Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Smik_4.727.348ON1971879141e-127
YDL166C (FAP7)7.348ON1971878651e-119
Suva_4.807.348ON2061878561e-118
Skud_4.917.348ON1941858181e-112
NCAS0A141407.348ON2241837209e-97
NDAI0A019107.348ON2141837172e-96
SAKL0F11330g7.348ON2081847119e-96
KAFR0B008607.348ON2281847094e-95
Kpol_530.337.348ON1951847056e-95
Ecym_47257.348ON2341847043e-94
TDEL0C020007.348ON2131826912e-92
TPHA0F029507.348ON2161806824e-91
Kwal_56.246357.348ON2261866712e-89
KLTH0H01298g7.348ON2141826693e-89
KLLA0D12386g7.348ON2111826623e-88
KNAG0C037707.348ON2231846494e-86
TBLA0E005207.348ON2091826477e-86
ACL150W7.348ON2191846461e-85
CAGL0I03366g7.348ON2121876277e-83
ZYRO0F11660g7.348ON1981826135e-81
Kwal_23.59567.274ON94078664.2
TDEL0E022205.402ON3734119647.8
NDAI0E025908.590ON68583638.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Smik_4.72
         (197 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Smik_4.72 Chr4 complement(140216..140809) [594 bp, 197 aa] {ON} ...   356   e-127
YDL166C Chr4 complement(163449..164042) [594 bp, 197 aa] {ON}  F...   337   e-119
Suva_4.80 Chr4 complement(150992..151612) [621 bp, 206 aa] {ON} ...   334   e-118
Skud_4.91 Chr4 complement(159116..159700) [585 bp, 194 aa] {ON} ...   319   e-112
NCAS0A14140 Chr1 (2779202..2779876) [675 bp, 224 aa] {ON} Anc_7....   281   9e-97
NDAI0A01910 Chr1 complement(428746..429390) [645 bp, 214 aa] {ON...   280   2e-96
SAKL0F11330g Chr6 (882784..883410) [627 bp, 208 aa] {ON} similar...   278   9e-96
KAFR0B00860 Chr2 (161692..162378) [687 bp, 228 aa] {ON} Anc_7.34...   277   4e-95
Kpol_530.33 s530 complement(81184..81771) [588 bp, 195 aa] {ON} ...   276   6e-95
Ecym_4725 Chr4 complement(1419236..1419940) [705 bp, 234 aa] {ON...   275   3e-94
TDEL0C02000 Chr3 complement(347930..348571) [642 bp, 213 aa] {ON...   270   2e-92
TPHA0F02950 Chr6 (649875..650525) [651 bp, 216 aa] {ON} Anc_7.34...   267   4e-91
Kwal_56.24635 s56 (1083026..1083706) [681 bp, 226 aa] {ON} YDL16...   263   2e-89
KLTH0H01298g Chr8 complement(124206..124850) [645 bp, 214 aa] {O...   262   3e-89
KLLA0D12386g Chr4 complement(1054141..1054776) [636 bp, 211 aa] ...   259   3e-88
KNAG0C03770 Chr3 (742558..743229) [672 bp, 223 aa] {ON} Anc_7.34...   254   4e-86
TBLA0E00520 Chr5 (95049..95678) [630 bp, 209 aa] {ON} Anc_7.348 ...   253   7e-86
ACL150W Chr3 (87745..88404) [660 bp, 219 aa] {ON} Syntenic homol...   253   1e-85
CAGL0I03366g Chr9 complement(287811..288449) [639 bp, 212 aa] {O...   246   7e-83
ZYRO0F11660g Chr6 (955635..956231) [597 bp, 198 aa] {ON} similar...   240   5e-81
Kwal_23.5956 s23 (1388218..1391040) [2823 bp, 940 aa] {ON} YIL07...    30   4.2  
TDEL0E02220 Chr5 complement(415477..426681) [11205 bp, 3734 aa] ...    29   7.8  
NDAI0E02590 Chr5 complement(537501..539558) [2058 bp, 685 aa] {O...    29   8.9  

>Smik_4.72 Chr4 complement(140216..140809) [594 bp, 197 aa] {ON}
           YDL166C (REAL)
          Length = 197

 Score =  356 bits (914), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 174/187 (93%), Positives = 174/187 (93%)

Query: 1   MESRRYGPNIIVTGTPGCGKSSMCEXXXXXXXXXXXXXISDFAKDHDCFEGYDEGRKSHI 60
           MESRRYGPNIIVTGTPGCGKSSMCE             ISDFAKDHDCFEGYDEGRKSHI
Sbjct: 1   MESRRYGPNIIVTGTPGCGKSSMCELLKNKLKDYKYYNISDFAKDHDCFEGYDEGRKSHI 60

Query: 61  VDEDKLLDVLEPLLRQGNSIVDWHVNDIFPERLIDLVVVLRCDNSYLYSRLHARGYHDSK 120
           VDEDKLLDVLEPLLRQGNSIVDWHVNDIFPERLIDLVVVLRCDNSYLYSRLHARGYHDSK
Sbjct: 61  VDEDKLLDVLEPLLRQGNSIVDWHVNDIFPERLIDLVVVLRCDNSYLYSRLHARGYHDSK 120

Query: 121 IEENLDAEIMGVVKQDAVESYEPHIVVELQSDTKEDMESNVSRIITWEKMWLEQHPEGVT 180
           IEENLDAEIMGVVKQDAVESYEPHIVVELQSDTKEDMESNVSRIITWEKMWLEQHPEGVT
Sbjct: 121 IEENLDAEIMGVVKQDAVESYEPHIVVELQSDTKEDMESNVSRIITWEKMWLEQHPEGVT 180

