Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Smik_4.707.350ON38638619710.0
YDL168W (SFA1)7.350ON38638618930.0
Skud_4.897.350ON38538418380.0
Suva_4.787.350ON38538418270.0
Kpol_530.317.350ON38037916330.0
CAGL0L01111g7.350ON38138016190.0
Kwal_56.246427.350ON38137616030.0
KLTH0H01254g7.350ON38137815900.0
TDEL0C019807.350ON38538015800.0
KLLA0D12342g7.350ON38438215760.0
ZYRO0F11704g7.350ON38238115710.0
NCAS0A141607.350ON45138015660.0
TPHA0F029707.350ON38138015440.0
TBLA0E00390singletonON38338215440.0
SAKL0F11374g7.350ON38338015400.0
Ecym_47237.350ON38137815320.0
ACL148C7.350ON38138015270.0
KAFR0B008807.350ON38138015030.0
KNAG0C037907.350ON38238213310.0
NDAI0A018907.350ON42238413130.0
SAKL0A00880gsingletonON38837510941e-148
KLLA0D19929gsingletonON3863392734e-26
YBR145W (ADH5)3.118ON3512642637e-25
KLLA0B00451gsingletonON3863522593e-24
Suva_4.3943.118ON3512722425e-22
NCAS0I023503.118ON3512682425e-22
Smik_2.2843.118ON3512722391e-21
AER032W3.118ON3512722372e-21
CAGL0D00198g7.3ON3832942382e-21
SAKL0C10164g3.118ON3512922372e-21
NCAS0I01720singletonON3512732345e-21
Skud_2.2723.118ON3512722345e-21
KNAG0K020003.118ON3502702311e-20
TBLA0I011402.480ON3772712312e-20
TPHA0G032102.480ON3772762312e-20
TDEL0C003908.16ON3532652292e-20
Skud_13.2402.480ON3752572293e-20
CAGL0J01441g2.480ON3722882284e-20
SAKL0F06270gna 1ON3512922274e-20
KAFR0G014203.118ON3512722258e-20
Suva_13.2612.480ON3752692232e-19
KLLA0F21010g3.118ON3502462213e-19
Smik_13.520na 2ON3482572204e-19
NDAI0A069303.118ON3512682204e-19
KLLA0F18260gsingletonON3482462204e-19
Ecym_53313.118ON3482592195e-19
Skud_13.477na 2ON3482802196e-19
SAKL0B08184gna 3ON3732722196e-19
KLLA0B09064gna 3ON3742462197e-19
YMR083W (ADH3)2.480ON3752572181e-18
YOL086C (ADH1)3.118ON3482772161e-18
TDEL0D050503.118ON3512722152e-18
Smik_13.2662.480ON3752572152e-18
KAFR0L02010singletonON3512722133e-18
Smik_15.713.118ON3482772134e-18
KLTH0G15686g3.118ON3512722134e-18
Suva_13.494na 2ON3482572124e-18
YMR303C (ADH2)na 2ON3482792124e-18
KLLA0F00506g7.3ON3852962125e-18
YAL060W (BDH1)7.3ON3822782126e-18
CAGL0I07843g3.118ON3522572117e-18
TBLA0E034403.118ON3512722107e-18
Skud_15.683.118ON3482772108e-18
Kpol_431.82.480ON3802452118e-18
KLTH0G18986g8.16ON3543712109e-18
KAFR0A007902.480ON3772692101e-17
ZYRO0B05940g3.118ON3792732101e-17
Skud_1.37.3ON3822932101e-17
Suva_15.813.118ON3482792081e-17
TBLA0E03430singletonON3512922081e-17
KLLA0F13530g2.480ON3752462092e-17
AAR084WsingletonON3852592092e-17
KLTH0D05588g2.480ON3892462082e-17
NDAI0H021602.480ON3812592082e-17
KLTH0A00418gsingletonON3562452082e-17
Suva_10.1548.16ON3563832046e-17
Kwal_56.231983.118ON3512722036e-17
KLTH0E05588gna 1ON3482462029e-17
SAKL0E02838g2.480ON3772572031e-16
Ecym_73912.480ON3752722021e-16
YLR070C (XYL2)8.16ON3563832021e-16
Kpol_1058.118.16ON3532612011e-16
KLTH0D00616g7.3ON3823112011e-16
ZYRO0G03388g2.480ON3702892011e-16
TPHA0M007303.118ON3502772002e-16
NCAS0A077802.480ON3732692002e-16
Smik_1.67.3ON3822911993e-16
SAKL0B00814g8.16ON3543571983e-16
TDEL0H044607.3ON3822781984e-16
SAKL0D14894g7.2ON3852411968e-16
TDEL0F03190na 1ON3512471931e-15
ZYRO0C12562gna 1ON3482591931e-15
TBLA0A042907.3ON3953121932e-15
KAFR0L02000singletonON3612461922e-15
Suva_1.77.3ON3822931914e-15
Kwal_26.67397.3ON3822881904e-15
Kpol_1049.187.2ON3862421905e-15
SAKL0D14872g7.3ON3832811879e-15
NDAI0H020507.3ON3853021871e-14
TDEL0A025602.480ON3732461871e-14
Kwal_26.77992.480ON3872691871e-14
Kwal_55.20564singletonON2162121801e-14
Kwal_55.19574singletonON3563651851e-14
NCAS0J003008.16ON3572631852e-14
Kpol_1036.193.118ON3532771815e-14
Suva_12.260singletonON3573641816e-14
Skud_20.2singletonON3573651799e-14
Skud_4.2singletonON3573651799e-14
ABR229C8.16ON3533601791e-13
ZYRO0F02552g8.16ON3512811781e-13
KNAG0K01040singletonON3912381791e-13
Kwal_26.6684singletonON3562541781e-13
ABL033C2.480ON3732841772e-13
ZYRO0G03410gsingletonON3733531772e-13
NCAS0A076707.2ON4393071746e-13
Suva_1.67.2ON4172961737e-13
KNAG0E025902.480ON3742721728e-13
Smik_48.1singletonON3573751719e-13
Smik_1.57.2ON4173061721e-12
YJR159W (SOR1)na 4ON3573571701e-12
YAL061W (BDH2)7.2ON4173081702e-12
YDL246C (SOR2)singletonON3573571673e-12
Skud_1.27.2ON4173081674e-12
KAFR0I001607.2ON3852811665e-12
NCAS0A076607.3ON3863131612e-11
KAFR0I001707.3ON3812781585e-11
KNAG0I00120singletonON3812311542e-10
TPHA0H03100singletonON3923101523e-10
KNAG0D00110singletonON3623421505e-10
YBR046C (ZTA1)3.253ON3342621452e-09
KAFR0C005803.253ON3342471442e-09
KLLA0F00528g7.2ON3812961443e-09
KLLA0D05511g8.16ON3542731425e-09
NDAI0H02950singletonON3633581345e-08
Smik_2.1703.253ON3342651327e-08
NCAS0C03020singletonON3623781328e-08
TPHA0J00170singletonON3613431302e-07
NDAI0G04880singletonON3613671302e-07
Kwal_47.17532na 5ON3732441282e-07
Kwal_56.229853.253ON3463511264e-07
TDEL0D037203.253ON3352521265e-07
NDAI0H020607.2ON3993071231e-06
SAKL0D03872g3.253ON3483601221e-06
KLLA0F00638gna 6ON3822471212e-06
SAKL0H22088gna 5ON3762561193e-06
KNAG0E042007.2ON3852811193e-06
NDAI0A063203.253ON3492631184e-06
KLTH0E07964gna 5ON3742721184e-06
KAFR0A08730singletonON3602651185e-06
NCAS0D01220na 7ON3621751185e-06
NCAS0I017303.253ON3493691159e-06
Skud_2.1623.253ON3342491122e-05
CAGL0M14047gna 8ON3593771113e-05
Ecym_1093singletonON3832181123e-05
KLTH0C07854g3.253ON3583541113e-05
NDAI0H02940na 7ON3612381104e-05
SAKL0D14938gsingletonON3783211104e-05
NDAI0A08470singletonON3633891105e-05
KLTH0B04972gna 9ON3603111061e-04
KLLA0E19889gna 9ON3662411025e-04
CAGL0H06853gsingletonON3603821015e-04
TDEL0A00140singletonON4052851008e-04
Suva_13.513na 8ON360157990.001
KNAG0K02680singletonON359228980.001
ZYRO0A03366g3.253ON349251960.002
ABL090W3.253ON334266950.003
Smik_13.535na 8ON360157950.003
Kwal_26.9050singletonON364110930.005
KLTH0B00506gna 6ON398280930.005
Kpol_526.18singletonON361216930.006
CAGL0H09944g3.253ON333275920.007
SAKL0C00264gsingletonON359238900.011
TDEL0E00230singletonON362111890.015
KNAG0B06990singletonON358343890.016
SAKL0H00374gsingletonON428104890.016
YCR105W (ADH7)na 10ON361346890.016
Skud_13.494na 8ON360157880.024
ZYRO0G10318gna 5ON376110870.031
Kwal_8.605singletonON379249860.037
TDEL0F02300na 5ON379226830.091
YMR318C (ADH6)na 8ON360157830.096
Kwal_27.12835singletonON364109830.097
Smik_3.203singletonON120107760.17
Smik_26.3singletonON12580750.24
Skud_3.175singletonON361248790.27
Suva_6.13singletonON6859710.39
KAFR0C01550singletonON359241770.44
TPHA0A00140singletonON362367760.66
TPHA0E007307.413ON97860760.85
TBLA0C014901.400ON86274751.2
KLTH0C10538gsingletonON273145731.3
Kpol_1018.1077.413ON112733741.3
KAFR0H03770singletonON365111721.7
TPHA0P003308.67ON64386732.0
KNAG0I013001.400ON80685722.3
SAKL0A10560gsingletonON409162712.4
YNL223W (ATG4)2.18ON49489722.4
NDAI0G005201.450ON57579712.8
KLTH0H14102g1.450ON55183713.2
ZYRO0E04642g1.400ON80760704.1
Ecym_13601.450ON544124704.3
TPHA0K007207.413ON101133704.4
Skud_86.1singletonON8959645.0
KLTH0C06182g7.413ON102533695.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Smik_4.70
         (386 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Smik_4.70 Chr4 (136242..137402) [1161 bp, 386 aa] {ON} YDL168W (...   763   0.0  
YDL168W Chr4 (159604..160764) [1161 bp, 386 aa] {ON}  SFA1Bifunc...   733   0.0  
Skud_4.89 Chr4 (155298..156455) [1158 bp, 385 aa] {ON} YDL168W (...   712   0.0  
Suva_4.78 Chr4 (147109..148266) [1158 bp, 385 aa] {ON} YDL168W (...   708   0.0  
Kpol_530.31 s530 (77132..78274) [1143 bp, 380 aa] {ON} (77132..7...   633   0.0  
CAGL0L01111g Chr12 (133129..134274) [1146 bp, 381 aa] {ON} highl...   628   0.0  
Kwal_56.24642 s56 complement(1085556..1086701) [1146 bp, 381 aa]...   622   0.0  
KLTH0H01254g Chr8 (121076..122221) [1146 bp, 381 aa] {ON} highly...   617   0.0  
TDEL0C01980 Chr3 (344639..345796) [1158 bp, 385 aa] {ON} Anc_7.3...   613   0.0  
KLLA0D12342g Chr4 (1050181..1051335) [1155 bp, 384 aa] {ON} high...   611   0.0  
ZYRO0F11704g Chr6 complement(958546..959694) [1149 bp, 382 aa] {...   609   0.0  
NCAS0A14160 Chr1 complement(2782022..2783377) [1356 bp, 451 aa] ...   607   0.0  
TPHA0F02970 Chr6 complement(653405..654550) [1146 bp, 381 aa] {O...   599   0.0  
TBLA0E00390 Chr5 complement(71890..73041) [1152 bp, 383 aa] {ON}      599   0.0  
SAKL0F11374g Chr6 complement(885478..886629) [1152 bp, 383 aa] {...   597   0.0  
Ecym_4723 Chr4 (1415078..1416223) [1146 bp, 381 aa] {ON} similar...   594   0.0  
ACL148C Chr3 complement(90932..92077) [1146 bp, 381 aa] {ON} Syn...   592   0.0  
KAFR0B00880 Chr2 complement(164475..165620) [1146 bp, 381 aa] {O...   583   0.0  
KNAG0C03790 Chr3 complement(745394..746542) [1149 bp, 382 aa] {O...   517   0.0  
NDAI0A01890 Chr1 (425090..426358) [1269 bp, 422 aa] {ON} Anc_7.350    510   0.0  
SAKL0A00880g Chr1 complement(92246..93412) [1167 bp, 388 aa] {ON...   426   e-148
KLLA0D19929g Chr4 (1694826..1695986) [1161 bp, 386 aa] {ON} weak...   109   4e-26
YBR145W Chr2 (533762..534817) [1056 bp, 351 aa] {ON}  ADH5Alcoho...   105   7e-25
KLLA0B00451g Chr2 complement(31822..32982) [1161 bp, 386 aa] {ON...   104   3e-24
Suva_4.394 Chr4 (702935..703990) [1056 bp, 351 aa] {ON} YBR145W ...    98   5e-22
NCAS0I02350 Chr9 (444097..445152) [1056 bp, 351 aa] {ON} Anc_3.118     98   5e-22
Smik_2.284 Chr2 (518341..519396) [1056 bp, 351 aa] {ON} YBR145W ...    97   1e-21
AER032W Chr5 (696807..697862) [1056 bp, 351 aa] {ON} Syntenic ho...    96   2e-21
CAGL0D00198g Chr4 (27559..28710) [1152 bp, 383 aa] {ON} similar ...    96   2e-21
SAKL0C10164g Chr3 complement(914732..915787) [1056 bp, 351 aa] {...    96   2e-21
NCAS0I01720 Chr9 (318144..319199) [1056 bp, 351 aa] {ON}               95   5e-21
Skud_2.272 Chr2 (501260..502315) [1056 bp, 351 aa] {ON} YBR145W ...    95   5e-21
KNAG0K02000 Chr11 (410263..411315) [1053 bp, 350 aa] {ON} Anc_3....    94   1e-20
TBLA0I01140 Chr9 (233777..234910) [1134 bp, 377 aa] {ON} Anc_2.4...    94   2e-20
TPHA0G03210 Chr7 complement(688137..689270) [1134 bp, 377 aa] {O...    94   2e-20
TDEL0C00390 Chr3 (53995..55056) [1062 bp, 353 aa] {ON} Anc_8.16 ...    93   2e-20
Skud_13.240 Chr13 (408909..410036) [1128 bp, 375 aa] {ON} YMR083...    93   3e-20
CAGL0J01441g Chr10 complement(134383..135501) [1119 bp, 372 aa] ...    92   4e-20
SAKL0F06270g Chr6 (472877..473932) [1056 bp, 351 aa] {ON} simila...    92   4e-20
KAFR0G01420 Chr7 complement(314119..315174) [1056 bp, 351 aa] {O...    91   8e-20
Suva_13.261 Chr13 (416378..417505) [1128 bp, 375 aa] {ON} YMR083...    91   2e-19
KLLA0F21010g Chr6 (1962951..1964003) [1053 bp, 350 aa] {ON} unip...    90   3e-19
Smik_13.520 Chr13 complement(856008..857054) [1047 bp, 348 aa] {...    89   4e-19
NDAI0A06930 Chr1 (1585575..1586630) [1056 bp, 351 aa] {ON} Anc_3...    89   4e-19
KLLA0F18260g Chr6 complement(1683417..1684463) [1047 bp, 348 aa]...    89   4e-19
Ecym_5331 Chr5 (676233..677279) [1047 bp, 348 aa] {ON} similar t...    89   5e-19
Skud_13.477 Chr13 complement(846790..847836) [1047 bp, 348 aa] {...    89   6e-19
SAKL0B08184g Chr2 (698686..699807) [1122 bp, 373 aa] {ON} unipro...    89   6e-19
KLLA0B09064g Chr2 complement(792849..793973) [1125 bp, 374 aa] {...    89   7e-19
YMR083W Chr13 (434788..435915) [1128 bp, 375 aa] {ON}  ADH3Mitoc...    89   1e-18
YOL086C Chr15 complement(159548..160594) [1047 bp, 348 aa] {ON} ...    88   1e-18
TDEL0D05050 Chr4 (921065..922120) [1056 bp, 351 aa] {ON} Anc_3.1...    87   2e-18
Smik_13.266 Chr13 (418869..419996) [1128 bp, 375 aa] {ON} YMR083...    87   2e-18
KAFR0L02010 Chr12 (379623..380678) [1056 bp, 351 aa] {ON}              87   3e-18
Smik_15.71 Chr15 complement(122645..123691) [1047 bp, 348 aa] {O...    87   4e-18
KLTH0G15686g Chr7 complement(1367997..1369052) [1056 bp, 351 aa]...    87   4e-18
Suva_13.494 Chr13 complement(856051..857097) [1047 bp, 348 aa] {...    86   4e-18
YMR303C Chr13 complement(873291..874337) [1047 bp, 348 aa] {ON} ...    86   4e-18
KLLA0F00506g Chr6 complement(36518..37675) [1158 bp, 385 aa] {ON...    86   5e-18
YAL060W Chr1 (35155..36303) [1149 bp, 382 aa] {ON}  BDH1NAD-depe...    86   6e-18
CAGL0I07843g Chr9 complement(756345..757403) [1059 bp, 352 aa] {...    86   7e-18
TBLA0E03440 Chr5 (852767..853822) [1056 bp, 351 aa] {ON} Anc_3.1...    86   7e-18
Skud_15.68 Chr15 complement(118795..119841) [1047 bp, 348 aa] {O...    86   8e-18
Kpol_431.8 s431 (21043..22185) [1143 bp, 380 aa] {ON} (21043..22...    86   8e-18
KLTH0G18986g Chr7 complement(1639254..1640318) [1065 bp, 354 aa]...    86   9e-18
KAFR0A00790 Chr1 complement(140666..141799) [1134 bp, 377 aa] {O...    86   1e-17
ZYRO0B05940g Chr2 (480279..481418) [1140 bp, 379 aa] {ON} highly...    86   1e-17
Skud_1.3 Chr1 (11174..12322) [1149 bp, 382 aa] {ON} YAL060W (REAL)     86   1e-17
Suva_15.81 Chr15 complement(132739..133785) [1047 bp, 348 aa] {O...    85   1e-17
TBLA0E03430 Chr5 (850493..851548) [1056 bp, 351 aa] {ON}               85   1e-17
KLLA0F13530g Chr6 (1251162..1252289) [1128 bp, 375 aa] {ON} unip...    85   2e-17
AAR084W Chr1 (494021..495178) [1158 bp, 385 aa] {ON} Non-synteni...    85   2e-17
KLTH0D05588g Chr4 complement(502176..503345) [1170 bp, 389 aa] {...    85   2e-17
NDAI0H02160 Chr8 (528551..529696) [1146 bp, 381 aa] {ON} Anc_2.480     85   2e-17
KLTH0A00418g Chr1 complement(34685..35755) [1071 bp, 356 aa] {ON...    85   2e-17
Suva_10.154 Chr10 complement(275737..276807) [1071 bp, 356 aa] {...    83   6e-17
Kwal_56.23198 s56 (443881..444936) [1056 bp, 351 aa] {ON} YOL086...    83   6e-17
KLTH0E05588g Chr5 complement(494815..495861) [1047 bp, 348 aa] {...    82   9e-17
SAKL0E02838g Chr5 (226264..227397) [1134 bp, 377 aa] {ON} unipro...    83   1e-16
Ecym_7391 Chr7 (801773..802900) [1128 bp, 375 aa] {ON} similar t...    82   1e-16
YLR070C Chr12 complement(274141..275211) [1071 bp, 356 aa] {ON} ...    82   1e-16
Kpol_1058.11 s1058 (41165..42226) [1062 bp, 353 aa] {ON} (41165....    82   1e-16
KLTH0D00616g Chr4 (59883..61031) [1149 bp, 382 aa] {ON} similar ...    82   1e-16
ZYRO0G03388g Chr7 complement(265952..267064) [1113 bp, 370 aa] {...    82   1e-16
TPHA0M00730 Chr13 complement(137798..138850) [1053 bp, 350 aa] {...    82   2e-16
NCAS0A07780 Chr1 (1548197..1549318) [1122 bp, 373 aa] {ON} Anc_2...    82   2e-16
Smik_1.6 Chr1 (18115..19263) [1149 bp, 382 aa] {ON} YAL060W (REAL)     81   3e-16
SAKL0B00814g Chr2 (74565..75629) [1065 bp, 354 aa] {ON} similar ...    81   3e-16
TDEL0H04460 Chr8 complement(769988..771136) [1149 bp, 382 aa] {O...    81   4e-16
SAKL0D14894g Chr4 complement(1230497..1231654) [1158 bp, 385 aa]...    80   8e-16
TDEL0F03190 Chr6 (583849..584904) [1056 bp, 351 aa] {ON}  possib...    79   1e-15
ZYRO0C12562g Chr3 (993434..994480) [1047 bp, 348 aa] {ON} highly...    79   1e-15
TBLA0A04290 Chr1 (1063289..1064476) [1188 bp, 395 aa] {ON} Anc_7...    79   2e-15
KAFR0L02000 Chr12 (378013..379098) [1086 bp, 361 aa] {ON}              79   2e-15
Suva_1.7 Chr1 (12310..13458) [1149 bp, 382 aa] {ON} YAL060W (REAL)     78   4e-15
Kwal_26.6739 s26 (46044..47192) [1149 bp, 382 aa] {ON} YAL060W (...    78   4e-15
Kpol_1049.18 s1049 complement(35191..36351) [1161 bp, 386 aa] {O...    78   5e-15
SAKL0D14872g Chr4 complement(1226093..1227244) [1152 bp, 383 aa]...    77   9e-15
NDAI0H02050 Chr8 complement(500914..502071) [1158 bp, 385 aa] {O...    77   1e-14
TDEL0A02560 Chr1 complement(462053..463174) [1122 bp, 373 aa] {O...    77   1e-14
Kwal_26.7799 s26 complement(515580..516743) [1164 bp, 387 aa] {O...    77   1e-14
Kwal_55.20564 s55 complement(459253..459903) [651 bp, 216 aa] {O...    74   1e-14
Kwal_55.19574 s55 complement(32260..33330) [1071 bp, 356 aa] {ON...    76   1e-14
NCAS0J00300 Chr10 (43719..44792) [1074 bp, 357 aa] {ON} Anc_8.16       76   2e-14
Kpol_1036.19 s1036 (51276..52337) [1062 bp, 353 aa] {ON} (51276....    74   5e-14
Suva_12.260 Chr12 (427406..428479) [1074 bp, 357 aa] {ON} YJR159...    74   6e-14
Skud_20.2 Chr20 (1588..2661) [1074 bp, 357 aa] {ON} YJR159W (REAL)     74   9e-14
Skud_4.2 Chr4 complement(6287..7360) [1074 bp, 357 aa] {ON} YJR1...    74   9e-14
ABR229C Chr2 complement(831895..832956) [1062 bp, 353 aa] {ON} S...    74   1e-13
ZYRO0F02552g Chr6 (203037..204092) [1056 bp, 351 aa] {ON} simila...    73   1e-13
KNAG0K01040 Chr11 complement(204636..205811) [1176 bp, 391 aa] {...    74   1e-13
Kwal_26.6684 s26 (21910..22980) [1071 bp, 356 aa] {ON} YJR159W (...    73   1e-13
ABL033C Chr2 complement(337866..338987) [1122 bp, 373 aa] {ON} S...    73   2e-13
ZYRO0G03410g Chr7 complement(269170..270291) [1122 bp, 373 aa] {...    73   2e-13
NCAS0A07670 Chr1 complement(1527273..1528592) [1320 bp, 439 aa] ...    72   6e-13
Suva_1.6 Chr1 (10591..11844) [1254 bp, 417 aa] {ON} YAL061W (REAL)     71   7e-13
KNAG0E02590 Chr5 complement(513565..514689) [1125 bp, 374 aa] {O...    71   8e-13
Smik_48.1 Chr48 complement(1..1074) [1074 bp, 357 aa] {ON} YJR15...    70   9e-13
Smik_1.5 Chr1 (16385..17638) [1254 bp, 417 aa] {ON} YAL061W (REAL)     71   1e-12
YJR159W Chr10 (736044..737117) [1074 bp, 357 aa] {ON}  SOR1Sorbi...    70   1e-12
YAL061W Chr1 (33448..34701) [1254 bp, 417 aa] {ON}  BDH2Putative...    70   2e-12
YDL246C Chr4 complement(8683..9756) [1074 bp, 357 aa] {ON}  SOR2...    69   3e-12
Skud_1.2 Chr1 (9513..10766) [1254 bp, 417 aa] {ON} YAL061W (REAL)      69   4e-12
KAFR0I00160 Chr9 (33043..34200) [1158 bp, 385 aa] {ON} Anc_7.2 Y...    69   5e-12
NCAS0A07660 Chr1 complement(1525755..1526915) [1161 bp, 386 aa] ...    67   2e-11
KAFR0I00170 Chr9 (34519..35664) [1146 bp, 381 aa] {ON} Anc_7.3 Y...    65   5e-11
KNAG0I00120 Chr9 (9352..10497) [1146 bp, 381 aa] {ON}                  64   2e-10
TPHA0H03100 Chr8 complement(736924..738102) [1179 bp, 392 aa] {O...    63   3e-10
KNAG0D00110 Chr4 (3538..4626) [1089 bp, 362 aa] {ON}                   62   5e-10
YBR046C Chr2 complement(330507..331511) [1005 bp, 334 aa] {ON}  ...    60   2e-09
KAFR0C00580 Chr3 (113544..114548) [1005 bp, 334 aa] {ON} Anc_3.2...    60   2e-09
KLLA0F00528g Chr6 complement(40081..41226) [1146 bp, 381 aa] {ON...    60   3e-09
KLLA0D05511g Chr4 complement(476363..477427) [1065 bp, 354 aa] {...    59   5e-09
NDAI0H02950 Chr8 complement(718762..719853) [1092 bp, 363 aa] {O...    56   5e-08
Smik_2.170 Chr2 complement(312211..313215) [1005 bp, 334 aa] {ON...    55   7e-08
NCAS0C03020 Chr3 complement(593785..594873) [1089 bp, 362 aa] {O...    55   8e-08
TPHA0J00170 Chr10 (40911..41996) [1086 bp, 361 aa] {ON}                55   2e-07
NDAI0G04880 Chr7 complement(1175518..1176603) [1086 bp, 361 aa] ...    55   2e-07
Kwal_47.17532 s47 (444594..445715) [1122 bp, 373 aa] {ON} YMR318...    54   2e-07
Kwal_56.22985 s56 complement(357501..358541) [1041 bp, 346 aa] {...    53   4e-07
TDEL0D03720 Chr4 (683833..684840) [1008 bp, 335 aa] {ON} Anc_3.2...    53   5e-07
NDAI0H02060 Chr8 complement(502872..504071) [1200 bp, 399 aa] {O...    52   1e-06
SAKL0D03872g Chr4 (316127..317173) [1047 bp, 348 aa] {ON} highly...    52   1e-06
KLLA0F00638g Chr6 (51849..52997) [1149 bp, 382 aa] {ON} weakly s...    51   2e-06
SAKL0H22088g Chr8 (1934171..1935301) [1131 bp, 376 aa] {ON} simi...    50   3e-06
KNAG0E04200 Chr5 complement(837232..838389) [1158 bp, 385 aa] {O...    50   3e-06
NDAI0A06320 Chr1 (1438393..1439442) [1050 bp, 349 aa] {ON} Anc_3...    50   4e-06
KLTH0E07964g Chr5 (735214..736338) [1125 bp, 374 aa] {ON} simila...    50   4e-06
KAFR0A08730 Chr1 complement(1747657..1748739) [1083 bp, 360 aa] ...    50   5e-06
NCAS0D01220 Chr4 (223821..224909) [1089 bp, 362 aa] {ON}               50   5e-06
NCAS0I01730 Chr9 (319449..320498) [1050 bp, 349 aa] {ON} Anc_3.253     49   9e-06
Skud_2.162 Chr2 complement(299642..300646) [1005 bp, 334 aa] {ON...    48   2e-05
CAGL0M14047g Chr13 complement(1386775..1387854) [1080 bp, 359 aa...    47   3e-05
Ecym_1093 Chr1 complement(195854..197005) [1152 bp, 383 aa] {ON}...    48   3e-05
KLTH0C07854g Chr3 (673945..675021) [1077 bp, 358 aa] {ON} simila...    47   3e-05
NDAI0H02940 Chr8 complement(717073..718158) [1086 bp, 361 aa] {O...    47   4e-05
SAKL0D14938g Chr4 complement(1235542..1236678) [1137 bp, 378 aa]...    47   4e-05
NDAI0A08470 Chr1 (1954035..1955126) [1092 bp, 363 aa] {ON}             47   5e-05
KLTH0B04972g Chr2 (408153..409235) [1083 bp, 360 aa] {ON} highly...    45   1e-04
KLLA0E19889g Chr5 (1770061..1771161) [1101 bp, 366 aa] {ON} simi...    44   5e-04
CAGL0H06853g Chr8 complement(680184..681266) [1083 bp, 360 aa] {...    44   5e-04
TDEL0A00140 Chr1 (23016..24233) [1218 bp, 405 aa] {ON}                 43   8e-04
Suva_13.513 Chr13 complement(894394..895476) [1083 bp, 360 aa] {...    43   0.001
KNAG0K02680 Chr11 complement(531173..532252) [1080 bp, 359 aa] {...    42   0.001
ZYRO0A03366g Chr1 (271779..272828) [1050 bp, 349 aa] {ON} highly...    42   0.002
ABL090W Chr2 (230699..231703) [1005 bp, 334 aa] {ON} Syntenic ho...    41   0.003
Smik_13.535 Chr13 complement(893727..894809) [1083 bp, 360 aa] {...    41   0.003
Kwal_26.9050 s26 (1055019..1056113) [1095 bp, 364 aa] {ON} YCR10...    40   0.005
KLTH0B00506g Chr2 complement(53662..54858) [1197 bp, 398 aa] {ON...    40   0.005
Kpol_526.18 s526 (51360..52445) [1086 bp, 361 aa] {ON} (51360..5...    40   0.006
CAGL0H09944g Chr8 complement(971519..972520) [1002 bp, 333 aa] {...    40   0.007
SAKL0C00264g Chr3 complement(17429..18508) [1080 bp, 359 aa] {ON...    39   0.011
TDEL0E00230 Chr5 (36310..37398) [1089 bp, 362 aa] {ON}   Added 3...    39   0.015
KNAG0B06990 Chr2 (1393058..1394134) [1077 bp, 358 aa] {ON}             39   0.016
SAKL0H00374g Chr8 (45725..47011) [1287 bp, 428 aa] {ON} weakly s...    39   0.016
YCR105W Chr3 (309070..310155) [1086 bp, 361 aa] {ON}  ADH7NADPH-...    39   0.016
Skud_13.494 Chr13 complement(884038..885120) [1083 bp, 360 aa] {...    39   0.024
ZYRO0G10318g Chr7 (831554..832684) [1131 bp, 376 aa] {ON} simila...    38   0.031
Kwal_8.605 s8 (25017..26156) [1140 bp, 379 aa] {ON} YCR105W - Hy...    38   0.037
TDEL0F02300 Chr6 complement(421372..422511) [1140 bp, 379 aa] {O...    37   0.091
YMR318C Chr13 complement(911061..912143) [1083 bp, 360 aa] {ON} ...    37   0.096
Kwal_27.12835 s27 complement(1395770..1396864) [1095 bp, 364 aa]...    37   0.097
Smik_3.203 Chr3 (301227..301247,301251..301589) [360 bp, 120 aa]...    34   0.17 
Smik_26.3 Chr26 (2136..2513) [378 bp, 125 aa] {ON} YMR318C (REAL)      33   0.24 
Skud_3.175 Chr3 (288164..289249) [1086 bp, 361 aa] {ON} YCR105W ...    35   0.27 
Suva_6.13 Chr6 (21861..22031,22035..22067) [204 bp, 68 aa] {ON} ...    32   0.39 
KAFR0C01550 Chr3 complement(318350..319429) [1080 bp, 359 aa] {O...    34   0.44 
TPHA0A00140 Chr1 (14857..15945) [1089 bp, 362 aa] {ON}                 34   0.66 
TPHA0E00730 Chr5 (139190..142126) [2937 bp, 978 aa] {ON} Anc_7.4...    34   0.85 
TBLA0C01490 Chr3 complement(343276..345864) [2589 bp, 862 aa] {O...    33   1.2  
KLTH0C10538g Chr3 complement(873623..874444) [822 bp, 273 aa] {O...    33   1.3  
Kpol_1018.107 s1018 complement(282640..286023) [3384 bp, 1127 aa...    33   1.3  
KAFR0H03770 Chr8 complement(715399..716496) [1098 bp, 365 aa] {O...    32   1.7  
TPHA0P00330 Chr16 (63488..65419) [1932 bp, 643 aa] {ON} Anc_8.67...    33   2.0  
KNAG0I01300 Chr9 (248944..251364) [2421 bp, 806 aa] {ON} Anc_1.4...    32   2.3  
SAKL0A10560g Chr1 (928213..929442) [1230 bp, 409 aa] {ON} simila...    32   2.4  
YNL223W Chr14 (227370..228854) [1485 bp, 494 aa] {ON}  ATG4Conse...    32   2.4  
NDAI0G00520 Chr7 complement(112068..113795) [1728 bp, 575 aa] {O...    32   2.8  
KLTH0H14102g Chr8 (1226474..1228129) [1656 bp, 551 aa] {ON} simi...    32   3.2  
ZYRO0E04642g Chr5 complement(349593..352016) [2424 bp, 807 aa] {...    32   4.1  
Ecym_1360 Chr1 (739963..741597) [1635 bp, 544 aa] {ON} similar t...    32   4.3  
TPHA0K00720 Chr11 (147285..150320) [3036 bp, 1011 aa] {ON} Anc_7...    32   4.4  
Skud_86.1 Chr86 complement(469..738) [270 bp, 89 aa] {ON} YJR159...    29   5.0  
KLTH0C06182g Chr3 (535274..538351) [3078 bp, 1025 aa] {ON} simil...    31   5.4  

>Smik_4.70 Chr4 (136242..137402) [1161 bp, 386 aa] {ON} YDL168W
           (REAL)
          Length = 386

 Score =  763 bits (1971), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 374/386 (96%), Positives = 374/386 (96%)

Query: 1   MSAATVGKPIKCIAAVAYDAKKPSSVEEITVDAPKAHEVRIKIEYTAVCHTDAYTLSGSD 60
           MSAATVGKPIKCIAAVAYDAKKPSSVEEITVDAPKAHEVRIKIEYTAVCHTDAYTLSGSD
Sbjct: 1   MSAATVGKPIKCIAAVAYDAKKPSSVEEITVDAPKAHEVRIKIEYTAVCHTDAYTLSGSD 60

Query: 61  PEGLFPCILGHEGAGIVESVGDGVVTVKPGDHVIALYTAECGKCKFCTSGKTNLCSAVRA 120
           PEGLFPCILGHEGAGIVESVGDGVVTVKPGDHVIALYTAECGKCKFCTSGKTNLCSAVRA
Sbjct: 61  PEGLFPCILGHEGAGIVESVGDGVVTVKPGDHVIALYTAECGKCKFCTSGKTNLCSAVRA 120

Query: 121 TQGKGVMPDGTTRFHNAKGKDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDASCLLGCG 180
           TQGKGVMPDGTTRFHNAKGKDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDASCLLGCG
Sbjct: 121 TQGKGVMPDGTTRFHNAKGKDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDASCLLGCG 180

Query: 181 VTTGYGAAVKTANVQKGDTVAVFGCGTVGLSVIQGAKLRGASKIIAVDINNNKKKYCSQF 240
           VTTGYGAAVKTANVQKGDTVAVFGCGTVGLSVIQGAKLRGASKIIAVDINNNKKKYCSQF
Sbjct: 181 VTTGYGAAVKTANVQKGDTVAVFGCGTVGLSVIQGAKLRGASKIIAVDINNNKKKYCSQF 240

Query: 241 GATDFINPKEDLAKDQTIVEKLVEMTDGGLDFTFDCTGNTKIMRDALEACHKGWGQSXXX 300
           GATDFINPKEDLAKDQTIVEKLVEMTDGGLDFTFDCTGNTKIMRDALEACHKGWGQS   
Sbjct: 241 GATDFINPKEDLAKDQTIVEKLVEMTDGGLDFTFDCTGNTKIMRDALEACHKGWGQSIII 300

Query: 301 XXXXXXXXXSTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQSGVLKVEEFITHRRPF 360
                    STRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQSGVLKVEEFITHRRPF
Sbjct: 301 GVAAAGEEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQSGVLKVEEFITHRRPF 360

Query: 361 KEINHAFEDLHNGDCLRTVLKFDETK 386
           KEINHAFEDLHNGDCLRTVLKFDETK
Sbjct: 361 KEINHAFEDLHNGDCLRTVLKFDETK 386

>YDL168W Chr4 (159604..160764) [1161 bp, 386 aa] {ON}
           SFA1Bifunctional enzyme containing both alcohol
           dehydrogenase and glutathione-dependent formaldehyde
           dehydrogenase activities, functions in formaldehyde
           detoxification and formation of long chain and complex
           alcohols, regulated by Hog1p-Sko1p
          Length = 386

 Score =  733 bits (1893), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 355/386 (91%), Positives = 365/386 (94%)

Query: 1   MSAATVGKPIKCIAAVAYDAKKPSSVEEITVDAPKAHEVRIKIEYTAVCHTDAYTLSGSD 60
           MSAATVGKPIKCIAAVAYDAKKP SVEEITVDAPKAHEVRIKIEYTAVCHTDAYTLSGSD
Sbjct: 1   MSAATVGKPIKCIAAVAYDAKKPLSVEEITVDAPKAHEVRIKIEYTAVCHTDAYTLSGSD 60

Query: 61  PEGLFPCILGHEGAGIVESVGDGVVTVKPGDHVIALYTAECGKCKFCTSGKTNLCSAVRA 120
           PEGLFPC+LGHEGAGIVESVGD V+TVKPGDHVIALYTAECGKCKFCTSGKTNLC AVRA
Sbjct: 61  PEGLFPCVLGHEGAGIVESVGDDVITVKPGDHVIALYTAECGKCKFCTSGKTNLCGAVRA 120

Query: 121 TQGKGVMPDGTTRFHNAKGKDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDASCLLGCG 180
           TQGKGVMPDGTTRFHNAKG+DIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDA+CLLGCG
Sbjct: 121 TQGKGVMPDGTTRFHNAKGEDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDAACLLGCG 180

Query: 181 VTTGYGAAVKTANVQKGDTVAVFGCGTVGLSVIQGAKLRGASKIIAVDINNNKKKYCSQF 240
           VTTG+GAA+KTANVQKGDTVAVFGCGTVGLSVIQGAKLRGASKIIA+DINN KK+YCSQF
Sbjct: 181 VTTGFGAALKTANVQKGDTVAVFGCGTVGLSVIQGAKLRGASKIIAIDINNKKKQYCSQF 240

Query: 241 GATDFINPKEDLAKDQTIVEKLVEMTDGGLDFTFDCTGNTKIMRDALEACHKGWGQSXXX 300
           GATDF+NPKEDLAKDQTIVEKL+EMTDGGLDFTFDCTGNTKIMRDALEACHKGWGQS   
Sbjct: 241 GATDFVNPKEDLAKDQTIVEKLIEMTDGGLDFTFDCTGNTKIMRDALEACHKGWGQSIII 300

Query: 301 XXXXXXXXXSTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQSGVLKVEEFITHRRPF 360
                    STRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQ G LKVEEFITHRRPF
Sbjct: 301 GVAAAGEEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQKGALKVEEFITHRRPF 360

Query: 361 KEINHAFEDLHNGDCLRTVLKFDETK 386
           KEIN AFEDLHNGDCLRTVLK DE K
Sbjct: 361 KEINQAFEDLHNGDCLRTVLKSDEIK 386

>Skud_4.89 Chr4 (155298..156455) [1158 bp, 385 aa] {ON} YDL168W
           (REAL)
          Length = 385

 Score =  712 bits (1838), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 343/384 (89%), Positives = 359/384 (93%)

Query: 1   MSAATVGKPIKCIAAVAYDAKKPSSVEEITVDAPKAHEVRIKIEYTAVCHTDAYTLSGSD 60
           M AATVGKPI+C+AAVAY+AKK  SVEEITVD PKAHEVRIKIE+TAVCHTDAYTLSGSD
Sbjct: 1   MLAATVGKPIQCVAAVAYNAKKSLSVEEITVDPPKAHEVRIKIEFTAVCHTDAYTLSGSD 60

Query: 61  PEGLFPCILGHEGAGIVESVGDGVVTVKPGDHVIALYTAECGKCKFCTSGKTNLCSAVRA 120
           PEGLFPCILGHEGAGIVESVGD V+TVKPGDHVIALYTAECGKCKFCTSGKTNLCSAVRA
Sbjct: 61  PEGLFPCILGHEGAGIVESVGDDVMTVKPGDHVIALYTAECGKCKFCTSGKTNLCSAVRA 120

Query: 121 TQGKGVMPDGTTRFHNAKGKDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDASCLLGCG 180
           TQGKGVMPDGTTRFHNAKG+DIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDA+CLLGCG
Sbjct: 121 TQGKGVMPDGTTRFHNAKGEDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDAACLLGCG 180

Query: 181 VTTGYGAAVKTANVQKGDTVAVFGCGTVGLSVIQGAKLRGASKIIAVDINNNKKKYCSQF 240
           VTTGYGAA+KTANVQ+GDTVAVFGCGTVGLSV+QGAK RGASKIIAVDINN K++Y S F
Sbjct: 181 VTTGYGAAIKTANVQEGDTVAVFGCGTVGLSVMQGAKSRGASKIIAVDINNKKRQYSSNF 240

Query: 241 GATDFINPKEDLAKDQTIVEKLVEMTDGGLDFTFDCTGNTKIMRDALEACHKGWGQSXXX 300
           GATDFINPKEDLA+DQTIVEKL++MTDGGLDFTFDCTGNT IMRDALEACHKGWGQS   
Sbjct: 241 GATDFINPKEDLAEDQTIVEKLIDMTDGGLDFTFDCTGNTNIMRDALEACHKGWGQSIII 300

Query: 301 XXXXXXXXXSTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQSGVLKVEEFITHRRPF 360
                    STRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQSG LKVEEFITHRRPF
Sbjct: 301 GVAAAGEEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQSGALKVEEFITHRRPF 360

Query: 361 KEINHAFEDLHNGDCLRTVLKFDE 384
           KEIN AFEDLHNGDCLRTVL+F E
Sbjct: 361 KEINQAFEDLHNGDCLRTVLRFQE 384

>Suva_4.78 Chr4 (147109..148266) [1158 bp, 385 aa] {ON} YDL168W
           (REAL)
          Length = 385

 Score =  708 bits (1827), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 343/384 (89%), Positives = 355/384 (92%)

Query: 1   MSAATVGKPIKCIAAVAYDAKKPSSVEEITVDAPKAHEVRIKIEYTAVCHTDAYTLSGSD 60
           MSA+TVGKPI+CIAA+AYDAKKP SVEEITVD PKAHEVRIKIEYTAVCHTDAYTLSGSD
Sbjct: 1   MSASTVGKPIQCIAAIAYDAKKPLSVEEITVDPPKAHEVRIKIEYTAVCHTDAYTLSGSD 60

Query: 61  PEGLFPCILGHEGAGIVESVGDGVVTVKPGDHVIALYTAECGKCKFCTSGKTNLCSAVRA 120
           PEGLFPCILGHEGAGIVESVGD V TVKPGDHVIALYTAECGKCKFCTSGKTNLCSAVRA
Sbjct: 61  PEGLFPCILGHEGAGIVESVGDDVTTVKPGDHVIALYTAECGKCKFCTSGKTNLCSAVRA 120

Query: 121 TQGKGVMPDGTTRFHNAKGKDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDASCLLGCG 180
           TQG+G+MPD TTRFHN KG+DIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDA+ LLGCG
Sbjct: 121 TQGRGIMPDETTRFHNGKGEDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDAASLLGCG 180

Query: 181 VTTGYGAAVKTANVQKGDTVAVFGCGTVGLSVIQGAKLRGASKIIAVDINNNKKKYCSQF 240
           VTTGYGAAVKTANVQKGDTVAVFGCGTVGLSVIQGAK RGASKII +DINN KK+YC  F
Sbjct: 181 VTTGYGAAVKTANVQKGDTVAVFGCGTVGLSVIQGAKARGASKIIGIDINNKKKQYCFDF 240

Query: 241 GATDFINPKEDLAKDQTIVEKLVEMTDGGLDFTFDCTGNTKIMRDALEACHKGWGQSXXX 300
           GATDFINPKEDLAK QTIVEKL+E TDGGLDFTFDCTGNTKIMRDALEACHKGWGQS   
Sbjct: 241 GATDFINPKEDLAKGQTIVEKLIETTDGGLDFTFDCTGNTKIMRDALEACHKGWGQSIII 300

