Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Smik_4.737.347ON19119110241e-144
Skud_4.927.347ON19119110201e-143
YDL165W (CDC36)7.347ON19119110151e-142
Suva_4.817.347ON19119110081e-141
ZYRO0F11638g7.347ON1911919231e-128
TDEL0C020107.347ON1911919171e-127
NDAI0A019207.347ON1931938951e-124
Kpol_530.347.347ON1911918931e-124
KAFR0B008507.347ON1921928911e-123
NCAS0A141307.347ON1911918701e-120
CAGL0I03388g7.347ON1911918591e-118
KNAG0C037607.347ON1911918501e-117
TPHA0F029407.347ON1911918341e-115
TBLA0E005107.347ON2871677911e-107
KLTH0H01320g7.347ON1901927761e-106
Kwal_56.246347.347ON1901927721e-105
SAKL0F11308g7.347ON1911927691e-105
KLLA0D12408g7.347ON1841916968e-94
Ecym_47267.347ON1911986691e-89
ACL151C7.347ON2081986659e-89
SAKL0B08052g3.370ON576871101e-05
ZYRO0C16588g3.370ON608821091e-05
KAFR0H008603.370ON578821072e-05
YPR072W (NOT5)3.370ON560821045e-05
Smik_16.3163.370ON560791045e-05
Kwal_23.39623.370ON553841045e-05
CAGL0D01342g3.370ON548831046e-05
KLTH0F11880g3.370ON5631191021e-04
Skud_16.3613.370ON560821011e-04
Suva_16.4013.370ON565821011e-04
TPHA0A035003.370ON548801011e-04
NDAI0A050803.370ON57582992e-04
Kpol_1006.73.370ON54080974e-04
KNAG0A072903.370ON50782965e-04
TBLA0H014903.370ON55281966e-04
ADL364C3.370ON50487930.002
Ecym_34563.370ON50886920.002
TDEL0C051203.370ON56279880.006
KLLA0B09196g3.370ON59072850.017
ZYRO0D16302g7.214ON829115760.23
KLTH0A03652g7.214ON77265750.34
NCAS0A112103.370ON58238701.1
Kpol_1070.257.214ON686103701.2
NDAI0I021505.204ON31760672.4
TDEL0H023307.214ON81281648.4
YIL034C (CAP2)7.208ON28759638.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Smik_4.73
         (191 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Smik_4.73 Chr4 (141054..141629) [576 bp, 191 aa] {ON} YDL165W (R...   399   e-144
Skud_4.92 Chr4 (159953..160528) [576 bp, 191 aa] {ON} YDL165W (R...   397   e-143
YDL165W Chr4 (164290..164865) [576 bp, 191 aa] {ON}  CDC36Compon...   395   e-142
Suva_4.81 Chr4 (151849..152424) [576 bp, 191 aa] {ON} YDL165W (R...   392   e-141
ZYRO0F11638g Chr6 complement(954908..955483) [576 bp, 191 aa] {O...   360   e-128
TDEL0C02010 Chr3 (348737..349312) [576 bp, 191 aa] {ON} Anc_7.34...   357   e-127
NDAI0A01920 Chr1 (429808..430389) [582 bp, 193 aa] {ON} Anc_7.34...   349   e-124
Kpol_530.34 s530 (82095..82670) [576 bp, 191 aa] {ON} (82095..82...   348   e-124
KAFR0B00850 Chr2 complement(160852..161430) [579 bp, 192 aa] {ON...   347   e-123
NCAS0A14130 Chr1 complement(2778386..2778961) [576 bp, 191 aa] {...   339   e-120
CAGL0I03388g Chr9 (288784..289359) [576 bp, 191 aa] {ON} highly ...   335   e-118
KNAG0C03760 Chr3 complement(741798..742373) [576 bp, 191 aa] {ON...   332   e-117
TPHA0F02940 Chr6 complement(648881..649456) [576 bp, 191 aa] {ON...   325   e-115
TBLA0E00510 Chr5 complement(93705..94568) [864 bp, 287 aa] {ON} ...   309   e-107
KLTH0H01320g Chr8 (125017..125589) [573 bp, 190 aa] {ON} highly ...   303   e-106
Kwal_56.24634 s56 complement(1082319..1082891) [573 bp, 190 aa] ...   301   e-105
SAKL0F11308g Chr6 complement(882040..882615) [576 bp, 191 aa] {O...   300   e-105
KLLA0D12408g Chr4 (1055117..1055671) [555 bp, 184 aa] {ON} simil...   272   8e-94
Ecym_4726 Chr4 (1420080..1420655) [576 bp, 191 aa] {ON} similar ...   262   1e-89
ACL151C Chr3 complement(87037..87663) [627 bp, 208 aa] {ON} Synt...   260   9e-89
SAKL0B08052g Chr2 (688482..690212) [1731 bp, 576 aa] {ON} highly...    47   1e-05
ZYRO0C16588g Chr3 (1293001..1294827) [1827 bp, 608 aa] {ON} high...    47   1e-05
KAFR0H00860 Chr8 complement(158881..160617) [1737 bp, 578 aa] {O...    46   2e-05
YPR072W Chr16 (690107..691789) [1683 bp, 560 aa] {ON}  NOT5Subun...    45   5e-05
Smik_16.316 Chr16 (567157..568839) [1683 bp, 560 aa] {ON} YPR072...    45   5e-05
Kwal_23.3962 s23 complement(502287..503948) [1662 bp, 553 aa] {O...    45   5e-05
CAGL0D01342g Chr4 complement(149562..151208) [1647 bp, 548 aa] {...    45   6e-05
KLTH0F11880g Chr6 complement(1000583..1002274) [1692 bp, 563 aa]...    44   1e-04
Skud_16.361 Chr16 (655247..656929) [1683 bp, 560 aa] {ON} YPR072...    44   1e-04
Suva_16.401 Chr16 (697328..699025) [1698 bp, 565 aa] {ON} YPR072...    44   1e-04
TPHA0A03500 Chr1 complement(769721..771367) [1647 bp, 548 aa] {O...    44   1e-04
NDAI0A05080 Chr1 complement(1154530..1156257) [1728 bp, 575 aa] ...    43   2e-04
Kpol_1006.7 s1006 (30700..32322) [1623 bp, 540 aa] {ON} (30700.....    42   4e-04
KNAG0A07290 Chr1 (1139630..1141153) [1524 bp, 507 aa] {ON} Anc_3...    42   5e-04
TBLA0H01490 Chr8 complement(331583..333241) [1659 bp, 552 aa] {O...    42   6e-04
ADL364C Chr4 complement(66072..67586) [1515 bp, 504 aa] {ON} Syn...    40   0.002
Ecym_3456 Chr3 complement(853907..855433) [1527 bp, 508 aa] {ON}...    40   0.002
TDEL0C05120 Chr3 (917832..919520) [1689 bp, 562 aa] {ON} Anc_3.3...    39   0.006
KLLA0B09196g Chr2 complement(803259..805031) [1773 bp, 590 aa] {...    37   0.017
ZYRO0D16302g Chr4 (1357223..1359712) [2490 bp, 829 aa] {ON} simi...    34   0.23 
KLTH0A03652g Chr1 (314336..316654) [2319 bp, 772 aa] {ON} some s...    33   0.34 
NCAS0A11210 Chr1 (2223815..2225563) [1749 bp, 582 aa] {ON} Anc_3...    32   1.1  
Kpol_1070.25 s1070 complement(58286..59491,59501..59509,59592..6...    32   1.2  
NDAI0I02150 Chr9 (495208..496161) [954 bp, 317 aa] {ON} Anc_5.20...    30   2.4  
TDEL0H02330 Chr8 complement(391361..393799) [2439 bp, 812 aa] {O...    29   8.4  
YIL034C Chr9 complement(289226..290089) [864 bp, 287 aa] {ON}  C...    29   8.9  

>Smik_4.73 Chr4 (141054..141629) [576 bp, 191 aa] {ON} YDL165W
           (REAL)
          Length = 191

 Score =  399 bits (1024), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 191/191 (100%), Positives = 191/191 (100%)

Query: 1   MEKFGLQALVPLLKLEDKELSSTYDHSMTLGADLSSMLYSLGIPRDSQDHRVLDTFQSPW 60
           MEKFGLQALVPLLKLEDKELSSTYDHSMTLGADLSSMLYSLGIPRDSQDHRVLDTFQSPW
Sbjct: 1   MEKFGLQALVPLLKLEDKELSSTYDHSMTLGADLSSMLYSLGIPRDSQDHRVLDTFQSPW 60

Query: 61  AETSRSEVEPRFFTPESFTNIPGVLQSNVTPPCFNSIQNDQQRVALFQDETLFFLFYKHP 120
           AETSRSEVEPRFFTPESFTNIPGVLQSNVTPPCFNSIQNDQQRVALFQDETLFFLFYKHP
Sbjct: 61  AETSRSEVEPRFFTPESFTNIPGVLQSNVTPPCFNSIQNDQQRVALFQDETLFFLFYKHP 120