Query: 181 NEYQGSR 187
           NEYQGSR
Sbjct: 181 NEYQGSR 187

>YDL166C Chr4 complement(163449..164042) [594 bp, 197 aa] {ON}
           FAP7Essential NTPase required for small ribosome subunit
           synthesis, mediates processing of the 20S pre-rRNA at
           site D in the cytoplasm but associates only transiently
           with 43S preribosomes via Rps14p, may be the
           endonuclease for site D
          Length = 197

 Score =  337 bits (865), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 163/187 (87%), Positives = 169/187 (90%)

Query: 1   MESRRYGPNIIVTGTPGCGKSSMCEXXXXXXXXXXXXXISDFAKDHDCFEGYDEGRKSHI 60
           ME+RRYGPNIIVTGTPGCGKSS CE             ISDFAKD+DCFEGYDEGRKSHI
Sbjct: 1   MEARRYGPNIIVTGTPGCGKSSTCEFLKNKLKDYKYYNISDFAKDNDCFEGYDEGRKSHI 60

Query: 61  VDEDKLLDVLEPLLRQGNSIVDWHVNDIFPERLIDLVVVLRCDNSYLYSRLHARGYHDSK 120
           VDEDKLLD+LEPLLRQGNSIVDWHVND+FPERLIDLVVVLRCDNS LYSRLHARGYHDSK
Sbjct: 61  VDEDKLLDMLEPLLRQGNSIVDWHVNDVFPERLIDLVVVLRCDNSNLYSRLHARGYHDSK 120

Query: 121 IEENLDAEIMGVVKQDAVESYEPHIVVELQSDTKEDMESNVSRIITWEKMWLEQHPEGVT 180
           IEENLDAEIMGVVKQDAVESYEPHIVVELQSDTKEDM SNVSRI+ WEKMWLEQHP+GVT
Sbjct: 121 IEENLDAEIMGVVKQDAVESYEPHIVVELQSDTKEDMVSNVSRIVAWEKMWLEQHPDGVT 180

Query: 181 NEYQGSR 187
           NEYQG R
Sbjct: 181 NEYQGPR 187

>Suva_4.80 Chr4 complement(150992..151612) [621 bp, 206 aa] {ON}
           YDL166C (REAL)
          Length = 206

 Score =  334 bits (856), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 160/187 (85%), Positives = 168/187 (89%)

Query: 1   MESRRYGPNIIVTGTPGCGKSSMCEXXXXXXXXXXXXXISDFAKDHDCFEGYDEGRKSHI 60
           MESRRYGPNIIVTGTPGCGKSS CE             ISDFAKD+DCFEGYDEGRKSHI
Sbjct: 1   MESRRYGPNIIVTGTPGCGKSSTCELLKDELKGYKYYNISDFAKDNDCFEGYDEGRKSHI 60

Query: 61  VDEDKLLDVLEPLLRQGNSIVDWHVNDIFPERLIDLVVVLRCDNSYLYSRLHARGYHDSK 120
           VDEDKLLD LEPL+RQGNSI+DWHVND+FPERLIDLVVVLRCDNS LYSRLHARGYHDSK
Sbjct: 61  VDEDKLLDTLEPLMRQGNSIIDWHVNDVFPERLIDLVVVLRCDNSKLYSRLHARGYHDSK 120

Query: 121 IEENLDAEIMGVVKQDAVESYEPHIVVELQSDTKEDMESNVSRIITWEKMWLEQHPEGVT 180
           IEENLDAEIMGVVKQDAV+SYEPHIVVELQSDTK+D+ SNV+RII WEKMWLEQHPEGVT
Sbjct: 121 IEENLDAEIMGVVKQDAVDSYEPHIVVELQSDTKQDIVSNVARIIAWEKMWLEQHPEGVT 180

Query: 181 NEYQGSR 187
           NEYQG R
Sbjct: 181 NEYQGGR 187

>Skud_4.91 Chr4 complement(159116..159700) [585 bp, 194 aa] {ON}
           YDL166C (REAL)
          Length = 194

 Score =  319 bits (818), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 154/185 (83%), Positives = 162/185 (87%)

Query: 1   MESRRYGPNIIVTGTPGCGKSSMCEXXXXXXXXXXXXXISDFAKDHDCFEGYDEGRKSHI 60
           ME RR+GPNIIVTGTPGCGKSS CE             ISDFAKD+DCFE YDE RKSHI
Sbjct: 1   MELRRFGPNIIVTGTPGCGKSSTCELLKDELKGYKYYNISDFAKDNDCFEAYDEARKSHI 60

Query: 61  VDEDKLLDVLEPLLRQGNSIVDWHVNDIFPERLIDLVVVLRCDNSYLYSRLHARGYHDSK 120
           VDEDKLLD LEPLLRQGNSI+DWHVND+FPERLIDLVVVLRCDNS LYSRLHARGYHDSK
Sbjct: 61  VDEDKLLDKLEPLLRQGNSIIDWHVNDVFPERLIDLVVVLRCDNSNLYSRLHARGYHDSK 120

Query: 121 IEENLDAEIMGVVKQDAVESYEPHIVVELQSDTKEDMESNVSRIITWEKMWLEQHPEGVT 180
           IEENLDAEIMGVVKQDAV+SYEPHIVVELQ DTKEDM SNV+RI+ WEKMWLEQH +GVT
Sbjct: 121 IEENLDAEIMGVVKQDAVDSYEPHIVVELQGDTKEDMVSNVARIVAWEKMWLEQHSDGVT 180