Query: 301 XXXXXXXXXSTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQSGVLKVEEFITHRRPF 360
                    STRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQ+G LKVEEFITHRRPF
Sbjct: 301 GVAAAGEEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQNGALKVEEFITHRRPF 360

Query: 361 KEINHAFEDLHNGDCLRTVLKFDE 384
           KEIN AFEDLH GDCLRTVLKFD+
Sbjct: 361 KEINQAFEDLHQGDCLRTVLKFDK 384

>Kpol_530.31 s530 (77132..78274) [1143 bp, 380 aa] {ON}
           (77132..78274) [1143 nt, 381 aa]
          Length = 380

 Score =  633 bits (1633), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 307/379 (81%), Positives = 332/379 (87%), Gaps = 1/379 (0%)

Query: 4   ATVGKPIKCIAAVAYDAKKPSSVEEITVDAPKAHEVRIKIEYTAVCHTDAYTLSGSDPEG 63
           +TVGKPI C AAVAY+A KP  VEEI VD PKAHEVRIKI  TAVCHTDAYTLSG DPEG
Sbjct: 2   STVGKPITCQAAVAYEAAKPLVVEEIVVDPPKAHEVRIKIINTAVCHTDAYTLSGVDPEG 61

Query: 64  LFPCILGHEGAGIVESVGDGVVTVKPGDHVIALYTAECGKCKFCTSGKTNLCSAVRATQG 123
           LFPC+LGHEG+GIVESVGD V TVKPGDHV+ALYTAECGKCKFC SGKTNLC +VRATQG
Sbjct: 62  LFPCVLGHEGSGIVESVGDNVTTVKPGDHVVALYTAECGKCKFCLSGKTNLCGSVRATQG 121

Query: 124 KGVMPDGTTRFHNAKGKDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDASCLLGCGVTT 183
           KGVMPDGT RFHN KG+ +YHFMGCSTFSEYTVVADVSVVAIDP APLD+ CLLGCGVTT
Sbjct: 122 KGVMPDGTPRFHNKKGEPLYHFMGCSTFSEYTVVADVSVVAIDPTAPLDSVCLLGCGVTT 181

Query: 184 GYGAAVKTANVQKGDTVAVFGCGTVGLSVIQGAKLRGASKIIAVDINNNKKKYCSQFGAT 243
           GYGAA+KTANVQKGDTVAVFG GTVGLSV+QGAK RGASKII VDINN+KK++ ++FGAT
Sbjct: 182 GYGAAIKTANVQKGDTVAVFGAGTVGLSVVQGAKSRGASKIIVVDINNDKKEWSAEFGAT 241

Query: 244 DFINPKEDLAKDQTIVEKLVEMTDGGLDFTFDCTGNTKIMRDALEACHKGWGQSXXXXXX 303
           DF+NP E L + Q IV KLVEMTDGGLDFTFDCTGN  +MRDALEACHKGWGQS      
Sbjct: 242 DFVNPSE-LPEGQDIVSKLVEMTDGGLDFTFDCTGNVNVMRDALEACHKGWGQSIIIGVA 300

Query: 304 XXXXXXSTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQSGVLKVEEFITHRRPFKEI 363
                 STRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQ+G LKV+EFIT+RRPF EI
Sbjct: 301 AAGKEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQNGSLKVDEFITNRRPFVEI 360

Query: 364 NHAFEDLHNGDCLRTVLKF 382
           N AFE+LH+G+CLRTVL F
Sbjct: 361 NDAFEELHHGNCLRTVLSF 379

>CAGL0L01111g Chr12 (133129..134274) [1146 bp, 381 aa] {ON} highly
           similar to uniprot|P32771 Saccharomyces cerevisiae
           YDL168w SFA1 long-chain alcohol dehydrogenase
          Length = 381

 Score =  628 bits (1619), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 299/380 (78%), Positives = 328/380 (86%)

Query: 5   TVGKPIKCIAAVAYDAKKPSSVEEITVDAPKAHEVRIKIEYTAVCHTDAYTLSGSDPEGL 64
           T GKPI+C+AAVAY+A KP  VE+I VD PKAHEVRIKI  TAVCHTDAYTLSG+DPEGL
Sbjct: 2   TEGKPIECLAAVAYEAGKPQVVEQIVVDPPKAHEVRIKIVNTAVCHTDAYTLSGADPEGL 61

Query: 65  FPCILGHEGAGIVESVGDGVVTVKPGDHVIALYTAECGKCKFCTSGKTNLCSAVRATQGK 124
           FPC+LGHEGAGIVESVGDGV  VKPGDHVIALYTAEC KCKFC SGKTNLC AVRATQGK
Sbjct: 62  FPCVLGHEGAGIVESVGDGVTNVKPGDHVIALYTAECQKCKFCLSGKTNLCGAVRATQGK 121

Query: 125 GVMPDGTTRFHNAKGKDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDASCLLGCGVTTG 184
           GVMPDGT+RFHN KG+ +YHFMGCSTFSEYTVVADVSVVAID  APL++ CLLGCGVTTG
Sbjct: 122 GVMPDGTSRFHNKKGESLYHFMGCSTFSEYTVVADVSVVAIDQTAPLESVCLLGCGVTTG 181

Query: 185 YGAAVKTANVQKGDTVAVFGCGTVGLSVIQGAKLRGASKIIAVDINNNKKKYCSQFGATD 244
           YGAAVKTANVQKGDTVAVFGCGTVGLSV+QGA  RGAS+IIA+D N+ KK +C+QFGATD
Sbjct: 182 YGAAVKTANVQKGDTVAVFGCGTVGLSVLQGAHQRGASRIIAIDTNDQKKDFCTQFGATD 241

Query: 245 FINPKEDLAKDQTIVEKLVEMTDGGLDFTFDCTGNTKIMRDALEACHKGWGQSXXXXXXX 304
           FINP +DL +++TIV KL+EMTDGGLD TFDCTGN  +MR ALEACHKGWGQS       
Sbjct: 242 FINPTKDLKENETIVAKLIEMTDGGLDHTFDCTGNVNVMRSALEACHKGWGQSVIIGVAA 301

Query: 305 XXXXXSTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQSGVLKVEEFITHRRPFKEIN 364
                STRPFQLVTGRVWKGSAFGG+KGRSEM GLI+ Y+ G LKV+EFITHRR F EIN
Sbjct: 302 AGQEISTRPFQLVTGRVWKGSAFGGVKGRSEMAGLIEQYKKGELKVDEFITHRRSFNEIN 361

Query: 365 HAFEDLHNGDCLRTVLKFDE 384
            AF+DLHNG CLRTVL F +
Sbjct: 362 EAFDDLHNGLCLRTVLSFSK 381

>Kwal_56.24642 s56 complement(1085556..1086701) [1146 bp, 381 aa]
           {ON} YDL168W (SFA1) - Long-chain alcohol dehydrogenase
           (glutathione-dependent formaldehyde dehydrogenase)
           [contig 161] FULL
          Length = 381

 Score =  622 bits (1603), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 296/376 (78%), Positives = 327/376 (86%)

Query: 7   GKPIKCIAAVAYDAKKPSSVEEITVDAPKAHEVRIKIEYTAVCHTDAYTLSGSDPEGLFP 66
           GKPI C+AAVAY+A KP ++EEI VD PKAHEVR+KI YTAVCHTDAYTLSG DPEG FP
Sbjct: 4   GKPITCLAAVAYEAGKPLTIEEIVVDPPKAHEVRVKIAYTAVCHTDAYTLSGVDPEGAFP 63

Query: 67  CILGHEGAGIVESVGDGVVTVKPGDHVIALYTAECGKCKFCTSGKTNLCSAVRATQGKGV 126
            ILGHEGAGIVES+G+GV  VKPGDHVIALYTAEC +CKFC SGKTNLC +VRATQGKGV
Sbjct: 64  SILGHEGAGIVESIGEGVTNVKPGDHVIALYTAECKECKFCKSGKTNLCGSVRATQGKGV 123

Query: 127 MPDGTTRFHNAKGKDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDASCLLGCGVTTGYG 186
           MPDGTTRFHN KG+DI HFMGCSTFS+YTV+ADVSVVAIDPKAPLD +CLLGCGVTTGYG
Sbjct: 124 MPDGTTRFHNKKGEDILHFMGCSTFSQYTVLADVSVVAIDPKAPLDKTCLLGCGVTTGYG 183

Query: 187 AAVKTANVQKGDTVAVFGCGTVGLSVIQGAKLRGASKIIAVDINNNKKKYCSQFGATDFI 246
           AAVKTANVQKGDTVAVFG GTVGLSV+QGAK+RGAS+II VDIN+ KK++ ++FGATDF+
Sbjct: 184 AAVKTANVQKGDTVAVFGAGTVGLSVVQGAKVRGASRIIVVDINDQKKQWANEFGATDFV 243

Query: 247 NPKEDLAKDQTIVEKLVEMTDGGLDFTFDCTGNTKIMRDALEACHKGWGQSXXXXXXXXX 306
           NP +DL   +TIV+ LVEMTDGGLD+TFDCTGNT +MR ALEACHKGWG+S         
Sbjct: 244 NPSKDLKDGKTIVDMLVEMTDGGLDYTFDCTGNTDVMRSALEACHKGWGESIIIGVAAAG 303

Query: 307 XXXSTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQSGVLKVEEFITHRRPFKEINHA 366
              STRPFQLVTGRVWKGSAFGGIKGRSEMGGLI DY  G LKV+EFITHRR F +IN A
Sbjct: 304 KEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLISDYMDGKLKVDEFITHRRGFTDINSA 363

Query: 367 FEDLHNGDCLRTVLKF 382
           FEDLH+GDCLRTVL  
Sbjct: 364 FEDLHHGDCLRTVLDL 379

>KLTH0H01254g Chr8 (121076..122221) [1146 bp, 381 aa] {ON} highly
           similar to uniprot|P32771 Saccharomyces cerevisiae
           YDL168W SFA1 Long-chain alcohol dehydrogenase
           (glutathione-dependent formaldehyde dehydrogenase)
          Length = 381

 Score =  617 bits (1590), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 296/378 (78%), Positives = 324/378 (85%)

Query: 7   GKPIKCIAAVAYDAKKPSSVEEITVDAPKAHEVRIKIEYTAVCHTDAYTLSGSDPEGLFP 66
           GKPI C AAVAY+A KP +VEEI VD PKAHEVRIK+EYTAVCHTDAYTLSG DPEG FP
Sbjct: 4   GKPITCTAAVAYEAGKPLTVEEIVVDPPKAHEVRIKVEYTAVCHTDAYTLSGVDPEGAFP 63

Query: 67  CILGHEGAGIVESVGDGVVTVKPGDHVIALYTAECGKCKFCTSGKTNLCSAVRATQGKGV 126
            ILGHEGAG+VESVG+GV  VK GDHVIALYTAEC +CKFC SGKTNLC +VRATQGKGV
Sbjct: 64  SILGHEGAGVVESVGEGVTNVKAGDHVIALYTAECKECKFCKSGKTNLCGSVRATQGKGV 123

Query: 127 MPDGTTRFHNAKGKDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDASCLLGCGVTTGYG 186
           MPDGT+RFHN KG+D+ HFMGCSTFS+YTVVADVSVVAIDPKAPLD +CLLGCGVTTGYG
Sbjct: 124 MPDGTSRFHNKKGEDLLHFMGCSTFSQYTVVADVSVVAIDPKAPLDKTCLLGCGVTTGYG 183

Query: 187 AAVKTANVQKGDTVAVFGCGTVGLSVIQGAKLRGASKIIAVDINNNKKKYCSQFGATDFI 246
           AAVKTA+VQKGDTVA+FG GTVGLSV+QGA +RGASKII VDIN+ KK++   FGATDF+
Sbjct: 184 AAVKTADVQKGDTVAIFGAGTVGLSVVQGAHVRGASKIIVVDINDQKKQWSLDFGATDFV 243

Query: 247 NPKEDLAKDQTIVEKLVEMTDGGLDFTFDCTGNTKIMRDALEACHKGWGQSXXXXXXXXX 306
           NP + L   QTIV+KLVEMTDGGLDFTFDCTGNT +MR ALEACHKGWGQS         
Sbjct: 244 NPSKGLKDGQTIVDKLVEMTDGGLDFTFDCTGNTDVMRSALEACHKGWGQSIIIGVAAAG 303

Query: 307 XXXSTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQSGVLKVEEFITHRRPFKEINHA 366
              STRPFQLVTGRVWKGSAFGGIKGRSEMGGL+ DY  G LKV+EFITHRR F +IN A
Sbjct: 304 KEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLVSDYMDGKLKVDEFITHRRGFTDINSA 363

Query: 367 FEDLHNGDCLRTVLKFDE 384
           FEDLH+GDCLRTVL   +
Sbjct: 364 FEDLHHGDCLRTVLDLSK 381

>TDEL0C01980 Chr3 (344639..345796) [1158 bp, 385 aa] {ON} Anc_7.350
           YDL168W
          Length = 385

 Score =  613 bits (1580), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 305/380 (80%), Positives = 333/380 (87%)

Query: 3   AATVGKPIKCIAAVAYDAKKPSSVEEITVDAPKAHEVRIKIEYTAVCHTDAYTLSGSDPE 62
           AAT GK I C+AAVAY+A KP +VEEITV+AP+AHEVRIKIEYTAVCHTDAYTLSG DPE
Sbjct: 4   AATEGKSITCVAAVAYEAGKPLTVEEITVEAPRAHEVRIKIEYTAVCHTDAYTLSGVDPE 63

Query: 63  GLFPCILGHEGAGIVESVGDGVVTVKPGDHVIALYTAECGKCKFCTSGKTNLCSAVRATQ 122
           G FP ILGHEGAGIVESVG+GV  VKPGDHVIALYTAEC KCKFC SGKTNLCS+VRATQ
Sbjct: 64  GAFPSILGHEGAGIVESVGEGVTNVKPGDHVIALYTAECQKCKFCKSGKTNLCSSVRATQ 123

Query: 123 GKGVMPDGTTRFHNAKGKDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDASCLLGCGVT 182
           GKGVMPDGT+RF N KG+++ HFMGCSTFS+YTVVADVSVVA+DP APL++ CLLGCGVT
Sbjct: 124 GKGVMPDGTSRFKNQKGEELKHFMGCSTFSQYTVVADVSVVAVDPSAPLESICLLGCGVT 183

Query: 183 TGYGAAVKTANVQKGDTVAVFGCGTVGLSVIQGAKLRGASKIIAVDINNNKKKYCSQFGA 242
           TGYGAA KTANVQKGDTVAVFG GTVGLSVIQGAK+RGAS+II VDIN+ K+KY ++FGA
Sbjct: 184 TGYGAATKTANVQKGDTVAVFGAGTVGLSVIQGAKVRGASRIILVDINDQKRKYGNEFGA 243

Query: 243 TDFINPKEDLAKDQTIVEKLVEMTDGGLDFTFDCTGNTKIMRDALEACHKGWGQSXXXXX 302
           TDFINPK DL   QTIVEKL+EMTDGGLD+TFDCTGNTK+MRDALEACHKGWG S     
Sbjct: 244 TDFINPKSDLKDGQTIVEKLIEMTDGGLDYTFDCTGNTKVMRDALEACHKGWGTSVIIGV 303

Query: 303 XXXXXXXSTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQSGVLKVEEFITHRRPFKE 362
                  STRPFQLVTGRVWKGSAFGGIKGRSEMGGLI+DY+ G LKV+EFIT+ RPF E
Sbjct: 304 AAAEEEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIEDYKKGTLKVDEFITNERPFTE 363

Query: 363 INHAFEDLHNGDCLRTVLKF 382
           IN AFEDLH GDCLRTVL  
Sbjct: 364 INKAFEDLHAGDCLRTVLDL 383

>KLLA0D12342g Chr4 (1050181..1051335) [1155 bp, 384 aa] {ON} highly
           similar to uniprot|P32771 Saccharomyces cerevisiae
           YDL168W SFA1 Long-chain alcohol dehydrogenase
           (glutathione-dependent formaldehyde dehydrogenase)
          Length = 384

 Score =  611 bits (1576), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 289/382 (75%), Positives = 327/382 (85%)

Query: 1   MSAATVGKPIKCIAAVAYDAKKPSSVEEITVDAPKAHEVRIKIEYTAVCHTDAYTLSGSD 60
           M++AT GKPI+C+AAVAY+A KP +VE+I VDAPKAHEVR+++ +TAVCHTDAYTLSG D
Sbjct: 1   MTSATAGKPIECVAAVAYEAGKPLTVEKIIVDAPKAHEVRVQVTHTAVCHTDAYTLSGVD 60

Query: 61  PEGLFPCILGHEGAGIVESVGDGVVTVKPGDHVIALYTAECGKCKFCTSGKTNLCSAVRA 120
           PEG FP ILGHEGAGIVESVGDGV  VK GDHV+ LYTAECGKCKFC S KTNLC +VRA
Sbjct: 61  PEGAFPSILGHEGAGIVESVGDGVTNVKVGDHVVLLYTAECGKCKFCKSNKTNLCGSVRA 120

Query: 121 TQGKGVMPDGTTRFHNAKGKDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDASCLLGCG 180
           TQGKGVMPDGTTRFHN KG+ + HFMGCSTFS+YTVVADVS+V IDP APL + CLLGCG
Sbjct: 121 TQGKGVMPDGTTRFHNLKGEPLLHFMGCSTFSQYTVVADVSLVTIDPSAPLSSVCLLGCG 180

Query: 181 VTTGYGAAVKTANVQKGDTVAVFGCGTVGLSVIQGAKLRGASKIIAVDINNNKKKYCSQF 240
           VTTGYGAAVKTANVQ+GDTVAVFG GTVGLSV+QGAK RGASKII VD+N+ KK++   F
Sbjct: 181 VTTGYGAAVKTANVQEGDTVAVFGAGTVGLSVVQGAKSRGASKIIVVDVNDQKKQWSMDF 240

Query: 241 GATDFINPKEDLAKDQTIVEKLVEMTDGGLDFTFDCTGNTKIMRDALEACHKGWGQSXXX 300
           GAT F+NP +DL + +TIV KL++MTDGGLDFTFDCTGN K+MRDALEACHKGWGQS   
Sbjct: 241 GATGFVNPLKDLKEGETIVSKLIDMTDGGLDFTFDCTGNVKVMRDALEACHKGWGQSIII 300

Query: 301 XXXXXXXXXSTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQSGVLKVEEFITHRRPF 360
                    STRPFQL+TGRVWKGSAFGGIKGRSEMG L+  YQ G LKV++FITH+RPF
Sbjct: 301 GVAAAGEEISTRPFQLITGRVWKGSAFGGIKGRSEMGQLVTSYQKGDLKVDDFITHKRPF 360

Query: 361 KEINHAFEDLHNGDCLRTVLKF 382
            EIN+AFEDLH+GDCLRTVL  
Sbjct: 361 TEINNAFEDLHHGDCLRTVLDL 382

>ZYRO0F11704g Chr6 complement(958546..959694) [1149 bp, 382 aa] {ON}
           highly similar to uniprot|P32771 Saccharomyces
           cerevisiae YDL168W SFA1 Long-chain alcohol dehydrogenase
           (glutathione-dependent formaldehyde dehydrogenase)
          Length = 382

 Score =  609 bits (1571), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 302/381 (79%), Positives = 332/381 (87%)

Query: 4   ATVGKPIKCIAAVAYDAKKPSSVEEITVDAPKAHEVRIKIEYTAVCHTDAYTLSGSDPEG 63
           +T GKP+  +AAVAY+A KP SVEEITVD PKAHEVRI+++ TAVCHTDAYTLSG+DPEG
Sbjct: 2   STEGKPVTSLAAVAYEAGKPLSVEEITVDPPKAHEVRIRVKKTAVCHTDAYTLSGADPEG 61

Query: 64  LFPCILGHEGAGIVESVGDGVVTVKPGDHVIALYTAECGKCKFCTSGKTNLCSAVRATQG 123
            FP ILGHEGAGIVESVG+GV +VKPGDHV+ALYTAECGKCKFC SGKTNLC +VRATQG
Sbjct: 62  AFPSILGHEGAGIVESVGEGVTSVKPGDHVVALYTAECGKCKFCKSGKTNLCGSVRATQG 121

Query: 124 KGVMPDGTTRFHNAKGKDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDASCLLGCGVTT 183
           KGVMPDGT+RF N KG+ + HFMGCSTFSEYTVVADVSVVA+DPKAPL+++CLLGCGVTT
Sbjct: 122 KGVMPDGTSRFKNKKGETLLHFMGCSTFSEYTVVADVSVVAVDPKAPLESACLLGCGVTT 181

Query: 184 GYGAAVKTANVQKGDTVAVFGCGTVGLSVIQGAKLRGASKIIAVDINNNKKKYCSQFGAT 243
           GYGAAVKTANVQKGDTVA+FG GTVGLSV QGAK RGAS+II VDIN+ KKKY  +FGAT
Sbjct: 182 GYGAAVKTANVQKGDTVAIFGAGTVGLSVAQGAKARGASQIILVDINDAKKKYMHEFGAT 241

Query: 244 DFINPKEDLAKDQTIVEKLVEMTDGGLDFTFDCTGNTKIMRDALEACHKGWGQSXXXXXX 303
           DFINP  DL   QTIVEKL+EMTDGGLDFTFDCTGN K+MRDALEACHKGWG S      
Sbjct: 242 DFINPATDLQNGQTIVEKLIEMTDGGLDFTFDCTGNVKVMRDALEACHKGWGVSVVIGVA 301

Query: 304 XXXXXXSTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQSGVLKVEEFITHRRPFKEI 363
                 STRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQ G LKV+EFIT+RRPFK+I
Sbjct: 302 ASGQEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQGGALKVDEFITNRRPFKQI 361

Query: 364 NHAFEDLHNGDCLRTVLKFDE 384
           N AFEDLH GD LRTVL + +
Sbjct: 362 NEAFEDLHAGDSLRTVLNYTD 382

>NCAS0A14160 Chr1 complement(2782022..2783377) [1356 bp, 451 aa]
           {ON} Anc_7.350
          Length = 451

 Score =  607 bits (1566), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 302/380 (79%), Positives = 333/380 (87%)

Query: 3   AATVGKPIKCIAAVAYDAKKPSSVEEITVDAPKAHEVRIKIEYTAVCHTDAYTLSGSDPE 62
           ++T GKPI C AAVAY A KP +VE+I VD PKAHEVRIKIEYTAVCHTDAYTLSG DPE
Sbjct: 70  SSTQGKPITCTAAVAYAAGKPLTVEQIVVDPPKAHEVRIKIEYTAVCHTDAYTLSGIDPE 129

Query: 63  GLFPCILGHEGAGIVESVGDGVVTVKPGDHVIALYTAECGKCKFCTSGKTNLCSAVRATQ 122
           G FP ILGHEG+GIVESVG+GV  VK GDHVIALYTAECGKCKFC SGKTNLC +VRATQ
Sbjct: 130 GAFPSILGHEGSGIVESVGEGVTNVKVGDHVIALYTAECGKCKFCKSGKTNLCGSVRATQ 189

Query: 123 GKGVMPDGTTRFHNAKGKDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDASCLLGCGVT 182
           GKGVMPDGT+RFHN KG+ + HFMGCSTFS+YTVVADVSVVA+DPKAPLD+  LLGCGVT
Sbjct: 190 GKGVMPDGTSRFHNQKGEPLLHFMGCSTFSQYTVVADVSVVAVDPKAPLDSISLLGCGVT 249

Query: 183 TGYGAAVKTANVQKGDTVAVFGCGTVGLSVIQGAKLRGASKIIAVDINNNKKKYCSQFGA 242
           TGYGAA+KTANVQKGDTVAVFG GTVGLSV+QGAK RGASKII VDINN+KK++   FGA
Sbjct: 250 TGYGAAIKTANVQKGDTVAVFGAGTVGLSVVQGAKSRGASKIIVVDINNDKKQWSFDFGA 309

Query: 243 TDFINPKEDLAKDQTIVEKLVEMTDGGLDFTFDCTGNTKIMRDALEACHKGWGQSXXXXX 302
           TDF+NPKEDL + +TIV+KL+EMTDGGL++TFDCTGN K+MRDALEACHKGWG+S     
Sbjct: 310 TDFVNPKEDLKEGETIVQKLIEMTDGGLEYTFDCTGNVKVMRDALEACHKGWGESIIIGV 369

Query: 303 XXXXXXXSTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQSGVLKVEEFITHRRPFKE 362
                  STRPFQLVTGRVWKGSAFGGIKGRSEMGGLI+DYQ+G LKV+EFITHRRPF E
Sbjct: 370 AGAGEEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIEDYQNGKLKVDEFITHRRPFTE 429

Query: 363 INHAFEDLHNGDCLRTVLKF 382
           IN AFEDLH+GDCLRTVL  
Sbjct: 430 INDAFEDLHHGDCLRTVLDL 449

>TPHA0F02970 Chr6 complement(653405..654550) [1146 bp, 381 aa] {ON}
           Anc_7.350 YDL168W
          Length = 381

 Score =  599 bits (1544), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 291/380 (76%), Positives = 319/380 (83%), Gaps = 3/380 (0%)

Query: 1   MSAATVGKPIKCIAAVAYDAKKPSSVEEITVDAPKAHEVRIKIEYTAVCHTDAYTLSGSD 60
           MSA  VGKPI C AA+AY+A KP +V EI VD PKAHEVRIKI  TAVCHTDAY+LSG D
Sbjct: 1   MSA--VGKPITCTAAIAYEANKPLTVTEIVVDPPKAHEVRIKIVKTAVCHTDAYSLSGVD 58

Query: 61  PEGLFPCILGHEGAGIVESVGDGVVTVKPGDHVIALYTAECGKCKFCTSGKTNLCSAVRA 120
           PEGLFPC+LGHEG+GIVES+G  V  VK GDHVIALYTAECGKCKFC SGKTNLC +VRA
Sbjct: 59  PEGLFPCVLGHEGSGIVESIGADVTNVKVGDHVIALYTAECGKCKFCLSGKTNLCGSVRA 118

Query: 121 TQGKGVMPDGTTRFHNAKGKDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDASCLLGCG 180
           TQGKGVMPDGTTRFH+  GK IYHFMGCSTFS+YTVVADVS+VA D     + + LLGCG
Sbjct: 119 TQGKGVMPDGTTRFHDKDGKPIYHFMGCSTFSQYTVVADVSLVAFDKSVSFEPTALLGCG 178

Query: 181 VTTGYGAAVKTANVQKGDTVAVFGCGTVGLSVIQGAKLRGASKIIAVDINNNKKKYCSQF 240
           VTTGYGAA+KTAN+QKGDTVAVFG GTVGLSV+QGAK RGASKII VD+NN+KK +  +F
Sbjct: 179 VTTGYGAAIKTANIQKGDTVAVFGAGTVGLSVVQGAKSRGASKIIVVDLNNDKKDWSFEF 238

Query: 241 GATDFINPKEDLAKDQTIVEKLVEMTDGGLDFTFDCTGNTKIMRDALEACHKGWGQSXXX 300
           GATDF+NPKE L   + IV KL+EMTDGGLDFTFDCTGN  +MR+ALEACHKGWGQS   
Sbjct: 239 GATDFVNPKE-LKDSEDIVSKLIEMTDGGLDFTFDCTGNVNVMRNALEACHKGWGQSIII 297

Query: 301 XXXXXXXXXSTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQSGVLKVEEFITHRRPF 360
                    +TRPFQLVTGRVW+GSAFGGIKGRSEMGGLIKDYQSG LKV+EFIT RRPF
Sbjct: 298 GVAAAGQEIATRPFQLVTGRVWRGSAFGGIKGRSEMGGLIKDYQSGTLKVDEFITGRRPF 357

Query: 361 KEINHAFEDLHNGDCLRTVL 380
            EIN AFEDLHNG CLRTVL
Sbjct: 358 TEINAAFEDLHNGSCLRTVL 377

>TBLA0E00390 Chr5 complement(71890..73041) [1152 bp, 383 aa] {ON} 
          Length = 383

 Score =  599 bits (1544), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 287/382 (75%), Positives = 322/382 (84%)

Query: 3   AATVGKPIKCIAAVAYDAKKPSSVEEITVDAPKAHEVRIKIEYTAVCHTDAYTLSGSDPE 62
           + T GKPIKC+AAVAY A +P +VEEI V+ P+AHEVRIKI +TAVCHTDAYTLSG DPE
Sbjct: 2   SETQGKPIKCLAAVAYKAAEPLTVEEIIVEPPEAHEVRIKITHTAVCHTDAYTLSGVDPE 61

Query: 63  GLFPCILGHEGAGIVESVGDGVVTVKPGDHVIALYTAECGKCKFCTSGKTNLCSAVRATQ 122
           G FPC+LGHEG+GIVESVG+GV +VK GDHVIALYTAECG CKFC SGKTNLC +VR TQ
Sbjct: 62  GAFPCVLGHEGSGIVESVGEGVSSVKVGDHVIALYTAECGVCKFCKSGKTNLCGSVRETQ 121

Query: 123 GKGVMPDGTTRFHNAKGKDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDASCLLGCGVT 182
           GKGVMPDGT+RF N KG+ + HFMGCSTFS+YTVVADVSVVAI+  APL + CLLGCGVT
Sbjct: 122 GKGVMPDGTSRFKNLKGESLLHFMGCSTFSQYTVVADVSVVAINKTAPLQSVCLLGCGVT 181

Query: 183 TGYGAAVKTANVQKGDTVAVFGCGTVGLSVIQGAKLRGASKIIAVDINNNKKKYCSQFGA 242
           TGYGAA+KTANVQK DTVAVFG GTVGLSV+QGA+ RGASKII VD+N+ K+ Y  QFGA
Sbjct: 182 TGYGAAIKTANVQKNDTVAVFGAGTVGLSVVQGAQARGASKIIMVDVNSKKETYSRQFGA 241

Query: 243 TDFINPKEDLAKDQTIVEKLVEMTDGGLDFTFDCTGNTKIMRDALEACHKGWGQSXXXXX 302
           TDFINP  DL   +TIV KLVEMTDGGLD TFDCTGN K+MRDALE CHKGWGQS     
Sbjct: 242 TDFINPMTDLKPGETIVSKLVEMTDGGLDHTFDCTGNVKVMRDALECCHKGWGQSIIIGV 301

Query: 303 XXXXXXXSTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQSGVLKVEEFITHRRPFKE 362
                  STRPFQLVTGRVWKGSAFGG+KGRSEMGGLI+ YQ G LKV++FIT++RPF E
Sbjct: 302 AAAGQEISTRPFQLVTGRVWKGSAFGGVKGRSEMGGLIESYQKGDLKVDQFITNKRPFTE 361

Query: 363 INHAFEDLHNGDCLRTVLKFDE 384
           IN AFEDLH+GDCLRTVL  ++
Sbjct: 362 INAAFEDLHHGDCLRTVLDLEK 383

>SAKL0F11374g Chr6 complement(885478..886629) [1152 bp, 383 aa] {ON}
           highly similar to uniprot|P32771 Saccharomyces
           cerevisiae YDL168W SFA1 Long-chain alcohol dehydrogenase
           (glutathione-dependent formaldehyde dehydrogenase)
          Length = 383

 Score =  597 bits (1540), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 295/380 (77%), Positives = 326/380 (85%)

Query: 5   TVGKPIKCIAAVAYDAKKPSSVEEITVDAPKAHEVRIKIEYTAVCHTDAYTLSGSDPEGL 64
           TVGKPI C+AAVAY+A KP +VEEI V+ PKAHEVRI+I YTAVCHTDAYTLSG DPEG 
Sbjct: 4   TVGKPITCLAAVAYEAGKPLTVEEIIVEPPKAHEVRIRITYTAVCHTDAYTLSGVDPEGA 63

Query: 65  FPCILGHEGAGIVESVGDGVVTVKPGDHVIALYTAECGKCKFCTSGKTNLCSAVRATQGK 124
           FP ILGHEGAG+VESVG GV  VKPGDHV+ALYTAEC KCKFCTSGKTNLC +VRATQGK
Sbjct: 64  FPSILGHEGAGVVESVGKGVTNVKPGDHVVALYTAECQKCKFCTSGKTNLCGSVRATQGK 123

Query: 125 GVMPDGTTRFHNAKGKDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDASCLLGCGVTTG 184
           GVMPDGT+RF    G+ I HFMGCSTFS+YTVVADVSVVA+D +APLD  CLLGCGVTTG
Sbjct: 124 GVMPDGTSRFRTKNGESILHFMGCSTFSQYTVVADVSVVAVDSQAPLDRICLLGCGVTTG 183

Query: 185 YGAAVKTANVQKGDTVAVFGCGTVGLSVIQGAKLRGASKIIAVDINNNKKKYCSQFGATD 244
           YGAA+KTANVQKGDTVAVFG GTVGLSV+QGAK RGAS+II VDIN+ KK++ S FGATD
Sbjct: 184 YGAAIKTANVQKGDTVAVFGAGTVGLSVVQGAKARGASRIIVVDINDQKKQWASDFGATD 243

Query: 245 FINPKEDLAKDQTIVEKLVEMTDGGLDFTFDCTGNTKIMRDALEACHKGWGQSXXXXXXX 304
           F+NP +DL + +TIV KL+E+TDGGLDFTFDCTGNTK+MRDALEACHKGWGQS       
Sbjct: 244 FVNPSKDLKEGETIVSKLIELTDGGLDFTFDCTGNTKVMRDALEACHKGWGQSIIIGVAA 303

Query: 305 XXXXXSTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQSGVLKVEEFITHRRPFKEIN 364
                STRPFQLVTGRVWKGSAFGGIKGRSEMGGL+ DY  G LKV+EFITHRRPF EIN
Sbjct: 304 AGQEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLVSDYMDGQLKVDEFITHRRPFTEIN 363

Query: 365 HAFEDLHNGDCLRTVLKFDE 384
            AF+DLH+GDCLRTVL   +
Sbjct: 364 AAFDDLHHGDCLRTVLDLSK 383

>Ecym_4723 Chr4 (1415078..1416223) [1146 bp, 381 aa] {ON} similar to
           Ashbya gossypii ACL148C
          Length = 381

 Score =  594 bits (1532), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 289/378 (76%), Positives = 317/378 (83%)

Query: 5   TVGKPIKCIAAVAYDAKKPSSVEEITVDAPKAHEVRIKIEYTAVCHTDAYTLSGSDPEGL 64
           T GK I+C AA+AY A  P  +E ITVD PKAHEVRIKI +TA+CHTDAYTLSG DPEG+
Sbjct: 4   TAGKTIQCKAAIAYTAGNPLKIETITVDPPKAHEVRIKITHTALCHTDAYTLSGVDPEGI 63

Query: 65  FPCILGHEGAGIVESVGDGVVTVKPGDHVIALYTAECGKCKFCTSGKTNLCSAVRATQGK 124
           FP ILGHEG+GIVESVG GV  VK GDHVI LYTAEC +CKFC SGKTNLC +VRATQGK
Sbjct: 64  FPSILGHEGSGIVESVGTGVTNVKVGDHVIPLYTAECQECKFCISGKTNLCGSVRATQGK 123

Query: 125 GVMPDGTTRFHNAKGKDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDASCLLGCGVTTG 184
           G+MPDGT+RF N+KG+ IYHFMGCSTFSEYTVVADVSVVAID KAPLD  CLLGCGVTTG
Sbjct: 124 GLMPDGTSRFKNSKGEVIYHFMGCSTFSEYTVVADVSVVAIDEKAPLDKVCLLGCGVTTG 183

Query: 185 YGAAVKTANVQKGDTVAVFGCGTVGLSVIQGAKLRGASKIIAVDINNNKKKYCSQFGATD 244
           YGAAVKTA+VQKGDTVAVFG GTVGLSV+QGA+ RGASKII VDIN++KKK+   FGATD
Sbjct: 184 YGAAVKTADVQKGDTVAVFGAGTVGLSVVQGAQSRGASKIIVVDINDDKKKWSFDFGATD 243

Query: 245 FINPKEDLAKDQTIVEKLVEMTDGGLDFTFDCTGNTKIMRDALEACHKGWGQSXXXXXXX 304
           FINP +DL   +TIV KL++MTDGGLD TFDCTGNTK+MRDALEACHKGWGQS       
Sbjct: 244 FINPTKDLNDGETIVSKLIDMTDGGLDHTFDCTGNTKVMRDALEACHKGWGQSIIIGVAA 303

Query: 305 XXXXXSTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQSGVLKVEEFITHRRPFKEIN 364
                STRPFQLVTGRVWKGSAFGGIKGRSEMG LI DY +G LKV+EF+TH RPF EIN
Sbjct: 304 AGQEISTRPFQLVTGRVWKGSAFGGIKGRSEMGNLISDYFAGKLKVDEFVTHTRPFSEIN 363

Query: 365 HAFEDLHNGDCLRTVLKF 382
               DLH+GDCLRTVL F
Sbjct: 364 DGLTDLHHGDCLRTVLNF 381

>ACL148C Chr3 complement(90932..92077) [1146 bp, 381 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDL168W
           (SFA1)
          Length = 381

 Score =  592 bits (1527), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 289/380 (76%), Positives = 329/380 (86%)

Query: 3   AATVGKPIKCIAAVAYDAKKPSSVEEITVDAPKAHEVRIKIEYTAVCHTDAYTLSGSDPE 62
           + T GKPI+C AAVAY A +P  +E++TVD PKAHEVRIKI  +A+CHTDAYTLSGSDPE
Sbjct: 2   SETQGKPIQCTAAVAYAAGEPLRIEKVTVDPPKAHEVRIKIVNSAICHTDAYTLSGSDPE 61

Query: 63  GLFPCILGHEGAGIVESVGDGVVTVKPGDHVIALYTAECGKCKFCTSGKTNLCSAVRATQ 122
           GLFPCILGHEG+GIVESVG+GV  VKPGDHV+ LYTAEC +CKFC SGKTNLC AVRATQ
Sbjct: 62  GLFPCILGHEGSGIVESVGEGVTNVKPGDHVVPLYTAECQQCKFCVSGKTNLCGAVRATQ 121

Query: 123 GKGVMPDGTTRFHNAKGKDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDASCLLGCGVT 182
           GKGVMPDGT+RF N KG+ +YHFMGCSTFSEYTVVADVSVVA+D +APL+  CLLGCGVT
Sbjct: 122 GKGVMPDGTSRFRNGKGETLYHFMGCSTFSEYTVVADVSVVAVDQQAPLETVCLLGCGVT 181

Query: 183 TGYGAAVKTANVQKGDTVAVFGCGTVGLSVIQGAKLRGASKIIAVDINNNKKKYCSQFGA 242
           TGYGAAVKTA+VQ+GDTVAVFG GTVGLSV+QGAK R AS+II VDIN+ K+++ S+FGA
Sbjct: 182 TGYGAAVKTADVQEGDTVAVFGAGTVGLSVVQGAKARNASRIIVVDINDAKREWASKFGA 241

Query: 243 TDFINPKEDLAKDQTIVEKLVEMTDGGLDFTFDCTGNTKIMRDALEACHKGWGQSXXXXX 302
           TDFINPK DL + +TIV +L+EMTDGGLD TFDCTGNTK+MRDALEACHKGWGQS     
Sbjct: 242 TDFINPKTDLKEGETIVARLIEMTDGGLDHTFDCTGNTKVMRDALEACHKGWGQSIIIGV 301

Query: 303 XXXXXXXSTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQSGVLKVEEFITHRRPFKE 362
                  STRPFQLVTGRVWKGSAFGGIKGRSEMGGL++DY +G LKV+EF+TH+RPF+E
Sbjct: 302 AAAGQEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLVRDYLNGTLKVQEFVTHKRPFEE 361

Query: 363 INHAFEDLHNGDCLRTVLKF 382
           IN  FEDLH+GDCLRTVL  
Sbjct: 362 INSGFEDLHHGDCLRTVLSL 381

>KAFR0B00880 Chr2 complement(164475..165620) [1146 bp, 381 aa] {ON}
           Anc_7.350 YDL168W
          Length = 381

 Score =  583 bits (1503), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 277/380 (72%), Positives = 317/380 (83%)

Query: 3   AATVGKPIKCIAAVAYDAKKPSSVEEITVDAPKAHEVRIKIEYTAVCHTDAYTLSGSDPE 62
           ++T GK I+C AAVAY+AKKP  V+++ VDAPKAHEVRIKI  TA+CHTDAYTLSG DPE
Sbjct: 2   SSTQGKAIQCKAAVAYEAKKPLVVQDVIVDAPKAHEVRIKIMNTAICHTDAYTLSGVDPE 61

Query: 63  GLFPCILGHEGAGIVESVGDGVVTVKPGDHVIALYTAECGKCKFCTSGKTNLCSAVRATQ 122
           GLFPCILGHEG+GIVES+G+GV +VK GDHVI LYTAEC KCKFC SGKTNLC AVR TQ
Sbjct: 62  GLFPCILGHEGSGIVESIGEGVTSVKVGDHVIPLYTAECQKCKFCKSGKTNLCGAVRETQ 121

Query: 123 GKGVMPDGTTRFHNAKGKDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDASCLLGCGVT 182
           GKGVMPDGT+RFH  +GKDI+HFMGCSTFSEYTVVADVSVVAID K  L+ + LLGCGVT
Sbjct: 122 GKGVMPDGTSRFHTLEGKDIFHFMGCSTFSEYTVVADVSVVAIDKKVSLEPASLLGCGVT 181

Query: 183 TGYGAAVKTANVQKGDTVAVFGCGTVGLSVIQGAKLRGASKIIAVDINNNKKKYCSQFGA 242
           TG+GAAVK ANVQKGDTVAVFG GTVGLSV+QGA++RG SK+I VDIN+ KK++   FGA
Sbjct: 182 TGFGAAVKAANVQKGDTVAVFGAGTVGLSVVQGARMRGCSKVIVVDINDEKKQFSYDFGA 241

Query: 243 TDFINPKEDLAKDQTIVEKLVEMTDGGLDFTFDCTGNTKIMRDALEACHKGWGQSXXXXX 302
           TDF+NP  DL   +TIV KL+ MTDGGLD+TFDCTGN  +MR+ALEACHKGWGQS     
Sbjct: 242 TDFVNPMTDLKDGETIVNKLISMTDGGLDYTFDCTGNVHVMRNALEACHKGWGQSFIIGV 301

Query: 303 XXXXXXXSTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQSGVLKVEEFITHRRPFKE 362
                  STRPFQLVTGRVW+G+AFG IKGR++M  L+ DY+ G+LK++EFITHRR F E
Sbjct: 302 AAAGQEISTRPFQLVTGRVWRGTAFGDIKGRTDMPQLLDDYEKGLLKIDEFITHRRQFDE 361

Query: 363 INHAFEDLHNGDCLRTVLKF 382
           IN  FEDLH G CLRTVLKF
Sbjct: 362 INDGFEDLHMGTCLRTVLKF 381

>KNAG0C03790 Chr3 complement(745394..746542) [1149 bp, 382 aa] {ON}
           Anc_7.350 YDL168W
          Length = 382

 Score =  517 bits (1331), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 264/382 (69%), Positives = 301/382 (78%), Gaps = 3/382 (0%)

Query: 3   AATVGKPIKCIAAVAYDAKKPSSVEEITVDAPK-AHEVRIKIEYTAVCHTDAYTLS-GSD 60
           A T G+ I C AAVAY A KP +VE+ITV+AP  A       ++  + H   +++  GS+
Sbjct: 2   ANTEGQTITCTAAVAYAAGKPLTVEQITVEAPTGARGAYQDHQHCYLPHGCVHSVWFGSE 61

Query: 61  PEGLFPCILGHEGAGIVESVGDGVVTVKPGDHVIALYTAECGKCKFCTSGKTNLCSAVRA 120
              +  C  G  GAG+VESVG  V +VK GDHVIALYTAEC +CK C SGKTNLCSAVRA
Sbjct: 62  VRCVSLC-FGARGAGVVESVGPDVTSVKVGDHVIALYTAECKECKMCKSGKTNLCSAVRA 120

Query: 121 TQGKGVMPDGTTRFHNAKGKDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDASCLLGCG 180
           TQGKGVMPDGT+RF N+KG+ + HFMGCSTF+EYTVVADVSVVAID  APL+  CLLGCG
Sbjct: 121 TQGKGVMPDGTSRFRNSKGEPLLHFMGCSTFAEYTVVADVSVVAIDRDAPLEKVCLLGCG 180

Query: 181 VTTGYGAAVKTANVQKGDTVAVFGCGTVGLSVIQGAKLRGASKIIAVDINNNKKKYCSQF 240
           VTTGYGAA+KTANVQKGDTVAVFG GT+GLSV+QGAK R ASKII VDIN+ KKK+   F
Sbjct: 181 VTTGYGAALKTANVQKGDTVAVFGAGTIGLSVVQGAKAREASKIIVVDINDTKKKFAFDF 240

Query: 241 GATDFINPKEDLAKDQTIVEKLVEMTDGGLDFTFDCTGNTKIMRDALEACHKGWGQSXXX 300
           GATDF+NPK DL   QTIVEKLVEMTDGGLDFTFD TGN ++MRDALEACHKGWGQS   
Sbjct: 241 GATDFVNPKTDLKDGQTIVEKLVEMTDGGLDFTFDGTGNVQVMRDALEACHKGWGQSIII 300