Query: 121 GTVIQELTYLELRKRNWRYHKTLKAWLTKDPMMEPIVSADGLSERGSYVFFDPQRWEKCQ 180
           GTVIQELTYLELRKRNWRYHKTLKAWLTKDPMMEPIVSADGLSERGSYVFFDPQRWEKCQ
Sbjct: 121 GTVIQELTYLELRKRNWRYHKTLKAWLTKDPMMEPIVSADGLSERGSYVFFDPQRWEKCQ 180

Query: 181 RDFLLFYNAIM 191
           RDFLLFYNAIM
Sbjct: 181 RDFLLFYNAIM 191

>Skud_4.92 Chr4 (159953..160528) [576 bp, 191 aa] {ON} YDL165W
           (REAL)
          Length = 191

 Score =  397 bits (1020), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 190/191 (99%), Positives = 191/191 (100%)

Query: 1   MEKFGLQALVPLLKLEDKELSSTYDHSMTLGADLSSMLYSLGIPRDSQDHRVLDTFQSPW 60
           MEKFGL+ALVPLLKLEDKELSSTYDHSMTLGADLSSMLYSLGIPRDSQDHRVLDTFQSPW
Sbjct: 1   MEKFGLRALVPLLKLEDKELSSTYDHSMTLGADLSSMLYSLGIPRDSQDHRVLDTFQSPW 60

Query: 61  AETSRSEVEPRFFTPESFTNIPGVLQSNVTPPCFNSIQNDQQRVALFQDETLFFLFYKHP 120
           AETSRSEVEPRFFTPESFTNIPGVLQSNVTPPCFNSIQNDQQRVALFQDETLFFLFYKHP
Sbjct: 61  AETSRSEVEPRFFTPESFTNIPGVLQSNVTPPCFNSIQNDQQRVALFQDETLFFLFYKHP 120

Query: 121 GTVIQELTYLELRKRNWRYHKTLKAWLTKDPMMEPIVSADGLSERGSYVFFDPQRWEKCQ 180
           GTVIQELTYLELRKRNWRYHKTLKAWLTKDPMMEPIVSADGLSERGSYVFFDPQRWEKCQ
Sbjct: 121 GTVIQELTYLELRKRNWRYHKTLKAWLTKDPMMEPIVSADGLSERGSYVFFDPQRWEKCQ 180

Query: 181 RDFLLFYNAIM 191
           RDFLLFYNAIM
Sbjct: 181 RDFLLFYNAIM 191

>YDL165W Chr4 (164290..164865) [576 bp, 191 aa] {ON}  CDC36Component
           of the CCR4-NOT complex, which has multiple roles in
           regulating mRNA levels including regulation of
           transcription and destabilizing mRNAs by deadenylation;
           basal transcription factor
          Length = 191

 Score =  395 bits (1015), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 189/191 (98%), Positives = 190/191 (99%)

Query: 1   MEKFGLQALVPLLKLEDKELSSTYDHSMTLGADLSSMLYSLGIPRDSQDHRVLDTFQSPW 60
           MEKFGL+ALVPLLKLEDKELSSTYDHSMTLGADLSSMLYSLGIPRDSQDHRVLDTFQSPW
Sbjct: 1   MEKFGLKALVPLLKLEDKELSSTYDHSMTLGADLSSMLYSLGIPRDSQDHRVLDTFQSPW 60

Query: 61  AETSRSEVEPRFFTPESFTNIPGVLQSNVTPPCFNSIQNDQQRVALFQDETLFFLFYKHP 120
           AETSRSEVEPRFFTPESFTNIPGVLQS VTPPCFNSIQNDQQRVALFQDETLFFLFYKHP
Sbjct: 61  AETSRSEVEPRFFTPESFTNIPGVLQSTVTPPCFNSIQNDQQRVALFQDETLFFLFYKHP 120

Query: 121 GTVIQELTYLELRKRNWRYHKTLKAWLTKDPMMEPIVSADGLSERGSYVFFDPQRWEKCQ 180
           GTVIQELTYLELRKRNWRYHKTLKAWLTKDPMMEPIVSADGLSERGSYVFFDPQRWEKCQ
Sbjct: 121 GTVIQELTYLELRKRNWRYHKTLKAWLTKDPMMEPIVSADGLSERGSYVFFDPQRWEKCQ 180

Query: 181 RDFLLFYNAIM 191
           RDFLLFYNAIM
Sbjct: 181 RDFLLFYNAIM 191

>Suva_4.81 Chr4 (151849..152424) [576 bp, 191 aa] {ON} YDL165W
           (REAL)
          Length = 191

 Score =  392 bits (1008), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 188/191 (98%), Positives = 189/191 (98%)

Query: 1   MEKFGLQALVPLLKLEDKELSSTYDHSMTLGADLSSMLYSLGIPRDSQDHRVLDTFQSPW 60
           M+KFGLQALVPLLK EDKELSSTYDHSMTLGADLSSMLYSLGIPRDSQDHRVLDTFQSPW
Sbjct: 1   MDKFGLQALVPLLKQEDKELSSTYDHSMTLGADLSSMLYSLGIPRDSQDHRVLDTFQSPW 60

Query: 61  AETSRSEVEPRFFTPESFTNIPGVLQSNVTPPCFNSIQNDQQRVALFQDETLFFLFYKHP 120
           AETSRSEVEPRFFTPESFTNIP VLQSNVTPPCFNSIQNDQQRVALFQDETLFFLFYKHP
Sbjct: 61  AETSRSEVEPRFFTPESFTNIPSVLQSNVTPPCFNSIQNDQQRVALFQDETLFFLFYKHP 120

Query: 121 GTVIQELTYLELRKRNWRYHKTLKAWLTKDPMMEPIVSADGLSERGSYVFFDPQRWEKCQ 180
           GTVIQELTYLELRKRNWRYHKTLKAWLTKDPMMEPIVSADGLSERGSYVFFDPQRWEKCQ
Sbjct: 121 GTVIQELTYLELRKRNWRYHKTLKAWLTKDPMMEPIVSADGLSERGSYVFFDPQRWEKCQ 180

Query: 181 RDFLLFYNAIM 191
           RDFLLFYNAIM
Sbjct: 181 RDFLLFYNAIM 191

>ZYRO0F11638g Chr6 complement(954908..955483) [576 bp, 191 aa] {ON}
           highly similar to uniprot|P06100 Saccharomyces
           cerevisiae YDL165W CDC36 Component of the CCR4-NOT
           complex which has multiple roles in regulating mRNA
           levels including regulation of transcription and
           destabilizing mRNAs by deadenylation basal transcription
           factor
          Length = 191

 Score =  360 bits (923), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 168/191 (87%), Positives = 179/191 (93%)

Query: 1   MEKFGLQALVPLLKLEDKELSSTYDHSMTLGADLSSMLYSLGIPRDSQDHRVLDTFQSPW 60
           M+KFGL+ALVPL+K ED+ELS  YDHSMTLGADLSSML+SLGIPRDS+ H+VLDTFQSPW
Sbjct: 1   MDKFGLEALVPLVKQEDRELSGKYDHSMTLGADLSSMLHSLGIPRDSKRHKVLDTFQSPW 60

Query: 61  AETSRSEVEPRFFTPESFTNIPGVLQSNVTPPCFNSIQNDQQRVALFQDETLFFLFYKHP 120
           AETSRSEVEPRFF PESF NIP VL S  TPPCFNS+Q DQQRVALFQDETLF+LFYKHP
Sbjct: 61  AETSRSEVEPRFFIPESFVNIPNVLHSQSTPPCFNSVQQDQQRVALFQDETLFYLFYKHP 120

Query: 121 GTVIQELTYLELRKRNWRYHKTLKAWLTKDPMMEPIVSADGLSERGSYVFFDPQRWEKCQ 180
           GTVIQELTYLELRKRNWRYHKTLKAWLTKDP MEP+VS+DGLSERGSYVFFDPQRWEKCQ
Sbjct: 121 GTVIQELTYLELRKRNWRYHKTLKAWLTKDPKMEPVVSSDGLSERGSYVFFDPQRWEKCQ 180

Query: 181 RDFLLFYNAIM 191
           RDFLLFYNAIM
Sbjct: 181 RDFLLFYNAIM 191

>TDEL0C02010 Chr3 (348737..349312) [576 bp, 191 aa] {ON} Anc_7.347
           YDL165W
          Length = 191

 Score =  357 bits (917), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 166/191 (86%), Positives = 182/191 (95%)