Query: 181 NEYQG 185
           NEYQG
Sbjct: 181 NEYQG 185

>NCAS0A14140 Chr1 (2779202..2779876) [675 bp, 224 aa] {ON} Anc_7.348
           YDL166C
          Length = 224

 Score =  281 bits (720), Expect = 9e-97,   Method: Compositional matrix adjust.
 Identities = 131/183 (71%), Positives = 151/183 (82%)

Query: 2   ESRRYGPNIIVTGTPGCGKSSMCEXXXXXXXXXXXXXISDFAKDHDCFEGYDEGRKSHIV 61
           +SRRY PN+++TGTPGCGKS+ CE             ISDFAK+HDC++GYD+GRKSHIV
Sbjct: 3   KSRRYQPNLLITGTPGCGKSTTCELLQRRLPEYKYYNISDFAKEHDCYDGYDKGRKSHIV 62

Query: 62  DEDKLLDVLEPLLRQGNSIVDWHVNDIFPERLIDLVVVLRCDNSYLYSRLHARGYHDSKI 121
           DEDKLLD LEPLLRQG SI+DWHVND+FPERLIDLV VLRCDNS LY RLH R YHD+KI
Sbjct: 63  DEDKLLDELEPLLRQGKSIIDWHVNDVFPERLIDLVAVLRCDNSVLYDRLHGRKYHDTKI 122

Query: 122 EENLDAEIMGVVKQDAVESYEPHIVVELQSDTKEDMESNVSRIITWEKMWLEQHPEGVTN 181
           EEN+DAEIMGVV QDA+ESY   IVVELQSDT E M++NV RI+ W+KMWLEQH +GVTN
Sbjct: 123 EENMDAEIMGVVLQDALESYAKEIVVELQSDTTEQMDANVDRIVDWQKMWLEQHEDGVTN 182

Query: 182 EYQ 184
           E +
Sbjct: 183 ELE 185

>NDAI0A01910 Chr1 complement(428746..429390) [645 bp, 214 aa] {ON}
           Anc_7.348 YDL166C
          Length = 214

 Score =  280 bits (717), Expect = 2e-96,   Method: Compositional matrix adjust.
 Identities = 134/183 (73%), Positives = 150/183 (81%)

Query: 3   SRRYGPNIIVTGTPGCGKSSMCEXXXXXXXXXXXXXISDFAKDHDCFEGYDEGRKSHIVD 62
           SRRY PN+++TGTPG GKS+ CE             ISDFAK++DC+EGYD+GRKSHIVD
Sbjct: 6   SRRYEPNLLITGTPGSGKSTTCELLQRRLPEYAYYNISDFAKENDCYEGYDKGRKSHIVD 65

Query: 63  EDKLLDVLEPLLRQGNSIVDWHVNDIFPERLIDLVVVLRCDNSYLYSRLHARGYHDSKIE 122
           EDKLLD LEPLLR+G SIVDWHVNDIFPERLIDLVVVLRCDNS LY RL+ RGYHDSKI+
Sbjct: 66  EDKLLDELEPLLRKGKSIVDWHVNDIFPERLIDLVVVLRCDNSILYDRLNKRGYHDSKIQ 125

Query: 123 ENLDAEIMGVVKQDAVESYEPHIVVELQSDTKEDMESNVSRIITWEKMWLEQHPEGVTNE 182
           ENLDAEIMGVV QDAVESY+  IVVELQSD  E ME+NV RI+ W KMW++QH  GVTNE
Sbjct: 126 ENLDAEIMGVVLQDAVESYQQEIVVELQSDDTEQMEANVERIVEWHKMWMDQHKNGVTNE 185

Query: 183 YQG 185
            QG
Sbjct: 186 LQG 188

>SAKL0F11330g Chr6 (882784..883410) [627 bp, 208 aa] {ON} similar to
           uniprot|Q12055 Saccharomyces cerevisiae YDL166C FAP7
           Essential nuclear protein involved in the oxidative
           stress response
          Length = 208

 Score =  278 bits (711), Expect = 9e-96,   Method: Compositional matrix adjust.
 Identities = 133/184 (72%), Positives = 149/184 (80%)

Query: 1   MESRRYGPNIIVTGTPGCGKSSMCEXXXXXXXXXXXXXISDFAKDHDCFEGYDEGRKSHI 60
           ME++R  PNI+VTGTPGCGKS+ CE             ISDFA++H C++GYDE RKSHI
Sbjct: 1   METKRSRPNILVTGTPGCGKSTTCELLVRRLSDYTYYNISDFAREHKCYDGYDEVRKSHI 60

Query: 61  VDEDKLLDVLEPLLRQGNSIVDWHVNDIFPERLIDLVVVLRCDNSYLYSRLHARGYHDSK 120
           VDEDKLLD LEPLLR+G SIVDWHVND+FPERLIDLVVVLRCDNS LY RLH RGYHDSK
Sbjct: 61  VDEDKLLDELEPLLRKGKSIVDWHVNDVFPERLIDLVVVLRCDNSILYDRLHKRGYHDSK 120

Query: 121 IEENLDAEIMGVVKQDAVESYEPHIVVELQSDTKEDMESNVSRIITWEKMWLEQHPEGVT 180
           IEENLDAEIMGVV QDA ESY   IVVELQSDT E M++NV RI+ W++MWL QHP GVT
Sbjct: 121 IEENLDAEIMGVVMQDAAESYAQEIVVELQSDTVEHMDANVDRIVEWQEMWLNQHPNGVT 180