Query: 301 XXXXXXXXXSTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQSGVLKVEEFITHRRPF 360
                    STRPFQLVTGRVWKGSAFGG+KGRSEMG LI+DY  G LK++EFIT++RPF
Sbjct: 301 GVAAAGKEISTRPFQLVTGRVWKGSAFGGVKGRSEMGSLIEDYNKGNLKIDEFITNKRPF 360

Query: 361 KEINHAFEDLHNGDCLRTVLKF 382
           KEIN  FEDLH+GDCLRTVL +
Sbjct: 361 KEINEGFEDLHHGDCLRTVLNY 382

>NDAI0A01890 Chr1 (425090..426358) [1269 bp, 422 aa] {ON} Anc_7.350
          Length = 422

 Score =  510 bits (1313), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 254/384 (66%), Positives = 284/384 (73%), Gaps = 46/384 (11%)

Query: 1   MSAATVGKPIKCIAAVAYDAKKPSSVEEITVDAPKAHEVRIKIEYTAVCHTDAYTLSGSD 60
           + + T GKPI C AAVAY+A KP +VE+I VD PKAHEVRIKI+YTAVCHTDAYTLSG D
Sbjct: 85  IMSTTQGKPITCTAAVAYEAGKPLTVEDIVVDPPKAHEVRIKIDYTAVCHTDAYTLSGVD 144

Query: 61  PEGLFPCILGHEGAGIVESVGDGVVTVKPGDHVIALYTAECGKCKFCTSGKTNLCSAVRA 120
           PEG FP ILGHEG+GIVESVG+GV  VK GDHVIALYTAECG+CKFC SG          
Sbjct: 145 PEGAFPSILGHEGSGIVESVGEGVTNVKVGDHVIALYTAECGECKFCKSGXXX------- 197

Query: 121 TQGKGVMPDGTTRFHNAKGKDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDASCLLGCG 180
                                                      A+D  AP+D+ CLLGCG
Sbjct: 198 ---------------------------------------XXXXAVDKNAPMDSICLLGCG 218

Query: 181 VTTGYGAAVKTANVQKGDTVAVFGCGTVGLSVIQGAKLRGASKIIAVDINNNKKKYCSQF 240
           VTTGYGAA+KTANVQKGDTVAVFG GTVGLSV+QGAK RGASKII VD+N+ KK++   F
Sbjct: 219 VTTGYGAAIKTANVQKGDTVAVFGAGTVGLSVVQGAKARGASKIIVVDVNDQKKQWSMDF 278

Query: 241 GATDFINPKEDLAKDQTIVEKLVEMTDGGLDFTFDCTGNTKIMRDALEACHKGWGQSXXX 300
           GATDFINPK DL + +TIV KL+EMTDGGL++TFDCTGNTK+MRDALEACHKGWG+S   
Sbjct: 279 GATDFINPKTDLKEGETIVSKLIEMTDGGLEYTFDCTGNTKVMRDALEACHKGWGESIII 338

Query: 301 XXXXXXXXXSTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQSGVLKVEEFITHRRPF 360
                    STRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQ+G LKV+EFITHRRPF
Sbjct: 339 GVAAAGEEISTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQNGNLKVDEFITHRRPF 398

Query: 361 KEINHAFEDLHNGDCLRTVLKFDE 384
            EIN+AFEDLH+GDCLRTVL   +
Sbjct: 399 TEINNAFEDLHHGDCLRTVLDLSK 422

>SAKL0A00880g Chr1 complement(92246..93412) [1167 bp, 388 aa] {ON}
           similar to uniprot|P32771 Saccharomyces cerevisiae
           YDL168W SFA1 Long-chain alcohol dehydrogenase
           (glutathione- dependent formaldehyde dehydrogenase)
          Length = 388

 Score =  426 bits (1094), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 200/375 (53%), Positives = 270/375 (72%), Gaps = 3/375 (0%)

Query: 7   GKPIKCIAAVAYDAKKPSSVEEITVDAPKAHEVRIKIEYTAVCHTDAYTLSGSDPEGLFP 66
           G+PI+C AAVAY   KP  +E+I VD P+ HEVR+K+  TA+C TD +TL G +PEG FP
Sbjct: 6   GEPIRCTAAVAYSINKPLVLEQIIVDPPQEHEVRVKVTNTALCRTDLFTLKGLNPEGKFP 65

Query: 67  CILGHEGAGIVESVGDGVVTVKPGDHVIALYTAECGKCKFCTSGKTNLCSAVRATQGKGV 126
           C+LGHEG+GIVES G  V TVK GDHV+ LY  ECG C  C S K+NLCS ++ATQ +GV
Sbjct: 66  CVLGHEGSGIVESCGSKVETVKKGDHVLLLYIPECGHCADCKSEKSNLCSVIKATQAQGV 125

Query: 127 MPDGTTRFHNAKGKDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDASCLLGCGVTTGYG 186
           MP G++R HN + K ++HFMGCS+FS+Y VV+D+S V I   APLD  CLLGCGVTTG+G
Sbjct: 126 MPQGSSRLHNLENKTLWHFMGCSSFSQYAVVSDISCVKIRDDAPLDKICLLGCGVTTGFG 185

Query: 187 AAVKTANVQKGDTVAVFGCGTVGLSVIQGAKLRGASKIIAVDINNNKKKYCSQFGATDFI 246
           A +    V+ GD VAVFG GTVGLSV+Q        ++I VD+ +NK+++   FGATDFI
Sbjct: 186 API-AKGVKAGDRVAVFGSGTVGLSVVQSCSQLKCFQVIVVDVQDNKREWALGFGATDFI 244

Query: 247 NPKEDLAKDQTIVEKLVEMTDG-GLDFTFDCTGNTKIMRDALEACHKGWGQSXXXXXXXX 305
           NP++ + K++++++ L++ + G G DFTFDCTG+T +MR ALE+C KGWG S        
Sbjct: 245 NPQK-IPKNKSLLQTLIDKSGGDGFDFTFDCTGSTSVMRTALESCRKGWGTSVIIGLAGA 303

Query: 306 XXXXSTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQSGVLKVEEFITHRRPFKEINH 365
               ST P+ L+ GR W+G AFGG+KGRSE+  L++ Y +  +K++E+IT++RP KEIN 
Sbjct: 304 GEEISTLPYNLIVGRSWEGCAFGGVKGRSELPTLVERYMNNEIKLDEYITNKRPLKEINE 363

Query: 366 AFEDLHNGDCLRTVL 380
           A ++L +G  L+TVL
Sbjct: 364 ALKELEDGLVLKTVL 378

>KLLA0D19929g Chr4 (1694826..1695986) [1161 bp, 386 aa] {ON} weakly
           similar to uniprot|P35497 Saccharomyces cerevisiae
           YJR159W SOR1 Sorbitol dehydrogenase
          Length = 386

 Score =  109 bits (273), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 98/339 (28%), Positives = 150/339 (44%), Gaps = 48/339 (14%)

Query: 41  IKIEYTAVCHTDAYTLSGSDPE---------GLFPC-ILGHEGAGIVESVGDGVVTVKPG 90
           IK+ +T++C TD     G +PE         G F   ILGHEG GI++ VGD V   K G
Sbjct: 60  IKMTHTSICGTDLGIWKGKNPEIEQTAQTKEGSFNGRILGHEGIGIIDEVGDAVHNFKKG 119

Query: 91  DHVIALYTAECGKCKFCTSGKTNLCSAVRATQGKGVMPDGTTRFHNAKGKDIYHFMGCST 150
           D VI    + CG C+ C     + C     T G G                I  +M   T
Sbjct: 120 DRVIVSCISRCGTCENCAKSLYSHC-----TNGGGW---------------ILGYMIDGT 159

Query: 151 FSEY--TVVADVSVVAIDPKAPLDASCLLGCGVTTGYGAAVKTANVQKGDTVAVFGCGTV 208
            +EY  T  AD S+ ++      +A+ +L   + T +   V+  NV+ GDTVA+ G G V
Sbjct: 160 QAEYVRTPFADTSLYSVPENLSDEAAVMLSDALPTAHEIGVQMGNVKPGDTVAIVGAGPV 219

Query: 209 GLSVIQGAKLRGASKIIAVDINNNKKKYCSQFGATDFINPKEDLAKDQTIVEKLVEMTDG 268
           G+  +  ++L   S +I VDI++N+     + G+T  IN  ++ A     V K++E T+G
Sbjct: 220 GMGCVLTSQLYSPSLLIVVDIDDNRLAMAKEMGSTHTINSAKEDA-----VSKILEYTNG 274

Query: 269 -GLDFTFDCTGNTKIMRDALEACHKGWGQSXXXXXXXXXXXXSTRPFQLVTGRVW--KGS 325
            G+D   +  G  +   D  +   K  G                +P      ++W    +
Sbjct: 275 RGVDCVMEAVG-AQATWDICQRVIKEGGH-------LANVGVHGKPVNFEIDKLWIKNLT 326

Query: 326 AFGGIKGRSEMGGLIKDYQSGVLKVEEFITHRRPFKEIN 364
              G+   +  G L+K   SG LK E  +TH   F E++
Sbjct: 327 ITSGLVNTNTTGMLMKSCCSGKLKSERLVTHHCNFGEMS 365

>YBR145W Chr2 (533762..534817) [1056 bp, 351 aa] {ON}  ADH5Alcohol
           dehydrogenase isoenzyme V; involved in ethanol
           production
          Length = 351

 Score =  105 bits (263), Expect = 7e-25,   Method: Compositional matrix adjust.
 Identities = 84/264 (31%), Positives = 118/264 (44%), Gaps = 31/264 (11%)

Query: 9   PIKCIAAVAYDAKKPSSVEEITVDAPKAHEVRIKIEYTAVCHTDAYTLSGSDPEGL-FPC 67
           P K  A V Y+       +++TV  PK +E+ + ++Y+ VCH+D +   G  P  L FP 
Sbjct: 7   PEKQKAIVFYETDGKLEYKDVTVPEPKPNEILVHVKYSGVCHSDLHAWHGDWPFQLKFPL 66

Query: 68  ILGHEGAGIVESVGDGVVTVKPGDHV-IALYTAECGKCKFCTSGKTNLCSAVRATQGKGV 126
           I GHEGAG+V  +G  V   K GD   I      C  C++C  G  + C  +        
Sbjct: 67  IGGHEGAGVVVKLGSNVKGWKVGDFAGIKWLNGTCMSCEYCEVGNESQCPYL-------- 118

Query: 127 MPDGTTRFHNAKGKDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDASCLLGCGVTTGYG 186
             DGT   H+             TF EY     V    I P   L     + C   T Y 
Sbjct: 119 --DGTGFTHDG------------TFQEYATADAVQAAHIPPNVNLAEVAPILCAGITVY- 163

Query: 187 AAVKTANVQKGDTVAVFG-CGTVGLSVIQGAKLRGASKIIAVDINNNKKKYCSQFGATDF 245
            A+K ANV  G  V + G CG +G   IQ A   G  ++I +D  N K+K   Q G   F
Sbjct: 164 KALKRANVIPGQWVTISGACGGLGSLAIQYALAMG-YRVIGIDGGNAKRKLFEQLGGEIF 222

Query: 246 INPKEDLAKDQTIVEKLVEMTDGG 269
           I    D  +++ IV  +++ T+GG
Sbjct: 223 I----DFTEEKDIVGAIIKATNGG 242

>KLLA0B00451g Chr2 complement(31822..32982) [1161 bp, 386 aa] {ON}
           weakly similar to uniprot|P35497 Saccharomyces
           cerevisiae YJR159W SOR1 Sorbitol dehydrogenase
          Length = 386

 Score =  104 bits (259), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 96/352 (27%), Positives = 149/352 (42%), Gaps = 49/352 (13%)

Query: 34  PKAHEVR---IKIEYTAVCHTDAYTLSGSDPE---------GLFPC-ILGHEGAGIVESV 80
           PK  + R   IK+  T++C TD     G  PE         G F   +LGHEG GIV  V
Sbjct: 50  PKIIDQRDAIIKMTNTSICGTDVGIWKGKSPEIEEIAVKNEGSFNGRVLGHEGTGIVTEV 109

Query: 81  GDGVVTVKPGDHVIALYTAECGKCKFCTSGKTNLCSAVRATQGKGVMPDGTTRFHNAKGK 140
           GD V  +K GD VI      CG C+ C  G    C           M DG          
Sbjct: 110 GDAVRNIKKGDKVIISCITRCGTCENCARGMYAHC-----------MNDGGWALG----- 153

Query: 141 DIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDASCLLGCGVTTGYGAAVKTANVQKGDTV 200
             Y   G       T  AD S+ A+      + + LL   + T +   V+  NV+ GD+V
Sbjct: 154 --YSIDGTQAEYVRTPFADTSLYALPEGLSDENAVLLSDALPTAHEIGVQMGNVKPGDSV 211

Query: 201 AVFGCGTVGLSVIQGAKLRGASKIIAVDINNNKKKYCSQFGATDFINP-KEDLAKDQTIV 259
           A+ G G VG+  +  ++L   S +I VD+++N+ +   + GAT  IN  KED       V
Sbjct: 212 AILGAGPVGMGCVLTSQLYSPSLLIVVDMDDNRLEMAKEMGATHTINSGKEDA------V 265

Query: 260 EKLVEMTDG-GLDFTFDCTGNTKIMRDALEACHKGWGQSXXXXXXXXXXXXSTRPFQLVT 318
            K++E+T+G G+D   +  G     +   + C     Q               +P     
Sbjct: 266 AKILEITNGRGVDCAMEAVG----AQPTWDICQ----QIIKEGGHLANVGVHGKPVDFAI 317

Query: 319 GRVW--KGSAFGGIKGRSEMGGLIKDYQSGVLKVEEFITHRRPFKEINHAFE 368
            ++W    +   G+   +    L+K+  SG L+ ++ ++H   FK++ + + 
Sbjct: 318 DKLWIKNLTITSGLVNTNTTSMLMKNCCSGKLQSDKLVSHHCNFKDMANNYN 369

>Suva_4.394 Chr4 (702935..703990) [1056 bp, 351 aa] {ON} YBR145W
           (REAL)
          Length = 351

 Score = 97.8 bits (242), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 83/272 (30%), Positives = 119/272 (43%), Gaps = 33/272 (12%)

Query: 1   MSAATVGKPIKCIAAVAYDAKKPSSVEEITVDAPKAHEVRIKIEYTAVCHTDAYTLSGSD 60
           MS+  + +  K I  V Y+       ++I V  PKA+E+ + ++Y+ VCH+D +   G  
Sbjct: 1   MSSQAIPESQKAI--VFYETNGKLEYKDIAVPEPKANEILVHVKYSGVCHSDLHAWRGDW 58

Query: 61  PEGL-FPCILGHEGAGIVESVGDGVVTVKPGDHV-IALYTAECGKCKFCTSGKTNLCSAV 118
           P  L FP I GHEGAG+V  +G  V   K GD   I      C  C++C  G  + C  +
Sbjct: 59  PFQLKFPLIGGHEGAGVVVKLGSNVKGWKVGDLAGIKWLNGTCMSCEYCEVGNESQCPHL 118

Query: 119 RATQGKGVMPDGTTRFHNAKGKDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDASCLLG 178
                     DGT   H+             TF EY     V    +     L     + 
Sbjct: 119 ----------DGTGFTHDG------------TFQEYATADAVQAAHLPENVDLAEVAPIL 156

Query: 179 CGVTTGYGAAVKTANVQKGDTVAVFG-CGTVGLSVIQGAKLRGASKIIAVDINNNKKKYC 237
           C   T Y  A+K AN+  G  V + G CG +G   IQ A   G  ++I +D    KK+  
Sbjct: 157 CAGVTVY-KALKRANLIPGQWVTISGACGGLGSLAIQYATAMG-YRVIGIDEGETKKQLF 214

Query: 238 SQFGATDFINPKEDLAKDQTIVEKLVEMTDGG 269
              G   FI    D  K++ IV  +++ TDGG
Sbjct: 215 EGLGGEVFI----DFTKEKDIVGAVIKATDGG 242

>NCAS0I02350 Chr9 (444097..445152) [1056 bp, 351 aa] {ON} Anc_3.118
          Length = 351

 Score = 97.8 bits (242), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 74/268 (27%), Positives = 122/268 (45%), Gaps = 31/268 (11%)

Query: 27  EEITVDAPKAHEVRIKIEYTAVCHTDAYTLSGSDP-EGLFPCILGHEGAGIVESVGDGVV 85
           ++I V  PK++E+ I ++Y+ VCHTD +   G  P     P + GHEGAG+V ++GD V 
Sbjct: 25  KDIPVPTPKSNEILINVKYSGVCHTDLHAWKGDWPLPTKLPLVGGHEGAGVVVAMGDAVK 84

Query: 86  TVKPGDHV-IALYTAECGKCKFCTSGKTNLCSAVRATQGKGVMPDGTTRFHNAKGKDIYH 144
             K GD+  I      C  C++C  G  + C                         D+  
Sbjct: 85  GWKIGDYAGIKWLNGSCMSCEYCELGNESNCPHA----------------------DLSG 122

Query: 145 FMGCSTFSEYTVVADVSVVAIDPKAPLDASCLLGCGVTTGYGAAVKTANVQKGDTVAVFG 204
           +    +F +Y     V    I P + L     + C   T Y  A+K+AN++ G+ VA+ G
Sbjct: 123 YTHDGSFQQYATADAVQAARIAPGSDLAEVAPVLCAGITVY-KALKSANLRAGEWVAISG 181

Query: 205 -CGTVGLSVIQGAKLRGASKIIAVDINNNKKKYCSQFGATDFINPKEDLAKDQTIVEKLV 263
            CG +G   IQ AK  G  +++ +D  + K K     G   FI    D  K + IV  ++
Sbjct: 182 ACGGLGSLAIQFAKAMG-YRVVGIDGGDEKAKMFKDLGGEVFI----DFTKTKDIVGDII 236

Query: 264 EMTDGGLDFTFDCTGNTKIMRDALEACH 291
           + T+GG     + + + + +  +++ C 
Sbjct: 237 KATNGGAHGVINVSVSEQAIDASVKYCR 264

>Smik_2.284 Chr2 (518341..519396) [1056 bp, 351 aa] {ON} YBR145W
           (REAL)
          Length = 351

 Score = 96.7 bits (239), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 81/272 (29%), Positives = 119/272 (43%), Gaps = 33/272 (12%)

Query: 1   MSAATVGKPIKCIAAVAYDAKKPSSVEEITVDAPKAHEVRIKIEYTAVCHTDAYTLSGSD 60
           MS+  + K  K I  V Y+       +++TV  PK +E+ + ++Y+ VCH+D +   G  
Sbjct: 1   MSSQAIPKTQKAI--VFYETDGKLEYKDVTVPEPKPNEILVHVKYSGVCHSDLHAWHGDW 58

Query: 61  PEGL-FPCILGHEGAGIVESVGDGVVTVKPGDHV-IALYTAECGKCKFCTSGKTNLCSAV 118
           P  L FP I GHEGAG+V  +G  V   K GD   I      C  C++C  G  + C  +
Sbjct: 59  PFQLKFPLIGGHEGAGVVVKLGSNVKGWKVGDLAGIKWLNGTCMSCEYCEVGNESQCPHL 118

Query: 119 RATQGKGVMPDGTTRFHNAKGKDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDASCLLG 178
                     DGT   H+             TF EY     V    I     L     + 
Sbjct: 119 ----------DGTGFTHDG------------TFQEYATADAVQAAHIPQNVNLAEVAPIL 156

Query: 179 CGVTTGYGAAVKTANVQKGDTVAVFG-CGTVGLSVIQGAKLRGASKIIAVDINNNKKKYC 237
           C   T Y  A+K AN+  G  V + G CG +G   IQ A   G  ++I +D    K+K  
Sbjct: 157 CAGITVY-KALKRANLMPGQWVTISGACGGLGSLAIQYALAMG-FRVIGIDGGEAKRKLF 214

Query: 238 SQFGATDFINPKEDLAKDQTIVEKLVEMTDGG 269
            + G   FI    D  K++ +   +++ T+GG
Sbjct: 215 EKLGGEIFI----DFTKERDVAGAVIKATNGG 242

>AER032W Chr5 (696807..697862) [1056 bp, 351 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOL086C (ADH1) and
           YBR145W (ADH5)
          Length = 351

 Score = 95.9 bits (237), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 81/272 (29%), Positives = 121/272 (44%), Gaps = 33/272 (12%)

Query: 1   MSAATVGKPIKCIAAVAYDAKKPSSVEEITVDAPKAHEVRIKIEYTAVCHTDAYTLSGSD 60
           MSA T+ +  K  A + Y+   P    +I V  PKA E+ I ++Y+ VCHTD +   G  
Sbjct: 1   MSAPTIPRTQK--AVIFYENGGPLQYTDIEVPKPKATELLINVKYSGVCHTDLHAWKGDW 58

Query: 61  P-EGLFPCILGHEGAGIVESVGDGVVTVKPGDHV-IALYTAECGKCKFCTSGKTNLCSAV 118
           P     P + GHEGAG+V ++G+ V   K GD   I      C  C++C     + C   
Sbjct: 59  PLPTKLPLVGGHEGAGVVVAMGENVRGWKIGDLAGIKWLNGSCMACEYCEKSNESNC--- 115

Query: 119 RATQGKGVMPDGTTRFHNAKGKDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDASCLLG 178
                    P+           D+  +    +F +Y     V    I     L     + 
Sbjct: 116 ---------PEA----------DLSGYTHDGSFQQYATADAVQAAHIPAGTDLAQVAPIL 156

Query: 179 CGVTTGYGAAVKTANVQKGDTVAVFG-CGTVGLSVIQGAKLRGASKIIAVDINNNKKKYC 237
           C   T Y  A+K+AN++ GD VA+ G CG +G   IQ A   G  +++ +D    K++  
Sbjct: 157 CAGITVY-KALKSANLRAGDWVAISGACGGLGSLAIQYATAMG-YRVLGIDGGEEKEQLF 214

Query: 238 SQFGATDFINPKEDLAKDQTIVEKLVEMTDGG 269
            Q G   FI    D  K + IV  +V+ T+GG
Sbjct: 215 RQLGGEVFI----DFRKSKDIVADVVKATNGG 242

>CAGL0D00198g Chr4 (27559..28710) [1152 bp, 383 aa] {ON} similar to
           uniprot|P39714 Saccharomyces cerevisiae YAL060w FUN49 or
           uniprot|P39713 Saccharomyces cerevisiae YAL061w FUN50
          Length = 383

 Score = 96.3 bits (238), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 86/294 (29%), Positives = 125/294 (42%), Gaps = 65/294 (22%)

Query: 31  VDAPKA---HEVRIKIEYTAVCHTDAYT----------------LSGSDPEGLFPCILGH 71
           +D PK    HE+ I + +  +C TD +                 LSG D     P  +GH
Sbjct: 18  IDTPKINNDHELMIDVAWCGICGTDLHEFLEGPIFMPKDGDTHYLSGLD----LPLPMGH 73

Query: 72  EGAGIVESVGDGVVTVKPGDHVIALYTAECGK--------------CKFCTSGKTNLCSA 117
           E +GIV+ VG GV   KPGD V+   T  CG               C  C  G  N C+ 
Sbjct: 74  EMSGIVKEVGKGVTRFKPGDRVVIEATTSCGDTHRWPKSKVAKGELCPACEMGLPNCCTH 133

Query: 118 VRATQGKGVMPDGTTRFHNAKGKDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDASCLL 177
             + QG G +  G                    F+E  VV +  VV I  K PLD + L+
Sbjct: 134 -GSFQGLGSVGGG--------------------FAEQVVVGEKHVVKIPDKLPLDVAALV 172

Query: 178 GCGVTTGYGAAVKTANVQKGDTVAVFGCGTVGLSVIQGAKLRGASKIIAVDINNNKKKYC 237
              ++  + AA + A  ++G    V G G +GL++I   K   A KI+  +    +++  
Sbjct: 173 E-PLSVAWHAA-RLAEFKEGSNALVLGSGPIGLAMILALKGMKAGKIVVSEPAKLRRELA 230

Query: 238 SQFGATDFINPKEDLAKDQTIVEKLVEMT--DGGLDFTFDCTGNTKIMRDALEA 289
            +     F NP    A  Q  +EKL E++  D G D+TFDC+G       A++A
Sbjct: 231 EKLNVVVF-NPTHTRA--QNAIEKLKELSPKDHGFDYTFDCSGVQDTFNAAVKA 281

>SAKL0C10164g Chr3 complement(914732..915787) [1056 bp, 351 aa] {ON}
           uniprot|Q6XQ74 Saccharomyces kluyveri ADH1 Alcohol
           dehydrogenase 1
          Length = 351

 Score = 95.9 bits (237), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 84/292 (28%), Positives = 129/292 (44%), Gaps = 37/292 (12%)

Query: 1   MSAATVGKPIKCIAAVAYDAKKPSSVEEITVDAPKAHEVRIKIEYTAVCHTDAYTLSGSD 60
           MSA  + +  K  A + Y+       ++I V  PK++E+ I I+Y+ VCHTD +   G  
Sbjct: 1   MSAPQIPETQK--AVIFYENGGELQYKDIPVPKPKSNEILINIKYSGVCHTDLHAWKGDW 58

Query: 61  P-EGLFPCILGHEGAGIVESVGDGVVTVKPGDHV-IALYTAECGKCKFCTSGKTNLCSAV 118
           P     P + GHEGAGIV  +G+ V   K GD+  I      C  C++C     + C   
Sbjct: 59  PLPTKLPLVGGHEGAGIVVGMGENVKGWKIGDYAGIKWLNGSCMSCEYCELSNESNC--- 115

Query: 119 RATQGKGVMPDGTTRFHNAKGKDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDASCLLG 178
                    PD           D+  +    +F +Y     V    I P   L     + 
Sbjct: 116 ---------PDA----------DLSGYTHDGSFQQYATADAVQAARIAPGTDLAEVAPVL 156

Query: 179 CGVTTGYGAAVKTANVQKGDTVAVFG-CGTVGLSVIQGAKLRGASKIIAVDINNNKKKYC 237
           C   T Y  A+K+AN++ G+ VA+ G CG +G   IQ AK  G  +++ +D  + K    
Sbjct: 157 CAGITVY-KALKSANLRAGEWVAISGACGGLGSLAIQYAKAMG-YRVLGIDGGDEKAALF 214

Query: 238 SQFGATDFINPKEDLAKDQTIVEKLVEMTDGGLDFTFDCTGNTKIMRDALEA 289
            + G   FI    D  K + +V+ +V+ T+GG         N  +   A+EA
Sbjct: 215 KELGGEVFI----DFTKTKDVVKAVVDATNGGAHGVI----NVSVSEAAIEA 258

>NCAS0I01720 Chr9 (318144..319199) [1056 bp, 351 aa] {ON} 
          Length = 351

 Score = 94.7 bits (234), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 77/273 (28%), Positives = 123/273 (45%), Gaps = 35/273 (12%)

Query: 23  PSSVEEITVDAPKAHEVRIKIEYTAVCHTDAYTLSGSDP-EGLFPCILGHEGAGIVESVG 81
           P   ++I V  PK++E+ + I+Y+ VCHTD +   G  P +   P + GHEGAGIV ++G
Sbjct: 21  PLEYKDIPVPTPKSNEILVNIKYSGVCHTDLHAWKGDWPLDTKLPLVGGHEGAGIVVAIG 80

Query: 82  DGVVTVKPGDHV-IALYTAECGKCKFCTSGKTNLCSAVRATQGKGVMPDGTTRFHNAKGK 140
           D V   K GD+  +      C  C++C  G  + C                    NA   
Sbjct: 81  DNVKGWKIGDYAGVKWLNGSCMACEYCELGNESNCP-------------------NA--- 118

Query: 141 DIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDASCLLGCGVTTGYGAAVKTANVQKGDTV 200
           D+  +    +F +Y     V    I     L     + C   T Y  A+K+AN++ G+ V
Sbjct: 119 DLSGYTHDGSFQQYATADAVQAARIPAGTNLSEVAPILCAGMTVY-KALKSANLRAGEWV 177

Query: 201 AVFG-CGTVGLSVIQGAKLRGASKIIAVDINNNKKKYCSQFGATDFINPKEDLAKDQTIV 259
           A+ G CG +G   IQ A   G  +++ +D  ++K K   Q     FI    D  K + ++
Sbjct: 178 AISGACGGLGSLCIQYANAMG-YRVLGIDGGDDKAKLFKQLHGEVFI----DFTKTKDVI 232

Query: 260 EKLVEMTDGGLDFTFDCTGNTKIMRDALEACHK 292
            ++ ++T+GG         N  +   A+EA  K
Sbjct: 233 SEVNKVTNGGAHGVI----NVSVSEAAIEASTK 261

>Skud_2.272 Chr2 (501260..502315) [1056 bp, 351 aa] {ON} YBR145W
           (REAL)
          Length = 351

 Score = 94.7 bits (234), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 81/272 (29%), Positives = 118/272 (43%), Gaps = 33/272 (12%)

Query: 1   MSAATVGKPIKCIAAVAYDAKKPSSVEEITVDAPKAHEVRIKIEYTAVCHTDAYTLSGSD 60
           MS+  V K  K I  V Y+       +++ V  PK +E+ + ++Y+ VCH+D +   G  
Sbjct: 1   MSSQVVPKTQKAI--VFYETDGKLEYKDVAVPEPKPNEILVHVKYSGVCHSDLHAWHGDW 58

Query: 61  PEGL-FPCILGHEGAGIVESVGDGVVTVKPGDHV-IALYTAECGKCKFCTSGKTNLCSAV 118
           P  L FP I GHEGAG+V  +G  V   K GD   I      C  C++C  G  + C  +
Sbjct: 59  PFQLKFPLIGGHEGAGVVVKLGSNVKGWKVGDIAGIKWLNGTCMSCEYCEVGNESQCPHL 118

Query: 119 RATQGKGVMPDGTTRFHNAKGKDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDASCLLG 178
                     DGT   H+             TF EY     V    I     L     + 
Sbjct: 119 ----------DGTGFTHDG------------TFQEYATADAVQAAHIPQNVDLAEVAPIL 156

Query: 179 CGVTTGYGAAVKTANVQKGDTVAVFG-CGTVGLSVIQGAKLRGASKIIAVDINNNKKKYC 237
           C   T Y  A+K AN+  G  V + G CG +G   +Q A   G  ++I +D    K+K  
Sbjct: 157 CAGITVY-KALKRANLMPGQWVTISGACGGLGSLAVQYALAMG-YRVIGIDGGEAKQKLF 214

Query: 238 SQFGATDFINPKEDLAKDQTIVEKLVEMTDGG 269
            +     FI    D  K++ +V  +++ TDGG
Sbjct: 215 EELHGEIFI----DFTKEKDVVGAVIKATDGG 242

>KNAG0K02000 Chr11 (410263..411315) [1053 bp, 350 aa] {ON} Anc_3.118
           YBR145W
          Length = 350

 Score = 93.6 bits (231), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 77/270 (28%), Positives = 117/270 (43%), Gaps = 35/270 (12%)

Query: 23  PSSVEEITVDAPKAHEVRIKIEYTAVCHTDAYTLSGSDPEGL-FPCILGHEGAGIVESVG 81
           P   +EI V  PKA+E+ I ++Y+ VCHTD +   G  P  +  P + GHEGAGIV ++G
Sbjct: 20  PLEYKEIPVPKPKANELLINVKYSGVCHTDLHAWHGDWPLPVKLPLVGGHEGAGIVVAMG 79

Query: 82  DGVVTVKPGDHV-IALYTAECGKCKFCTSGKTNLCSAVRATQGKGVMPDGTTRFHNAKGK 140
           D V     GD+  I      C  C+ C     + C                         
Sbjct: 80  DSVKNWNIGDYAGIKWLNGSCMNCESCELANESNCPQA---------------------- 117

Query: 141 DIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDASCLLGCGVTTGYGAAVKTANVQKGDTV 200
           D+  +    +F +Y     V    I     L     + C   T Y  A+K+AN++ GD V
Sbjct: 118 DLSGYTHDGSFQQYATADAVQAAKIPHGTDLAEVAPILCAGVTVY-KALKSANLKAGDWV 176

Query: 201 AVFG-CGTVGLSVIQGAKLRGASKIIAVDINNNKKKYCSQFGATDFINPKEDLAKDQTIV 259
           A+ G CG +G   IQ A   G  +++ +D    K +   + G   FI    D  K + ++
Sbjct: 177 AISGACGGLGSLAIQYATAMG-YRVLGIDGGEEKAELFKKLGGEYFI----DFTKCKDVI 231

Query: 260 EKLVEMTDGGLDFTFDCTGNTKIMRDALEA 289
            +++E+TDGG         N  +   A+EA
Sbjct: 232 AEILEVTDGGAHGVI----NVSVSEAAIEA 257

>TBLA0I01140 Chr9 (233777..234910) [1134 bp, 377 aa] {ON} Anc_2.480
           YMR083W
          Length = 377

 Score = 93.6 bits (231), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 76/271 (28%), Positives = 116/271 (42%), Gaps = 31/271 (11%)

Query: 2   SAATVGKPIKCIAAVAYDAKKPSSVEEITVDAPKAHEVRIKIEYTAVCHTDAYTLSGSDP 61
           +A +   P    A V Y+   P     I V  PK +E+ I ++Y+ VCHTD +   G  P
Sbjct: 26  TATSFKIPTTQKAVVFYENGGPLKYTTIPVPKPKPNEILINVKYSGVCHTDLHAWKGDWP 85

Query: 62  EGL-FPCILGHEGAGIVESVGDGVVTVKPGDHV-IALYTAECGKCKFCTSGKTNLCSAVR 119
             +  P + GHEGAG+V + G  V   + GD+  I      C  C+ C  G  + C    
Sbjct: 86  LAVKLPLVGGHEGAGVVVAKGSEVKNFEIGDYAGIKWLNGSCMSCELCEKGFESNCEQA- 144

Query: 120 ATQGKGVMPDGTTRFHNAKGKDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDASCLLGC 179
                                D+  +    +F +Y     V    I     L     + C
Sbjct: 145 ---------------------DLSGYTHDGSFQQYATADAVQAAHIPKNVDLAEVAPILC 183

Query: 180 GVTTGYGAAVKTANVQKGDTVAVFG-CGTVGLSVIQGAKLRGASKIIAVDINNNKKKYCS 238
              T Y  A+KTA+V+ G  VA+ G CG +G   +Q AK  G  +++ +D  + KKK   
Sbjct: 184 AGVTVY-KALKTADVKPGQWVAISGACGGLGSLAVQYAKAMGL-RVVGIDGGDEKKKLFH 241

Query: 239 QFGATDFINPKEDLAKDQTIVEKLVEMTDGG 269
             G   F+    D  K  +IV+ + ++T+GG
Sbjct: 242 SLGGDIFV----DFTKTHSIVKDIQDVTNGG 268

>TPHA0G03210 Chr7 complement(688137..689270) [1134 bp, 377 aa] {ON}
           Anc_2.480 YMR083W
          Length = 377

 Score = 93.6 bits (231), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 77/276 (27%), Positives = 120/276 (43%), Gaps = 31/276 (11%)

Query: 16  VAYDAKKPSSVEEITVDAPKAHEVRIKIEYTAVCHTDAYTLSGSDPEGL-FPCILGHEGA 74
           + Y+   P   ++I V  PK++E+ I +EY+ VCHTD +   G  P  +  P + GHEGA
Sbjct: 40  IFYENNGPLEYKDIPVPKPKSNEILINVEYSGVCHTDLHAWKGDWPLPVKLPLVGGHEGA 99

Query: 75  GIVESVGDGVVTVKPGDHV-IALYTAECGKCKFCTSGKTNLCSAVRATQGKGVMPDGTTR 133
           G+V  +GD V   K GD   I      C  C+ C +G    C                  
Sbjct: 100 GVVVGMGDNVKNWKIGDLAGIKWLNGSCMSCELCENGFEANCEHA--------------- 144

Query: 134 FHNAKGKDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDASCLLGCGVTTGYGAAVKTAN 193
                  D+  +    +F +Y     V    I     L     + C   T Y  A+KTA+
Sbjct: 145 -------DLSGYTHDGSFQQYATADAVQAARIPAGTDLANVAPILCAGVTVY-KALKTAD 196

Query: 194 VQKGDTVAVFG-CGTVGLSVIQGAKLRGASKIIAVDINNNKKKYCSQFGATDFINPKEDL 252
           ++ GD VA+ G  G +G   +Q A   G  ++I +D   +KKK   + G   FI    D 
Sbjct: 197 LKPGDWVAISGAAGGLGSLAVQYAAAMGL-RVIGIDGGEDKKKLFEKCGGEVFI----DF 251

Query: 253 AKDQTIVEKLVEMTDGGLDFTFDCTGNTKIMRDALE 288
            K + IV+ + E T GG     + + + K +  +++
Sbjct: 252 TKSKDIVKDIQEATHGGPHGVINVSVSDKAISQSVQ 287

>TDEL0C00390 Chr3 (53995..55056) [1062 bp, 353 aa] {ON} Anc_8.16
           YLR070C
          Length = 353

 Score = 92.8 bits (229), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 86/265 (32%), Positives = 121/265 (45%), Gaps = 36/265 (13%)

Query: 37  HEVRIKIEYTAVCHTDA-YTLSGSDPEGLF--PCILGHEGAGIVESVGDGVVTVKPGDHV 93
           H+V+I+I+ T +C +D  Y   GS  + +   P +LGHE AG+V  VGD V +VK GD V
Sbjct: 29  HDVKIQIKATGICGSDVHYFTQGSIGDFVVKSPLVLGHESAGVVVEVGDAVSSVKVGDRV 88

Query: 94  IALYTAECGKCKFCTSGKTNLCS--AVRATQGKGVMPDGT-TRFHNAKGKDIYHFMGCST 150
                      K   SG  NLC   A  AT       DGT  +++ +    +Y      +
Sbjct: 89  AVEPGVPSRYSKETMSGHYNLCPHMAFAATPPY----DGTLVKYYLSPEDFVYKLADHIS 144

Query: 151 FSEYTVVADVSVVAIDPKAPLDASCLLGCGVTTGYGAAVKTANVQKGDTVAVFGCGTVGL 210
           F E  VV  +SV                         A + AN   G  V V G G VGL
Sbjct: 145 FEEGAVVEPLSVAV----------------------HANRLANTAFGQAVLVLGAGPVGL 182

Query: 211 SVIQGAKLRGASKIIAVDINNNKKKYCSQFGATDFINPKEDLAKDQTIVEKLVEMTDGGL 270
                AK  GA+ ++ VDI  +K +   QFGAT  +  K D   D+  +  LV  + GGL
Sbjct: 183 LAGAVAKAFGATDVVFVDIFESKLEKAKQFGATRTVLFKPD--SDENDLVSLVTKSLGGL 240

Query: 271 --DFTFDCTGNTKIMRDALEACHKG 293
             D  F+C+G  K +R A+++  +G
Sbjct: 241 HPDVVFECSGAEKCIRAAVKSVKRG 265

>Skud_13.240 Chr13 (408909..410036) [1128 bp, 375 aa] {ON} YMR083W
           (REAL)
          Length = 375

 Score = 92.8 bits (229), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 73/257 (28%), Positives = 111/257 (43%), Gaps = 31/257 (12%)

Query: 16  VAYDAKKPSSVEEITVDAPKAHEVRIKIEYTAVCHTDAYTLSGSDPEGL-FPCILGHEGA 74
           + Y+       ++I V  PK +E+ I ++Y+ VCHTD +   G  P  +  P + GHEGA
Sbjct: 38  IFYENNGKLHYKDIPVPQPKPNEILINVKYSGVCHTDLHAWHGDWPLAVKLPLVGGHEGA 97

Query: 75  GIVESVGDGVVTVKPGDHV-IALYTAECGKCKFCTSGKTNLCSAVRATQGKGVMPDGTTR 133
           G+V  +G  V   K GD   I      C  C+FC SG  + C            P+    
Sbjct: 98  GVVVKLGSNVKGWKVGDLAGIKWLNGSCMTCEFCESGHESNC------------PEA--- 142

Query: 134 FHNAKGKDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDASCLLGCGVTTGYGAAVKTAN 193
                  D+  +    +F ++     +    I P   L     + C   T Y  A+K AN
Sbjct: 143 -------DLSGYTHDGSFQQFATADAIQAAKIQPGTDLAEVAPILCAGVTVY-KALKEAN 194

Query: 194 VQKGDTVAVFG-CGTVGLSVIQGAKLRGASKIIAVDINNNKKKYCSQFGATDFINPKEDL 252
           ++ GD VA+ G  G +G   +Q A   G  +++ +D    K+K   Q G   FI    D 
Sbjct: 195 LKAGDWVAISGAAGGLGSLAVQYATAMG-YRVLGIDAGEEKEKLFKQLGGEVFI----DF 249

Query: 253 AKDQTIVEKLVEMTDGG 269
            K + +V  + E T GG
Sbjct: 250 TKTKDMVSDIQEATKGG 266

>CAGL0J01441g Chr10 complement(134383..135501) [1119 bp, 372 aa]
           {ON} highly similar to uniprot|P07246 Saccharomyces
           cerevisiae YMR083w ADH3 or uniprot|P00330 Saccharomyces
           cerevisiae YOL086c ADH1 or uniprot|P00331 Saccharomyces
           cerevisiae YMR303c ADH2
          Length = 372

 Score = 92.4 bits (228), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 71/288 (24%), Positives = 123/288 (42%), Gaps = 31/288 (10%)

Query: 4   ATVGKPIKCIAAVAYDAKKPSSVEEITVDAPKAHEVRIKIEYTAVCHTDAYTLSGSDPEG 63
           +T+  P      + Y+       +++ V  PK +E+ I + Y+ VCHTD +   G  P G
Sbjct: 23  STLSIPQSQKGVIFYEHGGKLEYKDLPVPKPKPNEILINVRYSGVCHTDLHAWHGDWPLG 82

Query: 64  L-FPCILGHEGAGIVESVGDGVVTVKPGDHV-IALYTAECGKCKFCTSGKTNLCSAVRAT 121
              P + GHEGAG+V + G  V   + GD+  I      C  C+FC  G  + C+     
Sbjct: 83  AKLPLVGGHEGAGVVVAKGSSVTNFEIGDYAGIKWLNGSCMSCEFCEQGNESNCAKA--- 139

Query: 122 QGKGVMPDGTTRFHNAKGKDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDASCLLGCGV 181
                              D+  +    +F +Y     +    I     L     + C  
Sbjct: 140 -------------------DLSGYTHDGSFQQYATADAIQAAQIPKGTDLAQVAPILCAG 180

Query: 182 TTGYGAAVKTANVQKGDTVAVFG-CGTVGLSVIQGAKLRGASKIIAVDINNNKKKYCSQF 240
            T Y  A+K ++V+ G  VA+ G  G +G   +Q AK  G  +++ +D  + K+K     
Sbjct: 181 VTVY-KALKDSDVKPGQWVAISGAAGGLGSLAVQYAKAMGM-RVLGIDAGDEKRKLFESL 238

Query: 241 GATDFINPKEDLAKDQTIVEKLVEMTDGGLDFTFDCTGNTKIMRDALE 288
           G   F+    D  K + +V ++ E+T+GG     + + + K +  ++E
Sbjct: 239 GGNHFV----DFTKTKDLVSEIQEITEGGPHGVINVSVSEKAIGQSVE 282

>SAKL0F06270g Chr6 (472877..473932) [1056 bp, 351 aa] {ON} similar
           to uniprot|P00331 Saccharomyces cerevisiae YMR303C ADH2
           Glucose-repressible alcohol dehydrogenase II
          Length = 351

 Score = 92.0 bits (227), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 81/292 (27%), Positives = 129/292 (44%), Gaps = 37/292 (12%)

Query: 1   MSAATVGKPIKCIAAVAYDAKKPSSVEEITVDAPKAHEVRIKIEYTAVCHTDAYTLSGSD 60
           MSA+ + K  K  A + Y+       ++I V  PK++E+ I ++Y+ VCHTD +   G  
Sbjct: 1   MSASQIPKTQK--AVIFYENGGELQYKDIPVPKPKSNEILINVKYSGVCHTDLHAWKGDW 58

Query: 61  P-EGLFPCILGHEGAGIVESVGDGVVTVKPGDHV-IALYTAECGKCKFCTSGKTNLCSAV 118
           P     P + GHEGAG+V ++G+ V   K GD+  I      C  C++C     + C   
Sbjct: 59  PLPTKLPLVGGHEGAGVVVAIGENVKGWKIGDYAGIKWLNGSCMACEYCELSNESNC--- 115

Query: 119 RATQGKGVMPDGTTRFHNAKGKDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDASCLLG 178
                    P+           D+  +    +F +Y     V    I     L     + 
Sbjct: 116 ---------PEA----------DLSGYTHDGSFQQYATADAVQAARIPAGTDLAEVAPVL 156