Query: 1   MEKFGLQALVPLLKLEDKELSSTYDHSMTLGADLSSMLYSLGIPRDSQDHRVLDTFQSPW 60
           MEKFGL+ALVPL+K E++E +S YDHS+TLGADLSSML+SLGIPRDS+ HRVLDTFQSPW
Sbjct: 1   MEKFGLKALVPLIKQEERETASLYDHSITLGADLSSMLHSLGIPRDSKRHRVLDTFQSPW 60

Query: 61  AETSRSEVEPRFFTPESFTNIPGVLQSNVTPPCFNSIQNDQQRVALFQDETLFFLFYKHP 120
           AETSRSEVEP+FF P+SFTNIP VLQS  TPPCFNS+Q+DQQRVALFQDETLF+LFYKHP
Sbjct: 61  AETSRSEVEPKFFIPDSFTNIPQVLQSQTTPPCFNSVQHDQQRVALFQDETLFYLFYKHP 120

Query: 121 GTVIQELTYLELRKRNWRYHKTLKAWLTKDPMMEPIVSADGLSERGSYVFFDPQRWEKCQ 180
           GTVIQELTYLELRKRNWRYHKTLKAWLTKDP MEP+VS+DGLSERGSYVFFDPQRWEKCQ
Sbjct: 121 GTVIQELTYLELRKRNWRYHKTLKAWLTKDPKMEPVVSSDGLSERGSYVFFDPQRWEKCQ 180

Query: 181 RDFLLFYNAIM 191
           R+FLLFYNAIM
Sbjct: 181 REFLLFYNAIM 191

>NDAI0A01920 Chr1 (429808..430389) [582 bp, 193 aa] {ON} Anc_7.347
           YDL165W
          Length = 193

 Score =  349 bits (895), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 166/193 (86%), Positives = 180/193 (93%), Gaps = 2/193 (1%)

Query: 1   MEKFGLQALVPLLKLEDKELSSTYDHSMTLGADLSSMLYSLGIPRDSQDHRVLDTFQSPW 60
           M+KFGL+ALVPL+K +DKELS  YDHSMTLGADL+SML+SLGIPRDS+ HRVLDTFQSPW
Sbjct: 1   MDKFGLEALVPLIKPDDKELSKIYDHSMTLGADLTSMLHSLGIPRDSKRHRVLDTFQSPW 60

Query: 61  AETSRSEVEPRFFTPESFTNIPGVLQSNV--TPPCFNSIQNDQQRVALFQDETLFFLFYK 118
           AETSRSEVEP FF P+SFT+IP VLQSN   TPP F+S+Q DQQRVALFQDETLF+LFYK
Sbjct: 61  AETSRSEVEPTFFIPDSFTHIPDVLQSNTKDTPPSFDSVQKDQQRVALFQDETLFYLFYK 120

Query: 119 HPGTVIQELTYLELRKRNWRYHKTLKAWLTKDPMMEPIVSADGLSERGSYVFFDPQRWEK 178
           HPGTVIQELTYLELRKRNWRYHKTLKAWLTKDPMMEP+VS DGLSERGSYVFFDPQRWEK
Sbjct: 121 HPGTVIQELTYLELRKRNWRYHKTLKAWLTKDPMMEPVVSNDGLSERGSYVFFDPQRWEK 180

Query: 179 CQRDFLLFYNAIM 191
           CQR+FLLFYNAIM
Sbjct: 181 CQREFLLFYNAIM 193

>Kpol_530.34 s530 (82095..82670) [576 bp, 191 aa] {ON}
           (82095..82670) [576 nt, 192 aa]
          Length = 191

 Score =  348 bits (893), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 160/191 (83%), Positives = 179/191 (93%)

Query: 1   MEKFGLQALVPLLKLEDKELSSTYDHSMTLGADLSSMLYSLGIPRDSQDHRVLDTFQSPW 60
           M+KFGL+AL+PL+K +D ELS  Y+H+MT+G DLSSML+SLGIPRD+Q +R+LDTFQSPW
Sbjct: 1   MDKFGLEALLPLIKQDDTELSKKYNHAMTIGTDLSSMLHSLGIPRDNQRYRILDTFQSPW 60

Query: 61  AETSRSEVEPRFFTPESFTNIPGVLQSNVTPPCFNSIQNDQQRVALFQDETLFFLFYKHP 120
           AETSRSEVEPRFFTPESF NIP VLQS VTPP FNSI+NDQQRV LFQDETLF+LFYKHP
Sbjct: 61  AETSRSEVEPRFFTPESFKNIPNVLQSKVTPPVFNSIENDQQRVTLFQDETLFYLFYKHP 120

Query: 121 GTVIQELTYLELRKRNWRYHKTLKAWLTKDPMMEPIVSADGLSERGSYVFFDPQRWEKCQ 180
           GTVIQELTYLELRKRNWRYHKTLKAWLTKDPM+EP+VS DGLSERGSY+FFDPQRWEKCQ
Sbjct: 121 GTVIQELTYLELRKRNWRYHKTLKAWLTKDPMVEPLVSGDGLSERGSYIFFDPQRWEKCQ 180

Query: 181 RDFLLFYNAIM 191
           R+F+LFYNAIM
Sbjct: 181 REFVLFYNAIM 191

>KAFR0B00850 Chr2 complement(160852..161430) [579 bp, 192 aa] {ON}
           Anc_7.347 YDL165W
          Length = 192

 Score =  347 bits (891), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 165/192 (85%), Positives = 177/192 (92%), Gaps = 1/192 (0%)

Query: 1   MEKFGLQALVPLLKLEDK-ELSSTYDHSMTLGADLSSMLYSLGIPRDSQDHRVLDTFQSP 59
           M+KFGL+AL+PL+K + + E +  YDHSMTLGADLSSMLYSLGIPRD Q HRVLDTFQSP
Sbjct: 1   MDKFGLKALIPLIKQDPQGEKNGQYDHSMTLGADLSSMLYSLGIPRDKQHHRVLDTFQSP 60

Query: 60  WAETSRSEVEPRFFTPESFTNIPGVLQSNVTPPCFNSIQNDQQRVALFQDETLFFLFYKH 119
           WAETSRSEVEP+F  P+SF NI  VLQSNVTPPCF+SIQNDQQRVALFQDETLF+LFYKH
Sbjct: 61  WAETSRSEVEPKFSIPDSFNNISNVLQSNVTPPCFDSIQNDQQRVALFQDETLFYLFYKH 120

Query: 120 PGTVIQELTYLELRKRNWRYHKTLKAWLTKDPMMEPIVSADGLSERGSYVFFDPQRWEKC 179
           P TVIQELTYLELRKRNWRYHKTLKAWLTKDPMMEPIVS DGLSE+GSYVFFDPQRWEKC
Sbjct: 121 PATVIQELTYLELRKRNWRYHKTLKAWLTKDPMMEPIVSQDGLSEKGSYVFFDPQRWEKC 180

Query: 180 QRDFLLFYNAIM 191
           QRDFLLFYNAIM
Sbjct: 181 QRDFLLFYNAIM 192

>NCAS0A14130 Chr1 complement(2778386..2778961) [576 bp, 191 aa] {ON}
           Anc_7.347 YDL165W
          Length = 191

 Score =  339 bits (870), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 161/191 (84%), Positives = 175/191 (91%)

Query: 1   MEKFGLQALVPLLKLEDKELSSTYDHSMTLGADLSSMLYSLGIPRDSQDHRVLDTFQSPW 60
           M+KFGL+ALVPLL+ +DKELS  YDHSMTLGADLSSM++SLGIPRD+  HRVLDTFQSPW
Sbjct: 1   MDKFGLKALVPLLRQDDKELSKPYDHSMTLGADLSSMIHSLGIPRDNTRHRVLDTFQSPW 60

Query: 61  AETSRSEVEPRFFTPESFTNIPGVLQSNVTPPCFNSIQNDQQRVALFQDETLFFLFYKHP 120
           AETSRSEVEP FF P+SF  I GVLQS VTPP F+S QNDQQRVALFQDETLF+LFYKHP
Sbjct: 61  AETSRSEVEPTFFIPDSFVGISGVLQSPVTPPRFDSAQNDQQRVALFQDETLFYLFYKHP 120

Query: 121 GTVIQELTYLELRKRNWRYHKTLKAWLTKDPMMEPIVSADGLSERGSYVFFDPQRWEKCQ 180
           GTV+QELTYLELR RNWRYH TL+AWLTKDP+MEP VSADGLSERGSYVFFDPQRWEKCQ
Sbjct: 121 GTVLQELTYLELRNRNWRYHTTLRAWLTKDPLMEPEVSADGLSERGSYVFFDPQRWEKCQ 180

Query: 181 RDFLLFYNAIM 191
           +DFLLFYNAIM
Sbjct: 181 KDFLLFYNAIM 191

>CAGL0I03388g Chr9 (288784..289359) [576 bp, 191 aa] {ON} highly
           similar to uniprot|P06100 Saccharomyces cerevisiae
           YDL165w CDC36 transcription factor
          Length = 191