Query: 181 NEYQ 184
           NE +
Sbjct: 181 NELE 184

>KAFR0B00860 Chr2 (161692..162378) [687 bp, 228 aa] {ON} Anc_7.348
           YDL166C
          Length = 228

 Score =  277 bits (709), Expect = 4e-95,   Method: Compositional matrix adjust.
 Identities = 128/184 (69%), Positives = 152/184 (82%)

Query: 2   ESRRYGPNIIVTGTPGCGKSSMCEXXXXXXXXXXXXXISDFAKDHDCFEGYDEGRKSHIV 61
           ESRRY PN++VTGTPGCGKS+ CE             IS+FA+ H C++GYDE RKSHIV
Sbjct: 7   ESRRYSPNLLVTGTPGCGKSTTCELLMRRLPDYTYFNISEFAEKHKCYDGYDESRKSHIV 66

Query: 62  DEDKLLDVLEPLLRQGNSIVDWHVNDIFPERLIDLVVVLRCDNSYLYSRLHARGYHDSKI 121
           D+DKLLD LEPLLR+G SI+DWHVND+FPERLIDLVVVLRCDNS L+ RLH RGYH+SKI
Sbjct: 67  DDDKLLDELEPLLRRGKSIIDWHVNDVFPERLIDLVVVLRCDNSILFDRLHGRGYHESKI 126

Query: 122 EENLDAEIMGVVKQDAVESYEPHIVVELQSDTKEDMESNVSRIITWEKMWLEQHPEGVTN 181
           +ENLDAEIMGVV QDA++SYE  IVVELQS++ E+M++NV RI+ W++MWL QH  GVTN
Sbjct: 127 QENLDAEIMGVVLQDALDSYEQEIVVELQSNSTEEMDANVERIVAWQEMWLTQHKNGVTN 186

Query: 182 EYQG 185
           EYQG
Sbjct: 187 EYQG 190

>Kpol_530.33 s530 complement(81184..81771) [588 bp, 195 aa] {ON}
           complement(81184..81771) [588 nt, 196 aa]
          Length = 195

 Score =  276 bits (705), Expect = 6e-95,   Method: Compositional matrix adjust.
 Identities = 133/184 (72%), Positives = 149/184 (80%)

Query: 1   MESRRYGPNIIVTGTPGCGKSSMCEXXXXXXXXXXXXXISDFAKDHDCFEGYDEGRKSHI 60
           M SRR  PN+++TGTPGCGKS+ CE             ISDFAK+HDC+EGYDE RKSHI
Sbjct: 1   MLSRRLKPNLLITGTPGCGKSTSCELLQRRLSDYKYYNISDFAKEHDCYEGYDEDRKSHI 60

Query: 61  VDEDKLLDVLEPLLRQGNSIVDWHVNDIFPERLIDLVVVLRCDNSYLYSRLHARGYHDSK 120
           VDEDKLLD LEPLLR+G SIVDWHVND+FPERLIDLVVVLRCDNS LY RLHAR YHDSK
Sbjct: 61  VDEDKLLDELEPLLREGGSIVDWHVNDVFPERLIDLVVVLRCDNSILYDRLHARKYHDSK 120

Query: 121 IEENLDAEIMGVVKQDAVESYEPHIVVELQSDTKEDMESNVSRIITWEKMWLEQHPEGVT 180
           I+ENLDAEIMGVV QDA ESY   IVVELQSDT E ME+NV RI+ W ++WL+QH +GVT
Sbjct: 121 IQENLDAEIMGVVLQDAQESYAEEIVVELQSDTTEQMEANVDRIVDWVELWLKQHKKGVT 180

Query: 181 NEYQ 184
           NE +
Sbjct: 181 NELE 184

>Ecym_4725 Chr4 complement(1419236..1419940) [705 bp, 234 aa] {ON}
           similar to Ashbya gossypii ACL150W
          Length = 234

 Score =  275 bits (704), Expect = 3e-94,   Method: Compositional matrix adjust.
 Identities = 131/184 (71%), Positives = 147/184 (79%)

Query: 1   MESRRYGPNIIVTGTPGCGKSSMCEXXXXXXXXXXXXXISDFAKDHDCFEGYDEGRKSHI 60
           M+S R  PNIIVTGTPGCGK++ CE             ISDFAK+HDC+EGYDEGRKSHI
Sbjct: 15  MDSTRLRPNIIVTGTPGCGKTTTCELLQRRLDDCRYYNISDFAKEHDCYEGYDEGRKSHI 74

Query: 61  VDEDKLLDVLEPLLRQGNSIVDWHVNDIFPERLIDLVVVLRCDNSYLYSRLHARGYHDSK 120
           VDEDKLLD LEPLLR+G +I+DWHVND+FPERLIDLVVVLRCDNS LY RLH RGYHD+K
Sbjct: 75  VDEDKLLDELEPLLRKGGAIIDWHVNDVFPERLIDLVVVLRCDNSTLYDRLHKRGYHDAK 134

Query: 121 IEENLDAEIMGVVKQDAVESYEPHIVVELQSDTKEDMESNVSRIITWEKMWLEQHPEGVT 180
           IEEN+DAEIMGVV QDA++SY   IVVELQS+T   ME NV RI+ WE  W+ QHP GVT
Sbjct: 135 IEENIDAEIMGVVLQDAMDSYVHDIVVELQSNTANQMEENVGRIVAWESSWVSQHPTGVT 194