Query: 179 CGVTTGYGAAVKTANVQKGDTVAVFG-CGTVGLSVIQGAKLRGASKIIAVDINNNKKKYC 237
           C   T Y  A+K+AN++ G+ VA+ G CG +G   IQ AK  G  +++ +D    K    
Sbjct: 157 CAGITVY-KALKSANLRAGEWVAISGACGGLGSLAIQYAKAMG-YRVLGIDGGEEKAALF 214

Query: 238 SQFGATDFINPKEDLAKDQTIVEKLVEMTDGGLDFTFDCTGNTKIMRDALEA 289
            + G   FI    D  K + +V+ +V+ T+GG         N  +   A+EA
Sbjct: 215 KELGGEVFI----DFTKTKDVVKAVVDATNGGAHGVI----NVSVSEAAIEA 258

>KAFR0G01420 Chr7 complement(314119..315174) [1056 bp, 351 aa] {ON}
           Anc_3.118 YBR145W
          Length = 351

 Score = 91.3 bits (225), Expect = 8e-20,   Method: Compositional matrix adjust.
 Identities = 78/272 (28%), Positives = 121/272 (44%), Gaps = 33/272 (12%)

Query: 1   MSAATVGKPIKCIAAVAYDAKKPSSVEEITVDAPKAHEVRIKIEYTAVCHTDAYTLSGSD 60
           MSA  + K  K +  + Y+       ++I V  PKA+E+ I ++Y+ VCHTD +   G  
Sbjct: 1   MSAPVIPKTQKGV--IFYENGGKLEYKDIPVPTPKANELLINVKYSGVCHTDLHAWKGDW 58

Query: 61  PEGL-FPCILGHEGAGIVESVGDGVVTVKPGDHV-IALYTAECGKCKFCTSGKTNLCSAV 118
           P  +  P + GHEGAG+V ++G+ V   K GD+  I      C  C++C     + C   
Sbjct: 59  PLDVKLPLVGGHEGAGVVVAMGENVRGWKIGDYAGIKWLNGSCMSCEYCELSNESNC--- 115

Query: 119 RATQGKGVMPDGTTRFHNAKGKDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDASCLLG 178
                    P+           D+  +    +F +Y     V    I     L     + 
Sbjct: 116 ---------PEA----------DLSGYTHDGSFQQYATADAVQAAKIPQGTDLAQVAPIL 156

Query: 179 CGVTTGYGAAVKTANVQKGDTVAVFG-CGTVGLSVIQGAKLRGASKIIAVDINNNKKKYC 237
           C   T Y  A+K+AN+  G+ VA+ G CG +G   IQ AK  G  +I+ +D  + K    
Sbjct: 157 CAGITVY-KALKSANLSAGEWVAISGACGGLGSLAIQYAKAMG-YRILGIDGGDEKAALF 214

Query: 238 SQFGATDFINPKEDLAKDQTIVEKLVEMTDGG 269
            + G   FI    D  K + I   ++E T+GG
Sbjct: 215 KELGGEVFI----DFTKTKDIEAAVIEATNGG 242

>Suva_13.261 Chr13 (416378..417505) [1128 bp, 375 aa] {ON} YMR083W
           (REAL)
          Length = 375

 Score = 90.5 bits (223), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 75/269 (27%), Positives = 114/269 (42%), Gaps = 31/269 (11%)

Query: 4   ATVGKPIKCIAAVAYDAKKPSSVEEITVDAPKAHEVRIKIEYTAVCHTDAYTLSGSDPEG 63
           +T+  P      + Y+       ++I V  PK +E+ I ++Y+ VCHTD +   G  P  
Sbjct: 26  STIAIPQTQKGVIFYENNGKLHYKDIPVPEPKPNEILINVKYSGVCHTDLHAWHGDWPLP 85

Query: 64  L-FPCILGHEGAGIVESVGDGVVTVKPGDHV-IALYTAECGKCKFCTSGKTNLCSAVRAT 121
           +  P + GHEGAG+V  +G  V   K GD   I      C  C+FC SG  + C      
Sbjct: 86  VKLPLVGGHEGAGVVVKLGSNVKGWKVGDLAGIKWLNGSCMTCEFCESGHESNC------ 139

Query: 122 QGKGVMPDGTTRFHNAKGKDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDASCLLGCGV 181
                 PD           D+  +    +F ++     +    I     L     + C  
Sbjct: 140 ------PDA----------DLSGYTHDGSFQQFATADAIQAAKIQQGTDLAEVAPILCAG 183

Query: 182 TTGYGAAVKTANVQKGDTVAVFG-CGTVGLSVIQGAKLRGASKIIAVDINNNKKKYCSQF 240
            T Y  A+K AN++ GD VA+ G  G +G   +Q A   G  +++ +D    K+K   Q 
Sbjct: 184 VTVY-KALKEANLKAGDWVAISGAAGGLGSLAVQYATAMG-YRVLGIDAGAEKEKLFKQL 241

Query: 241 GATDFINPKEDLAKDQTIVEKLVEMTDGG 269
           G   FI    D  K + +V  + E T GG
Sbjct: 242 GGEVFI----DFTKTKDMVSDIQEATKGG 266

>KLLA0F21010g Chr6 (1962951..1964003) [1053 bp, 350 aa] {ON}
           uniprot|P20369 Kluyveromyces lactis KLLA0F21010g ADH1
           Alcohol dehydrogenase 1
          Length = 350

 Score = 89.7 bits (221), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 72/246 (29%), Positives = 109/246 (44%), Gaps = 31/246 (12%)

Query: 27  EEITVDAPKAHEVRIKIEYTAVCHTDAYTLSGSDP-EGLFPCILGHEGAGIVESVGDGVV 85
           ++I V  PKA+E+ I ++Y+ VCHTD +   G  P     P + GHEGAG+V ++G+ V 
Sbjct: 24  KDIPVPKPKANELLINVKYSGVCHTDLHAWKGDWPLPTKLPLVGGHEGAGVVVAMGENVK 83

Query: 86  TVKPGDHV-IALYTAECGKCKFCTSGKTNLCSAVRATQGKGVMPDGTTRFHNAKGKDIYH 144
             K GD   I      C  C++C     + C            P+           D+  
Sbjct: 84  GWKIGDFAGIKWLNGSCMSCEYCELSNESNC------------PEA----------DLSG 121

Query: 145 FMGCSTFSEYTVVADVSVVAIDPKAPLDASCLLGCGVTTGYGAAVKTANVQKGDTVAVFG 204
           +    +F +Y     V    I     L     + C   T Y  A+K+AN++ GD VA+ G
Sbjct: 122 YTHDGSFQQYATADAVQAAKIPVGTDLAEVAPVLCAGVTVY-KALKSANLKAGDWVAISG 180

Query: 205 -CGTVGLSVIQGAKLRGASKIIAVDINNNKKKYCSQFGATDFINPKEDLAKDQTIVEKLV 263
             G +G   +Q AK  G  +++ +D    K K     G   FI    D  K + I E+++
Sbjct: 181 AAGGLGSLAVQYAKAMG-YRVLGIDAGEEKAKLFKDLGGEYFI----DFTKSKNIPEEVI 235

Query: 264 EMTDGG 269
           E T GG
Sbjct: 236 EATKGG 241

>Smik_13.520 Chr13 complement(856008..857054) [1047 bp, 348 aa] {ON}
           YMR303C (REAL)
          Length = 348

 Score = 89.4 bits (220), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 72/257 (28%), Positives = 114/257 (44%), Gaps = 31/257 (12%)

Query: 16  VAYDAKKPSSVEEITVDAPKAHEVRIKIEYTAVCHTDAYTLSGSDP-EGLFPCILGHEGA 74
           + Y++      ++I V  PK +E+ I ++Y+ VCHTD +   G  P     P + GHEGA
Sbjct: 11  IFYESNGKLEHKDIPVPKPKPNELLINVKYSGVCHTDLHAWHGDWPLPTKLPLVGGHEGA 70

Query: 75  GIVESVGDGVVTVKPGDHV-IALYTAECGKCKFCTSGKTNLCSAVRATQGKGVMPDGTTR 133
           G+V ++GD V   K GD   I    + C  C++C  G  + C                  
Sbjct: 71  GVVVAIGDNVRGWKVGDLAGIKWLNSSCMACEYCELGNESNCPHA--------------- 115

Query: 134 FHNAKGKDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDASCLLGCGVTTGYGAAVKTAN 193
                  D+  +    +F +Y     V    I     L     + C   T Y  A+K+AN
Sbjct: 116 -------DLSGYTHDGSFQQYATADAVQAARIPEGTDLAQVAPILCAGITVY-KALKSAN 167

Query: 194 VQKGDTVAVFG-CGTVGLSVIQGAKLRGASKIIAVDINNNKKKYCSQFGATDFINPKEDL 252
           ++ G  VA+ G  G +G   +Q AK  G  +++ +D    K++  +  G   FI    D 
Sbjct: 168 LRAGHWVAISGAAGGLGSLAVQYAKAMG-YRVLGIDGGEGKEELFTSLGGEVFI----DF 222

Query: 253 AKDQTIVEKLVEMTDGG 269
            K++ IV  +V+ TDGG
Sbjct: 223 TKEKDIVSAVVKATDGG 239

>NDAI0A06930 Chr1 (1585575..1586630) [1056 bp, 351 aa] {ON}
           Anc_3.118
          Length = 351

 Score = 89.4 bits (220), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 76/268 (28%), Positives = 117/268 (43%), Gaps = 31/268 (11%)

Query: 27  EEITVDAPKAHEVRIKIEYTAVCHTDAYTLSGSDPEGL-FPCILGHEGAGIVESVGDGVV 85
           ++I V  PK+ E+ I ++Y+ VCHTD +   G  P     P + GHEGAGIV  VG+ V 
Sbjct: 25  KDIPVPVPKSTEILINVKYSGVCHTDLHAWKGDWPLATKLPLVGGHEGAGIVVQVGENVQ 84

Query: 86  TVKPGDHV-IALYTAECGKCKFCTSGKTNLCSAVRATQGKGVMPDGTTRFHNAKGKDIYH 144
             K GD   I      C  C++C  G  + C                    NA   D+  
Sbjct: 85  GWKVGDLAGIKWLNGSCMACEYCELGNESNCP-------------------NA---DLSG 122

Query: 145 FMGCSTFSEYTVVADVSVVAIDPKAPLDASCLLGCGVTTGYGAAVKTANVQKGDTVAVFG 204
           +    +F +Y     V    I     L     + C   T Y  A+K+AN++ G+ VA+ G
Sbjct: 123 YTHDGSFQQYATADAVQAARIPQGTDLAEVAPVLCAGITVY-KALKSANLRAGEWVAISG 181

Query: 205 -CGTVGLSVIQGAKLRGASKIIAVDINNNKKKYCSQFGATDFINPKEDLAKDQTIVEKLV 263
             G +G   +Q AK  G  +I+ +D    K+K   + G   FI    D  K + IV  ++
Sbjct: 182 AAGGLGSLAVQYAKAMG-YRILGIDGGEEKEKLFRELGGEIFI----DFTKTKDIVGDII 236

Query: 264 EMTDGGLDFTFDCTGNTKIMRDALEACH 291
           + T+GG     + + +   +  + E C 
Sbjct: 237 KATNGGAHGVINVSVSEAAIGASTEYCR 264

>KLLA0F18260g Chr6 complement(1683417..1684463) [1047 bp, 348 aa]
           {ON} uniprot|P49383 Kluyveromyces lactis KLLA0F18260g
           ADH2 Alcohol dehydrogenase 2
          Length = 348

 Score = 89.4 bits (220), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 70/246 (28%), Positives = 112/246 (45%), Gaps = 31/246 (12%)

Query: 27  EEITVDAPKAHEVRIKIEYTAVCHTDAYTLSGSDP-EGLFPCILGHEGAGIVESVGDGVV 85
           ++I V  PKA+E+ I ++Y+ VCHTD +   G  P     P + GHEGAG+V ++G+ V 
Sbjct: 22  KDIPVPKPKANELLINVKYSGVCHTDLHAWKGDWPLPTKLPLVGGHEGAGVVVAMGENVK 81

Query: 86  TVKPGDHV-IALYTAECGKCKFCTSGKTNLCSAVRATQGKGVMPDGTTRFHNAKGKDIYH 144
               GD   I      C  C++C     + C            PD           D+  
Sbjct: 82  GWNIGDFAGIKWLNGSCMSCEYCELSNESNC------------PDA----------DLSG 119

Query: 145 FMGCSTFSEYTVVADVSVVAIDPKAPLDASCLLGCGVTTGYGAAVKTANVQKGDTVAVFG 204
           +    +F +Y     V    I     L     + C   T Y  A+K+A+++ GD VA+ G
Sbjct: 120 YTHDGSFQQYATADAVQAARIPKGTDLAEVAPILCAGVTVY-KALKSADLKAGDWVAISG 178

Query: 205 -CGTVGLSVIQGAKLRGASKIIAVDINNNKKKYCSQFGATDFINPKEDLAKDQTIVEKLV 263
            CG +G   IQ AK  G  +++ +D    K K   + G   F+    D A  + +++++V
Sbjct: 179 ACGGLGSLAIQYAKAMG-YRVLGIDTGAEKAKLFKELGGEYFV----DYAVSKDLIKEIV 233

Query: 264 EMTDGG 269
           + T+GG
Sbjct: 234 DATNGG 239

>Ecym_5331 Chr5 (676233..677279) [1047 bp, 348 aa] {ON} similar to
           Ashbya gossypii AER032W
          Length = 348

 Score = 89.0 bits (219), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 73/259 (28%), Positives = 114/259 (44%), Gaps = 31/259 (11%)

Query: 14  AAVAYDAKKPSSVEEITVDAPKAHEVRIKIEYTAVCHTDAYTLSGSDP-EGLFPCILGHE 72
           A + Y+        +I V  PK  E+ I ++Y+ VCHTD +   G  P     P + GHE
Sbjct: 9   AVIFYENGGELKYTDIPVPKPKPSELLINVKYSGVCHTDLHAWKGDWPLPTKLPLVGGHE 68

Query: 73  GAGIVESVGDGVVTVKPGDHV-IALYTAECGKCKFCTSGKTNLCSAVRATQGKGVMPDGT 131
           GAG+V ++G+ V   K GD   I      C  C++C     + C            PD  
Sbjct: 69  GAGVVVAMGENVRGWKIGDFAGIKWLNGSCMTCEYCEKSNESNC------------PDA- 115

Query: 132 TRFHNAKGKDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDASCLLGCGVTTGYGAAVKT 191
                    D+  +    +F +Y     V    I     L     + C   T Y  A+K+
Sbjct: 116 ---------DLSGYTHDGSFQQYATADAVHAAKIPQGTDLAQVAPVLCAGITVY-KALKS 165

Query: 192 ANVQKGDTVAVFGC-GTVGLSVIQGAKLRGASKIIAVDINNNKKKYCSQFGATDFINPKE 250
           A +Q G+ VA+ G  G +G   +Q AK  G  +I+ +D    KKK   + G   FI    
Sbjct: 166 ARLQAGEWVAISGASGGLGSLAVQYAKAMG-YRILGIDSGEEKKKLFKELGGEYFI---- 220

Query: 251 DLAKDQTIVEKLVEMTDGG 269
           D A+ + +V +++++T+GG
Sbjct: 221 DFAESKDVVAEVIKVTNGG 239

>Skud_13.477 Chr13 complement(846790..847836) [1047 bp, 348 aa] {ON}
           YMR303C (REAL)
          Length = 348

 Score = 89.0 bits (219), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 75/280 (26%), Positives = 121/280 (43%), Gaps = 35/280 (12%)

Query: 16  VAYDAKKPSSVEEITVDAPKAHEVRIKIEYTAVCHTDAYTLSGSDP-EGLFPCILGHEGA 74
           + Y++      + I V  PK +E+ I ++Y+ VCHTD +   G  P     P + GHEGA
Sbjct: 11  IFYESNGKLEHKNIPVPKPKPNELLINVKYSGVCHTDLHAWHGDWPLPTKLPLVGGHEGA 70

Query: 75  GIVESVGDGVVTVKPGDHV-IALYTAECGKCKFCTSGKTNLCSAVRATQGKGVMPDGTTR 133
           G+V ++GD V   K GD   +    + C  C++C  G  + C                  
Sbjct: 71  GVVVAIGDNVRGWKVGDLAGVKWLNSSCMACEYCELGNESNCPHA--------------- 115

Query: 134 FHNAKGKDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDASCLLGCGVTTGYGAAVKTAN 193
                  D+  +    +F +Y     V    I     L     + C   T Y  A+K+AN
Sbjct: 116 -------DLSGYTHDGSFQQYATADAVQAARIPEGTDLAEVAPILCAGITVY-KALKSAN 167

Query: 194 VQKGDTVAVFG-CGTVGLSVIQGAKLRGASKIIAVDINNNKKKYCSQFGATDFINPKEDL 252
           ++ G+ VA+ G  G +G   +Q AK  G  +++ +D    K++  +  G   FI    D 
Sbjct: 168 LRAGNWVAISGAAGGLGSLAVQYAKAMG-YRVLGIDGGPGKQELFTSLGGEVFI----DF 222

Query: 253 AKDQTIVEKLVEMTDGGLDFTFDCTGNTKIMRDALEACHK 292
            K++ I+  +V+ TDGG         N  +   A+EA  K
Sbjct: 223 TKEKDIIGAVVKATDGGAHGII----NVSVSEAAIEASTK 258

>SAKL0B08184g Chr2 (698686..699807) [1122 bp, 373 aa] {ON}
           uniprot|Q9P8S5 Saccharomyces kluyveri Alcohol
           dehydrogenase isozyme 3
          Length = 373

 Score = 89.0 bits (219), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 77/272 (28%), Positives = 118/272 (43%), Gaps = 33/272 (12%)

Query: 2   SAATVGKPIKCIAAVAYDAKKPSSVEEITVDAPKAHEVRIKIEYTAVCHTDAYTLSGSDP 61
           + AT   P K    + Y+       E+I V  PK +E+ I ++Y+ VCHTD +   G  P
Sbjct: 22  TMATASIPEKQKGIIFYENGGELKYEDIPVPKPKPNELLINVKYSGVCHTDLHAWKGDWP 81

Query: 62  -EGLFPCILGHEGAGIVESVGDGVVTVKPGDHV-IALYTAECGKCKFCTSGKTNLCSAVR 119
                P + GHEGAG+V ++G+ V   K GD   I      C  C++C     + C    
Sbjct: 82  LPTKLPLVGGHEGAGVVVAMGENVKGWKIGDLAGIKWLNGSCLSCEYCEKSNESNCPHA- 140

Query: 120 ATQGKGVMPDGTTRFHNAKGKDIYHFMGCSTFSEYTVVADVSVVAIDPKAPL-DASCLLG 178
                                D+  +    +F +Y     V    I     L + S +L 
Sbjct: 141 ---------------------DLSGYTHDGSFQQYATADYVQAARIPEGTDLAEVSPILC 179

Query: 179 CGVTTGYGAAVKTANVQKGDTVAVFG-CGTVGLSVIQGAKLRGASKIIAVDINNNKKKYC 237
            GVT     A+K+AN++ GD VA+ G  G +G   +Q AK  G  +++ +D    K +  
Sbjct: 180 AGVTV--YKALKSANLKAGDWVAISGAAGGLGSLAVQYAKAMG-YRVLGIDGGAEKGELV 236

Query: 238 SQFGATDFINPKEDLAKDQTIVEKLVEMTDGG 269
            + G   FI    D  K + +VE + E T+GG
Sbjct: 237 KKLGGEVFI----DFTKHKNLVEAVQEATNGG 264

>KLLA0B09064g Chr2 complement(792849..793973) [1125 bp, 374 aa] {ON}
           uniprot|P49384 Kluyveromyces lactis KLLA0B09064g ADH3
           Alcohol dehydrogenase III mitochondrial precursor
          Length = 374

 Score = 89.0 bits (219), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 70/246 (28%), Positives = 109/246 (44%), Gaps = 31/246 (12%)

Query: 27  EEITVDAPKAHEVRIKIEYTAVCHTDAYTLSGSDP-EGLFPCILGHEGAGIVESVGDGVV 85
           ++I V  PK +E+ I ++Y+ VCHTD +   G  P     P + GHEGAG+V ++G+ V 
Sbjct: 48  KDIPVPKPKPNEILINVKYSGVCHTDLHAWKGDWPLPTKLPLVGGHEGAGVVVAMGENVK 107

Query: 86  TVKPGDHV-IALYTAECGKCKFCTSGKTNLCSAVRATQGKGVMPDGTTRFHNAKGKDIYH 144
               GD   I      C  C++C     + C            PD           D+  
Sbjct: 108 GWNIGDFAGIKWLNGSCMSCEYCELSNESNC------------PDA----------DLSG 145

Query: 145 FMGCSTFSEYTVVADVSVVAIDPKAPLDASCLLGCGVTTGYGAAVKTANVQKGDTVAVFG 204
           +    +F +Y     V    I     L     + C   T Y  A+K+AN++ GD VA+ G
Sbjct: 146 YTHDGSFQQYATADAVQAARIPKGTDLAEVAPILCAGVTVY-KALKSANLKAGDWVAISG 204

Query: 205 -CGTVGLSVIQGAKLRGASKIIAVDINNNKKKYCSQFGATDFINPKEDLAKDQTIVEKLV 263
             G +G   +Q AK  G  +++ +D    K K   Q G   F+    D  K + +V ++ 
Sbjct: 205 AAGGLGSLAVQYAKAMG-YRVVGIDGGEEKGKLVKQLGGEAFV----DFTKTKDMVAEIQ 259

Query: 264 EMTDGG 269
           E+T+GG
Sbjct: 260 EITNGG 265

>YMR083W Chr13 (434788..435915) [1128 bp, 375 aa] {ON}
           ADH3Mitochondrial alcohol dehydrogenase isozyme III;
           involved in the shuttling of mitochondrial NADH to the
           cytosol under anaerobic conditions and ethanol
           production
          Length = 375

 Score = 88.6 bits (218), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 72/257 (28%), Positives = 111/257 (43%), Gaps = 31/257 (12%)

Query: 16  VAYDAKKPSSVEEITVDAPKAHEVRIKIEYTAVCHTDAYTLSGSDPEGL-FPCILGHEGA 74
           + Y+ K     ++I V  PK +E+ I ++Y+ VCHTD +   G  P  +  P + GHEGA
Sbjct: 38  IFYENKGKLHYKDIPVPEPKPNEILINVKYSGVCHTDLHAWHGDWPLPVKLPLVGGHEGA 97

Query: 75  GIVESVGDGVVTVKPGDHV-IALYTAECGKCKFCTSGKTNLCSAVRATQGKGVMPDGTTR 133
           G+V  +G  V   K GD   I      C  C+FC SG  + C            PD    
Sbjct: 98  GVVVKLGSNVKGWKVGDLAGIKWLNGSCMTCEFCESGHESNC------------PDA--- 142

Query: 134 FHNAKGKDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDASCLLGCGVTTGYGAAVKTAN 193
                  D+  +    +F ++     +    I     L     + C   T Y  A+K A+
Sbjct: 143 -------DLSGYTHDGSFQQFATADAIQAAKIQQGTDLAEVAPILCAGVTVY-KALKEAD 194

Query: 194 VQKGDTVAVFG-CGTVGLSVIQGAKLRGASKIIAVDINNNKKKYCSQFGATDFINPKEDL 252
           ++ GD VA+ G  G +G   +Q A   G  +++ +D    K+K   + G   FI    D 
Sbjct: 195 LKAGDWVAISGAAGGLGSLAVQYATAMG-YRVLGIDAGEEKEKLFKKLGGEVFI----DF 249

Query: 253 AKDQTIVEKLVEMTDGG 269
            K + +V  + E T GG
Sbjct: 250 TKTKNMVSDIQEATKGG 266

>YOL086C Chr15 complement(159548..160594) [1047 bp, 348 aa] {ON}
           ADH1Alcohol dehydrogenase, fermentative isozyme active
           as homo- or heterotetramers; required for the reduction
           of acetaldehyde to ethanol, the last step in the
           glycolytic pathway
          Length = 348

 Score = 87.8 bits (216), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 75/277 (27%), Positives = 119/277 (42%), Gaps = 35/277 (12%)

Query: 16  VAYDAKKPSSVEEITVDAPKAHEVRIKIEYTAVCHTDAYTLSGSDPEGL-FPCILGHEGA 74
           + Y++      ++I V  PKA+E+ I ++Y+ VCHTD +   G  P  +  P + GHEGA
Sbjct: 11  IFYESHGKLEYKDIPVPKPKANELLINVKYSGVCHTDLHAWHGDWPLPVKLPLVGGHEGA 70

Query: 75  GIVESVGDGVVTVKPGDHV-IALYTAECGKCKFCTSGKTNLCSAVRATQGKGVMPDGTTR 133
           G+V  +G+ V   K GD+  I      C  C++C  G  + C                  
Sbjct: 71  GVVVGMGENVKGWKIGDYAGIKWLNGSCMACEYCELGNESNCPHA--------------- 115

Query: 134 FHNAKGKDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDASCLLGCGVTTGYGAAVKTAN 193
                  D+  +    +F +Y     V    I     L     + C   T Y  A+K+AN
Sbjct: 116 -------DLSGYTHDGSFQQYATADAVQAAHIPQGTDLAQVAPILCAGITVY-KALKSAN 167

Query: 194 VQKGDTVAVFG-CGTVGLSVIQGAKLRGASKIIAVDINNNKKKYCSQFGATDFINPKEDL 252
           +  G  VA+ G  G +G   +Q AK  G  +++ +D    K++     G   FI    D 
Sbjct: 168 LMAGHWVAISGAAGGLGSLAVQYAKAMG-YRVLGIDGGEGKEELFRSIGGEVFI----DF 222

Query: 253 AKDQTIVEKLVEMTDGGLDFTFDCTGNTKIMRDALEA 289
            K++ IV  +++ TDGG         N  +   A+EA
Sbjct: 223 TKEKDIVGAVLKATDGGAHGVI----NVSVSEAAIEA 255

>TDEL0D05050 Chr4 (921065..922120) [1056 bp, 351 aa] {ON} Anc_3.118
           YBR145W
          Length = 351

 Score = 87.4 bits (215), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 75/272 (27%), Positives = 120/272 (44%), Gaps = 33/272 (12%)

Query: 1   MSAATVGKPIKCIAAVAYDAKKPSSVEEITVDAPKAHEVRIKIEYTAVCHTDAYTLSGSD 60
           MSA T+ +  K +  + Y+       ++I V  P  +E+ I ++Y+ VCHTD +   G  
Sbjct: 1   MSAPTIPETQKGV--IFYENNGTLEYKDIPVPKPAPNELLINVKYSGVCHTDLHAWKGDW 58

Query: 61  PEGL-FPCILGHEGAGIVESVGDGVVTVKPGDHV-IALYTAECGKCKFCTSGKTNLCSAV 118
           P  +  P + GHEGAG+V ++G  V   K GD+  I      C  C+ C  G  + C   
Sbjct: 59  PLPVKLPLVGGHEGAGVVVALGSNVKNWKVGDYAGIKWLNGCCMSCEDCELGNESNCPQA 118

Query: 119 RATQGKGVMPDGTTRFHNAKGKDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDASCLLG 178
                                 D+  +    +F +Y     V    I P   L     + 
Sbjct: 119 ----------------------DLSGYTHDGSFQQYATTDAVQAAKISPGTDLAEVAPVL 156

Query: 179 CGVTTGYGAAVKTANVQKGDTVAVFG-CGTVGLSVIQGAKLRGASKIIAVDINNNKKKYC 237
           C   T Y  A+K+A ++ G  VA+ G CG +G   +Q AK  G  +++ +D  + K K  
Sbjct: 157 CAGLTVY-KALKSAELEAGQWVAISGACGGLGSLAVQYAKAMG-YRVLGIDGGDEKAKMF 214

Query: 238 SQFGATDFINPKEDLAKDQTIVEKLVEMTDGG 269
            + G   FI    D  K + I+ ++V+ T+GG
Sbjct: 215 KELGGEYFI----DFTKCKDIIGEVVKATNGG 242

>Smik_13.266 Chr13 (418869..419996) [1128 bp, 375 aa] {ON} YMR083W
           (REAL)
          Length = 375

 Score = 87.4 bits (215), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 72/257 (28%), Positives = 111/257 (43%), Gaps = 31/257 (12%)

Query: 16  VAYDAKKPSSVEEITVDAPKAHEVRIKIEYTAVCHTDAYTLSGSDPEGL-FPCILGHEGA 74
           + Y+ K     ++I V  PK +E+ I ++Y+ VCHTD +   G  P  +  P + GHEGA
Sbjct: 38  IFYENKGKLHYKDIPVPEPKPNEILINVKYSGVCHTDLHAWHGDWPLPVKLPLVGGHEGA 97

Query: 75  GIVESVGDGVVTVKPGDHV-IALYTAECGKCKFCTSGKTNLCSAVRATQGKGVMPDGTTR 133
           G+V  +G  V   K GD   I      C  C+FC SG  + C            PD    
Sbjct: 98  GVVVKLGSNVKGWKIGDLAGIKWLNGSCMTCEFCESGHESNC------------PDA--- 142

Query: 134 FHNAKGKDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDASCLLGCGVTTGYGAAVKTAN 193
                  D+  +    +F ++     +    I     L     + C   T Y  A+K A+
Sbjct: 143 -------DLSGYTHDGSFQQFATADAIQAAKIQQGTDLAEVAPILCAGVTVY-KALKEAD 194

Query: 194 VQKGDTVAVFG-CGTVGLSVIQGAKLRGASKIIAVDINNNKKKYCSQFGATDFINPKEDL 252
           ++ GD VA+ G  G +G   +Q A   G  +++ +D    K+K   + G   FI    D 
Sbjct: 195 LKAGDWVAISGAAGGLGSLAVQYATAMG-YRVLGIDAGEEKEKLFKKLGGEVFI----DF 249

Query: 253 AKDQTIVEKLVEMTDGG 269
            K + +V  + E T GG
Sbjct: 250 TKTKDMVSDIQEATKGG 266

>KAFR0L02010 Chr12 (379623..380678) [1056 bp, 351 aa] {ON} 
          Length = 351

 Score = 86.7 bits (213), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 83/272 (30%), Positives = 117/272 (43%), Gaps = 33/272 (12%)

Query: 1   MSAATVGKPIKCIAAVAYDAKKPSSVEEITVDAPKAHEVRIKIEYTAVCHTDAYTLSGSD 60
           MSA T+ K  K I       K     ++I V  PK++E+ I + Y+ VCH+D +   G  
Sbjct: 1   MSAPTIPKTQKAIIFSEVGGKL--EYKDIPVPVPKSNELLINVLYSGVCHSDLHIWQGDL 58

Query: 61  PEGLFPCIL-GHEGAGIVESVGDGVVTVKPGDHV-IALYTAECGKCKFCTSGKTNLCSAV 118
           P  L   ++ GHEGAG+V  +G  V   K GD+  I      C  C+FC       C   
Sbjct: 59  PLPLKLPLVGGHEGAGVVVGMGSNVKGWKLGDYAGIKFLNGTCNACEFCEQSFEISCPHA 118

Query: 119 RATQGKGVMPDGTTRFHNAKGKDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDASCLLG 178
             T   G + DG                   +F +Y     V    I     L A   L 
Sbjct: 119 DFT---GTVHDG-------------------SFQQYATADAVQAARIPQGTDLAAIAPLL 156

Query: 179 CGVTTGYGAAVKTANVQKGDTVAVFG-CGTVGLSVIQGAKLRGASKIIAVDINNNKKKYC 237
           C   T Y  A+K+AN++ G  VA+ G CG +G   IQ A   G  +++ +D    K KY 
Sbjct: 157 CAGLTAY-KALKSANMRPGQWVAISGACGGLGTYAIQYATAMG-YRVLGIDSGEEKAKYF 214

Query: 238 SQFGATDFINPKEDLAKDQTIVEKLVEMTDGG 269
              G   FI    D  K + +V  +++ TDGG
Sbjct: 215 KTLGGEVFI----DYKKSKDVVADVIKATDGG 242

>Smik_15.71 Chr15 complement(122645..123691) [1047 bp, 348 aa] {ON}
           YOL086C (REAL)
          Length = 348

 Score = 86.7 bits (213), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 74/277 (26%), Positives = 118/277 (42%), Gaps = 35/277 (12%)

Query: 16  VAYDAKKPSSVEEITVDAPKAHEVRIKIEYTAVCHTDAYTLSGSDP-EGLFPCILGHEGA 74
           + Y++      ++I V  PKA+E+ I ++Y+ VCHTD +   G  P     P + GHEGA
Sbjct: 11  IFYESHGKLEYKDIPVPKPKANELLINVKYSGVCHTDLHAWHGDWPLPTKLPLVGGHEGA 70

Query: 75  GIVESVGDGVVTVKPGDHV-IALYTAECGKCKFCTSGKTNLCSAVRATQGKGVMPDGTTR 133
           G+V ++G+ V     GD+  I      C  C++C  G  + C                  
Sbjct: 71  GVVVAMGENVKGWNIGDYAGIKWLNGSCMACEYCELGNESNCPHA--------------- 115

Query: 134 FHNAKGKDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDASCLLGCGVTTGYGAAVKTAN 193
                  D+  +    +F +Y     V    I     L     + C   T Y  A+K+AN
Sbjct: 116 -------DLSGYTHDGSFQQYATADAVQAAHIPQGTDLAEVAPVLCAGITVY-KALKSAN 167

Query: 194 VQKGDTVAVFG-CGTVGLSVIQGAKLRGASKIIAVDINNNKKKYCSQFGATDFINPKEDL 252
           +  G  VA+ G  G +G   +Q AK  G  +++ +D    K++     G   FI    D 
Sbjct: 168 LMAGHWVAISGAAGGLGSLAVQYAKAMG-YRVLGIDGGEGKEELFRSIGGEVFI----DF 222

Query: 253 AKDQTIVEKLVEMTDGGLDFTFDCTGNTKIMRDALEA 289
            K++ IV  +++ TDGG         N  +   A+EA
Sbjct: 223 TKEKDIVNAVLKATDGGAHGVI----NVSVSEAAIEA 255

>KLTH0G15686g Chr7 complement(1367997..1369052) [1056 bp, 351 aa]
           {ON} highly similar to uniprot|P00330 Saccharomyces
           cerevisiae YOL086C ADH1 Alcohol dehydrogenase involved
           in the production of certain carboxylate esters
          Length = 351

 Score = 86.7 bits (213), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 77/272 (28%), Positives = 122/272 (44%), Gaps = 33/272 (12%)

Query: 1   MSAATVGKPIKCIAAVAYDAKKPSSVEEITVDAPKAHEVRIKIEYTAVCHTDAYTLSGSD 60
           MSA  + K  K +  + Y+       ++I V  PKA+E+ + ++Y+ VCHTD +   G  
Sbjct: 1   MSAHEIPKTQKGV--IFYETGGKLEYKDIDVPTPKANELLVNVKYSGVCHTDLHAYHGDW 58

Query: 61  PEGL-FPCILGHEGAGIVESVGDGVVTVKPGDHV-IALYTAECGKCKFCTSGKTNLCSAV 118
           P  +  P + GHEGAG+V ++G+ V   K GD   I      C  C+ C  G  + C   
Sbjct: 59  PLPVKLPLVGGHEGAGVVVAMGENVKGWKVGDLAGIKWLNGSCMSCESCELGNESNC--- 115

Query: 119 RATQGKGVMPDGTTRFHNAKGKDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDASCLLG 178
                    P+           D+  +    +F +Y     V    I   A L     + 
Sbjct: 116 ---------PEA----------DLSGYTHDGSFQQYATADAVQAAKIPAGADLAEIAPIL 156

Query: 179 CGVTTGYGAAVKTANVQKGDTVAVFG-CGTVGLSVIQGAKLRGASKIIAVDINNNKKKYC 237
           C   T Y  A+K+AN+Q GD VA+ G  G +G   +Q AK  G  +++ +D    K++  
Sbjct: 157 CAGITVY-KALKSANLQAGDWVAISGAAGGLGSLAVQYAKAMG-YRVLGIDGGEEKEQLF 214

Query: 238 SQFGATDFINPKEDLAKDQTIVEKLVEMTDGG 269
            Q G   FI    D    + I  ++++ T+GG
Sbjct: 215 RQLGGEVFI----DFRTCKDIEGEIIKATNGG 242

>Suva_13.494 Chr13 complement(856051..857097) [1047 bp, 348 aa] {ON}
           YMR303C (REAL)
          Length = 348

 Score = 86.3 bits (212), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 70/257 (27%), Positives = 114/257 (44%), Gaps = 31/257 (12%)

Query: 16  VAYDAKKPSSVEEITVDAPKAHEVRIKIEYTAVCHTDAYTLSGSDPEGL-FPCILGHEGA 74
           + Y++      ++I V  PK +E+ I ++Y+ VCHTD +   G  P     P + GHEGA
Sbjct: 11  IFYESNGKLEHKDIPVPTPKPNELLINVKYSGVCHTDLHAWHGDWPLATKLPLVGGHEGA 70

Query: 75  GIVESVGDGVVTVKPGDHV-IALYTAECGKCKFCTSGKTNLCSAVRATQGKGVMPDGTTR 133
           G+V ++G+ V   K GD   I    + C  C++C  G  + C                  
Sbjct: 71  GVVVAMGENVRGWKVGDLAGIKWLNSSCMACEYCELGNESNCPHA--------------- 115

Query: 134 FHNAKGKDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDASCLLGCGVTTGYGAAVKTAN 193
                  D+  +    +F +Y     V    I     L     + C   T Y  A+K+AN
Sbjct: 116 -------DLSGYTHDGSFQQYATADAVQAAHIPEGTDLAEVAPILCAGITVY-KALKSAN 167

Query: 194 VQKGDTVAVFG-CGTVGLSVIQGAKLRGASKIIAVDINNNKKKYCSQFGATDFINPKEDL 252
           ++ G  VA+ G  G +G   +Q AK  G  +++ +D    K++  +  G   FI    D 
Sbjct: 168 LRAGHWVAISGAAGGLGSLAVQYAKAMG-YRVVGIDGGPGKEELFTSLGGEVFI----DF 222

Query: 253 AKDQTIVEKLVEMTDGG 269
            K++ IV  +++ TDGG
Sbjct: 223 TKEKDIVGAVIKATDGG 239

>YMR303C Chr13 complement(873291..874337) [1047 bp, 348 aa] {ON}
           ADH2Glucose-repressible alcohol dehydrogenase II,
           catalyzes the conversion of ethanol to acetaldehyde;
           involved in the production of certain carboxylate
           esters; regulated by ADR1
          Length = 348

 Score = 86.3 bits (212), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 75/279 (26%), Positives = 119/279 (42%), Gaps = 35/279 (12%)

Query: 14  AAVAYDAKKPSSVEEITVDAPKAHEVRIKIEYTAVCHTDAYTLSGSDP-EGLFPCILGHE 72
           A + Y++      ++I V  PK +E+ I ++Y+ VCHTD +   G  P     P + GHE
Sbjct: 9   AIIFYESNGKLEHKDIPVPKPKPNELLINVKYSGVCHTDLHAWHGDWPLPTKLPLVGGHE 68

Query: 73  GAGIVESVGDGVVTVKPGDHV-IALYTAECGKCKFCTSGKTNLCSAVRATQGKGVMPDGT 131
           GAG+V  +G+ V   K GD+  I      C  C++C  G  + C                
Sbjct: 69  GAGVVVGMGENVKGWKIGDYAGIKWLNGSCMACEYCELGNESNCPHA------------- 115

Query: 132 TRFHNAKGKDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDASCLLGCGVTTGYGAAVKT 191
                    D+  +    +F EY     V    I     L     + C   T Y  A+K+
Sbjct: 116 ---------DLSGYTHDGSFQEYATADAVQAAHIPQGTDLAEVAPILCAGITVY-KALKS 165

Query: 192 ANVQKGDTVAVFG-CGTVGLSVIQGAKLRGASKIIAVDINNNKKKYCSQFGATDFINPKE 250
           AN++ G   A+ G  G +G   +Q AK  G  +++ +D    K++  +  G   FI    
Sbjct: 166 ANLRAGHWAAISGAAGGLGSLAVQYAKAMG-YRVLGIDGGPGKEELFTSLGGEVFI---- 220

Query: 251 DLAKDQTIVEKLVEMTDGGLDFTFDCTGNTKIMRDALEA 289
           D  K++ IV  +V+ T+GG         N  +   A+EA
Sbjct: 221 DFTKEKDIVSAVVKATNGGAHGII----NVSVSEAAIEA 255

>KLLA0F00506g Chr6 complement(36518..37675) [1158 bp, 385 aa] {ON}
           similar to uniprot|P39714 Saccharomyces cerevisiae
           YAL060W BDH1 NAD-dependent (2R 3R)-2 3-butanediol
           dehydrogenase
          Length = 385

 Score = 86.3 bits (212), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 80/296 (27%), Positives = 126/296 (42%), Gaps = 57/296 (19%)

Query: 13  IAAVAY----DAKKPSSVEEITVDAPKAHEVRIKIEYTAVCHTDAYT-LSGS-------- 59
           + A+AY    D +    +EE  ++      + I++ +  +C +D +  L G         
Sbjct: 1   MRALAYFGKQDIRYTKDLEEPVIETDDG--IEIEVSWCGICGSDLHEYLDGPIFFPEDGK 58

Query: 60  --DPEGL-FPCILGHEGAGIVESVGDGVVTVKPGDHVIALYTAEC--------------G 102
             D  GL  P  +GHE +GIV  VG  V  +K GDHV+   T  C               
Sbjct: 59  VHDVSGLGLPQAMGHEMSGIVSKVGPKVTNIKAGDHVVVEATGTCLDHYTWPNAAHAKDA 118

Query: 103 KCKFCTSGKTNLCSAVRATQGKGVMPDGTTRFHNAKGKDIYHFMGCSTFSEYTVVADVSV 162
           +C  C  G  N C+ +    G GV   G                    F+E  VV++  V
Sbjct: 119 ECAACQRGFYNCCAHL-GFMGLGVHSGG--------------------FAEKVVVSEKHV 157

Query: 163 VAIDPKAPLDASCLLGCGVTTGYGAAVKTANVQKGDTVAVFGCGTVGLSVIQGAKLRGAS 222
           V I    PLD + L+     + +  AV+ + +QKG +  V G G +GL+ I   +  GAS
Sbjct: 158 VKIPNTLPLDVAALVEPISVSWH--AVRISKLQKGQSALVLGAGPIGLATILALQGHGAS 215

Query: 223 KIIAVDINNNKKKYCSQFGATDFINPKEDLAKDQTIVEKLVEMTDGGLDFTFDCTG 278
           KI+  +    ++   ++ G   F +P E       I++KL    + G DF +DC+G
Sbjct: 216 KIVVSEPAEIRRNQAAKLGVETF-DPSEHKEDAVNILKKLAPGGE-GFDFAYDCSG 269

>YAL060W Chr1 (35155..36303) [1149 bp, 382 aa] {ON}
           BDH1NAD-dependent (R,R)-butanediol dehydrogenase,
           catalyzes oxidation of (R,R)-2,3-butanediol to
           (3R)-acetoin, oxidation of meso-butanediol to
           (3S)-acetoin, and reduction of acetoin; enhances use of
           2,3-butanediol as an aerobic carbon source
          Length = 382

 Score = 86.3 bits (212), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 78/278 (28%), Positives = 116/278 (41%), Gaps = 51/278 (18%)

Query: 38  EVRIKIEYTAVCHTDAYT-LSGS-----DPE------GLFPCILGHEGAGIVESVGDGVV 85
           EV I + +  +C +D +  L G      D E         P  +GHE +GIV  VG  V 
Sbjct: 28  EVIIDVSWCGICGSDLHEYLDGPIFMPKDGECHKLSNAALPLAMGHEMSGIVSKVGPKVT 87

Query: 86  TVKPGDHVIALYTAECG--------------KCKFCTSGKTNLCSAVRATQGKGVMPDGT 131
            VK GDHV+    + C                C  C  G  NLC+      G GV+  G 
Sbjct: 88  KVKVGDHVVVDAASSCADLHCWPHSKFYNSKPCDACQRGSENLCTHA-GFVGLGVISGG- 145

Query: 132 TRFHNAKGKDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDASCLLGCGVTTGYGAAVKT 191
                              F+E  VV+   ++ +  + PLD + L+     T +  AVK 
Sbjct: 146 -------------------FAEQVVVSQHHIIPVPKEIPLDVAALVEPLSVTWH--AVKI 184

Query: 192 ANVQKGDTVAVFGCGTVGLSVIQGAKLRGASKIIAVDINNNKKKYCSQFGATDFINPKED 251
           +  +KG +  V G G +GL  I   K  GASKI+  +I   + +   + G   F NP + 
Sbjct: 185 SGFKKGSSALVLGAGPIGLCTILVLKGMGASKIVVSEIAERRIEMAKKLGVEVF-NPSKH 243

Query: 252 LAKDQTIVEKLVEMTDGGLDFTFDCTGNTKIMRDALEA 289
             K   I+  L +  D G D+++DC+G       +L+A
Sbjct: 244 GHKSIEILRGLTKSHD-GFDYSYDCSGIQVTFETSLKA 280