 Score =  335 bits (859), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 154/191 (80%), Positives = 172/191 (90%)

Query: 1   MEKFGLQALVPLLKLEDKELSSTYDHSMTLGADLSSMLYSLGIPRDSQDHRVLDTFQSPW 60
           M KFGLQ LVPL++ ++++    YDHSMT+G DLSSML+SLGIPRDS+ HRVLDTFQSPW
Sbjct: 1   MSKFGLQKLVPLIRADEEKDGKVYDHSMTIGTDLSSMLHSLGIPRDSKHHRVLDTFQSPW 60

Query: 61  AETSRSEVEPRFFTPESFTNIPGVLQSNVTPPCFNSIQNDQQRVALFQDETLFFLFYKHP 120
           AETSRSEVEP+++ PESF NIP VLQS  TPP F+ +Q DQQRVALFQDETLF+LFYKHP
Sbjct: 61  AETSRSEVEPKYYIPESFKNIPDVLQSKTTPPTFDDVQTDQQRVALFQDETLFYLFYKHP 120

Query: 121 GTVIQELTYLELRKRNWRYHKTLKAWLTKDPMMEPIVSADGLSERGSYVFFDPQRWEKCQ 180
           GTVIQELTYLELRKRNWRYHK LKAWLTKDPMMEP+V+ADGLSERGSYVFFDPQRWEKCQ
Sbjct: 121 GTVIQELTYLELRKRNWRYHKGLKAWLTKDPMMEPVVAADGLSERGSYVFFDPQRWEKCQ 180

Query: 181 RDFLLFYNAIM 191
           RDF LFY+AIM
Sbjct: 181 RDFPLFYSAIM 191

>KNAG0C03760 Chr3 complement(741798..742373) [576 bp, 191 aa] {ON}
           Anc_7.347 YDL165W
          Length = 191

 Score =  332 bits (850), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 157/191 (82%), Positives = 170/191 (89%)

Query: 1   MEKFGLQALVPLLKLEDKELSSTYDHSMTLGADLSSMLYSLGIPRDSQDHRVLDTFQSPW 60
           M+KFGL+ALVPL++  D E++S YDHSM LGADLSSML+SLGIPRDS+   VL TFQSPW
Sbjct: 1   MDKFGLKALVPLVRQGDPEVASKYDHSMALGADLSSMLHSLGIPRDSKRQAVLATFQSPW 60

Query: 61  AETSRSEVEPRFFTPESFTNIPGVLQSNVTPPCFNSIQNDQQRVALFQDETLFFLFYKHP 120
           AETSRSEVEP F+ P SF  I  VLQS  TPPCF+S+Q DQQRVALFQDETLF+LFYKHP
Sbjct: 61  AETSRSEVEPTFYIPASFLGIDEVLQSESTPPCFDSVQRDQQRVALFQDETLFYLFYKHP 120

Query: 121 GTVIQELTYLELRKRNWRYHKTLKAWLTKDPMMEPIVSADGLSERGSYVFFDPQRWEKCQ 180
           GTVIQELTYLELRKRNWRYHKTLKAWLTKDP MEP+VS DGLSERGSYVFFDPQRWEKCQ
Sbjct: 121 GTVIQELTYLELRKRNWRYHKTLKAWLTKDPTMEPVVSPDGLSERGSYVFFDPQRWEKCQ 180

Query: 181 RDFLLFYNAIM 191
           RDFLLFYNAIM
Sbjct: 181 RDFLLFYNAIM 191

>TPHA0F02940 Chr6 complement(648881..649456) [576 bp, 191 aa] {ON}
           Anc_7.347 YDL165W
          Length = 191

 Score =  325 bits (834), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 148/191 (77%), Positives = 175/191 (91%)

Query: 1   MEKFGLQALVPLLKLEDKELSSTYDHSMTLGADLSSMLYSLGIPRDSQDHRVLDTFQSPW 60
           M+KFGL+AL+PL+K +D E S  Y+H+MT+GADL+S+ +SLGIP +++ +RVLDTFQSPW
Sbjct: 1   MDKFGLEALLPLIKQDDPEFSKKYNHAMTIGADLTSIQHSLGIPNNNKRYRVLDTFQSPW 60

Query: 61  AETSRSEVEPRFFTPESFTNIPGVLQSNVTPPCFNSIQNDQQRVALFQDETLFFLFYKHP 120
           AETSRSEVEPR+FTP+SFTNIP VLQS  TP  FNS++ DQQR++LFQDETLF+LFYKHP
Sbjct: 61  AETSRSEVEPRYFTPKSFTNIPKVLQSIDTPSVFNSVETDQQRISLFQDETLFYLFYKHP 120

Query: 121 GTVIQELTYLELRKRNWRYHKTLKAWLTKDPMMEPIVSADGLSERGSYVFFDPQRWEKCQ 180
           GTVIQELTYLELRKRNWRYHK LKAWLTKDP++EPIV+ADG SERGSY+FFDPQRWEKCQ
Sbjct: 121 GTVIQELTYLELRKRNWRYHKILKAWLTKDPIVEPIVTADGQSERGSYIFFDPQRWEKCQ 180

Query: 181 RDFLLFYNAIM 191
           RDF+LFYNAIM
Sbjct: 181 RDFVLFYNAIM 191

>TBLA0E00510 Chr5 complement(93705..94568) [864 bp, 287 aa] {ON}
           Anc_7.347 YDL165W
          Length = 287

 Score =  309 bits (791), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 139/167 (83%), Positives = 155/167 (92%)

Query: 25  DHSMTLGADLSSMLYSLGIPRDSQDHRVLDTFQSPWAETSRSEVEPRFFTPESFTNIPGV 84
           DHS+T+GADLSSML+SLG+PRD++ HR+LDTFQSPWAETSRSEV+PRFF P SF+NI  V
Sbjct: 121 DHSLTIGADLSSMLHSLGLPRDNKRHRILDTFQSPWAETSRSEVQPRFFIPSSFSNISNV 180

Query: 85  LQSNVTPPCFNSIQNDQQRVALFQDETLFFLFYKHPGTVIQELTYLELRKRNWRYHKTLK 144
           LQ N TPP FN+I+ DQQRVALFQDETLF+LFYKHPGTVIQELTYLELRKRNWR+HK LK
Sbjct: 181 LQCNTTPPTFNNIELDQQRVALFQDETLFYLFYKHPGTVIQELTYLELRKRNWRFHKILK 240

Query: 145 AWLTKDPMMEPIVSADGLSERGSYVFFDPQRWEKCQRDFLLFYNAIM 191
            WLTKDPMMEPIV+ADG SERGSYVFFDPQRWEKCQR+F+LFYNAIM
Sbjct: 241 TWLTKDPMMEPIVAADGFSERGSYVFFDPQRWEKCQREFILFYNAIM 287

>KLTH0H01320g Chr8 (125017..125589) [573 bp, 190 aa] {ON} highly
           similar to uniprot|P06100 Saccharomyces cerevisiae
           YDL165W CDC36 Component of the CCR4-NOT complex which
           has multiple roles in regulating mRNA levels including
           regulation of transcription and destabilizing mRNAs by
           deadenylation basal transcription factor
          Length = 190

 Score =  303 bits (776), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 143/192 (74%), Positives = 163/192 (84%), Gaps = 3/192 (1%)

Query: 1   MEKFGLQALVPLLKLEDKELSSTYDHSMTLGADLSSMLYSLGIPRDSQD-HRVLDTFQSP 59
           MEK+GL AL+PL++ ED+  S  YD SMTLG DLS +L+SLGIP +    +RVLDTFQSP
Sbjct: 1   MEKYGLSALLPLIRREDQ--SPDYDSSMTLGIDLSPVLHSLGIPNNQPSRNRVLDTFQSP 58

Query: 60  WAETSRSEVEPRFFTPESFTNIPGVLQSNVTPPCFNSIQNDQQRVALFQDETLFFLFYKH 119
           W ETSRSEVEP+FF PESF NIP VLQS   PP FNS+Q D  +++LFQDETLF+LFYKH
Sbjct: 59  WVETSRSEVEPKFFVPESFKNIPNVLQSGERPPAFNSVQQDHAKISLFQDETLFYLFYKH 118

Query: 120 PGTVIQELTYLELRKRNWRYHKTLKAWLTKDPMMEPIVSADGLSERGSYVFFDPQRWEKC 179
           PG+V+QELTYLELRKRNWRYHKTLK WLTKDPMMEP+V+  G SERGSYVFFDPQRWEKC
Sbjct: 119 PGSVVQELTYLELRKRNWRYHKTLKVWLTKDPMMEPVVAPGGASERGSYVFFDPQRWEKC 178