Query: 181 NEYQ 184
           NE Q
Sbjct: 195 NELQ 198

>TDEL0C02000 Chr3 complement(347930..348571) [642 bp, 213 aa] {ON}
           Anc_7.348 YDL166C
          Length = 213

 Score =  270 bits (691), Expect = 2e-92,   Method: Compositional matrix adjust.
 Identities = 126/182 (69%), Positives = 149/182 (81%)

Query: 1   MESRRYGPNIIVTGTPGCGKSSMCEXXXXXXXXXXXXXISDFAKDHDCFEGYDEGRKSHI 60
           ME RR+ PN+++TGTPGCGKS+ CE             ISDFAK+HDC +GYDE RKS+I
Sbjct: 1   MEPRRFKPNLLITGTPGCGKSTTCELLQRRLPDYKYYNISDFAKEHDCHDGYDEARKSYI 60

Query: 61  VDEDKLLDVLEPLLRQGNSIVDWHVNDIFPERLIDLVVVLRCDNSYLYSRLHARGYHDSK 120
           VDEDKLLD LEPLLR+G +IVDWHVND+FPERLIDLVVVLRCDN+ LY RL +R YHD+K
Sbjct: 61  VDEDKLLDELEPLLREGAAIVDWHVNDVFPERLIDLVVVLRCDNTILYDRLKSRDYHDAK 120

Query: 121 IEENLDAEIMGVVKQDAVESYEPHIVVELQSDTKEDMESNVSRIITWEKMWLEQHPEGVT 180
           I+ENLDAEIMGVV QDA +SYE  IVVELQSD+ E ME+NV RI++WEK+WL+QH +G T
Sbjct: 121 IQENLDAEIMGVVLQDATDSYEQEIVVELQSDSTEQMEANVDRIVSWEKLWLKQHKDGQT 180

Query: 181 NE 182
           NE
Sbjct: 181 NE 182

>TPHA0F02950 Chr6 (649875..650525) [651 bp, 216 aa] {ON} Anc_7.348
           YDL166C
          Length = 216

 Score =  267 bits (682), Expect = 4e-91,   Method: Compositional matrix adjust.
 Identities = 125/180 (69%), Positives = 146/180 (81%)

Query: 3   SRRYGPNIIVTGTPGCGKSSMCEXXXXXXXXXXXXXISDFAKDHDCFEGYDEGRKSHIVD 62
           SRRY PN+++TGTPGCGKS+ CE             ISDFAK+H+C++G+DEGRKSHIVD
Sbjct: 2   SRRYQPNLLITGTPGCGKSTTCELLQRRLSDYTYYNISDFAKEHNCYDGFDEGRKSHIVD 61

Query: 63  EDKLLDVLEPLLRQGNSIVDWHVNDIFPERLIDLVVVLRCDNSYLYSRLHARGYHDSKIE 122
           EDKLLD LEPLLR+G  IVDWHVND+FPERLIDLVVVLRCDNS LY RL +RGYHDSKI+
Sbjct: 62  EDKLLDELEPLLRKGKCIVDWHVNDVFPERLIDLVVVLRCDNSVLYDRLKSRGYHDSKID 121

Query: 123 ENLDAEIMGVVKQDAVESYEPHIVVELQSDTKEDMESNVSRIITWEKMWLEQHPEGVTNE 182
           EN+DAEIMGVV QDA ESY   IVVELQSDT E M+ NV +I+ W ++W++QH  GVTNE
Sbjct: 122 ENMDAEIMGVVLQDAQESYAQEIVVELQSDTTEQMDENVDKIVDWVELWIKQHKNGVTNE 181

>Kwal_56.24635 s56 (1083026..1083706) [681 bp, 226 aa] {ON} YDL166C
           (FAP7) - Nuclear protein involved in oxidative stress
           response [contig 161] FULL
          Length = 226

 Score =  263 bits (671), Expect = 2e-89,   Method: Compositional matrix adjust.
 Identities = 125/186 (67%), Positives = 142/186 (76%)

Query: 1   MESRRYGPNIIVTGTPGCGKSSMCEXXXXXXXXXXXXXISDFAKDHDCFEGYDEGRKSHI 60
           M S R  PNI+VTGTPGCGK+S CE             ISDFAK++ C++GYDE RKSHI
Sbjct: 1   MASTRTSPNILVTGTPGCGKTSTCELLQRRLEGSKYYNISDFAKEYKCYDGYDEARKSHI 60

Query: 61  VDEDKLLDVLEPLLRQGNSIVDWHVNDIFPERLIDLVVVLRCDNSYLYSRLHARGYHDSK 120
           VDEDKLLD LEPLLR G +IVDWHVND+FPERLIDLVVVLR DNS L+ RL  RGYH++K
Sbjct: 61  VDEDKLLDELEPLLRAGGAIVDWHVNDVFPERLIDLVVVLRTDNSALFDRLSKRGYHEAK 120

Query: 121 IEENLDAEIMGVVKQDAVESYEPHIVVELQSDTKEDMESNVSRIITWEKMWLEQHPEGVT 180
           I+EN+DAEIMGVV  DA +SY   IVVELQSDT E M+ NV RI+TW   W EQHPEGVT
Sbjct: 121 IQENIDAEIMGVVMHDARDSYAQEIVVELQSDTTEQMDENVDRIVTWRDAWREQHPEGVT 180