>CAGL0I07843g Chr9 complement(756345..757403) [1059 bp, 352 aa] {ON}
           highly similar to uniprot|P00330 Saccharomyces
           cerevisiae YOL086c ADH1 alcohol dehydrogenase I or
           uniprot|P00331 Saccharomyces cerevisiae YMR303c ADH2
          Length = 352

 Score = 85.9 bits (211), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 69/257 (26%), Positives = 112/257 (43%), Gaps = 31/257 (12%)

Query: 16  VAYDAKKPSSVEEITVDAPKAHEVRIKIEYTAVCHTDAYTLSGSDPEGL-FPCILGHEGA 74
           + Y+       ++I V  PKA+E+ I ++Y+ VCHTD +   G  P     P + GHEGA
Sbjct: 15  IFYENNGKLEYKDIPVPKPKANEILINVKYSGVCHTDLHAWHGDWPLATKLPLVGGHEGA 74

Query: 75  GIVESVGDGVVTVKPGDHV-IALYTAECGKCKFCTSGKTNLCSAVRATQGKGVMPDGTTR 133
           G+V  +G+ V   K GD+  I      C  C++C     + C            P+    
Sbjct: 75  GVVVGMGENVKGWKIGDYAGIKWLNGSCMACEYCEKSNESNC------------PEA--- 119

Query: 134 FHNAKGKDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDASCLLGCGVTTGYGAAVKTAN 193
                  D+  +    +F +Y     V    I     L     + C   T Y  A+K+AN
Sbjct: 120 -------DLSGYTHDGSFQQYATADYVQAARIPQGTDLAQVAPILCAGITVY-KALKSAN 171

Query: 194 VQKGDTVAVFG-CGTVGLSVIQGAKLRGASKIIAVDINNNKKKYCSQFGATDFINPKEDL 252
           +  G+ VA+ G  G +G   +Q AK  G  +I+ +D  + KK    + G   F+    D 
Sbjct: 172 LNAGEWVAISGAAGGLGSLAVQYAKAMG-YRILGIDGGDEKKALFHELGGEIFV----DF 226

Query: 253 AKDQTIVEKLVEMTDGG 269
            K + + + ++  T+GG
Sbjct: 227 TKSKNVEQDILVATNGG 243

>TBLA0E03440 Chr5 (852767..853822) [1056 bp, 351 aa] {ON} Anc_3.118
           YBR145W
          Length = 351

 Score = 85.5 bits (210), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 76/272 (27%), Positives = 117/272 (43%), Gaps = 33/272 (12%)

Query: 1   MSAATVGKPIKCIAAVAYDAKKPSSVEEITVDAPKAHEVRIKIEYTAVCHTDAYTLSGSD 60
           MSA  + +  K  A + Y    P   +++ V  PK +E+ I I+Y+ VCHTD +   G  
Sbjct: 1   MSAPVIPQTQK--AVIFYKNGGPLEYKDVPVPTPKPNEILINIKYSGVCHTDLHAWKGDW 58

Query: 61  P-EGLFPCILGHEGAGIVESVGDGVVTVKPGDHV-IALYTAECGKCKFCTSGKTNLCSAV 118
           P +   P I GHEGAG+V  +G  V   K GD+  +      C  C+ C     + C   
Sbjct: 59  PLDTKLPLIGGHEGAGVVVGMGSNVKGWKIGDYAGVKWLNGSCMSCEECELSNESNC--- 115

Query: 119 RATQGKGVMPDGTTRFHNAKGKDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDASCLLG 178
                    P+           D+  +    +F EY     V    I     L     L 
Sbjct: 116 ---------PEA----------DLSGYTHDGSFQEYCTADAVQAARIPQGTDLAQVAPLL 156

Query: 179 CGVTTGYGAAVKTANVQKGDTVAVFG-CGTVGLSVIQGAKLRGASKIIAVDINNNKKKYC 237
           C   T Y  A+K+A++  G  VA+ G CG +G   IQ AK  G  +++ +D    KKK  
Sbjct: 157 CAGVTVY-KALKSADLAAGQWVAISGACGGLGSLAIQFAKAMGL-RVLGIDGGEEKKKMF 214

Query: 238 SQFGATDFINPKEDLAKDQTIVEKLVEMTDGG 269
            + G   F+    D   ++ +   +++ T+GG
Sbjct: 215 HELGGEVFL----DFRLEKDMEAAIIKATNGG 242

>Skud_15.68 Chr15 complement(118795..119841) [1047 bp, 348 aa] {ON}
           YOL086C (REAL)
          Length = 348

 Score = 85.5 bits (210), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 73/277 (26%), Positives = 118/277 (42%), Gaps = 35/277 (12%)

Query: 16  VAYDAKKPSSVEEITVDAPKAHEVRIKIEYTAVCHTDAYTLSGSDP-EGLFPCILGHEGA 74
           + Y++      ++I V  PKA+E+ I ++Y+ VCHTD +   G  P     P + GHEGA
Sbjct: 11  IFYESHGKLEYKDIPVPKPKANELLINVKYSGVCHTDLHAWHGDWPLPTKLPLVGGHEGA 70

Query: 75  GIVESVGDGVVTVKPGDHV-IALYTAECGKCKFCTSGKTNLCSAVRATQGKGVMPDGTTR 133
           G+V ++G+ V     GD   I      C  C++C  G  + C                  
Sbjct: 71  GVVVAMGENVKGWNIGDFAGIKWLNGSCMACEYCELGNESNCPHA--------------- 115

Query: 134 FHNAKGKDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDASCLLGCGVTTGYGAAVKTAN 193
                  D+  +    +F +Y     V    + P   L     + C   T Y  A+K+AN
Sbjct: 116 -------DLSGYTHDGSFQQYATADAVQAAHVAPGTDLAEVAPVLCAGITVY-KALKSAN 167

Query: 194 VQKGDTVAVFG-CGTVGLSVIQGAKLRGASKIIAVDINNNKKKYCSQFGATDFINPKEDL 252
           +  G  VA+ G  G +G   +Q AK  G  ++I +D    K++     G   F+    D 
Sbjct: 168 LMAGHWVAISGAAGGLGSLAVQYAKAMG-YRVIGIDGGEGKEELFRSIGGEVFV----DF 222

Query: 253 AKDQTIVEKLVEMTDGGLDFTFDCTGNTKIMRDALEA 289
            K++ IV  +++ T+GG         N  +   A+EA
Sbjct: 223 TKEKDIVGAVLKATNGGAHGVI----NVSVSEAAIEA 255

>Kpol_431.8 s431 (21043..22185) [1143 bp, 380 aa] {ON}
           (21043..22185) [1143 nt, 381 aa]
          Length = 380

 Score = 85.9 bits (211), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 69/245 (28%), Positives = 106/245 (43%), Gaps = 31/245 (12%)

Query: 28  EITVDAPKAHEVRIKIEYTAVCHTDAYTLSGSDPEGL-FPCILGHEGAGIVESVGDGVVT 86
           +I V  PK++E+ I ++Y+ VCHTD +   G  P  +  P + GHEGAG+V  +G+ V  
Sbjct: 55  DIPVPTPKSNEILINVKYSGVCHTDLHAWKGDWPLAVKLPLVGGHEGAGVVVGIGENVKG 114

Query: 87  VKPGDHV-IALYTAECGKCKFCTSGKTNLCSAVRATQGKGVMPDGTTRFHNAKGKDIYHF 145
            K GD   I      C  C+ C +G    C                      +  D+  +
Sbjct: 115 WKLGDLAGIKWLNGSCMSCELCETGHEANC----------------------EHADLSGY 152

Query: 146 MGCSTFSEYTVVADVSVVAIDPKAPLDASCLLGCGVTTGYGAAVKTANVQKGDTVAVFG- 204
               +F +Y     V    I   + L     + C   T Y  A+KTAN++ G+ VA+ G 
Sbjct: 153 THDGSFQQYATADAVQAARIPEGSDLAQIAPILCAGITVY-KALKTANLKPGEWVAISGA 211

Query: 205 CGTVGLSVIQGAKLRGASKIIAVDINNNKKKYCSQFGATDFINPKEDLAKDQTIVEKLVE 264
            G +G   +Q AK  G  +++ +D    K+K     G   F+    D  K + IV  +  
Sbjct: 212 AGGLGSLAVQYAKAMG-YRVVGIDGGEEKEKLFRSLGGEVFV----DFTKSKDIVADIQN 266

Query: 265 MTDGG 269
            T GG
Sbjct: 267 ATKGG 271

>KLTH0G18986g Chr7 complement(1639254..1640318) [1065 bp, 354 aa]
           {ON} similar to uniprot|P35497 Saccharomyces cerevisiae
           YJR159W SOR1 Sorbitol dehydrogenase expression is
           induced in the presence of sorbitol
          Length = 354

 Score = 85.5 bits (210), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 98/371 (26%), Positives = 160/371 (43%), Gaps = 47/371 (12%)

Query: 20  AKKPSSVEEITVDAPKAHEVRIKIEYTAVCHTDA-YTLSGSDPEGLF--PCILGHEGAGI 76
           A +   V EIT      H V+++I+ T +C +D  Y ++G+  + +   P ILGHE +G+
Sbjct: 17  AVESKPVPEIT----DPHYVKLQIKKTGICGSDVHYYVAGAIGDFVVKKPMILGHESSGL 72

Query: 77  VESVGDGVVTVKPGDHVIALYTAECGKCKFCTSGKTNLCSAVRATQGKGVMPDGT-TRFH 135
           V  VG  V  V+ GD V               +G+ NLC  ++      +  DGT  +++
Sbjct: 73  VVEVGSEVSRVRVGDRVAIEPGVPSRYSDETKAGRYNLCPHMQFAATPPI--DGTLVKYY 130

Query: 136 NAKGKDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDASCLLGCGVTTGYGAAVKTANVQ 195
            A    +       ++ E  +V  +SV                 GV      A K A V 
Sbjct: 131 LAPEDFLVKLPDHVSYEEGALVEPLSV-----------------GVH-----ANKLAGVA 168

Query: 196 KGDTVAVFGCGTVGLSVIQGAKLRGASKIIAVDINNNKKKYCSQFGATDFINPKEDLAKD 255
               VAVFG G VGL     A+  GAS+++ +D+  +K    S FG T F+N      KD
Sbjct: 169 FNQRVAVFGAGPVGLLTGAVARAFGASEVVYIDVFEHKLSLSSNFGGTQFVNSAN--IKD 226

Query: 256 QTIVEKLVEMTDGGL--DFTFDCTGNTKIMRDALEACHKG--WGQSXXXXXXXXXXXXST 311
           +  + K +E   GG   D  FDCTG    +R  ++ C+ G  + Q             + 
Sbjct: 227 EDDLVKEIERVLGGARPDVVFDCTGAEICIRTGIKVCNSGGTYVQVGMGHDDVNFPIGAI 286

Query: 312 RPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQSGVLKVEEFITHRRPFKEINHAFE--D 369
              +L     ++  AFG  +   ++        SG + V+  +THR  F++   A+E   
Sbjct: 287 GAKELKVLGCFR-YAFGDYRDAVQL------IASGDVNVKPLVTHRFKFEDAEAAYEFNI 339

Query: 370 LHNGDCLRTVL 380
            H  + ++T++
Sbjct: 340 KHGSEVIKTII 350

>KAFR0A00790 Chr1 complement(140666..141799) [1134 bp, 377 aa] {ON}
           Anc_2.480 YMR083W
          Length = 377

 Score = 85.5 bits (210), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 71/269 (26%), Positives = 114/269 (42%), Gaps = 28/269 (10%)

Query: 4   ATVGKPIKCIAAVAYDAKKPSSVEEITVDAPKAHEVRIKIEYTAVCHTDAYTLSGSDPEG 63
           +T+  P      + Y+   P + +++ V  PK +E+ I ++Y+ VCHTD +   G  P  
Sbjct: 25  STIAIPKMQKGVIFYENGGPLTYKDMPVPVPKPNEILINVKYSGVCHTDLHAWKGDWPLP 84

Query: 64  L-FPCILGHEGAGIVESVGDGVVTVKPGDHV-IALYTAECGKCKFCTSGKTNLCSAVRAT 121
           +  P + GHEGAGIV + G  V   + GD   I      C  C+ C  G  + C      
Sbjct: 85  VKLPLVGGHEGAGIVVAKGSNVKNFEIGDLAGIKWLNGSCMACELCEKGYESNCEHA--- 141

Query: 122 QGKGVMPDGTTRFHNAKGKDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDASCLLGCGV 181
                              D+  +    +F +Y          I     L     + C  
Sbjct: 142 -------------------DLSGYTHDGSFQQYATADATQAAQIPRGTDLAEVAPILCAG 182

Query: 182 TTGYGAAVKTANVQKGDTVAVFG-CGTVGLSVIQGAKLRGASKIIAVDINNNKKKYCSQF 240
            T Y  A+KTA +Q G+ VA+ G CG +G   IQ AK  G  +++ +D    K K   + 
Sbjct: 183 VTVY-KALKTAALQPGEWVAISGACGGLGSLAIQYAKAMGL-RVLGIDGGEAKAKMFKEL 240

Query: 241 GATDFINPKEDLAKDQTIVEKLVEMTDGG 269
           G   FI+  +    ++ +++ + E T GG
Sbjct: 241 GGETFIDFTK-YKNNEAMIKDIQEATKGG 268

>ZYRO0B05940g Chr2 (480279..481418) [1140 bp, 379 aa] {ON} highly
           similar to uniprot|P00330 Saccharomyces cerevisiae
           YOL086C ADH1 Alcohol dehydrogenase involved in the
           production of certain carboxylate esters
          Length = 379

 Score = 85.5 bits (210), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 79/273 (28%), Positives = 114/273 (41%), Gaps = 32/273 (11%)

Query: 1   MSAATVGKPIKCIAAVAYD-AKKPSSVEEITVDAPKAHEVRIKIEYTAVCHTDAYTLSGS 59
           MSAA      K    V ++ +  P   +EI V  PK +E+ I + Y+ VCHTD +   G 
Sbjct: 26  MSAAPAPVIPKTQKGVVFNESNGPLEYKEIPVPTPKPNEILIHVRYSGVCHTDLHAWKGD 85

Query: 60  DP-EGLFPCILGHEGAGIVESVGDGVVTVKPGDHV-IALYTAECGKCKFCTSGKTNLCSA 117
            P     P + GHEGAG V ++G  V   K GD   I      C  C+ C     + C  
Sbjct: 86  WPLPTKLPLVGGHEGAGEVIALGSNVKNWKVGDLAGIKWLNGSCMSCESCEQSNESNC-- 143

Query: 118 VRATQGKGVMPDGTTRFHNAKGKDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDASCLL 177
                     PD           D+  +    +F +Y     V    I P   L     +
Sbjct: 144 ----------PDA----------DLSGYTHDGSFQQYATADAVQAAHIPPGTDLAEVAPV 183

Query: 178 GCGVTTGYGAAVKTANVQKGDTVAVFG-CGTVGLSVIQGAKLRGASKIIAVDINNNKKKY 236
            C   T Y  A+K+AN++ G  VA+ G  G +G   +Q AK  G  +++ +D    K++ 
Sbjct: 184 LCAGITVY-KALKSANLKAGQWVAISGAAGGLGSLAVQFAKAMGL-RVVGIDGGPGKEEL 241

Query: 237 CSQFGATDFINPKEDLAKDQTIVEKLVEMTDGG 269
               G   FI    D  K+  IV  +V  T+GG
Sbjct: 242 FKTLGGEVFI----DFQKESDIVGAVVNATNGG 270

>Skud_1.3 Chr1 (11174..12322) [1149 bp, 382 aa] {ON} YAL060W (REAL)
          Length = 382

 Score = 85.5 bits (210), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 79/293 (26%), Positives = 117/293 (39%), Gaps = 56/293 (19%)

Query: 28  EITVDAPKA-----HEVRIKIEYTAVC------HTDAYTLSGSDPE------GLFPCILG 70
             T D PK       EV I + +  +C      +TD       D E         P  +G
Sbjct: 13  HFTNDIPKPAIQADDEVIIDVSWCGICGSDLHEYTDGPIFMPKDGECHALSNAALPLAMG 72

Query: 71  HEGAGIVESVGDGVVTVKPGDHVIALYTAECG--------------KCKFCTSGKTNLCS 116
           HE +GI+  VG  V  VK GDHV+    + C                C+ C  G  NLC 
Sbjct: 73  HEMSGIIAKVGPRVTKVKVGDHVVVDAGSSCADLHCWPHSKYYNSKPCEACKKGSENLC- 131

Query: 117 AVRATQGKGVMPDGTTRFHNAKGKDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDASCL 176
           A     G GV+  G                    F+E  VV++  ++ +  + PLD + L
Sbjct: 132 AHSGFVGLGVISGG--------------------FAEQVVVSEHHIIPVPKEIPLDVAAL 171

Query: 177 LGCGVTTGYGAAVKTANVQKGDTVAVFGCGTVGLSVIQGAKLRGASKIIAVDINNNKKKY 236
           +     T +  AVK +  +KG +  V G G +GL  I   K  GA KI+  ++   + K 
Sbjct: 172 VEPLSVTWH--AVKLSGFKKGSSALVLGAGPIGLCTILVLKGMGAGKIVVSEVAERRLKM 229

Query: 237 CSQFGATDFINPKEDLAKDQTIVEKLVEMTDGGLDFTFDCTGNTKIMRDALEA 289
                   F NP +   K   ++  L E  D G D+++DC+G       +L+A
Sbjct: 230 AKSLDVEVF-NPAQHGHKSVELLRGLTESHD-GFDYSYDCSGIQATFETSLKA 280

>Suva_15.81 Chr15 complement(132739..133785) [1047 bp, 348 aa] {ON}
           YOL086C (REAL)
          Length = 348

 Score = 84.7 bits (208), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 76/279 (27%), Positives = 121/279 (43%), Gaps = 39/279 (13%)

Query: 16  VAYDAKKPSSVEEITVDAPKAHEVRIKIEYTAVCHTDAYTLSGSDPEGL-FPCILGHEGA 74
           + Y++      ++I V  PKA+E+ I ++Y+ VCHTD +   G  P  +  P + GHEGA
Sbjct: 11  IFYESHGKLEYKDIPVPTPKANELLINVKYSGVCHTDLHAWHGDWPLPVKLPLVGGHEGA 70

Query: 75  GIVESVGDGVVTVKPGDHV-IALYTAECGKCKFCTSGKTNLCSAVRATQGKGVMPDGTTR 133
           G+V ++G+ V     GD   I      C  C++C  G  + C                  
Sbjct: 71  GVVVAMGENVKGWNIGDFAGIKWLNGSCMACEYCELGNESNCPHA--------------- 115

Query: 134 FHNAKGKDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDASC--LLGCGVTTGYGAAVKT 191
                  D+  +    +F +Y     V    I PK    A C  +L  G+T     A+K+
Sbjct: 116 -------DLSGYTHDGSFQQYATADSVQAAHI-PKGTDLAECAPVLCAGITV--YKALKS 165

Query: 192 ANVQKGDTVAVFG-CGTVGLSVIQGAKLRGASKIIAVDINNNKKKYCSQFGATDFINPKE 250
           AN+  G  VA+ G  G +G   +Q AK  G  +++ +D    K++     G   FI    
Sbjct: 166 ANLSAGQWVAISGAAGGLGSLAVQYAKAMG-YRVVGIDGGEGKEELFRSIGGEVFI---- 220

Query: 251 DLAKDQTIVEKLVEMTDGGLDFTFDCTGNTKIMRDALEA 289
           D   ++ IV  +++ TDGG         N  +   A+EA
Sbjct: 221 DFTTEKDIVGAVIKATDGGAHGII----NVSVSEAAIEA 255

>TBLA0E03430 Chr5 (850493..851548) [1056 bp, 351 aa] {ON} 
          Length = 351

 Score = 84.7 bits (208), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 79/292 (27%), Positives = 126/292 (43%), Gaps = 37/292 (12%)

Query: 1   MSAATVGKPIKCIAAVAYDAKKPSSVEEITVDAPKAHEVRIKIEYTAVCHTDAYTLSGSD 60
           MSA  + K  K  A + Y++      +++ V  PK +E+ I I+Y+ VCHTD +   G  
Sbjct: 1   MSAPVIPKTQK--AVIFYESGGALEYKDVPVPTPKPNEILINIKYSGVCHTDLHAWKGDW 58

Query: 61  P-EGLFPCILGHEGAGIVESVGDGVVTVKPGDHV-IALYTAECGKCKFCTSGKTNLCSAV 118
           P +   P I GHEGAG+V  +G  V   K GD+  +      C  C+ C     + C   
Sbjct: 59  PLDTKLPLIGGHEGAGVVVGMGANVRGWKIGDYAGVKWLNGSCMSCEECELSNESNC--- 115

Query: 119 RATQGKGVMPDGTTRFHNAKGKDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDASCLLG 178
                    P+           D+  +    +F EY     V    I   A L     + 
Sbjct: 116 ---------PEA----------DLSGYTHDGSFQEYCTADAVQAARIPQGADLAEVAPIL 156

Query: 179 CGVTTGYGAAVKTANVQKGDTVAVFG-CGTVGLSVIQGAKLRGASKIIAVDINNNKKKYC 237
           C   T Y  A+K+A++  G+ VA+ G CG +G   +Q AK  G  +++ +D    KKK  
Sbjct: 157 CAGVTVY-KALKSADLAAGEWVAISGACGGLGSLAVQFAKAMGL-RVLGIDGGEEKKKMF 214

Query: 238 SQFGATDFINPKEDLAKDQTIVEKLVEMTDGGLDFTFDCTGNTKIMRDALEA 289
            + G   F+    D   ++ +   +++ T+GG         N  +   A+EA
Sbjct: 215 HEMGGEVFL----DFRLEKDMEAAVIKATNGGAHGVI----NVSVSEAAIEA 258

>KLLA0F13530g Chr6 (1251162..1252289) [1128 bp, 375 aa] {ON}
           uniprot|P49385 Kluyveromyces lactis ADH4 Alcohol
           dehydrogenase IV, mitochondrial precursor
          Length = 375

 Score = 85.1 bits (209), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 69/246 (28%), Positives = 109/246 (44%), Gaps = 31/246 (12%)

Query: 27  EEITVDAPKAHEVRIKIEYTAVCHTDAYTLSGSDPEGL-FPCILGHEGAGIVESVGDGVV 85
           +++ V  PKA+E+ I ++Y+ VCHTD +   G  P  +  P + GHEGAGIV + G+ V 
Sbjct: 49  KDLPVPKPKANEILINVKYSGVCHTDLHAWKGDWPLPVKLPLVGGHEGAGIVVAKGENVK 108

Query: 86  TVKPGDHV-IALYTAECGKCKFCTSGKTNLCSAVRATQGKGVMPDGTTRFHNAKGKDIYH 144
             + GD+  I      C  C+ C  G  + C                         D+  
Sbjct: 109 NFEIGDYAGIKWLNGSCMSCELCEQGYESNCLQA----------------------DLSG 146

Query: 145 FMGCSTFSEYTVVADVSVVAIDPKAPLDASCLLGCGVTTGYGAAVKTANVQKGDTVAVFG 204
           +    +F +Y     V    I     L     + C   T Y  A+KTA+++ G  VA+ G
Sbjct: 147 YTHDGSFQQYATADAVQAAQIPKGTDLAEIAPILCAGVTVY-KALKTADLKPGQWVAISG 205

Query: 205 -CGTVGLSVIQGAKLRGASKIIAVDINNNKKKYCSQFGATDFINPKEDLAKDQTIVEKLV 263
             G +G   +Q AK  G  +++ +D  + K++   Q G   FI    D  K + +V  + 
Sbjct: 206 AAGGLGSLAVQYAKAMGL-RVLGIDGGDGKEELFKQCGGEVFI----DFRKSKDMVADIQ 260

Query: 264 EMTDGG 269
           E T+GG
Sbjct: 261 EATNGG 266

>AAR084W Chr1 (494021..495178) [1158 bp, 385 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YMR303C (ADH2)
          Length = 385

 Score = 85.1 bits (209), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 72/259 (27%), Positives = 113/259 (43%), Gaps = 32/259 (12%)

Query: 15  AVAYDAKK-PSSVEEITVDAPKAHEVRIKIEYTAVCHTDAYTLSGSDP-EGLFPCILGHE 72
           A+ +D    P    EI V  PK  E+ I ++Y+ VCHTD +   G  P     P + GHE
Sbjct: 46  AIVFDKNGGPLEYREIEVPEPKPTELLINVKYSGVCHTDLHAWKGDWPLPTKLPLVGGHE 105

Query: 73  GAGIVESVGDGVVTVKPGDHV-IALYTAECGKCKFCTSGKTNLCSAVRATQGKGVMPDGT 131
           GAG+V ++G+ V   + GD   I      C  C+ C  G  + C            P+  
Sbjct: 106 GAGVVVAMGENVRGWQVGDLAGIKWLNGSCMSCEACEQGHESNC------------PEA- 152

Query: 132 TRFHNAKGKDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDASCLLGCGVTTGYGAAVKT 191
                    D+  +    +F +Y     V    I     L     + C   T Y  A+K+
Sbjct: 153 ---------DLSGYTHDGSFQQYATADAVQAAHIPAGTDLAQVAPILCAGITVY-KALKS 202

Query: 192 ANVQKGDTVAVFG-CGTVGLSVIQGAKLRGASKIIAVDINNNKKKYCSQFGATDFINPKE 250
           AN++ G+ VA+ G CG +G   IQ A+  G  +++ +D  + K+    + G   F+    
Sbjct: 203 ANLRAGNWVAISGACGGLGSLAIQYARAMG-YRVLEIDGGDEKEALFRKLGGEVFV---- 257

Query: 251 DLAKDQTIVEKLVEMTDGG 269
           D  K + +V  +V+ T GG
Sbjct: 258 DFRKSKDVVADVVKATGGG 276

>KLTH0D05588g Chr4 complement(502176..503345) [1170 bp, 389 aa] {ON}
           similar to uniprot|P07246 Saccharomyces cerevisiae
           YMR083W ADH3 Alcohol dehydrogenase isoenzyme III
          Length = 389

 Score = 84.7 bits (208), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 68/246 (27%), Positives = 104/246 (42%), Gaps = 31/246 (12%)

Query: 27  EEITVDAPKAHEVRIKIEYTAVCHTDAYTLSGSDPEGL-FPCILGHEGAGIVESVGDGVV 85
           +++ V  PK +E+ I ++Y+ VCHTD +   G  P  +  P + GHEGAG+V + G+ V 
Sbjct: 63  KDLPVPKPKPNEILINVKYSGVCHTDLHAWKGDWPLAVKLPLVGGHEGAGVVVAKGENVT 122

Query: 86  TVKPGDHV-IALYTAECGKCKFCTSGKTNLCSAVRATQGKGVMPDGTTRFHNAKGKDIYH 144
             + GD+  I      C  C+ C  G    C                         D+  
Sbjct: 123 NFEIGDYAGIKWLNGSCMSCELCEQGNEPNCEHA----------------------DLSG 160

Query: 145 FMGCSTFSEYTVVADVSVVAIDPKAPLDASCLLGCGVTTGYGAAVKTANVQKGDTVAVFG 204
           +    +F +Y     V    I     L     + C   T Y  A+KTA+V+ G  VA+ G
Sbjct: 161 YTHDGSFQQYATADAVQAAQIPKGTDLAQIAPILCAGVTVY-KALKTADVRPGQWVAISG 219

Query: 205 -CGTVGLSVIQGAKLRGASKIIAVDINNNKKKYCSQFGATDFINPKEDLAKDQTIVEKLV 263
             G +G   +Q AK  G  +++ +D   +KKK     G   FI    D    + +V  + 
Sbjct: 220 AAGGLGSLAVQYAKAMGL-RVLGIDGGEDKKKLFHDLGGETFI----DFRTTKDMVGAIQ 274

Query: 264 EMTDGG 269
           E T GG
Sbjct: 275 EATQGG 280

>NDAI0H02160 Chr8 (528551..529696) [1146 bp, 381 aa] {ON} Anc_2.480
          Length = 381

 Score = 84.7 bits (208), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 72/259 (27%), Positives = 109/259 (42%), Gaps = 31/259 (11%)

Query: 14  AAVAYDAKKPSSVEEITVDAPKAHEVRIKIEYTAVCHTDAYTLSGSDP-EGLFPCILGHE 72
           A V Y+   P   ++I V  PKA+E+ I ++Y+ VCHTD +   G  P     P + GHE
Sbjct: 42  AVVFYENGGPLHYKDIPVPKPKANEILINVKYSGVCHTDLHAWKGDWPLPTKLPLVGGHE 101

Query: 73  GAGIVESVGDGVVTVKPGDHV-IALYTAECGKCKFCTSGKTNLCSAVRATQGKGVMPDGT 131
           G+G+V  VG+ V   K GD   I      C  C+ C +G  + C                
Sbjct: 102 GSGVVMQVGENVKGWKVGDLAGIKWLNGSCMACELCETGNESNCEHA------------- 148

Query: 132 TRFHNAKGKDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDASCLLGCGVTTGYGAAVKT 191
                    D+  +    +F +Y     V    I     L     + C   T Y  A+K 
Sbjct: 149 ---------DLSGYTHDGSFQQYATADAVQAARIPEGTNLAEVAPILCAGITVY-KALKE 198

Query: 192 ANVQKGDTVAVFG-CGTVGLSVIQGAKLRGASKIIAVDINNNKKKYCSQFGATDFINPKE 250
           A+++ G  V + G  G +G   +Q AK  G  ++I +D    K++     G   FI    
Sbjct: 199 ADLKAGQWVCISGAAGGLGSLAVQYAKAMG-YRVIGIDGGKAKEELFKSMGGEVFI---- 253

Query: 251 DLAKDQTIVEKLVEMTDGG 269
           D  K + +V+ + E T GG
Sbjct: 254 DFTKSKDMVKDIQEATKGG 272

>KLTH0A00418g Chr1 complement(34685..35755) [1071 bp, 356 aa] {ON}
           similar to uniprot|P00331 Saccharomyces cerevisiae
           YMR303C ADH2 Glucose-repressible alcohol dehydrogenase
           II involved in the production of certain carboxylate
           esters
          Length = 356

 Score = 84.7 bits (208), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 72/245 (29%), Positives = 112/245 (45%), Gaps = 33/245 (13%)

Query: 26  VEEITVDAPKAHEVRIKIEYTAVCHTDAYTLSGSDP-EGLFPCILGHEGAGIVESVGDGV 84
           ++ I V +PKA+E+ I ++++ VCH+D +   G  P +   P + GHEGAGIV ++G  V
Sbjct: 27  LKSIEVQSPKANELLINVKFSGVCHSDLHAWKGDWPTKTKLPLVGGHEGAGIVVAMGASV 86

Query: 85  VTVKPGDHV-IALYTAECGKCKFCTSGKTNLCSAVRATQGKGVMPDGTTRFHNAKGKDIY 143
              K GD+  I    + C  C+ C       C+                        DI 
Sbjct: 87  RGWKIGDYAGIKWLNSCCMSCEQCELSNEPNCAYA----------------------DIS 124

Query: 144 HFMGCSTFSEYTVVADVSVVAIDPKAPL-DASCLLGCGVTTGYGAAVKTANVQKGDTVAV 202
            F    +F +Y     V    I P   L + S +L  G+T     A+KTAN+  G+ VA+
Sbjct: 125 GFTRDGSFQQYATADAVQAARIPPGTNLAEVSPVLCAGITV--FKALKTANLTAGNWVAI 182

Query: 203 FG-CGTVGLSVIQGAKLRGASKIIAVDINNNKKKYCSQFGATDFINPKEDLAKDQTIVEK 261
            G CG +G   IQ AK  G S ++ +D    K+   +  G   F+    D +K + +V +
Sbjct: 183 SGACGGLGSMAIQYAKAMGYS-VVGIDSGAEKEHLFNDLGGDVFL----DFSKSENLVPE 237

Query: 262 LVEMT 266
           +V  T
Sbjct: 238 VVSAT 242

>Suva_10.154 Chr10 complement(275737..276807) [1071 bp, 356 aa] {ON}
           YLR070C (REAL)
          Length = 356

 Score = 83.2 bits (204), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 98/383 (25%), Positives = 164/383 (42%), Gaps = 58/383 (15%)

Query: 21  KKPSSVEEITVDAPK---AHEVRIKIEYTAVCHTDAYTLSGSDPEGLF---PCILGHEGA 74
           ++P  +    V+ PK   A++V ++I+ T +C +D +  +           P +LGHE +
Sbjct: 13  EQPGKIVLTNVNIPKISDANDVIVQIKATGICGSDIHYYTHGRISHFVVKSPMVLGHESS 72

Query: 75  GIVESVGDGVVTVKPGDHVIALYTAECGKCKFCTSGKTNLCSAVRATQGKGVMPDGT-TR 133
           G+V  +GD V T+K GD V                G+ NL   ++         DGT T+
Sbjct: 73  GVVVLIGDNVKTLKVGDRVALEPGFPNRFSSELKEGRYNLDPDLKFAATPPY--DGTLTK 130

Query: 134 FHNAKGKDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDASCLLGCGVTTGYGAAVKTAN 193
           ++ A    +Y      +F E  ++  +SV                         A + A 
Sbjct: 131 YYRAPKDFVYKIPDHVSFEEGALMEPLSVAV----------------------HANRLAK 168

Query: 194 VQKGDTVAVFGCGTVGLSVIQGAKLRGASKIIAVDINNNKKKYCSQFGATDFINPKEDLA 253
           ++ G    VFG G VGL   + A + GA+ ++ VD++  K +   QFGAT  +N   DL 
Sbjct: 169 MRFGARCVVFGAGPVGLLTGKVASVFGATDVVFVDLSETKLERAKQFGATHMVN-SGDLP 227

Query: 254 KD---QTIVEKLVEMTDGGLDFTFDCTGNTKIMRDALEAC-------HKGWGQSXXXXXX 303
           +    +T++ K +     G D  F+C+G    +R  +E C         G GQ       
Sbjct: 228 QGVSAETVIRKAI--GKKGADVVFECSGAQPCIRTGIEVCKAGGTYVQVGMGQEEIQFPI 285

Query: 304 XXXXXXSTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQSGVLKVEEFITHRRPFKEI 363
                 S  P + +T   ++GS F   +G  +    I+   SG L ++  IT R  FKE 
Sbjct: 286 ------SKIPAKEIT---FQGS-FRYCQG--DYSDSIELVSSGKLSLKPLITRRYQFKEA 333

Query: 364 NHAFEDL--HNGDCLRTVLKFDE 384
             AF++   H  D ++T+++  E
Sbjct: 334 IEAFDENRDHPLDNVKTIIEGPE 356

>Kwal_56.23198 s56 (443881..444936) [1056 bp, 351 aa] {ON} YOL086C
           (ADH1) - Alcohol dehydrogenase [contig 183] FULL
          Length = 351

 Score = 82.8 bits (203), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 76/272 (27%), Positives = 117/272 (43%), Gaps = 33/272 (12%)

Query: 1   MSAATVGKPIKCIAAVAYDAKKPSSVEEITVDAPKAHEVRIKIEYTAVCHTDAYTLSGSD 60
           MSA  + K  K  A + Y+   P   ++I V  P A E+ I ++Y+ VCHTD +   G  
Sbjct: 1   MSAPEIPKTQK--AVIFYENGGPLEYKDIPVPKPSATELLINVKYSGVCHTDLHAWKGDW 58

Query: 61  P-EGLFPCILGHEGAGIVESVGDGVVTVKPGDHV-IALYTAECGKCKFCTSGKTNLCSAV 118
           P     P + GHEGAG+V ++G+ V   K GD+  I      C  C+ C     + C   
Sbjct: 59  PLPTKLPLVGGHEGAGVVVAMGENVKGWKIGDYAGIKWLNGSCMSCESCELSNESNC--- 115

Query: 119 RATQGKGVMPDGTTRFHNAKGKDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDASCLLG 178
                    P+           D+  +    +F +Y     V    I     L     + 
Sbjct: 116 ---------PEA----------DLSGYTHDGSFQQYATADAVQAAKIPQGTDLAEVAPVL 156

Query: 179 CGVTTGYGAAVKTANVQKGDTVAVFG-CGTVGLSVIQGAKLRGASKIIAVDINNNKKKYC 237
           C   T Y  A+K+AN+  GD VA+ G CG +G   IQ A   G  +++ +D    K +  
Sbjct: 157 CAGITVY-KALKSANLSAGDWVAISGACGGLGSLCIQYATAMG-YRVLGIDGGAEKAELF 214

Query: 238 SQFGATDFINPKEDLAKDQTIVEKLVEMTDGG 269
            Q G   FI    D    + +  ++++ T+GG
Sbjct: 215 KQLGGEVFI----DFTTCKDVEGEIIKATNGG 242

>KLTH0E05588g Chr5 complement(494815..495861) [1047 bp, 348 aa] {ON}
           highly similar to uniprot|P00330 Saccharomyces
           cerevisiae YOL086C ADH1 Alcohol dehydrogenase involved
           in the production of certain carboxylate esters
          Length = 348

 Score = 82.4 bits (202), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 67/246 (27%), Positives = 108/246 (43%), Gaps = 31/246 (12%)

Query: 27  EEITVDAPKAHEVRIKIEYTAVCHTDAYTLSGSDPEGL-FPCILGHEGAGIVESVGDGVV 85
           ++I V  P A+E+ I ++Y+ VCHTD +   G  P     P + GHEGAG+V  +G+ V 
Sbjct: 22  KDIPVPKPAANEILINVKYSGVCHTDLHAWKGDWPLATKLPLVGGHEGAGVVVGIGENVK 81

Query: 86  TVKPGDHV-IALYTAECGKCKFCTSGKTNLCSAVRATQGKGVMPDGTTRFHNAKGKDIYH 144
             K GD   I      C  C+ C     + C                         D+  
Sbjct: 82  GWKLGDLAGIKWLNGSCMACESCELSNESNCPHA----------------------DLSG 119

Query: 145 FMGCSTFSEYTVVADVSVVAIDPKAPLDASCLLGCGVTTGYGAAVKTANVQKGDTVAVFG 204
           +    +F +Y     V    I     L     + C   T Y  A+K+AN++ G+ VA+ G
Sbjct: 120 YTHDGSFQQYATADAVQAARIPEGTDLAEVAPILCAGITVY-KALKSANLRAGNWVAISG 178

Query: 205 -CGTVGLSVIQGAKLRGASKIIAVDINNNKKKYCSQFGATDFINPKEDLAKDQTIVEKLV 263
             G +G   +Q AK  G  ++I +D  + K++   + G   F+    D  K + +V +++
Sbjct: 179 AAGGLGSLAVQYAKAMG-YRVIGIDGGDEKEQLFKKLGGEYFV----DFRKSKDVVAEIL 233

Query: 264 EMTDGG 269
           E+T GG
Sbjct: 234 EVTGGG 239

>SAKL0E02838g Chr5 (226264..227397) [1134 bp, 377 aa] {ON}
           uniprot|Q6XQ71 Saccharomyces kluyveri ADH4 Alcohol
           dehydrogenase 4
          Length = 377

 Score = 82.8 bits (203), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 71/257 (27%), Positives = 109/257 (42%), Gaps = 31/257 (12%)

Query: 16  VAYDAKKPSSVEEITVDAPKAHEVRIKIEYTAVCHTDAYTLSGSDP-EGLFPCILGHEGA 74
           + Y++      ++I V  PK +E+ I ++Y+ VCHTD +   G  P     P + GHEGA
Sbjct: 40  IFYESGGKLEYKDIPVPKPKPNEILINVKYSGVCHTDLHAWKGDWPLPTKLPLVGGHEGA 99

Query: 75  GIVESVGDGVVTVKPGDHV-IALYTAECGKCKFCTSGKTNLCSAVRATQGKGVMPDGTTR 133
           G+V + G+ V+  + GD   I      C  C+ C  G  + C                  
Sbjct: 100 GVVVAKGENVMNFEIGDLAGIKWLNGSCMACELCEQGHESNC------------------ 141

Query: 134 FHNAKGKDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDASCLLGCGVTTGYGAAVKTAN 193
            H     D+  +    +F +Y     V    I     L     + C   T Y  A+KTA+
Sbjct: 142 LH----ADLSGYTHDGSFQQYATADAVQAAQIPKGTDLAEVAPILCAGVTVY-KALKTAD 196

Query: 194 VQKGDTVAVFG-CGTVGLSVIQGAKLRGASKIIAVDINNNKKKYCSQFGATDFINPKEDL 252
           ++ G  VA+ G  G +G   +Q AK  G  +I+ +D    K++     G   FI    D 
Sbjct: 197 LKPGQWVAISGAAGGLGSLAVQYAKAMGL-RILGIDGGPGKEELFKSLGGEVFI----DF 251

Query: 253 AKDQTIVEKLVEMTDGG 269
            K + IV  + E T GG
Sbjct: 252 TKTKDIVSAIQEATKGG 268

>Ecym_7391 Chr7 (801773..802900) [1128 bp, 375 aa] {ON} similar to
           Ashbya gossypii ABL033C
          Length = 375

 Score = 82.4 bits (202), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 74/272 (27%), Positives = 116/272 (42%), Gaps = 31/272 (11%)

Query: 1   MSAATVGKPIKCIAAVAYDAKKPSSVEEITVDAPKAHEVRIKIEYTAVCHTDAYTLSGSD 60
           +S+ + G P+   A + Y+       ++I V  PK +E+ + ++Y+ VCHTD +   G  
Sbjct: 23  LSSTSSGIPLTQKAVIFYEHGDKLHYKDIPVPKPKPNEILVNVKYSGVCHTDIHAWKGDW 82

Query: 61  PEGL-FPCILGHEGAGIVESVGDGVVTVKPGDHV-IALYTAECGKCKFCTSGKTNLCSAV 118
           P     P + GHEGAGIV + G  V   + GD+  +      C  C++C +G  + C+  
Sbjct: 83  PLATKLPLVGGHEGAGIVVAKGSNVTNFEIGDYAGVKWLNKSCMSCEYCETGHESNCAEA 142

Query: 119 RATQGKGVMPDGTTRFHNAKGKDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDASCLLG 178
             +   G   DG                   +F +Y     V    I     L     + 
Sbjct: 143 DLS---GYTRDG-------------------SFQQYATADAVQAAKIPQGTDLAQVAPIL 180

Query: 179 CGVTTGYGAAVKTANVQKGDTVAV-FGCGTVGLSVIQGAKLRGASKIIAVDINNNKKKYC 237
           C   T Y  A+KTAN+  G  VA+    G +G   +Q AK  G  +++ +D    K    
Sbjct: 181 CAGVTVY-KALKTANLDPGQWVAISGAGGGLGSLAVQYAKAMGL-RVVGIDGGAAKDALF 238

Query: 238 SQFGATDFINPKEDLAKDQTIVEKLVEMTDGG 269
            + G   FI    D  K + IV  + E T+GG
Sbjct: 239 KKLGGEVFI----DFTKSKDIVADIQEATNGG 266

>YLR070C Chr12 complement(274141..275211) [1071 bp, 356 aa] {ON}
           XYL2Xylitol dehydrogenase, converts xylitol to
           D-xylulose; expression induced by xylose, even though
           this pentose sugar is not well utilized by S.
           cerevisiae; null mutant has cell wall defect
          Length = 356

 Score = 82.4 bits (202), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 97/383 (25%), Positives = 158/383 (41%), Gaps = 58/383 (15%)

Query: 21  KKPSSVEEITVDAPK---AHEVRIKIEYTAVCHTDAYTLSGSDPEGLF---PCILGHEGA 74
           ++P  +    V  PK    +EV I+I+ T +C +D +  +           P +LGHE +
Sbjct: 13  ERPGKITLTNVSIPKISDPNEVIIQIKATGICGSDIHYYTHGRIANYVVESPMVLGHESS 72

Query: 75  GIVESVGDGVVTVKPGDHVIALYTAECGKCKFCTSGKTNLCSAVRATQGKGVMPDGT-TR 133
           GIV  +G+ V T+K GD V                G+ NL   ++         DGT T+
Sbjct: 73  GIVALIGENVKTLKVGDRVALEPGIPDRFSPEMKEGRYNLDPNLKFAATPPF--DGTLTK 130

Query: 134 FHNAKGKDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDASCLLGCGVTTGYGAAVKTAN 193
           ++      +Y      +F E  ++  +SV                         A K A 
Sbjct: 131 YYKTMKDFVYKLPDDVSFEEGALIEPLSVAI----------------------HANKLAK 168

Query: 194 VQKGDTVAVFGCGTVGLSVIQGAKLRGASKIIAVDINNNKKKYCSQFGATDFINPKEDLA 253
           ++ G    VFG G +GL   + A + GA+ ++ VD+  NK +   QFGAT  +N   DL 
Sbjct: 169 IKFGARCVVFGAGPIGLLAGKVASVFGAADVVFVDLLENKLETARQFGATHIVN-SGDLP 227