Query: 180 QRDFLLFYNAIM 191
           QRDF+LFYNAIM
Sbjct: 179 QRDFVLFYNAIM 190

>Kwal_56.24634 s56 complement(1082319..1082891) [573 bp, 190 aa]
           {ON} YDL165W (CDC36) - nuclear protein that negatively
           regulates basal transcription [contig 161] FULL
          Length = 190

 Score =  301 bits (772), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 142/192 (73%), Positives = 163/192 (84%), Gaps = 3/192 (1%)

Query: 1   MEKFGLQALVPLLKLEDKELSSTYDHSMTLGADLSSMLYSLGIPRD-SQDHRVLDTFQSP 59
           MEK+GL AL+PL++ ED+  S  YD SMTLG DLS +L+SLGI  + S  +RVLDTFQSP
Sbjct: 1   MEKYGLSALLPLIRREDQ--SPEYDSSMTLGIDLSPVLHSLGIASNQSTRYRVLDTFQSP 58

Query: 60  WAETSRSEVEPRFFTPESFTNIPGVLQSNVTPPCFNSIQNDQQRVALFQDETLFFLFYKH 119
           W ETSRSEVEP+FF PESF NIP VLQ+   PP FNS+Q D  +++LFQDETLF+LFYKH
Sbjct: 59  WVETSRSEVEPKFFVPESFKNIPNVLQAGDKPPAFNSVQQDHAKISLFQDETLFYLFYKH 118

Query: 120 PGTVIQELTYLELRKRNWRYHKTLKAWLTKDPMMEPIVSADGLSERGSYVFFDPQRWEKC 179
           PG+V+QELTYLELRKRNWRYHKTLK WLTKDPMMEP+V+  G SERGSYVFFDPQRWEKC
Sbjct: 119 PGSVVQELTYLELRKRNWRYHKTLKVWLTKDPMMEPVVAPGGASERGSYVFFDPQRWEKC 178

Query: 180 QRDFLLFYNAIM 191
           QRDF+LFYNAIM
Sbjct: 179 QRDFVLFYNAIM 190

>SAKL0F11308g Chr6 complement(882040..882615) [576 bp, 191 aa] {ON}
           highly similar to uniprot|P06100 Saccharomyces
           cerevisiae YDL165W CDC36 Component of the CCR4-NOT
           complex which has multiple roles in regulating mRNA
           levels including regulation of transcription and
           destabilizing mRNAs by deadenylation basal transcription
           factor
          Length = 191

 Score =  300 bits (769), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 144/192 (75%), Positives = 166/192 (86%), Gaps = 4/192 (2%)

Query: 1   MEKFGLQALVPLLKLEDKELSSTYDHSMTLGADLSSMLYSLGIPRDSQ-DHRVLDTFQSP 59
           +EK+GL+AL+PL+K E    ++ YD +MT+G DLSSML+SLGI  + +   RVLDTF SP
Sbjct: 3   VEKYGLKALLPLIKQETG--NAEYDPAMTMGMDLSSMLHSLGIDSNQEYKTRVLDTFPSP 60

Query: 60  WAETSRSEVEPRFFTPESFTNIPGVLQSNVTPPCFNSIQNDQQRVALFQDETLFFLFYKH 119
           W ETSRSEVEP+FFTPESF NIP VLQS  +PP FNS+Q D  ++ALFQDETLF+LFYKH
Sbjct: 61  WVETSRSEVEPKFFTPESFVNIPNVLQSP-SPPSFNSVQQDHPKIALFQDETLFYLFYKH 119

Query: 120 PGTVIQELTYLELRKRNWRYHKTLKAWLTKDPMMEPIVSADGLSERGSYVFFDPQRWEKC 179
           PGTV+QE+TYLELRKRNWRYHKTLK WLTKDPMMEP+VS DGLSERGSYVFFDPQRWEKC
Sbjct: 120 PGTVVQEITYLELRKRNWRYHKTLKVWLTKDPMMEPVVSQDGLSERGSYVFFDPQRWEKC 179

Query: 180 QRDFLLFYNAIM 191
           QRDF+LFYNAIM
Sbjct: 180 QRDFVLFYNAIM 191

>KLLA0D12408g Chr4 (1055117..1055671) [555 bp, 184 aa] {ON} similar
           to uniprot|P06100 Saccharomyces cerevisiae YDL165W CDC36
           Component of the CCR4-NOT complex which has multiple
           roles in regulating mRNA levels including regulation of
           transcription and destabilizing mRNAs by deadenylation
           basal transcription factor
          Length = 184

 Score =  272 bits (696), Expect = 8e-94,   Method: Compositional matrix adjust.
 Identities = 129/191 (67%), Positives = 154/191 (80%), Gaps = 7/191 (3%)

Query: 1   MEKFGLQALVPLLKLEDKELSSTYDHSMTLGADLSSMLYSLGIPRDSQDHRVLDTFQSPW 60
           MEK+GL+ LVP+L+ +      TYD +MTLG DL+S+L SL I +D++ H  LD F+SPW
Sbjct: 1   MEKYGLKDLVPVLRHD-----PTYDANMTLGIDLNSLLNSLDITKDTKSHHCLDAFESPW 55

Query: 61  AETSRSEVEPRFFTPESFTNIPGVLQSNVTPPCFNSIQNDQQRVALFQDETLFFLFYKHP 120
            ETSRSEV+P FF PESF NI G+L ++     F S+  DQ R++L QDETLF+LFYKHP
Sbjct: 56  VETSRSEVQPTFFIPESFKNIKGMLGTDQVE--FTSVNRDQPRISLLQDETLFYLFYKHP 113

Query: 121 GTVIQELTYLELRKRNWRYHKTLKAWLTKDPMMEPIVSADGLSERGSYVFFDPQRWEKCQ 180
           G+VIQELTYLELRKRNWRYHKTLK WLTKDPMMEP+V+ D +SERGSYVFFDPQRWEKCQ
Sbjct: 114 GSVIQELTYLELRKRNWRYHKTLKVWLTKDPMMEPVVAQDSMSERGSYVFFDPQRWEKCQ 173

Query: 181 RDFLLFYNAIM 191
           RDF+L YNAIM
Sbjct: 174 RDFVLHYNAIM 184

>Ecym_4726 Chr4 (1420080..1420655) [576 bp, 191 aa] {ON} similar to
           Ashbya gossypii ACL151C
          Length = 191

 Score =  262 bits (669), Expect = 1e-89,   Method: Compositional matrix adjust.
 Identities = 134/198 (67%), Positives = 153/198 (77%), Gaps = 14/198 (7%)

Query: 1   MEKFGLQALVPLLKLEDKELSSTYDHSMTLGADLSSMLYSLGIP-RDSQD------HRVL 53
           M K+GL++L+P++K  DK+    YD SMTLG DL S+L+SL +  RDS +      H  L
Sbjct: 1   MSKYGLKSLLPVIK-HDKQ----YDSSMTLGTDLPSILHSLQLTTRDSYNSGLNNGHHTL 55

Query: 54  DTFQSPWAETSRSEVEPRFFTPESFTNIPGVLQSNVTPPCFNSIQNDQQRVALFQDETLF 113
           DTF SPW ETSRSEVEP+FF PESF NI GVL    T   F S+  D  R++L QDETLF
Sbjct: 56  DTFPSPWVETSRSEVEPKFFIPESFKNIVGVLGQPST--YFTSVARDHPRISLLQDETLF 113

Query: 114 FLFYKHPGTVIQELTYLELRKRNWRYHKTLKAWLTKDPMMEPIVSADGLSERGSYVFFDP 173
           +LFYKHPGTV+QELTYLELRKRNWRYHKTLK WLTKDP+MEPIVS D  SERGSYVFFDP
Sbjct: 114 YLFYKHPGTVLQELTYLELRKRNWRYHKTLKVWLTKDPLMEPIVSQDSTSERGSYVFFDP 173

Query: 174 QRWEKCQRDFLLFYNAIM 191
           QRWEKCQRDF+L YNAIM
Sbjct: 174 QRWEKCQRDFILNYNAIM 191

>ACL151C Chr3 complement(87037..87663) [627 bp, 208 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDL165W
           (CDC36)
          Length = 208

 Score =  260 bits (665), Expect = 9e-89,   Method: Compositional matrix adjust.
 Identities = 129/198 (65%), Positives = 149/198 (75%), Gaps = 14/198 (7%)

Query: 1   MEKFGLQALVPLLKLEDKELSSTYDHSMTLGADLSSMLYSLGIPRD-------SQDHRVL 53
           M+K+GL+ L+P++K E +     YD  MTLG D+SS+L+SL +          S  H  L
Sbjct: 18  MDKYGLKGLLPVIKHEKQ-----YDAFMTLGVDVSSLLHSLQVSSKDGYNTALSNGHHAL 72

