSCEGLMVKMLDGSESHYEPSKRSRNWLKLKKDYLEGVGDSLDLCVL 704
           ++K L+ +++   EG+++K      S Y    R+ +W+K+K +YLE  G+++DL V+
Sbjct: 429 IRKSLEHAISVGSEGIVLK---NYNSRYMIGSRNDSWIKIKPEYLEQFGENMDLIVI 482

>NDAI0I02260 Chr9 complement(514711..517614) [2904 bp, 967 aa] {ON}
           Anc_6.18 YOR005C
          Length = 967

 Score = 84.7 bits (208), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 70/268 (26%), Positives = 127/268 (47%), Gaps = 11/268 (4%)

Query: 445 RDAFCQVPNYEIVINSCLEHGIMNLDKYCTLRPGIPLKPMLAKPTKAINEVLDRFQGETF 504
           +D    V + + V N   +  +   +   T+  G P  P  AK      E +       F
Sbjct: 234 QDYLSVVSDLKTVANKLWDPAVHLKNDDLTINVGSPFAPQSAKKLSISYEKICAKLKHDF 293

Query: 505 TSEYKYDGERAQVHLLNDGT-MRIYSRNGENMTERYPE-IK---ITDFIQDLDITKNLIL 559
             E K DGER Q+H  + G  +   SR G + T  Y E IK   ++ ++   +  +N +L
Sbjct: 294 FIEEKMDGERIQLHYQDYGNKLSFLSRRGTDYTYLYGESIKDGTVSKYLHLDNNVQNCVL 353

Query: 560 DCEAVAWDKDQAKILPFQVLSTRKRKDVELNDVK---VRVCLFAFDILCHNDERLINMSL 616
           D E V +DK++  +LPF ++ +  R  +    V     R  L  FD++  N   L+N+ L
Sbjct: 354 DGEMVTFDKERNALLPFGLVKSSARSIITQEGVANEGYRPLLMVFDLVYLNGVSLVNIPL 413

Query: 617 RERREYLTKVTKVVPGEFQYATQIITNNLDELQKFLDESVNHSCEGLMVKMLDGSESHYE 676
            +R+ YL K+        +       ++   ++  L+ +++   EG+++K  +   S Y 
Sbjct: 414 YQRKLYLEKIFTPERHIVELLRSKRCSDERSIKNALEHAISIGSEGVVLKHYN---SRYT 470

Query: 677 PSKRSRNWLKLKKDYLEGVGDSLDLCVL 704
            + R+ +W+K+K +YLE  G+++DL V+
Sbjct: 471 VASRNDDWIKVKPEYLEQFGENMDLIVI 498

>TPHA0M01460 Chr13 (311871..313751) [1881 bp, 626 aa] {ON} Anc_3.329
           YPR048W
          Length = 626

 Score = 34.7 bits (78), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 42/142 (29%), Positives = 65/142 (45%), Gaps = 22/142 (15%)

Query: 450 QVPNYEIVINSCLEHGIMNLDKYCTL-RPGIPLKPMLAKPTKAI-NEVLDRFQGETFTSE 507
           +V N  + +N  LEH   N D  C L  PG+ + PM++     I N V   F       +
Sbjct: 462 KVINNSLHLNKQLEH---NRDIPCILISPGVGIAPMMSLIRSDICNNVHLFFGNRVKDCD 518

Query: 508 YKYDGERAQVHLLNDGTMRIY---SRNGENMTERYPEIKITDFIQDL-----DITKNLIL 559
           + Y  E  Q      G +++Y   SR+  N     PE+K   ++QD+     D+  NLI+
Sbjct: 519 FLYRSELEQFD--KSGKIKLYTCFSRDEINS----PELK---YVQDILWEKKDLIANLII 569

Query: 560 DCEAVAWDKDQAKILPFQVLST 581
           D +AV +    +  +P QV  T
Sbjct: 570 DNQAVIYLCGSSGKMPIQVRIT 591

>KLLA0E01805g Chr5 complement(173125..174093) [969 bp, 322 aa] {ON}
           similar to uniprot|P25379 Saccharomyces cerevisiae
           YCL064C CHA1 catabolism of hydroxy amino acids catabolic
           serine (threonine) dehydratase
          Length = 322

 Score = 32.3 bits (72), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 19/65 (29%), Positives = 35/65 (53%), Gaps = 1/65 (1%)

Query: 213 QGLGPKVEDFEMNSNDSDHYSSNIPYSDVCEVFNQIEAISSRLEIIRICSDFFIKVMKQS 272
            GL   +  F M ++  D  S ++   +   V ++I +I++ L    IC+D F K +K S
Sbjct: 193 HGLAGSIPVFAMETDGCDVLSKSLIAGEPV-VLDRISSIATSLGSTEICADSFQKAIKFS 251

Query: 273 SKNLI 277
           SK+++
Sbjct: 252 SKSIV 256

>TBLA0D00640 Chr4 (168893..172321) [3429 bp, 1142 aa] {ON} Anc_7.387
           YBL063W
          Length = 1142

 Score = 33.1 bits (74), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 35/122 (28%), Positives = 55/122 (45%), Gaps = 13/122 (10%)

Query: 460 SCLEHGIMNLDKYCTLRPGIPLKPMLAK---PTKAINEVL---DRFQGETFTSEYKYDGE 513
           +CL+  I  L+ Y T    I   P + K   P+  IN+ +   DR + E  TS  K  G 
Sbjct: 378 TCLDETISTLE-YATRAMSIKNNPKINKSQNPSNFINDYINQIDRLKLELQTSTDKIGGI 436

Query: 514 RAQVHLLN---DGTMRIYSRNGE--NMTERYPEIKITDFIQDLDITKNLILDCEAVAWDK 568
              +  LN      + I  +N +  NMT +  + K   F++ + I K L  D +   W+K
Sbjct: 437 FIPLEKLNYYKSNEILIEEQNAKINNMTNQIAKFK-KKFVEQIQINKQLNTDMKKSQWEK 495

Query: 569 DQ 570
           +Q
Sbjct: 496 NQ 497

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.320    0.136    0.393 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 77,780,082
Number of extensions: 3182079
Number of successful extensions: 9093
Number of sequences better than 10.0: 48
Number of HSP's gapped: 9234
Number of HSP's successfully gapped: 49
Length of query: 845
Length of database: 53,481,399
Length adjustment: 118
Effective length of query: 727
Effective length of database: 39,950,811
Effective search space: 29044239597
Effective search space used: 29044239597
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 70 (31.6 bits)