Query: 254 KDQTIVEKLVEMTDG--GLDFTFDCTGNTKIMRDALEAC-------HKGWGQSXXXXXXX 304
              T V+ +++   G  G D  F+C+G    +R  +E C         G GQ        
Sbjct: 228 HGVT-VDSVIKKAIGKKGADVVFECSGAEPCVRAGIEVCKAGGTIVQVGMGQEEIQF--- 283

Query: 305 XXXXXSTRPFQLV-TGRVWKGSAFGGIKGRSEMGGLIKDYQSGVLKVEEFITHRRPFKEI 363
                   P  ++ T  +     F   +G  +    I+   S  L ++ FITHR  FK+ 
Sbjct: 284 --------PISIIPTKELTFQGCFRYCQG--DYSDSIELVSSRKLSLKPFITHRYSFKDA 333

Query: 364 NHAFEDL--HNGDCLRTVLKFDE 384
             AFE+   H  + ++T+++  E
Sbjct: 334 VEAFEETSHHPLNNIKTIIEGPE 356

>Kpol_1058.11 s1058 (41165..42226) [1062 bp, 353 aa] {ON}
           (41165..42226) [1062 nt, 354 aa]
          Length = 353

 Score = 82.0 bits (201), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 73/261 (27%), Positives = 113/261 (43%), Gaps = 29/261 (11%)

Query: 37  HEVRIKIEYTAVCHTDAYTLSGSDPEGLF---PCILGHEGAGIVESVGDGVVTVKPGDHV 93
           H V+++I+ T +C +D +  +           P +LGHE +GIV  VG  V  V  GD V
Sbjct: 31  HFVKVQIKATGICGSDVHFCTHGAIGSFIVKEPMVLGHESSGIVVEVGSEVTKVAVGDRV 90

Query: 94  IALYTAECGKCKFCTSGKTNLCSAVRATQGKGVMPDGTT-RFHNAKGKDIYHFMGCSTFS 152
                      +   SG  NLC  ++      V  DGT  ++       +Y      TF 
Sbjct: 91  AIEPGYPSRYSEETVSGHYNLCPGMKFAATPPV--DGTLLKYFQVPEDFVYKLPDDVTFE 148

Query: 153 EYTVVADVSVVAIDPKAPLDASCLLGCGVTTGYGAAVKTANVQKGDTVAVFGCGTVGLSV 212
           E  +V  ++V                         AVK A V+ GD V VFG G VGL V
Sbjct: 149 EGALVEPLAVAV----------------------HAVKLAGVKFGDKVVVFGAGPVGLLV 186

Query: 213 IQGAKLRGASKIIAVDINNNKKKYCSQFGATDFINPKEDLAKDQTIVEKLVEMTDGGLDF 272
               K  GA++++++D+ + K     + G+T  IN K D+A++   +E   ++     + 
Sbjct: 187 GSVCKAFGATEVVSIDVVDKKLDKSLEMGSTIAINSK-DMAEEALALEIQNDLNGQHPNK 245

Query: 273 TFDCTGNTKIMRDALEACHKG 293
             DCTG    +R ++ AC  G
Sbjct: 246 VIDCTGAEPCLRSSILACKPG 266

>KLTH0D00616g Chr4 (59883..61031) [1149 bp, 382 aa] {ON} similar to
           uniprot|P39713 Saccharomyces cerevisiae YAL061W putative
           polyol dehydrogenase
          Length = 382

 Score = 82.0 bits (201), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 79/311 (25%), Positives = 129/311 (41%), Gaps = 69/311 (22%)

Query: 13  IAAVAYDAKKPSSVEEITVDAPKAHE--VRIKIEYTAVCHTD----------------AY 54
           + A+AY  +K     +       +HE  V I + +  VC +D                 +
Sbjct: 1   MRALAYFGQKDIRFTDSLAQPQVSHEDEVEIDVSWCGVCGSDLHEYLDGPIFFPANGKTH 60

Query: 55  TLSGSDPEGLFPCILGHEGAGIVESVGDGVVTVKPGDHVIALYTAEC------------- 101
            +SG   +GL P  +GHE +GIV  VG  V  VK GDHV+      C             
Sbjct: 61  AMSG---QGL-PQAMGHEMSGIVSKVGSDVSKVKVGDHVVVGACCTCEDRARWPDVKHER 116

Query: 102 -GKCKFCTSGKTNLCSAVRATQGKGVMPDGTTRFHNAKGKDIYHFMGCST--FSEYTVVA 158
            G C  C +G  N C+ +                        +  +GC +  F+E  V++
Sbjct: 117 EGLCIACKTGNPNCCTDLG-----------------------FCGLGCQSGGFAEKIVLS 153

Query: 159 DVSVVAIDPKAPLDASCLLGCGVTTGYGAAVKTANVQKGDTVAVFGCGTVGLSVIQGAKL 218
           + +VV I    PLD + L+     + +  AV+ + +Q G T  V G G +GL+ +   + 
Sbjct: 154 ERNVVKIPNSLPLDVAALVEPISVSWH--AVRISKLQPGQTALVLGAGPIGLAAVLALQS 211

Query: 219 RGASKIIAVDINNNKKKYCSQFGATDFINPKEDLAKDQTIVEKLVEMTDG--GLDFTFDC 276
            GA  II  +  + +++     GA  F NP E       ++E L ++  G  G +F++DC
Sbjct: 212 HGAGTIIVSEPADTRRQKAEALGAQTF-NPTE---HGDNVIEALRKLAPGGEGFNFSYDC 267

Query: 277 TGNTKIMRDAL 287
            G ++     L
Sbjct: 268 CGTSETFSAGL 278

>ZYRO0G03388g Chr7 complement(265952..267064) [1113 bp, 370 aa] {ON}
           similar to uniprot|P07246 Saccharomyces cerevisiae
           YMR083W
          Length = 370

 Score = 82.0 bits (201), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 67/289 (23%), Positives = 121/289 (41%), Gaps = 31/289 (10%)

Query: 3   AATVGKPIKCIAAVAYDAKKPSSVEEITVDAPKAHEVRIKIEYTAVCHTDAYTLSGSDP- 61
           ++T+  P      + Y++      +++ V  P+ +E+ + ++Y+ VCHTD +   G  P 
Sbjct: 20  SSTISIPSTQKGVIFYESGGKLHYKDLAVPKPRNNEILVNVKYSGVCHTDLHAWKGDWPL 79

Query: 62  EGLFPCILGHEGAGIVESVGDGVVTVKPGDHV-IALYTAECGKCKFCTSGKTNLCSAVRA 120
           +   P + GHEGAG+V + G+ V   + GD   I      C  C+ C  G  + C+    
Sbjct: 80  DTKLPLVGGHEGAGVVVAKGENVKNFEIGDLAGIKWLNGSCQSCEMCEMGHESNCAHA-- 137

Query: 121 TQGKGVMPDGTTRFHNAKGKDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDASCLLGCG 180
                               D+  +    TF +Y     +    I     L     + C 
Sbjct: 138 --------------------DLSGYTHDGTFQQYATADAIQAAHIPKGTDLAGVAPILCA 177

Query: 181 VTTGYGAAVKTANVQKGDTVAVFG-CGTVGLSVIQGAKLRGASKIIAVDINNNKKKYCSQ 239
             T Y  A++++  + G+ VA+ G  G +G    Q A+  G  +++ +D   +K K    
Sbjct: 178 GVTVY-KALRSSGARPGEWVAISGAAGGLGSLATQYARAMGL-RVVGIDGGEDKAKLFKS 235

Query: 240 FGATDFINPKEDLAKDQTIVEKLVEMTDGGLDFTFDCTGNTKIMRDALE 288
            G   FI    D  K++ I   ++E T GG     + + + K M  ++E
Sbjct: 236 LGGEIFI----DFTKEKDIPAAILEATQGGAHGVINVSVSEKAMSQSVE 280

>TPHA0M00730 Chr13 complement(137798..138850) [1053 bp, 350 aa] {ON}
           Anc_3.118 YBR145W
          Length = 350

 Score = 81.6 bits (200), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 74/277 (26%), Positives = 118/277 (42%), Gaps = 35/277 (12%)

Query: 16  VAYDAKKPSSVEEITVDAPKAHEVRIKIEYTAVCHTDAYTLSGSDPEGL-FPCILGHEGA 74
           + Y+   P   ++I V  P  +E+ I + Y+ VCHTD +   G  P  +  P + GHEGA
Sbjct: 13  IFYENNGPLEYKDIPVPTPLPNELLIHVLYSGVCHTDLHAWHGDWPLPVKLPLVGGHEGA 72

Query: 75  GIVESVGDGVVTVKPGDHV-IALYTAECGKCKFCTSGKTNLCSAVRATQGKGVMPDGTTR 133
           G+V  +G  V   K GD+  I      C  C+ C     + C            P+    
Sbjct: 73  GVVVGMGSSVKGWKVGDYAGIKWLNGSCMSCEECELSNESNC------------PEA--- 117

Query: 134 FHNAKGKDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDASCLLGCGVTTGYGAAVKTAN 193
                  D+  +    +F +Y     V    I   A L     + C   T Y  A+K+AN
Sbjct: 118 -------DLSGYTHDGSFQQYATADAVQAAKIPAGADLKNIAPILCAGVTVY-KAIKSAN 169

Query: 194 VQKGDTVAVFG-CGTVGLSVIQGAKLRGASKIIAVDINNNKKKYCSQFGATDFINPKEDL 252
           ++ GD +A+ G CG +G   IQ  K  G  +I+ +D    K++   + G   FI    D 
Sbjct: 170 LKAGDWLAISGACGGLGSLAIQYGKAMGF-RILGIDGGAEKEELFKKLGGEYFI----DF 224

Query: 253 AKDQTIVEKLVEMTDGGLDFTFDCTGNTKIMRDALEA 289
            + + I+ ++ + T+GG         N  +   A+EA
Sbjct: 225 TQCKDIIAEVKKATNGGAHGVI----NVSVSEAAIEA 257

>NCAS0A07780 Chr1 (1548197..1549318) [1122 bp, 373 aa] {ON}
           Anc_2.480
          Length = 373

 Score = 81.6 bits (200), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 72/269 (26%), Positives = 112/269 (41%), Gaps = 31/269 (11%)

Query: 4   ATVGKPIKCIAAVAYDAKKPSSVEEITVDAPKAHEVRIKIEYTAVCHTDAYTLSGSDPEG 63
           +TV  P      + Y+   P   ++I V  PKA+E+ I ++Y+ VCHTD +   G  P  
Sbjct: 24  STVTIPKMQKGVIFYETGGPLHYKDIPVPKPKANEILINVKYSGVCHTDLHAWKGDWPLA 83

Query: 64  L-FPCILGHEGAGIVESVGDGVVTVKPGDHV-IALYTAECGKCKFCTSGKTNLCSAVRAT 121
              P + GHEG+G V ++G+ V   K GD   I      C  C+ C SG  + C      
Sbjct: 84  TKLPLVGGHEGSGEVVAMGENVKGWKIGDLAGIKWLNGSCMSCELCESGHESNCEHA--- 140

Query: 122 QGKGVMPDGTTRFHNAKGKDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDASCLLGCGV 181
                              D+  +    +F +Y     V    I     +     + C  
Sbjct: 141 -------------------DLSGYTHDGSFQQYATADAVQAARIPKGTNMAEVAPILCAG 181

Query: 182 TTGYGAAVKTANVQKGDTVAVFG-CGTVGLSVIQGAKLRGASKIIAVDINNNKKKYCSQF 240
            T Y  A+K A+++ G  V + G  G +G   +Q AK  G  ++I +D    K++     
Sbjct: 182 ITVY-KALKEADMRAGQWVCISGAAGGLGSLAVQYAKAMG-YRVIGIDGGPGKEELFKSL 239

Query: 241 GATDFINPKEDLAKDQTIVEKLVEMTDGG 269
           G   F+    D  K + IV ++ E T GG
Sbjct: 240 GGEIFV----DFTKTKDIVAEIQEATRGG 264

>Smik_1.6 Chr1 (18115..19263) [1149 bp, 382 aa] {ON} YAL060W (REAL)
          Length = 382

 Score = 81.3 bits (199), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 78/291 (26%), Positives = 119/291 (40%), Gaps = 56/291 (19%)

Query: 30  TVDAPKAH-----EVRIKIEYTAVCHTDAYT-LSGS-----DPE------GLFPCILGHE 72
           T D PK       EV I + +  +C +D +  L G      D E         P  +GHE
Sbjct: 15  TNDIPKPEIQTDDEVLIDVSWCGICGSDLHEYLDGPIFMPKDGECHALSNAGLPLAMGHE 74

Query: 73  GAGIVESVGDGVVTVKPGDHVIALYTAECG--------------KCKFCTSGKTNLCSAV 118
            +GIV  VG  V  VK GDHV+    + C                C+ C  G  NLC+  
Sbjct: 75  MSGIVAEVGPKVTKVKVGDHVVVDAASSCADLHCWPQSKHYSSKPCEACKKGSENLCTH- 133

Query: 119 RATQGKGVMPDGTTRFHNAKGKDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDASCLLG 178
               G GV+  G                    F+E   V++  ++ +  + PLD + L+ 
Sbjct: 134 GGFIGLGVISGG--------------------FAEQVAVSEHHIIPVPKEIPLDVAALVE 173

Query: 179 CGVTTGYGAAVKTANVQKGDTVAVFGCGTVGLSVIQGAKLRGASKIIAVDINNNKKKYCS 238
               T +  AVK +  +KG +  V G G +GL  I   K  GA KI+  ++   + +   
Sbjct: 174 PLSVTWH--AVKISGFKKGSSALVLGAGPIGLCTILVLKGMGAGKIVVSEVAERRIEMAK 231

Query: 239 QFGATDFINPKEDLAKDQTIVEKLVEMTDGGLDFTFDCTGNTKIMRDALEA 289
             G   F NP +   K   ++  L +  D G D+++DC+G       +L+A
Sbjct: 232 NLGVEVF-NPSKHGQKSIEVLRGLTKSHD-GFDYSYDCSGIQVTFETSLKA 280

>SAKL0B00814g Chr2 (74565..75629) [1065 bp, 354 aa] {ON} similar to
           uniprot|P35497 Saccharomyces cerevisiae YJR159W SOR1
           Sorbitol dehydrogenase expression is induced in the
           presence of sorbitol
          Length = 354

 Score = 80.9 bits (198), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 95/357 (26%), Positives = 150/357 (42%), Gaps = 49/357 (13%)

Query: 37  HEVRIKIEYTAVCHTDA-YTLSGSDPEGLF----PCILGHEGAGIVESVGDGVVTVKPGD 91
           H V++ I+ T +C +D  Y  +G+   G F    P +LGHE +G+V  VG  V +VK GD
Sbjct: 30  HYVKLAIKKTGICGSDVHYYKTGAI--GNFVVKDPMVLGHESSGVVVEVGSKVTSVKVGD 87

Query: 92  HVIALYTAECGKCKFCTSGKTNLCSAVRATQGKGVMPDGTTRFHNAKGKD-IYHFMGCST 150
            V           K   SG  NLC ++       +  DGT   +    +D +       +
Sbjct: 88  RVAIEPGVPSRYSKATKSGHYNLCPSMAFAATPPI--DGTLLKYYLSPEDFLVKLPDSVS 145

Query: 151 FSEYTVVADVSVVAIDPKAPLDASCLLGCGVTTGYGAAVKTANVQKGDTVAVFGCGTVGL 210
           F E   V  +SV                 GV      A K A+V+ G  V VFG G VGL
Sbjct: 146 FEEGACVEPLSV-----------------GV-----HANKLADVRFGSKVVVFGAGPVGL 183

Query: 211 SVIQGAKLRGASKIIAVDINNNKKKYCSQFGATDFINPKEDLAKDQTIVEKLVEMTDGGL 270
                ++  GA+ ++ VD+ ++K +  ++FGAT  +N  +  ++D  + E    ++    
Sbjct: 184 LAGAVSRAFGATDVVFVDVFDHKLERTNEFGATQTVNSSKFKSEDDLVKEIQRVLSGEQP 243

Query: 271 DFTFDCTGNTKIMRDALEACHKG-----WGQSXXXXXXXXXXXXSTRPFQLVTGRVWKGS 325
           +  F+C+G    +R  ++AC  G      G              S     L T R   G 
Sbjct: 244 EVVFECSGAEVCIRAGIKACKAGGRYVQVGMGKDNVNFPISEVVSKELQVLGTFRYCFGD 303

Query: 326 AFGGIKGRSEMGGLIKDYQSGVLKVEEFITHRRPFKEINHAFE--DLHNGDCLRTVL 380
               +K  SE          G + V+  ITHR  F++   A+E    H  D ++T++
Sbjct: 304 YNDSVKLISE----------GKVNVKPLITHRFKFQDAIKAYEFNIEHGEDVVKTII 350

>TDEL0H04460 Chr8 complement(769988..771136) [1149 bp, 382 aa] {ON}
           Anc_7.2 YAL061W
          Length = 382

 Score = 80.9 bits (198), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 80/278 (28%), Positives = 113/278 (40%), Gaps = 56/278 (20%)

Query: 38  EVRIKIEYTAVCHTDAYTLS----------GSDPEG--LFPCILGHEGAGIVESVGDGVV 85
           EV I++ +  +C TD +  S          GS P      P  +GHE +GIV  +G  V 
Sbjct: 28  EVLIEVSWAGICGTDLHEYSDGPIFMPQDGGSHPLSGKKLPQPMGHEMSGIVSKIGSKVT 87

Query: 86  TVKPGDHVIALYTAEC-------------GK-CKFCTSGKTNLCSAVRATQGKGVMPDGT 131
            VK GDHV+      C             GK C  C  G  N+C+    T G G    G 
Sbjct: 88  KVKVGDHVVVEAGCSCMDVKRWKESPLKGGKTCSACEKGLVNICAHACFT-GLGTSGGG- 145

Query: 132 TRFHNAKGKDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDASCLLGCGVTTGYGAAVKT 191
                              F+E   V+    + I    PLD + L+     T + A  K 
Sbjct: 146 -------------------FAERLTVSQDHCIPIPKDLPLDVAALVEPLSVTWHAA--KV 184

Query: 192 ANVQKGDTVAVFGCGTVGLSVIQGAKLRGASKIIAVDINNNKKKYCSQFGATDFINPKED 251
           A  QKG T  V G G +GL+ I   K  GASKI+  ++   ++   +  G   F NP   
Sbjct: 185 AGFQKGQTACVLGAGPIGLATILTLKGLGASKIVVSELAQIRRDMAASMGVEVF-NP--- 240

Query: 252 LAKDQTIVEKLVEMTDG--GLDFTFDCTGNTKIMRDAL 287
            A+ +  + +L ++ +G  G D  FDC+G       AL
Sbjct: 241 -AEHKDAIAELRKIPEGATGFDAAFDCSGVKATFNTAL 277

>SAKL0D14894g Chr4 complement(1230497..1231654) [1158 bp, 385 aa]
           {ON} similar to uniprot|P39713 Saccharomyces cerevisiae
           YAL061W putative polyol dehydrogenase
          Length = 385

 Score = 80.1 bits (196), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 67/241 (27%), Positives = 103/241 (42%), Gaps = 42/241 (17%)

Query: 65  FPCILGHEGAGIVESVGDGVVTVKPGDHVIALYTAEC--------------GKCKFCTSG 110
            P  +GHE AG+V  +G GV   + GDHV+   T+ C                C  C  G
Sbjct: 67  LPQAMGHEMAGVVSKIGPGVQGFEVGDHVVVEPTSTCLDRYRFPNSKHSGEEPCAACKRG 126

Query: 111 KTNLCSAVRATQGKGVMPDGTTRFHNAKGKDIYHFMGCSTFSEYTVVADVSVVAIDPKAP 170
             N+CS +    G GV   G                    FSE  V+    V+ I    P
Sbjct: 127 LYNICSHL-GLCGVGVQSGG--------------------FSERVVMNQKHVIKIPKHIP 165

Query: 171 LDASCLLGCGVTTGYGAAVKTANVQKGDTVAVFGCGTVGLSVIQGAKLRGASKIIAVDIN 230
           LD + L+     + +  A++ + +  G +  V G G +GL  I   +  GASKI+  +  
Sbjct: 166 LDVAALVQPLAVSWH--AIRISGLTAGKSALVVGGGPIGLGTILALQAYGASKIVVSEPA 223

Query: 231 NNKKKYCSQFGATDFINPKEDLAKDQTIVEKLVEMTDG--GLDFTFDCTGNTKIMRDALE 288
            N+++     GA  F +P E   ++   VE L ++  G  G D++FDC+G     R ++ 
Sbjct: 224 KNRRELAKLMGAEVF-DPTE--WEEHEAVEYLRKVAPGGDGFDYSFDCSGLPVTFRASVH 280

Query: 289 A 289
           A
Sbjct: 281 A 281

>TDEL0F03190 Chr6 (583849..584904) [1056 bp, 351 aa] {ON}  possible
           pseudogene; NNN added to avoid internal stop codon
          Length = 351

 Score = 79.0 bits (193), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 66/247 (26%), Positives = 107/247 (43%), Gaps = 32/247 (12%)

Query: 27  EEITVDAPKAHEVRIKIEYTAVCHTDAYTLSGSDP-EGLFPCILGHEGAGIVESVGDGVV 85
           ++I V  P+ +E+ I ++Y+ VCHTD +   G  P     P + GHEGAGIV + G  V 
Sbjct: 24  KDIPVPEPQPNELLINVKYSGVCHTDLHAWKGDWPLPTKLPLVGGHEGAGIVVAKGSMVX 83

Query: 86  T-VKPGDHV-IALYTAECGKCKFCTSGKTNLCSAVRATQGKGVMPDGTTRFHNAKGKDIY 143
              + GD   I      C  C++C     + C                         D+ 
Sbjct: 84  XGWEIGDLAGIKWLNGSCMSCEYCEKANESNCPQA----------------------DLS 121

Query: 144 HFMGCSTFSEYTVVADVSVVAIDPKAPLDASCLLGCGVTTGYGAAVKTANVQKGDTVAVF 203
            +    +F +Y     V    +     L     + C   T Y  A+K+AN++ G+ VA+ 
Sbjct: 122 GYTHDGSFQQYATADAVQAARVPKGTDLAEVAPILCAGITVY-KALKSANLRAGEWVAIS 180

Query: 204 GC-GTVGLSVIQGAKLRGASKIIAVDINNNKKKYCSQFGATDFINPKEDLAKDQTIVEKL 262
           G  G +G   +Q AK  G  +++ +D  + K K   Q G   FI    D  K + ++ ++
Sbjct: 181 GASGGLGSLAVQYAKAMG-YRVLGIDGGDEKAKLFKQLGGEYFI----DFTKSKDVIAEV 235

Query: 263 VEMTDGG 269
           ++ TDGG
Sbjct: 236 IKATDGG 242

>ZYRO0C12562g Chr3 (993434..994480) [1047 bp, 348 aa] {ON} highly
           similar to uniprot|P00331 Saccharomyces cerevisiae
           YMR303C ADH2 Glucose-repressible alcohol dehydrogenase
           II involved in the production of certain carboxylate
           esters
          Length = 348

 Score = 79.0 bits (193), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 70/259 (27%), Positives = 108/259 (41%), Gaps = 31/259 (11%)

Query: 14  AAVAYDAKKPSSVEEITVDAPKAHEVRIKIEYTAVCHTDAYTLSGSDP-EGLFPCILGHE 72
           A +  +   P   ++I V  PK +E+ I + Y+ VCHTD +   G  P     P + GHE
Sbjct: 9   AVIFSENNGPLEYKDIPVPKPKPNEILIHVRYSGVCHTDLHAWKGDWPLPTKLPLVGGHE 68

Query: 73  GAGIVESVGDGVVTVKPGDHV-IALYTAECGKCKFCTSGKTNLCSAVRATQGKGVMPDGT 131
           GAG V ++G  V   K GD   I      C  C+ C     + C            PD  
Sbjct: 69  GAGEVVALGSDVKNWKIGDLAGIKWLNGSCMSCEACEQSHESNC------------PDA- 115

Query: 132 TRFHNAKGKDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDASCLLGCGVTTGYGAAVKT 191
                    D+  +    +F +Y     V    I     L     + C   T Y  A+K+
Sbjct: 116 ---------DLSGYTHDGSFQQYATADAVQAAHIPAGTNLAEVAPVLCAGITVY-KALKS 165

Query: 192 ANVQKGDTVAVFG-CGTVGLSVIQGAKLRGASKIIAVDINNNKKKYCSQFGATDFINPKE 250
           AN++ G  VA+ G  G +G   +Q A+  G  +++ +D    K++     G   FI    
Sbjct: 166 ANLKAGQWVAISGAAGGLGSLAVQYARAMGL-RVLGIDGGPGKEELFKTLGGECFI---- 220

Query: 251 DLAKDQTIVEKLVEMTDGG 269
           D  K+  I E +++ T+GG
Sbjct: 221 DFTKEHDIAEAVIKATNGG 239

>TBLA0A04290 Chr1 (1063289..1064476) [1188 bp, 395 aa] {ON} Anc_7.3
           YAL060W
          Length = 395

 Score = 79.0 bits (193), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 79/312 (25%), Positives = 124/312 (39%), Gaps = 67/312 (21%)

Query: 13  IAAVAY----DAKKPSSVEEITVDAPKAHEVRIKIEYTAVCHTD---------------- 52
           + A+AY    D      ++E T++A    E+ I I +  +C TD                
Sbjct: 1   MRALAYFGQGDVHFTKDLKEPTIEADD--ELMIDISWCGICGTDLKEYTEGAIFFPNDGE 58

Query: 53  AYTLSGSDPEGLFPCILGHEGAGIVESVGDGVVTVKPGDHVIALYTAEC----------- 101
            + +SG       P  +GHE AG+V  VG GV   K GDHV+   T  C           
Sbjct: 59  CHQISGEP----LPQAMGHEMAGVVSRVGPGVKKFKVGDHVVVEPTGTCKDRYRWKNSPS 114

Query: 102 ---GKCKFCTSGKTNLCSAVRATQGKGVMPDGTTRFHNAKGKDIYHFMGCSTFSEYTVVA 158
                C  C  G  N+CS +    G GV   G                    F+E  V+ 
Sbjct: 115 KNDDMCNACKKGYYNICSKL-GLCGAGVQSGG--------------------FAERVVMN 153

Query: 159 DVSVVAIDPKAPLDASCLLGCGVTTGYGAAVKTANVQKGDTVAVFGCGTVGLSVIQGAKL 218
           +     +    PLD + L+       +  A++  N +KG +  V G G +GL +I     
Sbjct: 154 ESHCHKVPDDLPLDIAALIQPIAVCWH--ALRICNFKKGSSALVVGSGPIGLGIILALHG 211

Query: 219 RGASKIIAVDINNNKKKYCSQFGATDFINPKEDLAKDQTIVEKLVEMTDG--GLDFTFDC 276
            G + I+  +    ++ +  + GAT F +P   L   +  ++ L  +  G  G D+TFDC
Sbjct: 212 HGCTDIVVSEPAKIRRDFAKELGATVF-DPSS-LPTHEESIKYLRSIAPGGDGFDYTFDC 269

Query: 277 TGNTKIMRDALE 288
           +GN      ++E
Sbjct: 270 SGNQYTFNASIE 281

>KAFR0L02000 Chr12 (378013..379098) [1086 bp, 361 aa] {ON} 
          Length = 361

 Score = 78.6 bits (192), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 66/246 (26%), Positives = 102/246 (41%), Gaps = 31/246 (12%)

Query: 27  EEITVDAPKAHEVRIKIEYTAVCHTDAYTLSGSDP-EGLFPCILGHEGAGIVESVGDGVV 85
            +I V   KA+E+ I ++Y+ VCH+D Y      P     P + GHEGAG+V  +G  V 
Sbjct: 35  RDIPVPTKKANEILINVKYSGVCHSDLYVWKNRTPMTSKLPLVGGHEGAGVVVGMGSNVK 94

Query: 86  TVKPGDHV-IALYTAECGKCKFCTSGKTNLCSAVRATQGKGVMPDGTTRFHNAKGKDIYH 144
             K GD   +    + C  C+ C  G    C     ++  G   +G              
Sbjct: 95  NWKIGDKAGVKWLNSTCMTCEHCELGNEPSC---LKSEYNGFTRNG-------------- 137

Query: 145 FMGCSTFSEYTVVADVSVVAIDPKAPLDASCLLGCGVTTGYGAAVKTANVQKGDTVAVFG 204
                +F +Y  V  +    +     L       C   T Y  A+K+AN++ G  +A+ G
Sbjct: 138 -----SFQQYVAVDAIHAPRLPDNCDLAELAPASCAGVTVY-KAIKSANIRAGQWMAITG 191

Query: 205 -CGTVGLSVIQGAKLRGASKIIAVDINNNKKKYCSQFGATDFINPKEDLAKDQTIVEKLV 263
            CG +G   IQ  K  G  +++ +D    K     + G   FI    D  K + +V  +V
Sbjct: 192 ACGGLGSVAIQYCKAMG-YRVVGIDAGEAKANLFKELGGEVFI----DFTKSKDLVADVV 246

Query: 264 EMTDGG 269
             T+GG
Sbjct: 247 SATNGG 252

>Suva_1.7 Chr1 (12310..13458) [1149 bp, 382 aa] {ON} YAL060W (REAL)
          Length = 382

 Score = 78.2 bits (191), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 72/293 (24%), Positives = 118/293 (40%), Gaps = 56/293 (19%)

Query: 28  EITVDAPKAH-----EVRIKIEYTAVCHTDAYTLSG------------SDPEGLFPCILG 70
             T D PK       EV + + +  +C +D +  S             S      P  +G
Sbjct: 13  HFTNDIPKPEIQADDEVILDVSWCGICGSDLHEYSDGPIFMPKDGECHSLSNAGLPQAMG 72

Query: 71  HEGAGIVESVGDGVVTVKPGDHVIALYTAECG--------------KCKFCTSGKTNLCS 116
           HE +GI+  VG  V  VK GDHV+    + C                C  C  G  NLC+
Sbjct: 73  HEMSGIIAKVGPKVTKVKVGDHVVVQAGSSCADLHCWPHSKHYNSKPCDACKKGCENLCT 132

Query: 117 AVRATQGKGVMPDGTTRFHNAKGKDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDASCL 176
                 G GV+  G                    F+E  VV++  ++ +  + PLD + L
Sbjct: 133 HA-GFIGLGVISGG--------------------FAEQVVVSEHHIIPVPKEIPLDVAAL 171

Query: 177 LGCGVTTGYGAAVKTANVQKGDTVAVFGCGTVGLSVIQGAKLRGASKIIAVDINNNKKKY 236
           +     T +  AV+ +  +KG +  V G G +GL  I   K  GA +I+  ++   + + 
Sbjct: 172 VEPLSVTWH--AVRLSGFKKGSSALVLGAGPIGLCTILVLKGMGAGQIVVSEVAERRMEL 229

Query: 237 CSQFGATDFINPKEDLAKDQTIVEKLVEMTDGGLDFTFDCTGNTKIMRDALEA 289
             + G   F +P++   K    +  L +  D G D+++DC+G       +L+A
Sbjct: 230 ARRLGVEIF-DPRKHGEKSVESLRALTKSHD-GFDYSYDCSGIQATFDASLKA 280

>Kwal_26.6739 s26 (46044..47192) [1149 bp, 382 aa] {ON} YAL060W
           (BDH1) - (2R,3R)-2,3-butanediol dehydrogenase [contig
           44] FULL
          Length = 382

 Score = 77.8 bits (190), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 75/288 (26%), Positives = 133/288 (46%), Gaps = 41/288 (14%)

Query: 13  IAAVAY----DAKKPSSVEEITVDAPKAHEVRIKIEYTAVCHTDAYT-LSGS-----DPE 62
           + A+AY    D +  + + E T+ A  + +V+I I +  VC +D +  L G      D E
Sbjct: 1   MRALAYFGQKDIRFTNDLPEPTIQA--SDDVQIAISWCGVCGSDLHEYLDGPIFFPKDGE 58

Query: 63  -------GLFPCILGHEGAGIVESVGDGVVTVKPGDHVIALYTAECG---KCKFCTSGKT 112
                  GL P  +GHE +G+V  +G GV  +K GDHV+   T  C    +         
Sbjct: 59  KHAMSGVGL-PQAMGHEMSGVVAKIGPGVKNIKVGDHVVVETTGTCKDRYRWPDVKHASD 117

Query: 113 NLCSAVRATQGKGVMPDGTTRFHNAKGKDIYHFMGCST--FSEYTVVADVSVVAIDPKAP 170
             C+A +              F+N   +  +  +GC +  F+E  V+++  VV +    P
Sbjct: 118 EECAACKKD------------FYNCCSELGFCGLGCHSGGFAEKVVISEKHVVKVPKDIP 165

Query: 171 LDASCLLGCGVTTGYGAAVKTANVQKGDTVAVFGCGTVGLSVIQGAKLRGASKIIAVDIN 230
           LD + L+     + +  AV+ + ++ G +  + G G +GL+ +   +  GA  I+  + +
Sbjct: 166 LDVAALVEPLAVSWH--AVRISQLKAGQSALILGAGPIGLATVLALQGHGAGTIVVSEPS 223

Query: 231 NNKKKYCSQFGATDFINPKEDLAKDQTIVEKLVEMTDGGLDFTFDCTG 278
            +++K     GA  F NP +   K    + K+   +D G DF++DC+G
Sbjct: 224 ASRRKQAEALGALTF-NPFDHGDKAVDELRKIPPGSD-GFDFSYDCSG 269

>Kpol_1049.18 s1049 complement(35191..36351) [1161 bp, 386 aa] {ON}
           complement(35191..36351) [1161 nt, 387 aa]
          Length = 386

 Score = 77.8 bits (190), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 69/242 (28%), Positives = 107/242 (44%), Gaps = 42/242 (17%)

Query: 65  FPCILGHEGAGIVESVGDGVVTVKPGDHVIALYTAEC--------------GKCKFCTSG 110
            P  +GHE +GI+ SVG G    K GDHV+   TA C                C+ C +G
Sbjct: 67  LPQAMGHEISGIISSVGPGCKKFKIGDHVVVEPTATCIDRYRWPNAPNRDTPMCEACRNG 126

Query: 111 KTNLCSAVRATQGKGVMPDGTTRFHNAKGKDIYHFMGCSTFSEYTVVADVSVVAIDPKAP 170
             N+C  +  T G GV   G                    F+E  V+ +     I    P
Sbjct: 127 MPNICKYLGLT-GAGVEGGG--------------------FAEKMVINEHHCHKIPHHMP 165

Query: 171 LDASCLLGCGVTTGYGAAVKTANVQKGDTVAVFGCGTVGLSVIQGAKLRGASKIIAVDIN 230
           LD + L+       +  AVK ++ ++G +V + G G +GL  I   K  G   I+  +  
Sbjct: 166 LDVASLIQPISVCWH--AVKVSHYKQGGSVLIVGGGPIGLGTILALKGFGCEDIVVSEPA 223

Query: 231 NNKKKYCSQFGATDFINPKEDLAKDQTIVEKLVEMTDG--GLDFTFDCTGNTKIMRDALE 288
             +++   + GA  F +P  +++ D +I + L EM  G  G D+TFDC+G    ++ A+E
Sbjct: 224 LIRRELAEKMGARVF-DPS-NMSLDNSI-KTLTEMAPGSQGFDYTFDCSGIPATLKVAIE 280

Query: 289 AC 290
            C
Sbjct: 281 CC 282

>SAKL0D14872g Chr4 complement(1226093..1227244) [1152 bp, 383 aa]
           {ON} highly similar to gnl|GLV|KLLA0F00506g
           Kluyveromyces lactis KLLA0F00506g and similar to YAL060W
           uniprot|P39714 Saccharomyces cerevisiae YAL060W BDH1
           NAD- dependent (2R 3R)-2 3-butanediol dehydrogenase a
           zinc- containing medium-chain alcohol dehydrogenase
           produces 2 3- butanediol from acetoin during
           fermentation and allows using 2 3-butanediol as a carbon
           source during aerobic growth
          Length = 383

 Score = 76.6 bits (187), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 80/281 (28%), Positives = 122/281 (43%), Gaps = 54/281 (19%)

Query: 37  HEVRIKIEYTAVCHTDAYT-LSGSD--PE--------GL-FPCILGHEGAGIVESVGDGV 84
           +E+ I I +  +C +D +  L G    PE        G+  P  +GHE +GIV  VG GV
Sbjct: 27  NELEIDISWCGICGSDLHEYLDGPIFFPEEGKTHGVSGIGLPQPMGHEMSGIVSKVGPGV 86

Query: 85  V-TVKPGDHVIALYTAEC---GKCKFCTSGKTNLCSAVRATQGKGVMPDGTTRFHNAKGK 140
               K GDHV+   T  C    +     S K   CSA +                    +
Sbjct: 87  KGDYKVGDHVVVEATCTCLDRYRWPKIESSKLPPCSACK--------------------R 126

Query: 141 DIY----HFMGCST------FSEYTVVADVSVVAIDPKAPLDASCLLGCGVTTGYGAAVK 190
            IY    H   C        FSE  V+++  V+ I  + PLD + L+     + +  AVK
Sbjct: 127 GIYNCCTHLGFCGLGAHGGGFSEKVVISEQHVIKIPKEIPLDIAALVEPISVSWH--AVK 184

Query: 191 TANVQKGDTVAVFGCGTVGLSVIQGAKLRGASKIIAVDINNNKKKYCSQFGATDFINPKE 250
            +N++ G +  V G G +GL+ I   +  GA KI+  +    +++  ++ G   F NP E
Sbjct: 185 ISNLKPGQSALVLGAGPIGLATILALQGHGAGKIVVSEPAQIRREQAAKLGVETF-NPFE 243

Query: 251 DLAKDQTIVEKLVEMTDG--GLDFTFDCTGNTKIMRDALEA 289
                +  VE+L ++  G  G DF+FDC+G        L A
Sbjct: 244 ---HGEKAVEELRKIPPGGDGFDFSFDCSGMKATFDTGLHA 281

>NDAI0H02050 Chr8 complement(500914..502071) [1158 bp, 385 aa] {ON} 
          Length = 385

 Score = 76.6 bits (187), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 77/302 (25%), Positives = 129/302 (42%), Gaps = 44/302 (14%)

Query: 13  IAAVAY----DAKKPSSVEEITVDAPKAHEVRIKIEYTAVCHTDAYTLSG---------- 58
           + AVAY    D    S++ E  +++P   EV I++ Y  +C TD +  +           
Sbjct: 1   MRAVAYYKKGDIHFSSTLPEPKINSPD--EVLIEVSYCGICGTDLHEYTDGPIFFPKDGE 58

Query: 59  SDPEGLFPCI--LGHEGAGIVESVGDGVVTVKPGDHVIALYTAECG--------KCKFCT 108
           ++P    P    +GHE +G V+++G  V  V+ GD V+    A CG          K   
Sbjct: 59  TNPLSNIPLPQPMGHEFSGFVKAIGSNVTKVEVGDKVVV--EAGCGCKDVHRWPDSKLYE 116

Query: 109 SGKTNLCSAVRATQGKGVMPDGTTRFHNAKGKDIYHFMGCSTFSEYTVVADVSVVAIDPK 168
             K   CSA       G+  D     ++  G  +        F+E  VV +  +V +  +
Sbjct: 117 KRKDTFCSACE----NGI--DNCCENYDFTGLGVV----GGAFAERVVVGERHIVKLPEE 166

Query: 169 APLDASCLLGCGVTTGYGAAVKTANVQKGDTVAVFGCGTVGLSVIQGAKLRGASKIIAVD 228
            P D   L+   ++  +  AV+ +  +KG +  + G G +GL+ I   K  GASKI+  +
Sbjct: 167 VPTDVGALVE-PISVAW-HAVRVSKFEKGKSALILGAGPIGLAAILALKAHGASKIVVSE 224

Query: 229 INNNKKKYCSQFGATDFINPKEDLAKDQTIVE-KLVEMTDGGLDFTFDCTGNTKIMRDAL 287
           +   ++   S+ G   F   K     D  + E + +     G D+ FDC+G       AL
Sbjct: 225 LAERRRILASKMGVEVFDPSKHG---DNAVTELRNIPRGQHGFDYAFDCSGVKATFNTAL 281

Query: 288 EA 289
           +A
Sbjct: 282 KA 283

>TDEL0A02560 Chr1 complement(462053..463174) [1122 bp, 373 aa] {ON}
           Anc_2.480 YMR083W
          Length = 373

 Score = 76.6 bits (187), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 63/246 (25%), Positives = 104/246 (42%), Gaps = 31/246 (12%)

Query: 27  EEITVDAPKAHEVRIKIEYTAVCHTDAYTLSGSDPEGL-FPCILGHEGAGIVESVGDGVV 85
           ++I V  PK +E+ I I+Y+ VCHTD +   G  P  +  P + GHEGAG+V + G  V 
Sbjct: 47  KDIAVPKPKPNEILINIKYSGVCHTDLHAWKGDWPLPVKLPLVGGHEGAGVVVAKGKDVT 106

Query: 86  TVKPGDHV-IALYTAECGKCKFCTSGKTNLCSAVRATQGKGVMPDGTTRFHNAKGKDIYH 144
             + GD   +    + C  C++C  G  + C+                        D+  
Sbjct: 107 NFEIGDLAGVKWLNSSCMACEYCELGHESNCAKA----------------------DLSG 144

Query: 145 FMGCSTFSEYTVVADVSVVAIDPKAPLDASCLLGCGVTTGYGAAVKTANVQKGDTVAVFG 204
           +    +F +Y     +    I     L     + C   T Y  A+KT+  + G  VA+ G
Sbjct: 145 YTHDGSFQQYATADAIQAAPIPKDTDLAEVAPILCAGVTVY-KALKTSGAKPGQWVAISG 203

Query: 205 -CGTVGLSVIQGAKLRGASKIIAVDINNNKKKYCSQFGATDFINPKEDLAKDQTIVEKLV 263
             G +G   +Q A   G  +++ +D    K++     G   F+    D  K + +V  + 
Sbjct: 204 AAGGLGSLAVQYATAMGL-RVLGIDGGEGKEELFKSLGGEVFV----DFTKTKDMVSAIQ 258

Query: 264 EMTDGG 269
           E T+GG
Sbjct: 259 EATNGG 264

>Kwal_26.7799 s26 complement(515580..516743) [1164 bp, 387 aa] {ON}
           YMR083W (ADH3) - 1:1 [contig 55] FULL
          Length = 387

 Score = 76.6 bits (187), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 68/269 (25%), Positives = 109/269 (40%), Gaps = 31/269 (11%)

Query: 4   ATVGKPIKCIAAVAYDAKKPSSVEEITVDAPKAHEVRIKIEYTAVCHTDAYTLSGSDPEG 63
           A+   P      + Y+       +++ V  PK +E+ I ++Y+ VCHTD +   G  P  
Sbjct: 38  ASTNIPTTQKGVIFYEHGGELQYKDLPVPKPKPNEILINVKYSGVCHTDLHAWKGDWPLD 97

Query: 64  L-FPCILGHEGAGIVESVGDGVVTVKPGDHV-IALYTAECGKCKFCTSGKTNLCSAVRAT 121
           +  P + GHEGAG+V + G+ V   + GD   I      C  C+ C  G    C      
Sbjct: 98  VKLPLVGGHEGAGVVVAKGENVTNFEIGDLAGIKWLNGSCMSCELCEQGHEPNCEHA--- 154

Query: 122 QGKGVMPDGTTRFHNAKGKDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDASCLLGCGV 181
                              D+  +    +F +Y     V    +     L     + C  
Sbjct: 155 -------------------DLSGYTHDGSFQQYATADAVQAAQLPKGINLAEVAPILCAG 195

Query: 182 TTGYGAAVKTANVQKGDTVAVFG-CGTVGLSVIQGAKLRGASKIIAVDINNNKKKYCSQF 240
            T Y  A+KTA++  G  VA+ G  G +G   +Q AK  G  +++ +D  + KK+   + 
Sbjct: 196 VTVY-KALKTADLIPGQWVAISGAAGGLGSLAVQYAKAMGL-RVLGIDGGDEKKELFHKL 253

Query: 241 GATDFINPKEDLAKDQTIVEKLVEMTDGG 269
           G   FI    D    + +V  + E T GG
Sbjct: 254 GGEIFI----DYTTTKDMVGAIQEATQGG 278

>Kwal_55.20564 s55 complement(459253..459903) [651 bp, 216 aa] {ON}
           YOL086C (ADH1) - Alcohol dehydrogenase [contig 146] FULL
          Length = 216

 Score = 73.9 bits (180), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 57/212 (26%), Positives = 94/212 (44%), Gaps = 27/212 (12%)

Query: 27  EEITVDAPKAHEVRIKIEYTAVCHTDAYTLSGSDP-EGLFPCILGHEGAGIVESVGDGVV 85
           ++I V  P + E+ I ++Y+ VCHTD +   G  P     P + GHEGAG+V ++G+ V 
Sbjct: 22  KDIPVPKPSSTEILINVKYSGVCHTDLHAWKGDWPLPTKLPLVGGHEGAGVVVALGENVK 81