Query: 54  DTFQSPWAETSRSEVEPRFFTPESFTNIPGVLQSNVTPPCFNSIQNDQQRVALFQDETLF 113
           DTF SPW ETSRSEVEP+FF PESF NI GVL    T   F S+  D  R++L QDETLF
Sbjct: 73  DTFPSPWVETSRSEVEPKFFIPESFCNIGGVLGQASTD--FTSVARDHPRISLLQDETLF 130

Query: 114 FLFYKHPGTVIQELTYLELRKRNWRYHKTLKAWLTKDPMMEPIVSADGLSERGSYVFFDP 173
           +LFYKHPGTV+QELTYLELRKRNWRYHKTLK WLTKDP+MEPIVS D  SERGSYVFFDP
Sbjct: 131 YLFYKHPGTVLQELTYLELRKRNWRYHKTLKVWLTKDPLMEPIVSQDSTSERGSYVFFDP 190

Query: 174 QRWEKCQRDFLLFYNAIM 191
           QRWEKCQRDF+L Y+AIM
Sbjct: 191 QRWEKCQRDFILNYSAIM 208

>SAKL0B08052g Chr2 (688482..690212) [1731 bp, 576 aa] {ON} highly
           similar to uniprot|Q12514 Saccharomyces cerevisiae
           YPR072W NOT5 Subunit of global transcriptional regulator
          Length = 576

 Score = 47.0 bits (110), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 31/87 (35%), Positives = 48/87 (55%), Gaps = 6/87 (6%)

Query: 104 VALFQDETLFFLFYKHPGTVIQELTYLEL-RKRNWRYHKTLKAWLTKDPMMEP--IVSAD 160
            + F  +TLFF+FY + GT  Q L   EL + RNW+++K    W  K+    P  +VS++
Sbjct: 481 TSKFDLDTLFFIFYHYQGTYEQFLAARELSQNRNWQFNKLNHCWFYKEVEKLPPGVVSSE 540

Query: 161 GLSERGSYVFFDPQR-W--EKCQRDFL 184
              E  S+ +FD Q+ W   +C  DF+
Sbjct: 541 NKQEEISWRYFDYQKSWLARRCGSDFV 567

>ZYRO0C16588g Chr3 (1293001..1294827) [1827 bp, 608 aa] {ON} highly
           similar to uniprot|Q12514 Saccharomyces cerevisiae
           YPR072W NOT5 Subunit of global transcriptional regulator
          Length = 608

 Score = 46.6 bits (109), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 31/82 (37%), Positives = 45/82 (54%), Gaps = 6/82 (7%)

Query: 107 FQDETLFFLFYKHPGTVIQELTYLELRK-RNWRYHKTLKAWLTKDPMMEPIVSADGLSER 165
           F  +TLFF+FY + GT  Q L   EL K R W+++K  + W  K+  +E +      SE 
Sbjct: 519 FDLDTLFFIFYHYQGTYEQFLAARELAKNRKWKFNKVDRCWYYKE--VEKLPPGMAQSEE 576

Query: 166 GSYVFFDPQR-W--EKCQRDFL 184
            S+ +FD QR W   +C  DF+
Sbjct: 577 ESWRYFDYQRSWLARRCNSDFI 598

>KAFR0H00860 Chr8 complement(158881..160617) [1737 bp, 578 aa] {ON}
           Anc_3.370 YPR072W
          Length = 578

 Score = 45.8 bits (107), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 30/82 (36%), Positives = 47/82 (57%), Gaps = 6/82 (7%)

Query: 107 FQDETLFFLFYKHPGTVIQELTYLELRK-RNWRYHKTLKAWLTKDPMMEPIVSADGLSER 165
           F  +TLFF+FY + GT  Q L+  EL K RNW+++K  + W  K+  +E +      SE 
Sbjct: 490 FDLDTLFFIFYHYQGTYEQFLSSRELNKNRNWQFNKVDRCWYYKE--IEKLPPGMNKSEE 547

Query: 166 GSYVFFDPQR-W--EKCQRDFL 184
            S+ +FD ++ W   +C  DF+
Sbjct: 548 ESWRYFDYKKSWLARRCSPDFV 569

>YPR072W Chr16 (690107..691789) [1683 bp, 560 aa] {ON}  NOT5Subunit
           of the CCR4-NOT complex, which is a global
           transcriptional regulator with roles in transcription
           initiation and elongation and in mRNA degradation
          Length = 560

 Score = 44.7 bits (104), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 29/82 (35%), Positives = 46/82 (56%), Gaps = 6/82 (7%)

Query: 107 FQDETLFFLFYKHPGTVIQELTYLEL-RKRNWRYHKTLKAWLTKDPMMEPIVSADGLSER 165
           F  +TLFF+FY + G+  Q L   EL + RNW ++K  + W  K+  +E +    G SE 
Sbjct: 472 FDLDTLFFIFYHYQGSYEQFLAARELFKNRNWLFNKVDRCWYYKE--IEKLPPGMGKSEE 529

Query: 166 GSYVFFDPQR-W--EKCQRDFL 184
            S+ +FD ++ W   +C  DF+
Sbjct: 530 ESWRYFDYKKSWLARRCGNDFV 551

>Smik_16.316 Chr16 (567157..568839) [1683 bp, 560 aa] {ON} YPR072W
           (REAL)
          Length = 560

 Score = 44.7 bits (104), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 28/79 (35%), Positives = 45/79 (56%), Gaps = 6/79 (7%)

Query: 110 ETLFFLFYKHPGTVIQELTYLEL-RKRNWRYHKTLKAWLTKDPMMEPIVSADGLSERGSY 168
           +TLFF+FY + G+  Q L   EL + RNW ++K  + W  K+  +E +    G SE  S+
Sbjct: 475 DTLFFIFYHYQGSYEQFLAARELYKNRNWLFNKVDRCWYYKE--IEKLPPGMGKSEEESW 532

Query: 169 VFFDPQR-W--EKCQRDFL 184
            +FD ++ W   +C  DF+
Sbjct: 533 RYFDYKKSWLARRCGNDFV 551

>Kwal_23.3962 s23 complement(502287..503948) [1662 bp, 553 aa] {ON}
           YPR072W (NOT5) - member of the NOT complex, a global
           negative regulator of transcription [contig 255] FULL
          Length = 553

 Score = 44.7 bits (104), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 29/84 (34%), Positives = 46/84 (54%), Gaps = 5/84 (5%)

Query: 104 VALFQDETLFFLFYKHPGTVIQELTYLELRKRNWRYHKTLKAWLTKDPMMEPIVSADGLS 163
           ++ F  +TLFF+FY + GT  Q L   EL  R W+++K  + W  K+  +E +      S
Sbjct: 463 MSKFDLDTLFFIFYHYQGTHEQFLAARELTMRGWQFNKVNRCWFYKE--VEKLPPGMEQS 520

Query: 164 ERGSYVFFDPQR-W--EKCQRDFL 184
           E  S+ +FD Q+ W   +C  DF+
Sbjct: 521 EEISWRYFDYQKSWLARRCGTDFV 544

>CAGL0D01342g Chr4 complement(149562..151208) [1647 bp, 548 aa] {ON}
           similar to uniprot|Q12514 Saccharomyces cerevisiae
           YPR072w NOT5
          Length = 548

 Score = 44.7 bits (104), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 30/83 (36%), Positives = 46/83 (55%), Gaps = 6/83 (7%)

Query: 106 LFQDETLFFLFYKHPGTVIQELTYLELRK-RNWRYHKTLKAWLTKDPMMEPIVSADGLSE 164
           +F  +TLFF+FY + GT  Q L   EL K RNW+++K  + W  K+  +E +      SE
Sbjct: 459 MFDLDTLFFIFYHYQGTYEQFLAARELAKIRNWQFNKKDRCWYYKE--IEKLPPGMTKSE 516

Query: 165 RGSYVFFD-PQRW--EKCQRDFL 184
             S+ +FD  + W   +C  DF+
Sbjct: 517 EESWRYFDFKKSWLSRRCGSDFV 539

>KLTH0F11880g Chr6 complement(1000583..1002274) [1692 bp, 563 aa]
           {ON} highly similar to uniprot|Q12514 Saccharomyces
           cerevisiae YPR072W NOT5 Subunit of global
           transcriptional regulator
          Length = 563

 Score = 43.9 bits (102), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 40/119 (33%), Positives = 59/119 (49%), Gaps = 14/119 (11%)

Query: 78  FTNIPGVLQSN--VTPPCFNSIQND-QQRVAL------FQDETLFFLFYKHPGTVIQELT 128
           F N P  L SN  V P   +   ND   R +L      F  +TLFF+FY + GT  Q L+
Sbjct: 438 FPNEPIRLVSNEPVDPTKTHPKHNDIYSRTSLARIMSKFDLDTLFFIFYHYQGTYEQFLS 497