Query: 181 NEYQGS 186
           NE  G+
Sbjct: 181 NELNGA 186

>KLTH0H01298g Chr8 complement(124206..124850) [645 bp, 214 aa] {ON}
           similar to uniprot|Q12055 Saccharomyces cerevisiae
           YDL166C FAP7 Essential nuclear protein involved in the
           oxidative stress response
          Length = 214

 Score =  262 bits (669), Expect = 3e-89,   Method: Compositional matrix adjust.
 Identities = 122/182 (67%), Positives = 145/182 (79%)

Query: 1   MESRRYGPNIIVTGTPGCGKSSMCEXXXXXXXXXXXXXISDFAKDHDCFEGYDEGRKSHI 60
           M S R+ PNI+VTGTPGCGK+S CE             ISDFA+ H+C++GYDE RKSHI
Sbjct: 1   MLSTRFAPNILVTGTPGCGKTSTCELLQRRLKDANYYNISDFAQQHECYDGYDEARKSHI 60

Query: 61  VDEDKLLDVLEPLLRQGNSIVDWHVNDIFPERLIDLVVVLRCDNSYLYSRLHARGYHDSK 120
           VDED+LLD LEPL+R+G +IVDWHVNDIFPERLIDLVVVLR DN+ LY RL +RGYH++K
Sbjct: 61  VDEDRLLDELEPLMRKGGAIVDWHVNDIFPERLIDLVVVLRTDNTVLYDRLKSRGYHEAK 120

Query: 121 IEENLDAEIMGVVKQDAVESYEPHIVVELQSDTKEDMESNVSRIITWEKMWLEQHPEGVT 180
           I+EN+DAEIMGVV QDA +SYE  IVVELQSDT + M+ NV RI +W   WLEQ+P+GVT
Sbjct: 121 IQENIDAEIMGVVIQDAQDSYEKEIVVELQSDTADQMDENVDRIASWSAAWLEQNPKGVT 180

Query: 181 NE 182
           NE
Sbjct: 181 NE 182

>KLLA0D12386g Chr4 complement(1054141..1054776) [636 bp, 211 aa]
           {ON} similar to uniprot|Q12055 Saccharomyces cerevisiae
           YDL166C FAP7 Essential nuclear protein involved in the
           oxidative stress response
          Length = 211

 Score =  259 bits (662), Expect = 3e-88,   Method: Compositional matrix adjust.
 Identities = 122/182 (67%), Positives = 147/182 (80%)

Query: 1   MESRRYGPNIIVTGTPGCGKSSMCEXXXXXXXXXXXXXISDFAKDHDCFEGYDEGRKSHI 60
           ME  R+ PNIIV+GTPGCGKS+ CE             ISDFAK+HDC++GYD+ RKS+I
Sbjct: 1   MEPVRFKPNIIVSGTPGCGKSTTCELLSRRLPEYTYYNISDFAKEHDCYDGYDDARKSNI 60

Query: 61  VDEDKLLDVLEPLLRQGNSIVDWHVNDIFPERLIDLVVVLRCDNSYLYSRLHARGYHDSK 120
           VD+DKLLD LEPLLR+G  I+DWHVND+FPERL+DLVVVLRCDN  LY RL+ RGYH++K
Sbjct: 61  VDDDKLLDELEPLLRKGGCIIDWHVNDVFPERLVDLVVVLRCDNGILYDRLNKRGYHNAK 120

Query: 121 IEENLDAEIMGVVKQDAVESYEPHIVVELQSDTKEDMESNVSRIITWEKMWLEQHPEGVT 180
           IEEN+DAEIMGVV QDA +SY   IVVELQSDT E+M+ NV RII W+++WL+QH +GVT
Sbjct: 121 IEENMDAEIMGVVLQDAHDSYAQEIVVELQSDTTEEMDKNVDRIIAWQEIWLKQHKKGVT 180

Query: 181 NE 182
           NE
Sbjct: 181 NE 182

>KNAG0C03770 Chr3 (742558..743229) [672 bp, 223 aa] {ON} Anc_7.348
           YDL166C
          Length = 223

 Score =  254 bits (649), Expect = 4e-86,   Method: Compositional matrix adjust.
 Identities = 121/184 (65%), Positives = 139/184 (75%)

Query: 2   ESRRYGPNIIVTGTPGCGKSSMCEXXXXXXXXXXXXXISDFAKDHDCFEGYDEGRKSHIV 61
           ESRR  PNI+VTGTPG GKS+ CE             ISDFA  + C++GYDE RKSHIV
Sbjct: 3   ESRRLNPNILVTGTPGTGKSTTCELLLRNLPDYTYYNISDFAAKNKCYDGYDEARKSHIV 62

Query: 62  DEDKLLDVLEPLLRQGNSIVDWHVNDIFPERLIDLVVVLRCDNSYLYSRLHARGYHDSKI 121
           DEDKLLD LEPLL  G +I+DWHVND+FPERLIDLV VLRCD+S L+ RL+ R YH SKI
Sbjct: 63  DEDKLLDELEPLLHSGGNIIDWHVNDVFPERLIDLVAVLRCDSSVLFDRLNKREYHSSKI 122

Query: 122 EENLDAEIMGVVKQDAVESYEPHIVVELQSDTKEDMESNVSRIITWEKMWLEQHPEGVTN 181
           +EN+DAEIMGVV QDA++SYE  IVVELQSD  E M +NV R++TW  MW EQHPEGVTN
Sbjct: 123 DENMDAEIMGVVLQDALDSYEEQIVVELQSDDTEQMAANVDRVVTWTTMWKEQHPEGVTN 182