Query: 86  TVKPGDHV-IALYTAECGKCKFCTSGKTNLCSAVRATQGKGVMPDGTTRFHNAKGKDIYH 144
             K GD   I      C  C++C  G  + C                         D+  
Sbjct: 82  GWKVGDLAGIKWLNGSCMACEYCELGNESNCPHA----------------------DLSG 119

Query: 145 FMGCSTFSEYTVVADVSVVAIDPKAPLDASCLLGCGVTTGYGAAVKTANVQKGDTVAVFG 204
           +    +F +Y     V    I     L     + C   T Y  A+K+A+++ G  VA+ G
Sbjct: 120 YTHDGSFQQYATADAVQAAKIPQGTDLAQVAPILCAGITVY-KALKSADLKAGQWVAISG 178

Query: 205 -CGTVGLSVIQGAKLRGASKIIAVDINNNKKK 235
            CG +G   +Q A+  G  +++ +D  ++K+K
Sbjct: 179 ACGGLGSLAVQYARAMG-YRVLGIDGGDDKRK 209

>Kwal_55.19574 s55 complement(32260..33330) [1071 bp, 356 aa] {ON}
           YJR159W (SOR1) - sorbitol-induced sorbitol dehydrogenase
           [contig 159] FULL
          Length = 356

 Score = 75.9 bits (185), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 94/365 (25%), Positives = 150/365 (41%), Gaps = 69/365 (18%)

Query: 40  RIKIEYTAVCHTDA-YTLSGSDPEGLF--PCILGHEGAGIVESVGDGVVTVKPGDHVIAL 96
           ++ ++ T +C +D  Y  SG   + +   P +LGHE +G+V  VG  V  +K GD V   
Sbjct: 33  KVAVKATGICGSDVHYYRSGGIGKYILNSPMVLGHESSGVVVEVGPKVEKIKVGDRVAIE 92

Query: 97  YTAECGKCKFCTSGKTNLCSAVRATQGKGVMPDGTTRFHNAKGKDIYHFMGCSTFSEYTV 156
                       +GK NLC  +       +  DGT                      Y  
Sbjct: 93  PGVPDRYSDETKAGKYNLCPHMAFAATPPI--DGTL------------------VKYYLS 132

Query: 157 VADVSVVAIDPKAPLDASCL--LGCGVTTGYGAAVKTANVQKGDTVAVFGCGTVGLSVIQ 214
            AD  V   D  +  + +C+  L  GV +      K A V+ G TV VFG G VGL    
Sbjct: 133 PADFLVKLPDHVSFEEGACIEPLSVGVHSN-----KLAKVRFGQTVVVFGAGPVGLLTGA 187

Query: 215 GAKLRGASKIIAVDINNNKKKYCSQFGATDFIN----PKEDLAKDQTIVEKLVEMTDGGL 270
            AK  GAS ++ VD+ + K +    FGAT  IN    PK D    Q + +++ ++  G L
Sbjct: 188 VAKAFGASDVVFVDVFDQKLERAKNFGATHVINSTKLPKND---PQALADEVEKLLGGAL 244

Query: 271 -DFTFDCTGNTKIMRDALEACHKGWGQSXXXXXXXXXXXXSTRPFQLVTGRVWKGSAFGG 329
            D  F+C+G    +   ++A   G                     Q+  G+ +       
Sbjct: 245 ADVVFECSGAESCIDAGVKATKNGGTM-----------------VQIGMGKNYVNFPIAE 287

Query: 330 IKGRS-EMGGLIK----DYQ-------SGVLKVEEFITHRRPFKEINHA--FEDLHNGDC 375
           + G+   + G  +    DY+       +G + V++ ITHR  F++   A  F   H G+ 
Sbjct: 288 VSGKEMTLVGCFRYSYGDYKDAVNLVSTGRVDVKKLITHRFSFEDAAKAYDFNIAHGGEV 347

Query: 376 LRTVL 380
           ++T++
Sbjct: 348 VKTII 352

>NCAS0J00300 Chr10 (43719..44792) [1074 bp, 357 aa] {ON} Anc_8.16
          Length = 357

 Score = 75.9 bits (185), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 73/263 (27%), Positives = 113/263 (42%), Gaps = 30/263 (11%)

Query: 37  HEVRIKIEYTAVCHTDAYTL---SGSDPEGLFPCILGHEGAGIVESVGDGVVTVKPGDHV 93
           H V+++I+ T +C +D +     S  D     P +LGHE +GI+  VG  V T+K GD V
Sbjct: 31  HWVKVQIKATGICGSDVHFYKYGSIGDFVVKSPMVLGHESSGIIAEVGSAVKTLKVGDRV 90

Query: 94  IALYTAECGKCKFCTSGKTNLCSAVRATQGKGVMPDGT-TRFHNAKGKDIYHFMGCSTFS 152
                      +   SG  NLC  +          DGT T+++      +Y      ++ 
Sbjct: 91  ALEPGYPSRYTEATMSGHYNLCPFMHFAATPPC--DGTLTKYYLTPFDFVYKLPDNVSYE 148

Query: 153 EYTVVADVSVVAIDPKAPLDASCLLGCGVTTGYGAAVKTANVQKGDTVAVFGCGTVGLSV 212
           E  ++  +SV                 GV      A K A  + GD V VFG G VGL  
Sbjct: 149 EGALLEPLSV-----------------GVH-----ANKQAGTRFGDKVVVFGAGPVGLLN 186

Query: 213 IQGAKLRGASKIIAVDINNNKKKYCSQFGATDFINPKEDLAKDQTIVEKLVEMTDGGL-- 270
              AK+ GA +++ +D+ + K +    FGAT  IN  +    D+  +   ++   GG+  
Sbjct: 187 GAVAKVFGALQVVFIDVVDEKLERAKHFGATAVINSSKLRINDEFELAVAIKEKLGGVDP 246

Query: 271 DFTFDCTGNTKIMRDALEACHKG 293
           D   +CTG    +R  + A   G
Sbjct: 247 DIVLECTGAEPCIRAGIRALKTG 269

>Kpol_1036.19 s1036 (51276..52337) [1062 bp, 353 aa] {ON}
           (51276..52337) [1062 nt, 354 aa]
          Length = 353

 Score = 74.3 bits (181), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 73/277 (26%), Positives = 115/277 (41%), Gaps = 35/277 (12%)

Query: 16  VAYDAKKPSSVEEITVDAPKAHEVRIKIEYTAVCHTDAYTLSGSDP-EGLFPCILGHEGA 74
           + Y+       +++ V  PK  E+ I + Y+ VCHTD +   G  P +   P + GHEGA
Sbjct: 16  IFYENNGELQYKDLPVPQPKPTELLIHVLYSGVCHTDLHAWKGDWPLDTKLPLVGGHEGA 75

Query: 75  GIVESVGDGVVTVKPGDHV-IALYTAECGKCKFCTSGKTNLCSAVRATQGKGVMPDGTTR 133
           G+V  +G  V   K GD   I      C  C+ C     + C            P+    
Sbjct: 76  GVVVGMGSSVKGWKMGDLAGIKWLNGSCMNCEECELSNESNC------------PEA--- 120

Query: 134 FHNAKGKDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDASCLLGCGVTTGYGAAVKTAN 193
                  D+  +    +F +Y     V    I   A +     + C   T Y  A+K+A 
Sbjct: 121 -------DLSGYTHDGSFQQYATADAVQAAHIPQGADMAEVAPILCAGVTVY-KALKSAE 172

Query: 194 VQKGDTVAVFG-CGTVGLSVIQGAKLRGASKIIAVDINNNKKKYCSQFGATDFINPKEDL 252
           ++ GD VA+ G  G +G   +Q AK  G  +++ +D  + K+K+    G   F+    D 
Sbjct: 173 LKAGDWVAISGAAGGLGSLAVQYAKAMG-YRVLGIDGGDEKEKFFKSMGGEVFV----DF 227

Query: 253 AKDQTIVEKLVEMTDGGLDFTFDCTGNTKIMRDALEA 289
              + IV  + E T+GG      C  N  +   A+EA
Sbjct: 228 MTCKDIVGAVKEATNGG---AHGCI-NVSVSEKAIEA 260

>Suva_12.260 Chr12 (427406..428479) [1074 bp, 357 aa] {ON} YJR159W
           (REAL)
          Length = 357

 Score = 74.3 bits (181), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 94/364 (25%), Positives = 149/364 (40%), Gaps = 61/364 (16%)

Query: 37  HEVRIKIEYTAVCHTDA-YTLSGSDPEGLF--PCILGHEGAGIVESVGDGVVTVKPGDHV 93
           H V+I I+ T +C +D  Y  SG   + +   P +LGHE +G V  VG  V  VK GD V
Sbjct: 31  HYVKIAIKATGICGSDIHYYRSGGIGKYILKAPMVLGHESSGQVVEVGSAVTRVKVGDRV 90

Query: 94  IALYTAECGKCKFCTSGKTNLCSAVRATQGKGVMPDGT-TRFHNAKGKDIYHFMGCSTFS 152
                           G+ NLC  +       +  DGT  +++ +    +       ++ 
Sbjct: 91  AIEPGVPSRYSDETKEGRYNLCPHMAFAATPPI--DGTLVKYYLSPEDFLVKLPEGVSYE 148

Query: 153 EYTVVADVSVVAIDPKAPLDASCLLGCGVTTGYGAAVKTANVQKGDTVAVFGCGTVGLSV 212
           E   V  +SV                 GV +      K A V+ G  V VFG G VGL  
Sbjct: 149 EGACVEPLSV-----------------GVHSN-----KLAGVRFGSRVVVFGAGPVGLLT 186

Query: 213 IQGAKLRGASKIIAVDINNNKKKYCSQFGATDFINPKEDLA-KDQTIVEKLVEMTDG-GL 270
              A+  GAS ++ +D+ +NK     +FGAT   N  +  A K Q + +++ ++  G   
Sbjct: 187 GAVARAFGASDVVFIDVFDNKLDRAKEFGATHTFNSSKFPADKTQELADEVEKLLSGHHA 246

Query: 271 DFTFDCTG-------NTKIMRDALEACHKGWGQSXXXXXXXXXXXXSTRPFQLVTGRVWK 323
           D  F+C+G         KI +        G G++            +  P   V+G+  K
Sbjct: 247 DIVFECSGADACIDAGVKITKVGGTMVQIGMGKN-----------YTNFPIAEVSGKEMK 295

Query: 324 -----GSAFGGIKGRSEMGGLIKDYQSGVLKVEEFITHRRPFKEINHA--FEDLHNGDCL 376
                  +FG  +        +K   SG + V+  ITHR  F++   A  F   H G+ +
Sbjct: 296 LIGCFRYSFGDYR------DAVKLVASGKVNVKAMITHRFKFEDAAKAYDFNIAHGGEVV 349

Query: 377 RTVL 380
           +T++
Sbjct: 350 KTII 353

>Skud_20.2 Chr20 (1588..2661) [1074 bp, 357 aa] {ON} YJR159W (REAL)
          Length = 357

 Score = 73.6 bits (179), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 96/365 (26%), Positives = 151/365 (41%), Gaps = 51/365 (13%)

Query: 30  TVDAPKAHEVRIKIEYTAVCHTDA-YTLSGSDPEGLF--PCILGHEGAGIVESVGDGVVT 86
           T+D P  H V++ I+ T +C +D  Y  SG   + +   P +LGHE +G V  VGD V  
Sbjct: 26  TIDDP--HYVKLAIKATGICGSDVHYYRSGGIGKYILKAPMVLGHESSGQVVEVGDAVTR 83

Query: 87  VKPGDHVIALYTAECGKCKFCT-SGKTNLCSAVRATQGKGVMPDGT-TRFHNAKGKDIYH 144
           VK GD V A+     G+    T  G+ NLC  +       +  DGT  R++ +    +  
Sbjct: 84  VKIGDRV-AIEPGVPGRYSDETKEGRYNLCPHMAFAATPPI--DGTLVRYYLSPEDFLVK 140

Query: 145 FMGCSTFSEYTVVADVSVVAIDPKAPLDASCLLGCGVTTGYGAAVKTANVQKGDTVAVFG 204
                ++ E   V  +SV                 GV +      K A V+ G  V VFG
Sbjct: 141 LPDGVSYEEGACVEPLSV-----------------GVHSN-----KLAGVRFGTRVVVFG 178

Query: 205 CGTVGLSVIQGAKLRGASKIIAVDINNNKKKYCSQFGATDFINPKEDLAKDQTIVEKLVE 264
            G VGL     A   GAS +I VD+ +N+ +    FGA+   N  +    +   +   VE
Sbjct: 179 AGPVGLLTGAVAHAFGASDVIFVDVFDNRLQRAKDFGASGTFNSSKFSVDEAQQLADEVE 238

Query: 265 MTDGG--LDFTFDCTGNTKIMRDALEACHKGWGQSXXXXXXXXXXXXSTRPFQLVTGRVW 322
              GG   D  F+C+G    +   ++    G                +  P   V+G+  
Sbjct: 239 KLLGGHHADVVFECSGADVCIDAGVKTTKVGG----TMVQVGMGKNYTNFPIAEVSGKEM 294

Query: 323 K-----GSAFGGIKGRSEMGGLIKDYQSGVLKVEEFITHRRPFKEINHAFED--LHNGDC 375
           +       +FG  +    +        SG + V+  ITHR  F++   A++    H GD 
Sbjct: 295 RLIGCFRYSFGDYRDAVNL------VASGKVNVKPLITHRFKFEDAAKAYDYNIAHGGDV 348

Query: 376 LRTVL 380
           ++T++
Sbjct: 349 VKTII 353

>Skud_4.2 Chr4 complement(6287..7360) [1074 bp, 357 aa] {ON} YJR159W
           (REAL)
          Length = 357

 Score = 73.6 bits (179), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 96/365 (26%), Positives = 151/365 (41%), Gaps = 51/365 (13%)

Query: 30  TVDAPKAHEVRIKIEYTAVCHTDA-YTLSGSDPEGLF--PCILGHEGAGIVESVGDGVVT 86
           T+D P  H V++ I+ T +C +D  Y  SG   + +   P +LGHE +G V  VGD V  
Sbjct: 26  TIDDP--HYVKLAIKATGICGSDVHYYRSGGIGKYILKAPMVLGHESSGQVVEVGDAVTR 83

Query: 87  VKPGDHVIALYTAECGKCKFCT-SGKTNLCSAVRATQGKGVMPDGT-TRFHNAKGKDIYH 144
           VK GD V A+     G+    T  G+ NLC  +       +  DGT  R++ +    +  
Sbjct: 84  VKIGDRV-AIEPGVPGRYSDETKEGRYNLCPHMAFAATPPI--DGTLVRYYLSPEDFLVK 140

Query: 145 FMGCSTFSEYTVVADVSVVAIDPKAPLDASCLLGCGVTTGYGAAVKTANVQKGDTVAVFG 204
                ++ E   V  +SV                 GV +      K A V+ G  V VFG
Sbjct: 141 LPDGVSYEEGACVEPLSV-----------------GVHSN-----KLAGVRFGTRVVVFG 178

Query: 205 CGTVGLSVIQGAKLRGASKIIAVDINNNKKKYCSQFGATDFINPKEDLAKDQTIVEKLVE 264
            G VGL     A   GAS +I VD+ +N+ +    FGA+   N  +    +   +   VE
Sbjct: 179 AGPVGLLTGAVAHAFGASDVIFVDVFDNRLQRAKDFGASGTFNSSKFSVDEAQQLADEVE 238

Query: 265 MTDGG--LDFTFDCTGNTKIMRDALEACHKGWGQSXXXXXXXXXXXXSTRPFQLVTGRVW 322
              GG   D  F+C+G    +   ++    G                +  P   V+G+  
Sbjct: 239 KLLGGHHADVVFECSGADVCIDAGVKTTKVGG----TMVQVGMGKNYTNFPIAEVSGKEM 294

Query: 323 K-----GSAFGGIKGRSEMGGLIKDYQSGVLKVEEFITHRRPFKEINHAFED--LHNGDC 375
           +       +FG  +    +        SG + V+  ITHR  F++   A++    H GD 
Sbjct: 295 RLIGCFRYSFGDYRDAVNL------VASGKVNVKPLITHRFKFEDAAKAYDYNIAHGGDV 348

Query: 376 LRTVL 380
           ++T++
Sbjct: 349 VKTII 353

>ABR229C Chr2 complement(831895..832956) [1062 bp, 353 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR070C
           (XYL2)
          Length = 353

 Score = 73.6 bits (179), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 88/360 (24%), Positives = 131/360 (36%), Gaps = 45/360 (12%)

Query: 15  AVAYDAKKPSSVEEITVDAPKAHEVRIKIEYTAVCHTDA-YTLSGSDPEGLF----PCIL 69
           A+ Y+ +    +E+        H V++KIE T +C +D  Y L GS   G F    P +L
Sbjct: 16  AIVYEHRPVPVIED-------PHYVKVKIEKTGICGSDVHYYLHGSI--GPFVVRSPMVL 66

Query: 70  GHEGAGIVESVGDGVVTVKPGDHVIALYTAECGKCKFCTSGKTNLCSAVRATQGKGVMPD 129
           GHE +G V  VG  V  V+ GD V           +   SG  NLC  +R         D
Sbjct: 67  GHESSGTVVEVGSDVTRVRIGDRVAIEPGVPSRYSEETKSGHYNLCREMRFAATPPY--D 124

Query: 130 GTTRFHNAKGKDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDASCLLGCGVTTGYGAAV 189
           GT   +    +D    +  S   E   + +   VA+                      A 
Sbjct: 125 GTLVKYYISPEDFLVKLPDSVSLEEGALCEPLAVAVH---------------------AN 163

Query: 190 KTANVQKGDTVAVFGCGTVGLSVIQGAKLRGASKIIAVDINNNKKKYCSQFGATDFINPK 249
           + A  Q    V VFG G VGL     AK  GA+ +  VDI+ +K       G T  ++  
Sbjct: 164 RLAGTQFPSRVVVFGAGPVGLLTASVAKAFGATTVAIVDISKHKLCVAPALGVTHPVD-S 222

Query: 250 EDLAKDQTIVEKLVEMTDGGLDFTFDCTGNTKIMRDALEACHKGWGQSXXXXXXXXXXXX 309
            D +  + +  KL       +D  FDC+G    +  A+  C  G                
Sbjct: 223 SDCSSPEALANKLRAELRSDVDIAFDCSGAEICIAAAVLICRPGGTHVQVGSSRDYVS-- 280

Query: 310 STRPFQLVTGRVWKGSAFGGIK-GRSEMGGLIKDYQSGVLKVEEFITHRRPFKEINHAFE 368
               F L    V +    G  +    +    ++   S  +     +THR PF     A++
Sbjct: 281 ----FPLAEATVKQLRILGSFRYAAGDYATAVELLASKRVDAARLVTHRFPFDRAVEAYK 336

>ZYRO0F02552g Chr6 (203037..204092) [1056 bp, 351 aa] {ON} similar
           to uniprot|Q07786 Saccharomyces cerevisiae YDL246C SOR2
           Protein of unknown function computational analysis of
           large-scale protein-protein interaction data suggests a
           possible role in fructose or mannose metabolism
          Length = 351

 Score = 73.2 bits (178), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 78/281 (27%), Positives = 120/281 (42%), Gaps = 35/281 (12%)

Query: 21  KKPSSVEEITVDAPK---AHEVRIKIEYTAVCHTDA-YTLSGSDPEGLF--PCILGHEGA 74
           +KP  +     D P+    H V++ I+ T +C +D  Y   G+  + +   P +LGHE +
Sbjct: 10  QKPGVITVDKRDVPEIKDPHYVKLHIKATGICGSDVHYYTQGAIGQFVVKSPMVLGHESS 69

Query: 75  GIVESVGDGVVTVKPGDHVIALYTAECGKCKFCTSGKTNLCSAVRATQGKGVMPDGT-TR 133
           GIV  VG  V  VK GD V               SG  NLC  +          DGT T+
Sbjct: 70  GIVAEVGSAVTNVKVGDRVAIEPGIPSRYSDETMSGNYNLCPHMVFAATPPY--DGTLTK 127

Query: 134 FHNAKGKDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDASCLLGCGVTTGYGAAVKTAN 193
           ++ A    +Y      +F E  +   +SV                 GV      A K A 
Sbjct: 128 YYLAPEDFVYKMPDHLSFEEGALAEPMSV-----------------GVH-----ANKLAG 165

Query: 194 VQKGDTVAVFGCGTVGLSVIQGAKLRGASKIIAVDINNNKKKYCSQFGATDFINPKEDLA 253
            + G  V V G G VGL     A+  GA++++ VDI   K +   QFGAT  ++   D  
Sbjct: 166 TRFGSKVLVSGAGPVGLLAGAVARAFGATEVVFVDIAEEKLERSKQFGATHTVSSSSD-- 223

Query: 254 KDQTIVEKLVEMTDGGL-DFTFDCTGNTKIMRDALEACHKG 293
            ++  V ++ ++  G L +   +C+G    +R  ++AC  G
Sbjct: 224 -EERFVSEVSKVLGGDLPNIVLECSGAQPAIRCGVKACKAG 263

>KNAG0K01040 Chr11 complement(204636..205811) [1176 bp, 391 aa] {ON}
           
          Length = 391

 Score = 73.6 bits (179), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 58/238 (24%), Positives = 95/238 (39%), Gaps = 38/238 (15%)

Query: 65  FPCILGHEGAGIVESVGDGVVTVKPGDHVIALYTAECG--------------KCKFCTSG 110
            P  +GHE AGIV  VG GV   K GDHV    T  C               KC  C  G
Sbjct: 67  LPQAMGHEMAGIVREVGSGVTQFKVGDHVSVEPTGTCRDRYRWPEAPGVNKEKCAACKRG 126

Query: 111 KTNLCSAVRATQGKGVMPDGTTRFHNAKGKDIYHFMGCSTFSEYTVVADVSVVAIDPKAP 170
             N+CS +    G GV   G                    F+E  V+ +     +    P
Sbjct: 127 MYNVCSHL-GLIGNGVQSGG--------------------FAERVVINESHCYKLPNHIP 165

Query: 171 LDASCLLGCGVTTGYGAAVKTANVQKGDTVAVFGCGTVGLSVIQGAKLRGASKIIAVDIN 230
           ++   L+     + +  AV+ +  + G +V + G G +GLS I      G ++I+  +  
Sbjct: 166 MEVVALVQPIAVSWH--AVRVSKFKPGSSVLILGGGPIGLSTILALNGHGCTEIVVSEPA 223

Query: 231 NNKKKYCSQFGATDFINPKEDLAKDQTIVEKLVEMTDGGLDFTFDCTGNTKIMRDALE 288
             ++    + GA  + +P +   ++     + +     G D+ FDC+G    +R ++E
Sbjct: 224 KIRRDLAEKMGAVVY-DPMQHSYEENIKYLRALAPDKDGFDYCFDCSGTPATLRSSIE 280

>Kwal_26.6684 s26 (21910..22980) [1071 bp, 356 aa] {ON} YJR159W
           (SOR1) - sorbitol-induced sorbitol dehydrogenase [contig
           381] FULL
          Length = 356

 Score = 73.2 bits (178), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 79/254 (31%), Positives = 106/254 (41%), Gaps = 32/254 (12%)

Query: 32  DAPKAHEVRIKIEYTAVCHTDA-YTLSGSDPEGLF--PCILGHEGAGIVESVGDGVVTVK 88
           + P  H V++ I+ T +C +D  Y  SGS  + +   P +LGHE +G V  VG  V ++K
Sbjct: 25  ELPNEHYVKVAIKATGICGSDIHYYKSGSIGKYVVNQPMVLGHESSGEVVEVGSAVRSIK 84

Query: 89  PGDHVIALYTAECGKCKFCTSGKTNLCSAVRATQGKGVMPDGTTRFHNAKGKDIYHFMGC 148
            GD V                G+ NLC  +       +  DGT                 
Sbjct: 85  VGDRVAIEPGVPDRYSDETKQGRYNLCPDMAFAATPPI--DGTL---------------- 126

Query: 149 STFSEYTVVADVSVVAIDPKAPLDASCL--LGCGVTTGYGAAVKTANVQKGDTVAVFGCG 206
                Y   AD  V   D  +  + +C+  L  GV      A K A V  G  V VFG G
Sbjct: 127 --VKYYVSPADFLVKLPDHVSFEEGACIEPLSVGVH-----ANKLAKVHFGSVVVVFGAG 179

Query: 207 TVGLSVIQGAKLRGASKIIAVDINNNKKKYCSQFGATDFINPKEDLAKDQTIVEKLVEMT 266
            VGL     AK  GAS++I VD+ +NK +    FGAT  IN K     +   V   V   
Sbjct: 180 PVGLLTGAVAKAFGASEVIYVDVFDNKLERAKGFGATHTINSKSLPRGEGDAVSAAVSNY 239

Query: 267 DGG--LDFTFDCTG 278
            GG   D  F+C+G
Sbjct: 240 LGGALADVVFECSG 253

>ABL033C Chr2 complement(337866..338987) [1122 bp, 373 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YMR083W
           (ADH3)
          Length = 373

 Score = 72.8 bits (177), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 73/284 (25%), Positives = 114/284 (40%), Gaps = 33/284 (11%)

Query: 9   PIKCIAAVAYDAKKPSSVEEITVDAPKAHEVRIKIEYTAVCHTDAYTLSGS---DPEGLF 65
           P    A V Y+        +I V  PK +E+ + I+Y+ VCHTD +   G     P+   
Sbjct: 29  PTTQKAVVFYEHGGELKYTDIPVPKPKPNEILVNIKYSGVCHTDLHAWKGDWAIKPK--L 86

Query: 66  PCILGHEGAGIVESVGDGVVTVKPGDHV-IALYTAECGKCKFCTSGKTNLCSAVRATQGK 124
           P + GHEGAG+V + G  V   + GD+  +      C +C+FC  G    C     +   
Sbjct: 87  PLVGGHEGAGVVVAKGANVTNFEIGDYAGVKWLGKTCMECEFCQKGFEPNCETPTLS--- 143

Query: 125 GVMPDGTTRFHNAKGKDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDASCLLGCGVTTG 184
           G   DG                   TF +Y     +    I P   L     + C   T 
Sbjct: 144 GYTHDG-------------------TFQQYATADAIHAAHIPPGTDLAKVAPILCAGITV 184

Query: 185 YGAAVKTANVQKGDTVAVFGCGTVGLSVIQGAKLRGASKIIAVDINNNKKKYCSQFGATD 244
           Y  A+KTA +  G  VA+ G G    S+     +    +++ +D  N K+      G   
Sbjct: 185 Y-KALKTAALIPGQWVAISGAGGGLGSLAVQYAVAMGYRVVGIDGGNEKEALFRSLGGET 243

Query: 245 FINPKEDLAKDQTIVEKLVEMTDGGLDFTFDCTGNTKIMRDALE 288
           F+    D  K++ IV  + E T GG     + + +T  +  ++E
Sbjct: 244 FV----DFHKNKDIVSAVREATGGGPHGVVNVSVSTNAILQSVE 283

>ZYRO0G03410g Chr7 complement(269170..270291) [1122 bp, 373 aa] {ON}
           similar to uniprot|P07246 Saccharomyces cerevisiae
           YMR083W ADH3
          Length = 373

 Score = 72.8 bits (177), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 88/353 (24%), Positives = 140/353 (39%), Gaps = 40/353 (11%)

Query: 27  EEITVDAPKAHEVRIKIEYTAVCHTDAYTLSGSDP-EGLFPCILGHEGAGIVESVGDGVV 85
           E++ V  P ++EV I ++Y+ VCHTD +T  G  P +   P + GHEGAG+V + G  V 
Sbjct: 45  EDLPVPTPASNEVLINVKYSGVCHTDLHTWKGEIPFKTKLPLVGGHEGAGVVVAKGKDVK 104

Query: 86  TVKPGDHV-IALYTAECGKCKFCTSGKTNLCSAVRATQGKGVMPDGTTRFHNAKGKDIYH 144
           T + GD   +    + C  C+ C  G    C     +   G   DG              
Sbjct: 105 TFEIGDLAGVKQLVSSCMGCESCEIGHEFGCEQAEMS---GSSHDG-------------- 147

Query: 145 FMGCSTFSEYTVVADVSVVAIDPKAPLDASCLLGCGVTTGYGAAVKTANVQKGDTVAVFG 204
                TF +Y  +  +    +     L A   + C   + Y  A+K  N+Q    VA+FG
Sbjct: 148 -----TFQQYVAIDALQAPPLPANVDLAAVAPIFCAGVSVY-KALKNGNLQTNQWVAIFG 201

Query: 205 C-GTVGLSVIQGAKLRGASKIIAVD-INNNKKKYCSQFGATDFINPKEDLAKDQTIVEKL 262
             G +G   +Q AK  G  +++ +D     +K+     G   F+    D  +   I   +
Sbjct: 202 ATGGLGSIAVQYAKAMG-YRVLGIDGPGEERKQLFHSLGGEVFL----DYTQVDNIPAAV 256

Query: 263 VEMTDGGLDFTFDCTGNTKIMRDALEACHKGWGQSXXXXXXXXXXXXSTRPFQLVT-GRV 321
            + T GG     + T +       ++ C +  G               T  F +V  G  
Sbjct: 257 KQATQGGAHCVLNVTASLAAYDQTIK-CVRPLGTVVPVGVPPDSGLLKTDIFTIVQHGFS 315

Query: 322 WKGSAFGGIKGRSEMGGLIKDYQSGVLKVEEFITHRRPFKEINHAFEDLHNGD 374
            KGSA G    R++    +  +  G++K    I       E+  AFE L +G 
Sbjct: 316 IKGSASG---SRADTREAVDFFTRGLIKSPIKILG---LSELPKAFELLESGQ 362

>NCAS0A07670 Chr1 complement(1527273..1528592) [1320 bp, 439 aa]
           {ON} 
          Length = 439

 Score = 71.6 bits (174), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 72/307 (23%), Positives = 120/307 (39%), Gaps = 58/307 (18%)

Query: 13  IAAVAY----DAKKPSSVEEITVDAPKAHEVRIKIEYTAVCHTDAYTLSGS--------- 59
           + A+AY    D K  + + E T+ AP   E+ I + +  +C TD +              
Sbjct: 40  MRALAYFGKNDIKFTNDLPEPTISAPD--EMIIDVSWCGICGTDLHEFQDGPIFFPHDGC 97

Query: 60  ----DPEGLFPCILGHEGAGIVESVGDGVVTVKPGDHVIALYTAECG------------- 102
                 EGL P  +GHE AG +   G GV   K GD V+   T  C              
Sbjct: 98  CHEISGEGL-PQAMGHEIAGTIIECGPGVTKFKVGDRVVVEPTGTCKDRYRWPNSPNVDK 156

Query: 103 -KCKFCTSGKTNLCSAVRATQGKGVMPDGTTRFHNAKGKDIYHFMGCSTFSEYTVVADVS 161
             C  C  G  N+CS +    G GV   G                    F+E  V+ +  
Sbjct: 157 EPCAACKKGLYNICSNL-GLVGAGVQSGG--------------------FAERLVMNERQ 195

Query: 162 VVAIDPKAPLDASCLLGCGVTTGYGAAVKTANVQKGDTVAVFGCGTVGLSVIQGAKLRGA 221
              +     +D + L+     + +  AV+ +  +KG +V + G G +GL  I      G 
Sbjct: 196 CYKVPDHMSMDVAALIQPIAVSWH--AVRVSKFKKGASVLIVGAGPIGLGTILALNGHGV 253

Query: 222 SKIIAVDINNNKKKYCSQFGATDFINPKEDLAKDQTIVEKLVEMTDGGLDFTFDCTGNTK 281
           S+++  +    ++ +  + GA  +    +D  +    +  +    D G D+ FDC+GN  
Sbjct: 254 SEVVVSEPAKIRRDFAEKMGAIVYDPSAKDHDESIKYLRSIAPGGD-GFDYAFDCSGNPA 312

Query: 282 IMRDALE 288
            ++ A+E
Sbjct: 313 TLKAAIE 319

>Suva_1.6 Chr1 (10591..11844) [1254 bp, 417 aa] {ON} YAL061W (REAL)
          Length = 417

 Score = 71.2 bits (173), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 75/296 (25%), Positives = 112/296 (37%), Gaps = 56/296 (18%)

Query: 13  IAAVAY----DAKKPSSVEEITVDAPKAHEVRIKIEYTAVCHTDAYTLSGSD---PE--- 62
           + A+AY    D +  + +EE  + AP   E+ + I +  +C TD +  +      PE   
Sbjct: 1   MRALAYFGKGDIRFTNHLEEPRIVAPD--ELVLDIAWCGICGTDLHEYTDGPIFFPEDGH 58

Query: 63  ------GLFPCILGHEGAGIVESVGDGVVTVKPGDHVIALYTAECGK------------- 103
                    P  +GHE AG V  VG GV   K GD V+   T  C               
Sbjct: 59  TNEISHNPLPQAMGHEMAGTVAKVGPGVTQFKVGDKVVVEPTGTCRDRYRWPTSPNVDKE 118

Query: 104 -CKFCTSGKTNLCSAVRATQGKGVMPDGTTRFHNAKGKDIYHFMGCSTFSEYTVVADVSV 162
            C  C  G  N+CS +    G GV   G                    F+E  V+ +   
Sbjct: 119 WCAACKRGLYNICSYL-GLCGAGVQSGG--------------------FAERVVINESHC 157

Query: 163 VAIDPKAPLDASCLLGCGVTTGYGAAVKTANVQKGDTVAVFGCGTVGLSVIQGAKLRGAS 222
             +    PLD + L+       +  A+   + + G T  + G G +GL  I      G S
Sbjct: 158 YKVPEFVPLDVAALIQPLAVCWH--AISVCDFKAGSTALIIGAGPIGLGTILALNAAGCS 215

Query: 223 KIIAVDINNNKKKYCSQFGATDFINPKEDLAKDQTIVEKLVEMTDGGLDFTFDCTG 278
            I   +    +++   + GA  F +P    AKD     + V     G D+TFDC+G
Sbjct: 216 DIAVSEPAKVRRELAEKMGARVF-DPTAHAAKDSIDYLRSVAPGGDGYDYTFDCSG 270

>KNAG0E02590 Chr5 complement(513565..514689) [1125 bp, 374 aa] {ON}
           Anc_2.480 YMR083W
          Length = 374

 Score = 70.9 bits (172), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 69/272 (25%), Positives = 110/272 (40%), Gaps = 34/272 (12%)

Query: 4   ATVGKPIKCIAAVAYDAKKPSSVEEITVDAPKAHEVRIKIEYTAVCHTDAYTLSGSDPEG 63
           +TV  P      + Y+       ++I V  PK +E+ + ++Y+ VCHTD +   G  P  
Sbjct: 22  STVSIPQTQKGVIFYEHGGDLHYKDIPVPKPKPNEILVNVKYSGVCHTDLHAWKGDWPLS 81

Query: 64  L-FPCILGHEGAGIVESVGDGVVTVKPGDHV-IALYTAECGKCKFCTSGKTNLCSAVRAT 121
           +  P + GHEGAG+V + G  V   + GD   I      C  C+ C SG  + C      
Sbjct: 82  VKLPLVGGHEGAGVVVAKGSNVNNFEIGDLAGIKWLNGSCMSCELCESGHESNC------ 135

Query: 122 QGKGVMPDGTTRFHNAKGKDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDASCLLGCGV 181
                           +  D+  +    +F +Y     V    I     L     + C  
Sbjct: 136 ----------------EHADLSGYTHDGSFQQYATADAVQAAKIPEGTNLAEVAPVLCAG 179

Query: 182 TTGYGAAVKTANVQKGDTVAVFG-CGTVGLSVIQGAKLRGASKIIAVDINNNKKKYCSQF 240
            T Y  A+K A++  G  V + G  G +G   +Q  K  G  ++I +D    K++     
Sbjct: 180 ITVY-KALKEASLSPGQWVCISGAAGGLGSLAVQYGKAMGL-RVIGIDGGPGKEELFKSL 237

Query: 241 GATDFINPKEDLAKDQT---IVEKLVEMTDGG 269
           G   FI    D  K +T   +V  + + T+GG
Sbjct: 238 GGEVFI----DFTKQKTDSDMVAAIQKATNGG 265

>Smik_48.1 Chr48 complement(1..1074) [1074 bp, 357 aa] {ON} YJR159W
           (REAL)
          Length = 357

 Score = 70.5 bits (171), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 95/375 (25%), Positives = 154/375 (41%), Gaps = 71/375 (18%)

Query: 30  TVDAPKAHEVRIKIEYTAVCHTDA-YTLSGSDPEGLF--PCILGHEGAGIVESVGDGVVT 86
           T++ P  H V++ I+ T +C +D  Y  SG   + +   P +LGHE +G V  VG+ V  
Sbjct: 26  TIEDP--HYVKLAIKATGICGSDVHYYRSGGIGKYILKAPMVLGHESSGEVVEVGNAVTR 83

Query: 87  VKPGDHVIALYTAECGKCKFCTSGKTNLCSAVRATQGKGVMPDGT-TRFHNAKGKDIYHF 145
           VK GD V                G+ NLC  +       +  DGT  +++ +    +   
Sbjct: 84  VKVGDRVAIEPGVPSRYSDETKEGRYNLCPHMAFAATPPI--DGTLVKYYLSPEDFLVKL 141

Query: 146 MGCSTFSEYTVVADVSVVAIDPKAPLDASCLLGCGVTTGYGAAVKTANVQKGDTVAVFGC 205
               ++ E   V  +SV                 GV +      K A V+    V VFG 
Sbjct: 142 PEGVSYEEGACVEPLSV-----------------GVHSN-----KLAGVRFSTRVVVFGA 179

Query: 206 GTVGLSVIQGAKLRGASKIIAVDINNNKKKYCSQFGATDFIN----PKEDLAKDQTIVEK 261
           G VGL     A+  GAS ++ VD+ +NK +    FGAT+  N    P +   +  + VEK
Sbjct: 180 GPVGLLTGAVARAFGASDVVFVDVFDNKLQRAKDFGATNTFNSSKIPTDKAQELASEVEK 239

Query: 262 LVEMTDGG--LDFTFDCTG-------NTKIMRDALEACHKGWGQSXXXXXXXXXXXXSTR 312
           L+    GG   D  F+C+G         K+ +        G G++            +  
Sbjct: 240 LL----GGNHADVVFECSGADVCIDAGVKVTKVGGTMVQVGMGKN-----------YTNF 284

Query: 313 PFQLVTGRVWK-----GSAFGGIKGRSEMGGLIKDYQSGVLKVEEFITHRRPFKEINHAF 367
           P   V+G+  K       +FG  +    +        +G + V+  ITHR  F++   A+
Sbjct: 285 PIAEVSGKEMKLIGCFRYSFGDYRDAVNL------VATGKVNVKPLITHRFKFEDAAKAY 338

Query: 368 ED--LHNGDCLRTVL 380
           +    H GD ++T++
Sbjct: 339 DYNISHGGDVVKTII 353

>Smik_1.5 Chr1 (16385..17638) [1254 bp, 417 aa] {ON} YAL061W (REAL)
          Length = 417

 Score = 70.9 bits (172), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 74/306 (24%), Positives = 118/306 (38%), Gaps = 56/306 (18%)

Query: 13  IAAVAY----DAKKPSSVEEITVDAPKAHEVRIKIEYTAVCHTDAYTLSGSD---PE--- 62
           + A+AY    D +  +S++E  + AP   E+ I I +  +C TD +  +      PE   
Sbjct: 1   MKALAYFGKGDIRFTNSLKEPRIVAPD--ELVIDIAWCGICGTDLHEYTDGPIFFPEDGH 58

Query: 63  ------GLFPCILGHEGAGIVESVGDGVVTVKPGDHVIALYTAECGK------------- 103
                    P  +GHE AG V  VG GV  +K GD V+   T  C               
Sbjct: 59  THEISHNPLPQAMGHEMAGTVLEVGPGVAHLKVGDKVVVEPTGTCRDRYRWPESPNVDKE 118

Query: 104 -CKFCTSGKTNLCSAVRATQGKGVMPDGTTRFHNAKGKDIYHFMGCSTFSEYTVVADVSV 162
            C  C  G  N+CS +    G GV   G                    F+E  V+ +   
Sbjct: 119 WCAACKKGYYNICSYL-GLCGAGVQSGG--------------------FAERVVMNESHC 157

Query: 163 VAIDPKAPLDASCLLGCGVTTGYGAAVKTANVQKGDTVAVFGCGTVGLSVIQGAKLRGAS 222
             +    PLD + L+       +  A+     + G T  + G G +GL  I      G  
Sbjct: 158 YKVPDFVPLDVAALIQPLAVCWH--AISVCEFKAGSTALIIGAGPIGLGTILALNAAGCR 215

Query: 223 KIIAVDINNNKKKYCSQFGATDFINPKEDLAKDQTIVEKLVEMTDGGLDFTFDCTGNTKI 282
            I+  +    +++   + GA  + +P E  A++     + V     G D+TFDC+G    
Sbjct: 216 DIVVSEPAKLRRELAEKMGARVY-DPTEHAARESIDYLRSVAEGGDGFDYTFDCSGLEVT 274

Query: 283 MRDALE 288
           +  A++
Sbjct: 275 LNAAIQ 280

>YJR159W Chr10 (736044..737117) [1074 bp, 357 aa] {ON}  SOR1Sorbitol
           dehydrogenase; expression is induced in the presence of
           sorbitol or xylose
          Length = 357

 Score = 70.1 bits (170), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 88/357 (24%), Positives = 147/357 (41%), Gaps = 47/357 (13%)

Query: 37  HEVRIKIEYTAVCHTDA-YTLSGSDPEGLF--PCILGHEGAGIVESVGDGVVTVKPGDHV 93
           H V++ I+ T +C +D  Y  SG   + +   P +LGHE +G V  VGD V  VK GD V
Sbjct: 31  HYVKLAIKATGICGSDIHYYRSGGIGKYILKAPMVLGHESSGQVVEVGDAVTRVKVGDRV 90

Query: 94  IALYTAECGKCKFCTSGKTNLCSAVRATQGKGVMPDGT-TRFHNAKGKDIYHFMGCSTFS 152
                           G+ NLC  +       +  DGT  +++ +    +       ++ 
Sbjct: 91  AIEPGVPSRYSDETKEGRYNLCPHMAFAATPPI--DGTLVKYYLSPEDFLVKLPEGVSYE 148

Query: 153 EYTVVADVSVVAIDPKAPLDASCLLGCGVTTGYGAAVKTANVQKGDTVAVFGCGTVGLSV 212
           E   V  +SV                 GV +      K A V+ G  V VFG G VGL  
Sbjct: 149 EGACVEPLSV-----------------GVHSN-----KLAGVRFGTKVVVFGAGPVGLLT 186

Query: 213 IQGAKLRGASKIIAVDINNNKKKYCSQFGATDFINPKE-DLAKDQTIVEKLVEMTDGG-L 270
              A+  GA+ +I VD+ +NK +    FGAT+  N  +    K Q + + + ++  G   
Sbjct: 187 GAVARAFGATDVIFVDVFDNKLQRAKDFGATNTFNSSQFSTDKAQDLADGVQKLLGGNHA 246

Query: 271 DFTFDCTGNTKIMRDALEACHKGWGQSXXXXXXXXXXXXSTRPFQLVTGRVWK-----GS 325
           D  F+C+G    +  A++    G                +  P   V+G+  K       
Sbjct: 247 DVVFECSGADVCIDAAVKTTKVGG----TMVQVGMGKNYTNFPIAEVSGKEMKLIGCFRY 302

Query: 326 AFGGIKGRSEMGGLIKDYQSGVLKVEEFITHRRPFKEINHAFED--LHNGDCLRTVL 380
           +FG  +    +        +G + V+  ITH+  F++   A++    H G+ ++T++
Sbjct: 303 SFGDYRDAVNL------VATGKVNVKPLITHKFKFEDAAKAYDYNIAHGGEVVKTII 353

>YAL061W Chr1 (33448..34701) [1254 bp, 417 aa] {ON}  BDH2Putative
           medium-chain alcohol dehydrogenase with similarity to
           BDH1; transcription induced by constitutively active
           PDR1 and PDR3
          Length = 417

 Score = 70.1 bits (170), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 75/308 (24%), Positives = 122/308 (39%), Gaps = 60/308 (19%)

Query: 13  IAAVAY----DAKKPSSVEEITVDAPKAHEVRIKIEYTAVCHTDAYTLSGSD---PE--- 62
           + A+AY    + +  + ++E  + AP   E+ I IE+  +C TD +  +      PE   
Sbjct: 1   MRALAYFGKGNIRFTNHLKEPHIVAPD--ELVIDIEWCGICGTDLHEYTDGPIFFPEDGH 58

Query: 63  ------GLFPCILGHEGAGIVESVGDGVVTVKPGDHVIALYTAECGK------------- 103
                    P  +GHE AG V  VG GV  +K GD V+   T  C               
Sbjct: 59  THEISHNPLPQAMGHEMAGTVLEVGPGVKNLKVGDKVVVEPTGTCRDRYRWPLSPNVDKE 118