Query: 129 YLELRKRNWRYHKTLKAWLTKDPMMEPIVSADGLSERGSYVFFDPQR-W--EKCQRDFL 184
             EL  R W+++K  + W  K+  +E +      SE  S+ +FD Q+ W   +C  +F+
Sbjct: 498 ARELSIRGWQFNKVNRCWFYKE--VEKLPPGMEQSEEISWRYFDYQKSWLARRCGAEFV 554

>Skud_16.361 Chr16 (655247..656929) [1683 bp, 560 aa] {ON} YPR072W
           (REAL)
          Length = 560

 Score = 43.5 bits (101), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 28/82 (34%), Positives = 46/82 (56%), Gaps = 6/82 (7%)

Query: 107 FQDETLFFLFYKHPGTVIQELTYLEL-RKRNWRYHKTLKAWLTKDPMMEPIVSADGLSER 165
           F  +TLFF+FY + G+  Q L   EL + RNW +++  + W  K+  +E +    G SE 
Sbjct: 472 FDLDTLFFIFYHYQGSYEQFLAARELYKNRNWLFNRVDRCWYYKE--IEKLPPGMGKSEE 529

Query: 166 GSYVFFDPQR-W--EKCQRDFL 184
            S+ +FD ++ W   +C  DF+
Sbjct: 530 ESWRYFDYKKSWLARRCGNDFV 551

>Suva_16.401 Chr16 (697328..699025) [1698 bp, 565 aa] {ON} YPR072W
           (REAL)
          Length = 565

 Score = 43.5 bits (101), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 28/82 (34%), Positives = 46/82 (56%), Gaps = 6/82 (7%)

Query: 107 FQDETLFFLFYKHPGTVIQELTYLEL-RKRNWRYHKTLKAWLTKDPMMEPIVSADGLSER 165
           F  +TLFF+FY + G+  Q L   EL + RNW +++  + W  K+  +E +    G SE 
Sbjct: 477 FDLDTLFFIFYHYQGSYEQFLAARELYKNRNWLFNRVDRCWYYKE--IEKLPPGMGKSEE 534

Query: 166 GSYVFFDPQR-W--EKCQRDFL 184
            S+ +FD ++ W   +C  DF+
Sbjct: 535 ESWRYFDYKKSWLARRCGNDFV 556

>TPHA0A03500 Chr1 complement(769721..771367) [1647 bp, 548 aa] {ON}
           Anc_3.370 YPR072W
          Length = 548

 Score = 43.5 bits (101), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 31/80 (38%), Positives = 43/80 (53%), Gaps = 10/80 (12%)

Query: 110 ETLFFLFYKHPGTVIQELTYLELRK-RNWRYHKTLKAWLTKDPMMEPIVSADGLS--ERG 166
           +TLFF+FY + GT  Q L   EL K RNW+Y+K  + W  K    E   SA  ++  E  
Sbjct: 463 DTLFFIFYHYQGTYEQFLVARELSKCRNWKYNKVDRNWYFK----EVTKSAPDMAQTEEE 518

Query: 167 SYVFFDPQR-W--EKCQRDF 183
           ++ +FD Q  W   +C  DF
Sbjct: 519 TWRYFDYQNSWLARRCNHDF 538

>NDAI0A05080 Chr1 complement(1154530..1156257) [1728 bp, 575 aa]
           {ON} Anc_3.370
          Length = 575

 Score = 42.7 bits (99), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 29/82 (35%), Positives = 43/82 (52%), Gaps = 4/82 (4%)

Query: 107 FQDETLFFLFYKHPGTVIQELTYLELRK-RNWRYHKTLKAWLTKDPMMEPIVSADGLSER 165
           F  +TLFF+FY + GT  Q L   EL K R+W+Y+K    W  K+    P  +     E 
Sbjct: 485 FDLDTLFFIFYHYQGTYDQFLASRELSKNRDWKYNKVDYCWYYKEIEKLPPGANYNKDEE 544

Query: 166 GSYVFFDPQR-W--EKCQRDFL 184
            S+ +FD ++ W   +C  DF+
Sbjct: 545 ESWRYFDYKKSWLSRRCGNDFV 566

>Kpol_1006.7 s1006 (30700..32322) [1623 bp, 540 aa] {ON}
           (30700..32322) [1623 nt, 541 aa]
          Length = 540

 Score = 42.0 bits (97), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 29/80 (36%), Positives = 43/80 (53%), Gaps = 10/80 (12%)

Query: 110 ETLFFLFYKHPGTVIQELTYLELRK-RNWRYHKTLKAWLTKDPMMEPIVSADGL--SERG 166
           +TLFF+FY + GT  Q L   EL K RNW+++K  + W  K+    P     G+  +E  
Sbjct: 455 DTLFFIFYHYQGTYEQFLVARELAKHRNWKFNKINRNWYYKEVTKSPP----GMQQAEEE 510

Query: 167 SYVFFDPQR-W--EKCQRDF 183
           ++ +FD Q  W   +C  DF
Sbjct: 511 TWRYFDYQNSWLARRCNSDF 530

>KNAG0A07290 Chr1 (1139630..1141153) [1524 bp, 507 aa] {ON}
           Anc_3.370 YPR072W
          Length = 507

 Score = 41.6 bits (96), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 28/82 (34%), Positives = 45/82 (54%), Gaps = 6/82 (7%)

Query: 107 FQDETLFFLFYKHPGTVIQELTYLELR-KRNWRYHKTLKAWLTKDPMMEPIVSADGLSER 165
           F  +TLFF+FY + GT  Q L   EL   R+W+++K  + W  K+  +E +      SE 
Sbjct: 419 FDLDTLFFIFYHYQGTYEQFLAARELSINRDWQFNKKDRCWYYKE--IEKLPPGMNKSEE 476

Query: 166 GSYVFFDPQR-W--EKCQRDFL 184
            S+ +FD ++ W   +C  DF+
Sbjct: 477 ESWRYFDYKKSWLARRCNSDFV 498

>TBLA0H01490 Chr8 complement(331583..333241) [1659 bp, 552 aa] {ON}
           Anc_3.370 YPR072W
          Length = 552

 Score = 41.6 bits (96), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 29/81 (35%), Positives = 45/81 (55%), Gaps = 6/81 (7%)

Query: 107 FQDETLFFLFYKHPGTVIQELTYLELRK-RNWRYHKTLKAWLTKDPMMEPIVSADGLSER 165
           F  +TLFF+FY + GT  Q L+  EL K RNW ++K  + W  ++  +E +      SE 
Sbjct: 463 FDLDTLFFIFYHYQGTYDQFLSARELAKNRNWEFNKVDRRWYYRE--VEKLPPGLPQSEE 520

Query: 166 GSYVFFDPQR-W--EKCQRDF 183
            S+ +FD Q+ W   +C  +F
Sbjct: 521 ISWRYFDYQKSWLSRRCNSNF 541

>ADL364C Chr4 complement(66072..67586) [1515 bp, 504 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPR072W
           (NOT5)
          Length = 504

 Score = 40.4 bits (93), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 28/87 (32%), Positives = 44/87 (50%), Gaps = 5/87 (5%)

Query: 102 QRVALFQDETLFFLFYKHPGTVIQELTYLELRKRNWRYHKTLKAWLTKDPMMEPIVSADG 161
           Q +  F  +TLFF+FY + GT  Q L   EL  R W +++  + W  K+  +E +     
Sbjct: 412 QIMTKFDLDTLFFIFYHYQGTYDQFLAARELIIRGWIFNRVNRCWFYKE--VEKLPPGMD 469

Query: 162 LSERGSYVFFDPQR-W--EKCQRDFLL 185
             E  S+ +FD Q+ W   +C  DF+ 
Sbjct: 470 QKEEVSWRYFDYQKSWLARRCGPDFVF 496

>Ecym_3456 Chr3 complement(853907..855433) [1527 bp, 508 aa] {ON}
           similar to Ashbya gossypii ADL364C
          Length = 508

 Score = 40.0 bits (92), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 27/86 (31%), Positives = 44/86 (51%), Gaps = 5/86 (5%)

Query: 102 QRVALFQDETLFFLFYKHPGTVIQELTYLELRKRNWRYHKTLKAWLTKDPMMEPIVSADG 161
           Q +  F  +TLFF+FY + GT  Q L   EL  R W +++  + W  ++  +E +     
Sbjct: 416 QILTKFDLDTLFFIFYHYQGTYEQFLAARELNIRGWLFNRVNRCWFYRE--VEKLPPGME 473

Query: 162 LSERGSYVFFDPQR-W--EKCQRDFL 184
             E  S+ +FD Q+ W   +C  DF+
Sbjct: 474 QKEEVSWRYFDYQKSWLARRCGPDFV 499

>TDEL0C05120 Chr3 (917832..919520) [1689 bp, 562 aa] {ON} Anc_3.370
           YPR072W
          Length = 562