Query: 182 EYQG 185
           E   
Sbjct: 183 ELSA 186

>TBLA0E00520 Chr5 (95049..95678) [630 bp, 209 aa] {ON} Anc_7.348
           YDL166C
          Length = 209

 Score =  253 bits (647), Expect = 7e-86,   Method: Compositional matrix adjust.
 Identities = 116/182 (63%), Positives = 147/182 (80%)

Query: 1   MESRRYGPNIIVTGTPGCGKSSMCEXXXXXXXXXXXXXISDFAKDHDCFEGYDEGRKSHI 60
           M+SRRY PN++++GTPG GKSS CE             ISDFAK+ +C++G+D+GRKSHI
Sbjct: 1   MKSRRYLPNLLISGTPGTGKSSTCELLKRELEDYKYINISDFAKEFNCYDGFDKGRKSHI 60

Query: 61  VDEDKLLDVLEPLLRQGNSIVDWHVNDIFPERLIDLVVVLRCDNSYLYSRLHARGYHDSK 120
           VDEDKLLD LEP+LR+G++IVDWHVND+FPERLIDLVV+LR DNS LY RL  R YHD+K
Sbjct: 61  VDEDKLLDELEPILREGHNIVDWHVNDVFPERLIDLVVILRADNSVLYDRLQNRKYHDAK 120

Query: 121 IEENLDAEIMGVVKQDAVESYEPHIVVELQSDTKEDMESNVSRIITWEKMWLEQHPEGVT 180
           ++ENLDAEIMGVV QDA++SY   IV+ELQS+  E+M SNV RI++W ++W +QH +GVT
Sbjct: 121 VQENLDAEIMGVVLQDAIDSYAQEIVIELQSNNTEEMTSNVDRIVSWVELWKKQHADGVT 180

Query: 181 NE 182
           NE
Sbjct: 181 NE 182

>ACL150W Chr3 (87745..88404) [660 bp, 219 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YDL166C (FAP7)
          Length = 219

 Score =  253 bits (646), Expect = 1e-85,   Method: Compositional matrix adjust.
 Identities = 120/184 (65%), Positives = 142/184 (77%)

Query: 1   MESRRYGPNIIVTGTPGCGKSSMCEXXXXXXXXXXXXXISDFAKDHDCFEGYDEGRKSHI 60
           M+  R  PNI+V+GTPGCGKS+ CE             ISDFA++H+C++GYDE RKSHI
Sbjct: 1   MQQTRCRPNILVSGTPGCGKSTTCELLQRHLPDYQYFNISDFAREHNCYDGYDEARKSHI 60

Query: 61  VDEDKLLDVLEPLLRQGNSIVDWHVNDIFPERLIDLVVVLRCDNSYLYSRLHARGYHDSK 120
           VDED+LLD LEPLLR+G +IVDWHVNDIFPERLIDLVVVLRCDN+ L+ RL  RGYH SK
Sbjct: 61  VDEDRLLDELEPLLRRGGAIVDWHVNDIFPERLIDLVVVLRCDNAILHDRLQKRGYHSSK 120

Query: 121 IEENLDAEIMGVVKQDAVESYEPHIVVELQSDTKEDMESNVSRIITWEKMWLEQHPEGVT 180
           IEEN+DAEIMGVV QDA++SY   IVVELQSD  E M+ NV RI  WE  W+ +HP+GV+
Sbjct: 121 IEENIDAEIMGVVLQDALDSYVREIVVELQSDDTEQMQQNVDRIAAWEANWVSEHPDGVS 180

Query: 181 NEYQ 184
           N  Q
Sbjct: 181 NALQ 184

>CAGL0I03366g Chr9 complement(287811..288449) [639 bp, 212 aa] {ON}
           highly similar to uniprot|Q12055 Saccharomyces
           cerevisiae YDL166c
          Length = 212

 Score =  246 bits (627), Expect = 7e-83,   Method: Compositional matrix adjust.
 Identities = 129/187 (68%), Positives = 149/187 (79%)

Query: 1   MESRRYGPNIIVTGTPGCGKSSMCEXXXXXXXXXXXXXISDFAKDHDCFEGYDEGRKSHI 60
           M SRR+ PNIIVTGTPGCGKS+ CE             IS+FA++H C++GYDEGRKSHI
Sbjct: 1   MGSRRFHPNIIVTGTPGCGKSTTCELLQRRLDGYKYYNISEFAEEHKCYDGYDEGRKSHI 60

Query: 61  VDEDKLLDVLEPLLRQGNSIVDWHVNDIFPERLIDLVVVLRCDNSYLYSRLHARGYHDSK 120
           VDEDKLLD LEPLL +G SI+DWHVND+FPERLIDLVVVLR +N  LY RL ARGYHDSK
Sbjct: 61  VDEDKLLDELEPLLLEGKSIIDWHVNDVFPERLIDLVVVLRSENGKLYDRLKARGYHDSK 120

Query: 121 IEENLDAEIMGVVKQDAVESYEPHIVVELQSDTKEDMESNVSRIITWEKMWLEQHPEGVT 180
           IEENLDAEIMGVV QDA ESYEP IVVELQS+T EDME+NV RI TW   W+E+H +GV+
Sbjct: 121 IEENLDAEIMGVVLQDAQESYEPEIVVELQSNTTEDMENNVDRINTWVDNWVEEHKDGVS 180