 Score = 38.5 bits (88), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 27/79 (34%), Positives = 42/79 (53%), Gaps = 6/79 (7%)

Query: 110 ETLFFLFYKHPGTVIQELTYLELRK-RNWRYHKTLKAWLTKDPMMEPIVSADGLSERGSY 168
           +TLFF+FY + GT  Q L   EL K R W+++K  + W  K+  +E +      +E  S+
Sbjct: 476 DTLFFIFYHYQGTYDQFLAARELSKNRKWKFNKIDRCWYYKE--VEKLPPGMLQAEEESW 533

Query: 169 VFFDPQ-RW--EKCQRDFL 184
            +FD Q  W   +C  D +
Sbjct: 534 RYFDYQGSWLARRCNNDVV 552

>KLLA0B09196g Chr2 complement(803259..805031) [1773 bp, 590 aa] {ON}
           similar to uniprot|Q12514 Saccharomyces cerevisiae
           YPR072W NOT5 Subunit of global transcriptional regulator
          Length = 590

 Score = 37.4 bits (85), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 22/72 (30%), Positives = 38/72 (52%), Gaps = 2/72 (2%)

Query: 104 VALFQDETLFFLFYKHPGTVIQELTYLELRKRNWRYHKTLKAWLTKDPMMEPIVSADGLS 163
           ++ F  +TLFF+FY + G+  Q L   EL  R W ++K  + W  K+  +E +       
Sbjct: 499 MSKFALDTLFFIFYHYQGSYDQFLASRELSLRGWTFNKVNRCWFHKE--VEKLPPGIEGK 556

Query: 164 ERGSYVFFDPQR 175
           E  ++ +FD Q+
Sbjct: 557 EEVTWRYFDYQK 568

>ZYRO0D16302g Chr4 (1357223..1359712) [2490 bp, 829 aa] {ON} similar
           to uniprot|P06102 Saccharomyces cerevisiae YIL038C NOT3
           Subunit of the CCR4-NOT complex which is a global
           transcriptional regulator with roles in transcription
           initiation and elongation and in mRNA degradation
          Length = 829

 Score = 33.9 bits (76), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 31/115 (26%), Positives = 51/115 (44%), Gaps = 11/115 (9%)

Query: 84  VLQSNVTPPCFNSIQNDQQR----VALFQDETLFFLFYKHPGTVI---QELTYLELRKRN 136
           +L+ ++ P   NS  NDQ++    +  F+   +F LFY +   V    QE+  + L +R+
Sbjct: 678 ILRCSLRPIIQNSELNDQEKYEAILENFRSLEMFTLFYNYYFAVTPLEQEIASIILSERD 737

Query: 137 WRYHKTLKAWLTKDPMMEPIVSADGLSERGSYVFFDPQRWEKCQR-DFLLFYNAI 190
           W+  K    W  +    +    A+ L E   Y  F    W    R +F L Y A+
Sbjct: 738 WKVSKNCAMWFLRQSETK---FANELCEVADYKIFKLDDWTVIDRLNFKLDYAAL 789

>KLTH0A03652g Chr1 (314336..316654) [2319 bp, 772 aa] {ON} some
           similarities with uniprot|P06102 Saccharomyces
           cerevisiae YIL038C NOT3 Subunit of the CCR4-NOT complex
           which is a global transcriptional regulator with roles
           in transcription initiation and elongation and in mRNA
           degradation
          Length = 772

 Score = 33.5 bits (75), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 20/65 (30%), Positives = 32/65 (49%), Gaps = 3/65 (4%)

Query: 112 LFFLFYKHPGTVIQELTYLELRKRNWRYHKTLKAWLTKDPMMEPIVSADGLSERGSYVFF 171
           LF+ FY     + QE+ Y  L +RNW+  KT + W ++  +  P  S + L E   +  F
Sbjct: 667 LFYCFYYSITPLEQEIAYTLLGERNWKVSKTGENWFSRHSL--PKFSNE-LCEVADFKIF 723

Query: 172 DPQRW 176
           +   W
Sbjct: 724 NLDDW 728

>NCAS0A11210 Chr1 (2223815..2225563) [1749 bp, 582 aa] {ON}
           Anc_3.370 YPR072W
          Length = 582

 Score = 31.6 bits (70), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 16/38 (42%), Positives = 23/38 (60%), Gaps = 1/38 (2%)

Query: 110 ETLFFLFYKHPGTVIQELTYLEL-RKRNWRYHKTLKAW 146
           +TLFF+FY + GT  Q L   EL + R+W ++K    W
Sbjct: 483 DTLFFIFYHYQGTYDQFLAARELSQNRHWLFNKVDSCW 520

>Kpol_1070.25 s1070
           complement(58286..59491,59501..59509,59592..60437) [2061
           bp, 686 aa] {ON}
           complement(58286..59491,59501..59509,59592..60437) [2061
           nt, 687 aa]
          Length = 686

 Score = 31.6 bits (70), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 29/103 (28%), Positives = 52/103 (50%), Gaps = 9/103 (8%)

Query: 95  NSIQNDQQRVAL--FQDETLFFLFYKH--PGTVIQ-ELTYLELRKRNWRYHKTLKAWLTK 149
           ++   D+ R+ L  F+   +F LFY +  P T +Q +++ + L +R+W+  K    W  K
Sbjct: 543 DNTNEDKLRLVLERFRPTEIFTLFYHYYFPLTPLQKQISSILLIERDWKLLKNGTMWFLK 602

Query: 150 DPMMEPIVSADGLSERGSYVFFDPQRWEKCQR-DFLLFYNAIM 191
               EP  S +   E G+Y  F    W   ++ +F L +N++M
Sbjct: 603 --QGEPKFSNESF-EVGNYKIFKADDWTVIEKFNFKLDFNSLM 642

>NDAI0I02150 Chr9 (495208..496161) [954 bp, 317 aa] {ON} Anc_5.204
          YLR017W
          Length = 317

 Score = 30.4 bits (67), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 27/60 (45%), Gaps = 3/60 (5%)

Query: 19 ELSSTYDHSMTLGADLSSMLYSLGIPRDSQDHRVLDTFQSPWAETSRSEVEPRFFTPESF 78
          EL S +D S+ LG    + LY L   +      VL   Q+PW  TS      +F   ESF
Sbjct: 5  ELPSVFDGSIDLGIIGGTGLYKLDCLKPIA---VLPPVQTPWGTTSSPITISKFVGNESF 61

>TDEL0H02330 Chr8 complement(391361..393799) [2439 bp, 812 aa] {ON}
           Anc_7.214 YIL038C
          Length = 812

 Score = 29.3 bits (64), Expect = 8.4,   Method: Compositional matrix adjust.
 Identities = 23/81 (28%), Positives = 36/81 (44%), Gaps = 4/81 (4%)

Query: 111 TLFFLFYKHPGTVIQELTYLELRKRNWRYHKTLKAWLTKDPMMEPIVSADGLSERGSYVF 170
           TLF+ +Y     + Q +  L L +RNW+  K+   W  +    EP   A+ + E   Y  
Sbjct: 692 TLFYNYYFAVTPLEQTIASLVLSERNWKVSKSGTLWFLR--QGEPKF-ANEVCEVADYKI 748

Query: 171 FDPQRWEKCQR-DFLLFYNAI 190
           F    W    + +F L Y A+
Sbjct: 749 FKLDDWTVADKPNFKLDYAAL 769

>YIL034C Chr9 complement(289226..290089) [864 bp, 287 aa] {ON}
          CAP2Beta subunit of the capping protein (CP)
          heterodimer (Cap1p and Cap2p) which binds to the barbed
          ends of actin filaments preventing further
          polymerization; localized predominantly to cortical
          actin patches
          Length = 287

 Score = 28.9 bits (63), Expect = 8.9,   Method: Compositional matrix adjust.
 Identities = 18/59 (30%), Positives = 28/59 (47%), Gaps = 10/59 (16%)

Query: 34 LSSMLYSLGIPRDSQD----------HRVLDTFQSPWAETSRSEVEPRFFTPESFTNIP 82
          LSS+   L   +DS D          +R +D+F+SPW+ T   E+ P+      F + P
Sbjct: 40 LSSVDVPLSTQKDSADSNREYLCCDYNRDIDSFRSPWSNTYYPELSPKDLQDSPFPSAP 98

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.321    0.136    0.419 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 21,247,577
Number of extensions: 880149
Number of successful extensions: 2010
Number of sequences better than 10.0: 54
Number of HSP's gapped: 1989
Number of HSP's successfully gapped: 54
Length of query: 191
Length of database: 53,481,399
Length adjustment: 103
Effective length of query: 88
Effective length of database: 41,670,801
Effective search space: 3667030488
Effective search space used: 3667030488
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 62 (28.5 bits)