Query: 181 NEYQGSR 187
           +E +  +
Sbjct: 181 SELKDGK 187

>ZYRO0F11660g Chr6 (955635..956231) [597 bp, 198 aa] {ON} similar to
           uniprot|Q12055 Saccharomyces cerevisiae YDL166C FAP7
           Essential nuclear protein involved in the oxidative
           stress response
          Length = 198

 Score =  240 bits (613), Expect = 5e-81,   Method: Compositional matrix adjust.
 Identities = 121/182 (66%), Positives = 148/182 (81%)

Query: 1   MESRRYGPNIIVTGTPGCGKSSMCEXXXXXXXXXXXXXISDFAKDHDCFEGYDEGRKSHI 60
           MESRRY PN+++TGTPG GKS+  E             ISDFA+++DCF+GYDEGRKSHI
Sbjct: 1   MESRRYHPNVLITGTPGSGKSTTSELLQRRLSDFQYYNISDFAQENDCFDGYDEGRKSHI 60

Query: 61  VDEDKLLDVLEPLLRQGNSIVDWHVNDIFPERLIDLVVVLRCDNSYLYSRLHARGYHDSK 120
           VDEDKLLD+LEPLLR+G +I+DWHVND+FPERLIDLVVVLRC+NS L+ RL  RGYH +K
Sbjct: 61  VDEDKLLDLLEPLLRKGGNIIDWHVNDVFPERLIDLVVVLRCENSILFKRLKKRGYHQTK 120

Query: 121 IEENLDAEIMGVVKQDAVESYEPHIVVELQSDTKEDMESNVSRIITWEKMWLEQHPEGVT 180
           I+EN+DAEIMGVV QDA++SYE  IVVEL SD+ E ME+NV RI++W ++W +QH  GVT
Sbjct: 121 IDENIDAEIMGVVMQDALDSYEKEIVVELTSDSTEQMENNVDRIVSWVELWQDQHHSGVT 180

Query: 181 NE 182
           NE
Sbjct: 181 NE 182

>Kwal_23.5956 s23 (1388218..1391040) [2823 bp, 940 aa] {ON} YIL075C
           (RPN2) - RPN2p is a component of the 26S proteosome
           [contig 12] FULL
          Length = 940

 Score = 30.0 bits (66), Expect = 4.2,   Method: Composition-based stats.
 Identities = 18/78 (23%), Positives = 39/78 (50%), Gaps = 17/78 (21%)

Query: 107 LYSRLHARGYHDSKIEENLDAEIMGVVKQD----------------AVESYEPHIVVE-L 149
           +Y +L AR + ++  +  +D ++  V ++                 A+ESY   ++ E L
Sbjct: 108 MYMKLSARNFENASAQTPIDPQLASVFERMLEKCVKCEEYRLALGIALESYRLDVIEEIL 167

Query: 150 QSDTKEDMESNVSRIITW 167
           ++  KED ++N  ++IT+
Sbjct: 168 KTRVKEDTDTNALKLITY 185

>TDEL0E02220 Chr5 complement(415477..426681) [11205 bp, 3734 aa] {ON}
            Anc_5.402 YHR099W
          Length = 3734

 Score = 29.3 bits (64), Expect = 7.8,   Method: Composition-based stats.
 Identities = 30/119 (25%), Positives = 52/119 (43%), Gaps = 14/119 (11%)

Query: 59   HIVDEDKLLDVLEPLLRQGNSIVDWHVNDIFP----ERLIDLVVVLRCDNSYLYSRL-HA 113
            H+ + + +L    PLL      +   +N+ F     E L  L+ VL  D ++ Y+RL   
Sbjct: 3197 HLQELNNILKTAYPLLALSLESLVAQINERFKTSTDEDLFRLINVLLIDGTFNYNRLPFP 3256

Query: 114  RGYHDSKIEENLDAEIMGVVKQDAVESYEPHIVVELQSD---TKEDMESNVSRIITWEK 169
            RG    K+  N +  ++   +        PHI  +  +D   +K D E+ + R+  W K
Sbjct: 3257 RG--KPKLPANTETNLIRFSET----LLAPHIRPKFNADFIDSKPDFETYIKRLRYWRK 3309

>NDAI0E02590 Chr5 complement(537501..539558) [2058 bp, 685 aa] {ON}
           Anc_8.590
          Length = 685

 Score = 28.9 bits (63), Expect = 8.9,   Method: Composition-based stats.
 Identities = 26/83 (31%), Positives = 37/83 (44%), Gaps = 10/83 (12%)

Query: 77  GNSIVDWHVNDI-FPE--RLIDLVVVLRCDNSYLYSRLHARGYHDSKIEENLDAEIMGVV 133
           G  I  W +  +  PE    + + VVLRCD S L+    A   HD K++E +       +
Sbjct: 456 GADIAKWEITGVEVPEGEESVPVKVVLRCDPSGLHIIEEAYTVHDIKVQEVVP------L 509

Query: 134 KQDAVESYEPHIVVELQSDTKED 156
             DA E  EP    E+    K+D
Sbjct: 510 PADAPEDAEPEF-REVTKTVKKD 531

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.136    0.410 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 20,148,344
Number of extensions: 850909
Number of successful extensions: 3019
Number of sequences better than 10.0: 32
Number of HSP's gapped: 3045
Number of HSP's successfully gapped: 32
Length of query: 197
Length of database: 53,481,399
Length adjustment: 104
Effective length of query: 93
Effective length of database: 41,556,135
Effective search space: 3864720555
Effective search space used: 3864720555
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 63 (28.9 bits)