Query: 104 -CKFCTSGKTNLCSAVRATQGKGVMPDGTTRFHNAKGKDIYHFMGCSTFSEYTVVADVSV 162
            C  C  G  N+CS +    G GV   G                    F+E  V+ +   
Sbjct: 119 WCAACKKGYYNICSYL-GLCGAGVQSGG--------------------FAERVVMNESHC 157

Query: 163 VAIDPKAPLDASCLLGCGVTTGYGAAVKTANVQKGDTVAVFGCGTVGLSVIQGAKLRGAS 222
             +    PLD + L+       +  A++    + G T  + G G +GL  I      G  
Sbjct: 158 YKVPDFVPLDVAALIQPLAVCWH--AIRVCEFKAGSTALIIGAGPIGLGTILALNAAGCK 215

Query: 223 KIIAVDINNNKKKYCSQFGATDFINPKEDLAKDQTIVEKLVEMTDG--GLDFTFDCTGNT 280
            I+  +    +++   + GA  + +P    AK+   ++ L  + DG  G D+TFDC+G  
Sbjct: 216 DIVVSEPAKVRRELAEKMGARVY-DPTAHAAKES--IDYLRSIADGGDGFDYTFDCSGLE 272

Query: 281 KIMRDALE 288
             +  A++
Sbjct: 273 VTLNAAIQ 280

>YDL246C Chr4 complement(8683..9756) [1074 bp, 357 aa] {ON}
           SOR2Protein of unknown function; protein sequence is 99%
           identical to the Sor1p sorbitol dehydrogenase;
           computational analysis of large-scale protein-protein
           interaction data also suggests a role in fructose or
           mannose metabolism
          Length = 357

 Score = 68.9 bits (167), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 88/357 (24%), Positives = 146/357 (40%), Gaps = 47/357 (13%)

Query: 37  HEVRIKIEYTAVCHTDA-YTLSGSDPEGLF--PCILGHEGAGIVESVGDGVVTVKPGDHV 93
           H V++ I+ T +C +D  Y  SG   + +   P +LGHE +G V  VGD V  VK GD V
Sbjct: 31  HYVKLAIKATGICGSDIHYYRSGGIGKYILKAPMVLGHESSGQVVEVGDAVTRVKVGDRV 90

Query: 94  IALYTAECGKCKFCTSGKTNLCSAVRATQGKGVMPDGT-TRFHNAKGKDIYHFMGCSTFS 152
                           G  NLC  +       +  DGT  +++ +    +       ++ 
Sbjct: 91  AIEPGVPSRYSDETKEGSYNLCPHMAFAATPPI--DGTLVKYYLSPEDFLVKLPEGVSYE 148

Query: 153 EYTVVADVSVVAIDPKAPLDASCLLGCGVTTGYGAAVKTANVQKGDTVAVFGCGTVGLSV 212
           E   V  +SV                 GV +      K A V+ G  V VFG G VGL  
Sbjct: 149 EGACVEPLSV-----------------GVHSN-----KLAGVRFGTKVVVFGAGPVGLLT 186

Query: 213 IQGAKLRGASKIIAVDINNNKKKYCSQFGATDFINPKE-DLAKDQTIVEKLVEMTDGG-L 270
              A+  GA+ +I VD+ +NK +    FGAT+  N  +    K Q + + + ++  G   
Sbjct: 187 GAVARAFGATDVIFVDVFDNKLQRAKDFGATNTFNSSQFSTDKAQDLADGVQKLLGGNHA 246

Query: 271 DFTFDCTGNTKIMRDALEACHKGWGQSXXXXXXXXXXXXSTRPFQLVTGRVWK-----GS 325
           D  F+C+G    +  A++    G                +  P   V+G+  K       
Sbjct: 247 DVVFECSGADVCIDAAVKTTKVGG----TMVQVGMGKNYTNFPIAEVSGKEMKLIGCFRY 302

Query: 326 AFGGIKGRSEMGGLIKDYQSGVLKVEEFITHRRPFKEINHAFED--LHNGDCLRTVL 380
           +FG  +    +        +G + V+  ITH+  F++   A++    H G+ ++T++
Sbjct: 303 SFGDYRDAVNL------VATGKVNVKPLITHKFKFEDAAKAYDYNIAHGGEVVKTII 353

>Skud_1.2 Chr1 (9513..10766) [1254 bp, 417 aa] {ON} YAL061W (REAL)
          Length = 417

 Score = 68.9 bits (167), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 75/308 (24%), Positives = 120/308 (38%), Gaps = 60/308 (19%)

Query: 13  IAAVAY----DAKKPSSVEEITVDAPKAHEVRIKIEYTAVCHTDAYTLSGSD---PE--- 62
           + A+AY    D +    ++E  + AP   E+ I I +  +C TD +  +      PE   
Sbjct: 1   MRALAYFGKGDVRFTGHLKEPQIVAPD--ELVIDIAWCGICGTDLHEYTDGPIFFPEDGH 58

Query: 63  ------GLFPCILGHEGAGIVESVGDGVVTVKPGDHVIALYTAECGK------------- 103
                    P  +GHE AG V  VG GV  +K GD V+   T  C               
Sbjct: 59  THEISHNPLPQAMGHEMAGTVLEVGPGVAHLKVGDKVVVEPTGTCRDRYRWPNSPNVSKE 118

Query: 104 -CKFCTSGKTNLCSAVRATQGKGVMPDGTTRFHNAKGKDIYHFMGCSTFSEYTVVADVSV 162
            C  C  G  N+CS +    G GV   G                    F+E  V+ +   
Sbjct: 119 WCAACKKGYYNICSYL-GLCGAGVQSGG--------------------FAERVVMNESHC 157

Query: 163 VAIDPKAPLDASCLLGCGVTTGYGAAVKTANVQKGDTVAVFGCGTVGLSVIQGAKLRGAS 222
             +    PLD + L+       +  A+     + G T  + G G +GL  I      G  
Sbjct: 158 YKVPDFVPLDVAALIQPLAVCWH--AISVCEFKAGSTALIIGAGPIGLGTILALDAAGCK 215

Query: 223 KIIAVDINNNKKKYCSQFGATDFINPKEDLAKDQTIVEKLVEMTDG--GLDFTFDCTGNT 280
            I+  +    +++   + GA  + +P E  AK+   ++ L  + +G  G D+TFDC+G  
Sbjct: 216 DIVVSEPAKLRRELAEKMGARVY-DPTEHAAKES--IDYLRSIAEGGDGFDYTFDCSGLE 272

Query: 281 KIMRDALE 288
             +  A++
Sbjct: 273 ITLNAAIQ 280

>KAFR0I00160 Chr9 (33043..34200) [1158 bp, 385 aa] {ON} Anc_7.2
           YAL061W
          Length = 385

 Score = 68.6 bits (166), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 65/281 (23%), Positives = 109/281 (38%), Gaps = 58/281 (20%)

Query: 38  EVRIKIEYTAVCHTDAYT----------------LSGSDPEGLFPCILGHEGAGIVESVG 81
           E+ ++I Y  +C TD +                 LSGS      P  +GHE AG V  +G
Sbjct: 28  ELILEINYCGICGTDLHEYIDGPIFFPEDGETNELSGSG----LPQAMGHEIAGTVVKIG 83

Query: 82  DGVVTVKPGDHVIALYTAECGK--------------CKFCTSGKTNLCSAVRATQGKGVM 127
             V   K GDHV+      C                C  C  G  N+CS +    G GV 
Sbjct: 84  PKVTKFKVGDHVVVQPNGTCKDRYRWPHSPHVNKPWCSACKKGHYNVCSNL-GLIGNGVQ 142

Query: 128 PDGTTRFHNAKGKDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDASCLLGCGVTTGYGA 187
             G                     +E   + +     +    P+D + L+     + +  
Sbjct: 143 SGGC--------------------AERMCINESHCFKVPKDMPMDIAALIQPIAVSWH-- 180

Query: 188 AVKTANVQKGDTVAVFGCGTVGLSVIQGAKLRGASKIIAVDINNNKKKYCSQFGATDFIN 247
           A+K A  ++G +V V G G +GL  +   +  G S I+  +    +++   + GAT +  
Sbjct: 181 AIKVARFKRGGSVLVIGGGPIGLCTLLALQGHGCSDIVVSEPAKVRRELAERMGATTYDP 240

Query: 248 PKEDLAKDQTIVEKLVEMTDGGLDFTFDCTGNTKIMRDALE 288
            + +  K+   + K++   D G D+ FD +G  + +  A+E
Sbjct: 241 SQHNTEKNIQNLRKMILGGD-GFDYVFDNSGTPETLETAIE 280

>NCAS0A07660 Chr1 complement(1525755..1526915) [1161 bp, 386 aa]
           {ON} 
          Length = 386

 Score = 66.6 bits (161), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 82/313 (26%), Positives = 126/313 (40%), Gaps = 65/313 (20%)

Query: 13  IAAVAY----DAKKPSSVEEITVDAPKAHEVRIKIEYTAVCHTDAYT-LSG--------- 58
           + A+AY    D    S +   T+  P   E+ I + +  +C +D +  L G         
Sbjct: 1   MRAIAYYKKGDIHFASDLPTPTISTPD--EILIDVAWCGICGSDLHEYLDGPIFMPQDGS 58

Query: 59  SDP--EGLFPCILGHEGAGIVESVGDGVVTVKPGDHVIALYTAECG-------------- 102
           + P      P  +GHE  G V+++G+ V  V  GD V+    A CG              
Sbjct: 59  THPLSNQPLPQPMGHEFCGFVKAIGNKVTKVAVGDKVVV--EAGCGCKDVHRWPQSHVYG 116

Query: 103 --KCKFCTSGKTNLCSAVRATQGKGVMPDGTTRFHNAKGKDIYHFMGCSTFSEYTVVADV 160
             +C  C  G  N C+    T G GV+                       F+E  VV + 
Sbjct: 117 KEQCTACRKGFDNCCTHAGFT-GLGVV--------------------GGAFAEQVVVGER 155

Query: 161 SVVAIDPKAPLDASCLLGCGVTTGYGAAVKTANVQKGD--TVAVFGCGTVGLSVIQGAKL 218
            VV +  + P D   L+       +  AVK A  +KG      V G G +GL+ I   K 
Sbjct: 156 HVVKLPEEVPTDVGALVEPLSVAWH--AVKVAGFEKGSGKNALVLGAGPIGLATILALKA 213

Query: 219 RGASKIIAVDINNNKKKYCSQFGATDFINPKEDLAKDQTIVEKLVEMTD--GGLDFTFDC 276
            GASKI+  ++   +++   + G   F +P +   + Q I +KL E+ +   G DF FDC
Sbjct: 214 HGASKIVVSELAAIRRELALKMGVEVF-DPSKHGDEKQGI-KKLREIPEDHDGFDFAFDC 271

Query: 277 TGNTKIMRDALEA 289
           +G       AL +
Sbjct: 272 SGVETTFNTALHS 284

>KAFR0I00170 Chr9 (34519..35664) [1146 bp, 381 aa] {ON} Anc_7.3
           YAL060W
          Length = 381

 Score = 65.5 bits (158), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 77/278 (27%), Positives = 110/278 (39%), Gaps = 51/278 (18%)

Query: 38  EVRIKIEYTAVCHTDAYT-LSG-----SDPEG------LFPCILGHEGAGIVESVGDGVV 85
           E+ I + Y  +C +D +  L G      D E         P  +GHE +GIV  VG  V 
Sbjct: 28  EIIIDVSYCGICGSDLHEYLEGPIFMPKDNETNEISNLSLPLAMGHEMSGIVREVGKNVT 87

Query: 86  TVKPGDHVIALYTAECG--------------KCKFCTSGKTNLCSAVRATQGKGVMPDGT 131
            VK GD V+   ++ C               KC  C  G  N C A     G G +  G 
Sbjct: 88  KVKKGDKVVVEASSACSDVHRFATGKHYGEEKCPNCARGYDN-CCAYAGFTGLGFIGGG- 145

Query: 132 TRFHNAKGKDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDASCLLGCGVTTGYGAAVKT 191
                              F+E  +V +  +V I  + PLD + L+     T + A  K 
Sbjct: 146 -------------------FAEQILVGEQHIVRIPDEIPLDVAALVEPLSVTWHAA--KV 184

Query: 192 ANVQKGDTVAVFGCGTVGLSVIQGAKLRGASKIIAVDINNNKKKYCSQFGATDFINPKED 251
               KG T  + G G +GL++I   K  GASKI+  ++   ++K   +     F +P   
Sbjct: 185 GKFVKGSTALILGSGPIGLAMILVLKALGASKIVVSEVAQVRRKLAEKMKVEVF-DPSVH 243

Query: 252 LAKDQTIVEKLVEMTDGGLDFTFDCTGNTKIMRDALEA 289
                  +  L E  D G DF FDC+G    M  A+ A
Sbjct: 244 GKNTSNELRLLTENKD-GFDFAFDCSGLEVTMNTAIHA 280

>KNAG0I00120 Chr9 (9352..10497) [1146 bp, 381 aa] {ON} 
          Length = 381

 Score = 63.9 bits (154), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 62/231 (26%), Positives = 96/231 (41%), Gaps = 21/231 (9%)

Query: 66  PCILGHEGAGIVESVGDGVVTVKPGDHVIALYTAECGKCKFCTSGKTNLCSAVRATQGKG 125
           P  +GHE +G V  VG  V  VK GD V+   T  C         K     A  A + + 
Sbjct: 68  PQAMGHEFSGYVAKVGPKVTKVKVGDRVVVEATCSCVDLHRWPESKHYKTPACNACKDRC 127

Query: 126 VMPDGTTRFHNAKGKDIYHFMGCST----FSEYTVVADVSVVAIDPKAPLDASCLLGCGV 181
              D    +          FMG       F+E  V  +  VV +    P+D + L+   +
Sbjct: 128 ---DNCCEYAG--------FMGLGVVGGAFAERIVTIEHHVVKLPDGFPMDVAALIE-PL 175

Query: 182 TTGYGAAVKTANVQKGDTVAVFGCGTVGLSVIQGAKLRGASKIIAVDINNNKKKYCSQFG 241
           +  + AA + +    G +  V G G +GL++I   K +GASKII  +    +++   +  
Sbjct: 176 SVAWHAA-RVSKFPPGKSALVLGAGPIGLAMILVLKAQGASKIIVSEPATMRRELADRMH 234

Query: 242 ATDFINPKEDLAKDQTIVEKLVEMTDG-GLDFTFDCTGNTKIMRDALEACH 291
              F +P      D+++     +  DG G DF FDC+G        L+A H
Sbjct: 235 VETF-DPSTH--GDKSVAMLRSKTFDGKGFDFAFDCSGVPATFNTGLQAAH 282

>TPHA0H03100 Chr8 complement(736924..738102) [1179 bp, 392 aa] {ON}
           Anc_7.3 YAL060W
          Length = 392

 Score = 63.2 bits (152), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 86/310 (27%), Positives = 132/310 (42%), Gaps = 60/310 (19%)

Query: 13  IAAVAY----DAKKPSSVEEITVDAPKAHEVRIKIEYTAVCHTD--AYTLSG--SDPEGL 64
           + A+AY    D +  + ++E  + A    E+ I + Y  +C TD   YT       P+G 
Sbjct: 1   MRALAYFGQNDVRFTTDLKEPVISADD--ELIIAVSYCGICGTDLKEYTEGAIFFPPDGG 58

Query: 65  --------FPCILGHEGAGIVESVGDGVVTVKPGDHVIALYTAECGK------------- 103
                    P  +GHE +G+VE VG G  T K GDHV+   T  C               
Sbjct: 59  HNEISGNGLPQAMGHEISGVVEKVGKGCKTFKVGDHVVVEPTGTCKDRYRWPESQNANKP 118

Query: 104 -CKFCTSGKTNLCSAVRATQGKGVMPDGTTRFHNAKGKDIYHFMGCSTFSEYTVVADVSV 162
            C  C+ G TN+C+ + A  G G+   G                    F+E  V+ +  V
Sbjct: 119 MCSACSIGMTNICAHL-ALCGAGLESGG--------------------FAERLVINEAHV 157

Query: 163 VAIDPKAPLDASCLLGCGVTTGYGAAVKTANVQKGDTVAVFGCGTVGLSVIQGAKLRGAS 222
             I    PLD   L+       +  AVK A+ +KG +  + G G +GL  I   K  G  
Sbjct: 158 HKIPDHMPLDIGALIQPISVCWH--AVKVAHYKKGGSALIIGGGPIGLGTILALKGFGCE 215

Query: 223 KIIAVDINNNKKKYCSQFGATDFINPKEDLAKDQTIVEKLVEM--TDGGLDFTFDCTGNT 280
            I+  +    +++Y  + GA  + +P   +  D++ V+ L EM     G D+TFDC+G  
Sbjct: 216 YIVLSEPATIRREYAGKMGAKVY-DPT-GVPFDES-VKTLREMGPNGDGFDYTFDCSGLP 272

Query: 281 KIMRDALEAC 290
             +  A+E C
Sbjct: 273 ITLNAAIECC 282

>KNAG0D00110 Chr4 (3538..4626) [1089 bp, 362 aa] {ON} 
          Length = 362

 Score = 62.4 bits (150), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 84/342 (24%), Positives = 135/342 (39%), Gaps = 37/342 (10%)

Query: 38  EVRIKIEYTAVCHTDAYTLSGSDPEGLFPCILGHEGAGIVESVGDGVVT-VKPGDHV-IA 95
           ++ +KIE   VC +D +  SG   +   P I+GHE  G V  VG    + VK GD V + 
Sbjct: 35  DIDVKIECCGVCGSDVHCASGHWGDIAKPLIVGHEIVGHVVKVGPNCTSGVKVGDRVGLG 94

Query: 96  LYTAECGKCKFCTSGKTNLCSAVRATQGKGVMPDGTTRFHNAKGKDIYHFMGCSTFSEYT 155
                C KCK C +G  + C     T         +T + +        ++    +++Y 
Sbjct: 95  AQALSCMKCKRCLNGNESYCPNAIQTY--------STPYEDG-------YVSKGGYADYV 139

Query: 156 VVADVSVVAIDPKAPLDASCLLGCGVTTGYGAAVKTANVQKGDTVAVFGCGTVGLSVIQG 215
            V +   V I    P   +  L CG  T +   ++      G  VA+ G G +G   +  
Sbjct: 140 RVHEQFTVPIPENIPSHLAAPLMCGGLTVFSPLLRNG-CGPGKKVAILGIGGIGHMGVLL 198

Query: 216 AKLRGASKIIAVDINNNKKKYCSQFGATDFINPKEDLAKDQTIVEKLVEMTDGGLDFTFD 275
           AK  GA ++ A+   ++KK+   + GA  FI  KE+    +   ++        LD    
Sbjct: 199 AKAMGA-EVYAISRTSSKKEDAMKLGADHFIATKEEPDWHEKYFDE--------LDLVVV 249

Query: 276 CTGN-TKIMRDALEACHKGWGQSXXXXXXXXXXXXSTRPFQLVTGRVWKGSAFGGIKGRS 334
           C G+ T I  + L       G+               +PF LV G     S  G ++   
Sbjct: 250 CAGSVTDIDFNTLPKIIAVGGRIVSIAIPEMSEVLELKPFGLV-GVSIANSLLGSME--- 305

Query: 335 EMGGLIKDYQSGVLKVEEFITHRRPFKE--INHAFEDLHNGD 374
           E+  L+K      +K+        P  E  ++  FE +  GD
Sbjct: 306 ELKQLLKLVSEKDIKI---WVETVPISEKGVHEVFERMDKGD 344

>YBR046C Chr2 complement(330507..331511) [1005 bp, 334 aa] {ON}
           ZTA1NADPH-dependent quinone reductase, GFP-tagged
           protein localizes to the cytoplasm and nucleus; has
           similarity to E. coli quinone oxidoreductase and to
           human zeta-crystallin
          Length = 334

 Score = 60.5 bits (145), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 66/262 (25%), Positives = 106/262 (40%), Gaps = 71/262 (27%)

Query: 27  EEITVDAPKAHEVRIKIEYTAVCHTDAYTLSGSDPEGLFPC----ILGHEGAGIVESVGD 82
           E+  V +    E+ IK +YT V + ++Y       +G++PC    +LG E +G V + G 
Sbjct: 26  EDYPVPSISEEELLIKNKYTGVNYIESYFR-----KGIYPCEKPYVLGREASGTVVAKGK 80

Query: 83  GVVTVKPGDHVIALYTAECGKCKFCTSGKTNLCSAVRATQGKGVMPDGTTRFHNAKGKDI 142
           GV   + GD V                                                 
Sbjct: 81  GVTNFEVGDQV------------------------------------------------- 91

Query: 143 YHFMGCSTFSEYTVVADVSVVAIDPKAPLDASCLLGCG----VTTGYGAAVKTANVQKGD 198
             ++  STF++Y+ ++    V   PK   D    L       V T      +  +V+KGD
Sbjct: 92  -AYISNSTFAQYSKISSQGPVMKLPKGTSDEELKLYAAGLLQVLTALSFTNEAYHVKKGD 150

Query: 199 TVAVF-GCGTVGLSVIQGAKLRGASKIIAVDINNNKKKYCSQFGATDFINPKEDLAKDQT 257
            V +F   G VGL + Q  K++GA   IAV   + K K   ++GA   IN     A  + 
Sbjct: 151 YVLLFAAAGGVGLILNQLLKMKGAH-TIAVASTDEKLKIAKEYGAEYLIN-----ASKED 204

Query: 258 IVEKLVEMTDG-GLDFTFDCTG 278
           I+ ++++ T+G G+D +FD  G
Sbjct: 205 ILRQVLKFTNGKGVDASFDSVG 226

>KAFR0C00580 Chr3 (113544..114548) [1005 bp, 334 aa] {ON} Anc_3.253
           YBR046C
          Length = 334

 Score = 60.1 bits (144), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 67/247 (27%), Positives = 98/247 (39%), Gaps = 63/247 (25%)

Query: 38  EVRIKIEYTAVCHTDAYTLSGSDPEGLFPCILGHEGAGIVESVGDGVVTVKPGDHVIALY 97
           EV IK  YT V + ++Y   G  P  L P +LG E  G V ++G  V  +K GD V    
Sbjct: 37  EVIIKNRYTGVNYIESYFRKGIYPAEL-PYVLGREAVGTVVAIGKSVRDLKVGDKV---- 91

Query: 98  TAECGKCKFCTSGKTNLCSAVRATQGKGVMPDGTTRFHNAKGKDIYHFMGCSTFSEYTVV 157
                                                          ++  +TF+++T V
Sbjct: 92  ----------------------------------------------SYIAGATFAQFTKV 105

Query: 158 ADVS-VVAIDPKAPLDASCLLGCGVTTGYGAAV---KTANVQKGDTVAVFGC-GTVGLSV 212
            + + V  +      +   L   G+  G  A     +  +V+KGD V ++   G VGL  
Sbjct: 106 PNSTHVFKLPDTTSTEQLKLYAAGMIQGLTALTFVNEAYDVKKGDYVLLYAAAGGVGLIF 165

Query: 213 IQGAKLRGASKIIAVDINNNKKKYCSQFGATDFINPKEDLAKDQTIVEKLVEMTDG-GLD 271
            Q  ++RGA  I AV   N K     + GA   IN KED      I+EK+ ++T G G+D
Sbjct: 166 NQLLRMRGAHTI-AVASTNEKLSLAKENGAEFLINSKED-----NILEKVQQITKGNGVD 219

Query: 272 FTFDCTG 278
             FD  G
Sbjct: 220 VAFDSVG 226

>KLLA0F00528g Chr6 complement(40081..41226) [1146 bp, 381 aa] {ON}
           similar to uniprot|P39713 Saccharomyces cerevisiae
           YAL061W putative polyol dehydrogenase
          Length = 381

 Score = 60.1 bits (144), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 73/296 (24%), Positives = 119/296 (40%), Gaps = 59/296 (19%)

Query: 13  IAAVAY----DAKKPSSVEEITVDAPKAHEVRIKIEYTAVCHTDAYTLSGSDPEGLFP-- 66
           + A+AY    D +  + + E  ++ P   +V I I +  +C TD + L   D    FP  
Sbjct: 1   MRALAYFGTRDIRFTTDLPEPVIEKPD--DVLIDIVWCGICGTDLHELL--DGPNFFPKD 56

Query: 67  ------------CILGHEGAGIVESVGDGVVTVKPGDHVIALYTAECGK----------C 104
                         +GHE AG+V  VG  V   +PGDHV+   T  C            C
Sbjct: 57  GETHEISGRGLPQAMGHEMAGVVSQVGSSVTKFQPGDHVVVEPTGTCQDRERYNTKGETC 116

Query: 105 KFCTSGKTNLCSAVRATQGKGVMPDGTTRFHNAKGKDIYHFMGCSTFSEYTVVADVSVVA 164
           K C  G  N+C  +    G GV   G                    F+E  V+ +     
Sbjct: 117 KACKRGMHNVCVHL-GLCGCGVQSGG--------------------FAEKVVIGEKHCFK 155

Query: 165 IDPKAPLDASCLLGCGVTTGYGAAVKTANVQKGDTVAVFGCGTVGLSVIQGAKLRGASKI 224
           +    PLD + L+       +  AVK   V++G +  + G G +GL +I   +  G + I
Sbjct: 156 VPSWIPLDVAALIQPLAVCWH--AVKLGAVKEGQSALILGGGPIGLGIIMALQHFGCTDI 213

Query: 225 IAVDINNNKKKYCSQFGATDFINPKEDLAKDQTIVEKLVEMTDG--GLDFTFDCTG 278
           +  +    ++    + GA   ++   D   ++  ++ L  ++    G DFTFDC+G
Sbjct: 214 VVSEPAKIRRDLAEKMGA--IVSNPMDFKTNEENIKNLCSLSPNGEGYDFTFDCSG 267

>KLLA0D05511g Chr4 complement(476363..477427) [1065 bp, 354 aa] {ON}
           similar to uniprot|P35497 Saccharomyces cerevisiae
           YJR159W SOR1 Sorbitol dehydrogenase expression is
           induced in the presence of sorbitol
          Length = 354

 Score = 59.3 bits (142), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 78/273 (28%), Positives = 110/273 (40%), Gaps = 37/273 (13%)

Query: 31  VDAPK---AHEVRIKIEYTAVCHTDA-YTLSGSDPEGLF--PCILGHEGAGIVESVGDGV 84
           + AP+   +H V+I ++ T +C +D  Y   GS  E +   P +LGHE +G+V  VG  V
Sbjct: 21  IPAPEITDSHYVKIHVKKTGICGSDIHYYTHGSIGEFVVKKPMVLGHESSGVVVEVGKDV 80

Query: 85  VTVKPGDHVIALYTAECGKCKFCTSGKTNLCS--AVRATQGKGVMPDGTTRFHNAKGKDI 142
             V+ GD V               SG  NLC   A  AT       DGT           
Sbjct: 81  TLVQVGDRVAIEPGVPSRYSDETKSGHYNLCPHMAFAATPPY----DGTL---------- 126

Query: 143 YHFMGCSTFSEYTVVADVSVVAIDPKAPLDASCL--LGCGVTTGYGAAVKTANVQKGDTV 200
                      Y    D  V   D  +  + +C   L  GV      A + A    G  V
Sbjct: 127 --------VKYYLAPEDFLVKLPDHVSFEEGACAEPLAVGV-----HANRLAETSFGKNV 173

Query: 201 AVFGCGTVGLSVIQGAKLRGASKIIAVDINNNKKKYCSQFGATDFINPKEDLAKDQTIVE 260
            VFG G VGL     A   GAS ++ VD+  NK +    FGAT+ IN  +  ++D+    
Sbjct: 174 VVFGAGPVGLVTGAVAAAFGASAVVYVDVFENKLERSKDFGATNTINSTKYKSEDELTEV 233

Query: 261 KLVEMTDGGLDFTFDCTGNTKIMRDALEACHKG 293
              E+     +   DC+G    +R A++    G
Sbjct: 234 IKSELKGEQPEIAIDCSGAEICIRTAIKVLKAG 266

>NDAI0H02950 Chr8 complement(718762..719853) [1092 bp, 363 aa] {ON} 
          Length = 363

 Score = 56.2 bits (134), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 91/358 (25%), Positives = 139/358 (38%), Gaps = 33/358 (9%)

Query: 19  DAKKPSSVEEITVDAPKAHEVRIKIEYTAVCHTDAYTLSGSDPEGLFPCILGHEGAGIVE 78
           D K P  VE  + +    ++V +KIE   VC +D +T SG   E   P ++GHE  G V 
Sbjct: 21  DWKNPKKVEFESKNL-YDYDVEVKIECCGVCGSDIHTASGHWGETKKPLVVGHEIIGTVT 79

Query: 79  SVGDGVVTVKPGDHV-IALYTAECGKCKFCTSGKTNLCSAVRATQGKGVMPDGTTRFHNA 137
            +G     +K GD V I      C +C  C S     C     T  K    DG    +N+
Sbjct: 80  QIGSQCNELKVGDRVGIGAQVFSCLECDRCKSDNEPYCPKTVNTYRKDYT-DG----YNS 134

Query: 138 KGKDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDASCLLGCGVTTGYGAAVKTANVQKG 197
           KG           +++Y  + +   V I    P   +  L CG  T +   ++      G
Sbjct: 135 KG----------GYADYIRLHEHFAVPIPENIPSHLAAPLMCGGVTAFSPLLRNG-CGPG 183

Query: 198 DTVAVFGCGTVGLSVIQGAKLRGASKIIAVDINNNKKKYCSQFGATDFINPKEDLAKDQT 257
             V + G G +G   +  AK  GA +  A+  ++ KK+   + GA  FI  KE+      
Sbjct: 184 KKVGIMGIGGIGHMGLIFAKAMGA-ETFAISRSSAKKEDAIKMGADHFIATKEEPDWATK 242

Query: 258 IVEKLVEMTDGGLDFTFDCTGN-TKIMRDALEACHKGWGQSXXXXXXXXXXXXSTRPFQL 316
             +          D    C+ + T I  + +    K  G+             + +PF L
Sbjct: 243 YFDT--------FDLIVVCSNSLTDIDFNVVPRTMKVGGKIVSICVPEQHEVMNLKPFGL 294

Query: 317 VTGRVWKGSAFGGIKGRSEMGGLIKDYQSGVLKVEEFITHRRPFKEINHAFEDLHNGD 374
           + G     SA GGI    +M  L+      +  VE      +  KE+   FE +  GD
Sbjct: 295 I-GVSISNSALGGINEIKQMLDLVSKKNLKIW-VETIPISEKGVKEV---FERMEKGD 347

>Smik_2.170 Chr2 complement(312211..313215) [1005 bp, 334 aa] {ON}
           YBR046C (REAL)
          Length = 334

 Score = 55.5 bits (132), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 69/265 (26%), Positives = 110/265 (41%), Gaps = 77/265 (29%)

Query: 27  EEITVDAPKAHEVRIKIEYTAVCHTDAYTLSGSDPEGLFPC----ILGHEGAGIVESVGD 82
           E+  V +    ++ IK +YT V + ++Y       +GL+PC    ILG E AG + + G 
Sbjct: 26  EDYPVPSISGKDLLIKNKYTGVNYIESYF-----RKGLYPCEKPYILGREAAGTIVAKGK 80

Query: 83  GVVTVKPGDHVIALYTAECGKCKFCTSGKTNLCSAVRATQGKGVMPDGTTRFHNAKGKDI 142
            V   + GD V                                                 
Sbjct: 81  DVTNFEIGDKV------------------------------------------------- 91

Query: 143 YHFMGCSTFSEYT------VVADVSVVAIDPKAPLDASCLLGCGVTTGYGAAVKTANVQK 196
             ++  STF++YT       V  +S    D +  L A+ LL     T      +  +V+K
Sbjct: 92  -AYISNSTFAQYTKFPSEGTVMKLSKETNDEELKLYAAGLLQA--LTALSFTNEAYHVRK 148

Query: 197 GDTVAVF-GCGTVGLSVIQGAKLRGASKIIAVDINNNKKKYCSQFGATDFIN-PKEDLAK 254
           GD + +F   G VGL + Q  +++GA   IAV   + K +   ++GA   IN  KED   
Sbjct: 149 GDYILLFAAAGGVGLILNQLLRMKGAHA-IAVASTDEKLEIAKEYGAEYLINSSKED--- 204

Query: 255 DQTIVEKLVEMTDG-GLDFTFDCTG 278
              I++K++E+T+G G+D +FD  G
Sbjct: 205 ---ILKKVLEITNGEGVDASFDSVG 226

>NCAS0C03020 Chr3 complement(593785..594873) [1089 bp, 362 aa] {ON} 
          Length = 362

 Score = 55.5 bits (132), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 100/378 (26%), Positives = 147/378 (38%), Gaps = 47/378 (12%)

Query: 9   PIKCIAAVAYDAKKPSSVEEITVDAPKA--HEVRIKIEYTAVCHTDAYTLSGSDPEGLFP 66
           P K       D K   + +++  D  K   H++ IK+E   VC +D +  SG+  +   P
Sbjct: 6   PEKFQGIAVLDHKDWKNPKKVQFDPRKLYDHDIEIKVECCGVCGSDIHAASGNWGDLTKP 65

Query: 67  CILGHEGAGIVESVGDGVVT-VKPGDHV-IALYTAECGKCKFCTSGKTNLCSAVRATQGK 124
            ++GHE  G V  +G+   + +K GD V +      C  C+ C +     C     T G+
Sbjct: 66  LVVGHEIIGTVVRLGENCNSGLKLGDRVGVGAQVFSCLDCERCKNDNEPYCEGFVTTYGQ 125

Query: 125 GVMPDGTTRFHNAKGKDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDASCLLGCGVTTG 184
              PDG    +++KG           +++Y  V +   V I    P   +  L CG  T 
Sbjct: 126 D-YPDG----YSSKG----------GYADYFRVHEHFAVPIPENIPSHLAAPLMCGGLTV 170

Query: 185 YGAAVKT--ANVQKGDTVAVFGCGTVGLSVIQGAKLRGASKIIAVDINNNKKKYCSQFGA 242
           Y   V+      +K   V + G G  GL     AK  GA ++ A+   + KK+   + GA
Sbjct: 171 YSPLVRNGCGPNKKVGIVGIGGIGHQGLLF---AKAMGA-EVYAISRTSAKKEDAMKLGA 226

Query: 243 TDFINPKEDL---AKDQTIVEKLVEMTDGGLDFTFDCTGNTKIMRDALEACHKGWGQSXX 299
             FI  KE+     K     + +V       D  F+   NT           K  G    
Sbjct: 227 DHFIATKEEPDWGTKYFDTFDLIVVCASSLTDVDFNTVPNTM----------KIGGSIVS 276

Query: 300 XXXXXXXXXXSTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQSGVLK--VEEFITHR 357
                     S +PF L  G     SA G I   SEM  L+K      +K  VE      
Sbjct: 277 ISVPEQNETLSLKPFGL-KGVSISNSALGSI---SEMRDLLKLVSENNIKLWVETIPIGE 332

Query: 358 RPFKEINHAFEDLHNGDC 375
           +  KE   AFE +  GDC
Sbjct: 333 KGVKE---AFERMDKGDC 347

>TPHA0J00170 Chr10 (40911..41996) [1086 bp, 361 aa] {ON} 
          Length = 361

 Score = 54.7 bits (130), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 85/343 (24%), Positives = 135/343 (39%), Gaps = 36/343 (10%)

Query: 37  HEVRIKIEYTAVCHTDAYTLSGSDPEGLFPCILGHEGAGIVESVGDGVVT-VKPGDHV-I 94
            +V IK+    VC +D +  +G        C++GHE  G V  VG      VK GD V +
Sbjct: 34  RDVDIKVIACGVCGSDVHCAAGRHLPLFEDCVVGHEIIGEVVKVGPKCTAGVKVGDRVGV 93

Query: 95  ALYTAECGKCKFCTSGKTNLCSAVRATQGKGVMPDGTTRFHNAKGKDIYHFMGCSTFSEY 154
              +  C +C+ C +G    C          + PDG+     A+G    H      F  +
Sbjct: 94  GAQSLSCLECESCIAGNEQYCKKNTVYTIASIYPDGS----KAQGGFGSHVRTHEYFV-H 148

Query: 155 TVVADVSVVAIDPKAPLDASCLLGCGVTTGYGAAVKTANVQKGDTVAVFGCGTVGLSVIQ 214
            +  ++  V   P         L CG  T +   ++   V  G TV + G G +G   I 
Sbjct: 149 PIPKELDTVNAAP---------LLCGGITAFSPLLR-GQVGPGKTVGIVGIGGIGHIAIL 198

Query: 215 GAKLRGASKIIAVDINNNKKKYCSQFGATDFINPKEDLAKDQTIVEKLVEMTDGGLDFTF 274
            AK  GA K+IA+  + +KK+ C + GA ++I   E     Q           G +DF  
Sbjct: 199 FAKAMGA-KVIAISRSASKKEDCLKLGADEYIASAEGDDWKQKFA--------GSIDFML 249

Query: 275 DCTGN-TKIMRDALEACHKGWGQSXXXXXXXXXXXXSTRPFQLVTGRVWKGSAFGGIKGR 333
            C  + +K   D+L +  K  G+             S  P  L+  +      F  +  R
Sbjct: 250 LCNSSFSKSNFDSLFSLIKLGGEVCSIGIPDMSYRLSISPLSLLGIKF----GFSALGSR 305

Query: 334 SEMGGLIKDYQSGVLKVEEFITHRRPFKE--INHAFEDLHNGD 374
           +E   + +  +   +K+        P  E  ++ AFE + NGD
Sbjct: 306 NEFQKMFELVKKNNIKL---WVETLPIGEKGLHEAFERVENGD 345

>NDAI0G04880 Chr7 complement(1175518..1176603) [1086 bp, 361 aa]
           {ON} 
          Length = 361

 Score = 54.7 bits (130), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 97/367 (26%), Positives = 146/367 (39%), Gaps = 50/367 (13%)

Query: 19  DAKKPSSVEEITVDAPKA---HEVRIKIEYTAVCHTDAYTLSGSDPEGLFPCILGHEGAG 75
           D K P  VE      PK    H++ IKIE   VC +D +T SG   +   P ++GHE  G
Sbjct: 18  DWKNPKKVEY----EPKKFLDHDIDIKIECCGVCGSDIHTASGHWGDITKPLVVGHEIIG 73

Query: 76  IVESVGDGVVT-VKPGDHV----IALYTAECGKCKFCTSGKTNLCSAVRATQGKGVMPDG 130
            V  +GD   + +K GD V     A    ECG+CK   S     C+    T       DG
Sbjct: 74  TVVRLGDKCTSGLKLGDRVGVGAQAFSCLECGRCK---SDNEPYCTKSVWTYSTN-YEDG 129

Query: 131 TTRFHNAKGKDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDASCLLGCGVTTGYGAAVK 190
               +N+KG           +++Y  + +   + I    P   +  L CG  T +   ++
Sbjct: 130 ----YNSKG----------GYADYIRLHEHFAIPIPENIPSHLAAPLMCGGITAFSPLLR 175

Query: 191 TANVQKGDTVAVFGCGTVGLSVIQGAKLRGASKIIAVDINNNKKKYCSQFGATDFINPKE 250
                +G  V + G G +G   +  AK  GA ++ A+   + KK    + GA  FI  KE
Sbjct: 176 NG-CGRGKKVGIMGIGGIGHMALIFAKAMGA-EVYAISRTSAKKDDSIKMGADHFIATKE 233

Query: 251 DLAKDQTIVEKLVEMTDGGLDFTFDCTGN-TKIMRDALEACHKGWGQSXXXXXXXXXXXX 309
           +        +          D    C+ + T I  D +    K  G+             
Sbjct: 234 EPDWATKYFDT--------FDLIVVCSNSLTDINFDVVPRTMKVGGKIVSICAPEQNEVI 285

Query: 310 STRPFQLVTGRVWKGSAFGGIKGRSEMGGLI--KDYQSGVLKVEEFITHRRPFKEINHAF 367
           + +PF L+ G     SA GGI    +M  L+  KD +   + VE      +  KE+   F
Sbjct: 286 NLKPFGLL-GVSISNSALGGINEIKQMLDLVSKKDLK---IWVETVPISEKGVKEV---F 338

Query: 368 EDLHNGD 374
           E +  GD
Sbjct: 339 ERMDMGD 345

>Kwal_47.17532 s47 (444594..445715) [1122 bp, 373 aa] {ON} YMR318C
           (ADH6) - NADPH-dependent alcohol dehydrogenase [contig
           207] FULL
          Length = 373

 Score = 53.9 bits (128), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 57/244 (23%), Positives = 95/244 (38%), Gaps = 30/244 (12%)

Query: 17  AYDAKKPSSVEEITVDAPKA---HEVRIKIEYTAVCHTDAYTLSGSDPEGLFPC------ 67
           A +  K  +  ++T   PKA   H+V I++E   +C ++ + L          C      
Sbjct: 11  AINDPKDWATPKLTSFEPKAFGPHDVDIEVECCGICASELFALKNEWGHAPLACLSSKYG 70

Query: 68  ----ILGHEGAGIVESVGDGVVTVKPGDHV-IALYTAECGKCKFCTSGKTNLCSAVRATQ 122
               ++GHE  G V +VG  V     GD V +    + C +C  C SG    C    +T 
Sbjct: 71  PKTQVVGHEVVGKVVAVGPQVSLCNVGDRVGLGAQASACMQCSRCNSGNEQYCPNAISTY 130

Query: 123 GKGVMPDGTTRFHNAKGKDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDASCLLGCGVT 182
            K   PDG              ++    ++ +    +     I P+ P +    L CG  
Sbjct: 131 CK-PYPDG--------------YVSQGGYASHVRAHEQFCFPIPPEIPSELVAPLQCGGL 175

Query: 183 TGYGAAVKTANVQKGDTVAVFGCGTVGLSVIQGAKLRGASKIIAVDINNNKKKYCSQFGA 242
           T +    +    +    VAV G G +G   I  A+  GA ++ A    ++K+    + GA
Sbjct: 176 TVFSPIKRNLQGKHDPKVAVIGIGGLGHMAIMIARALGA-EVYAFSRGHSKRDDALKMGA 234

Query: 243 TDFI 246
             F+
Sbjct: 235 HHFV 238

>Kwal_56.22985 s56 complement(357501..358541) [1041 bp, 346 aa] {ON}
           YBR046C (ZTA1) - 1:1 [contig 184] FULL
          Length = 346

 Score = 53.1 bits (126), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 83/351 (23%), Positives = 129/351 (36%), Gaps = 82/351 (23%)

Query: 37  HEVRIKIEYTAVCHTDAYTLSGSDPEGLFPCILGHEGAGIVESVGDGVVTVKPGDHVIAL 96
           +E+ IK +YT +   ++Y   G  P    P +LG E +G V + G  V            
Sbjct: 47  NEILIKNKYTGINFIESYFRKGIYPSQK-PYVLGREASGTVVAKGKAV------------ 93

Query: 97  YTAECGKCKFCTSGKTNLCSAVRATQGKGVMPDGTTRFHNAKGKDIYHFMGCSTFSEYTV 156
                         K NL   V                          ++   TF++YT 
Sbjct: 94  -------------SKFNLADKV-------------------------AYLSAGTFAQYTK 115

Query: 157 VADVSVVAIDPKAPLDASCLLGCG----VTTGYGAAVKTANVQKGDTVAVF-GCGTVGLS 211
           +A+   ++  P+   D    L       V T    A +   V+KGD V ++   G VGL+
Sbjct: 116 IAETGHISKLPENTTDKQLELYAASLVQVLTALTFAKEAYTVKKGDFVLLYAAAGGVGLA 175

Query: 212 VIQGAKLRGASKIIAVDINNNKKKYCSQFGATDFIN-PKEDLAKDQTIVEKLVEMTDG-G 269
             Q  K  GA   IAV   + K +   +FGA   +N  KED      ++ +++E+T G G
Sbjct: 176 FNQILKRLGAH-TIAVASTDEKLQLAKEFGAEYLVNSSKED------VLARVLEITQGQG 228

Query: 270 LDFTFDCTGNTKIMRDALEACHK-----GWGQSXXXXXXXXXXXXSTRPFQLVTGRVWKG 324
           +D  +D  G        L A  +      +G +            S +       ++ + 
Sbjct: 229 VDVAYDSIGK-DTFETTLSALRRKGTFVSFGNASGPVPPIAISRLSPKNI-----KILRP 282

Query: 325 SAFGGIKGRSEMG----GLIKDYQSGVLKVEEFITHRRPFKEINHAFEDLH 371
           + FG I  + E       LIK   S   KV   IT   P +E   A E+L 
Sbjct: 283 TLFGYIASQEEWAYYSEELIKLLHSEEFKV--LITKIYPLEEYRKATEELE 331

>TDEL0D03720 Chr4 (683833..684840) [1008 bp, 335 aa] {ON} Anc_3.253
           YBR046C
          Length = 335

 Score = 53.1 bits (126), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 67/252 (26%), Positives = 98/252 (38%), Gaps = 71/252 (28%)

Query: 37  HEVRIKIEYTAVCHTDAYTLSGSDPEGLFPCILGHEGAGIVESVGDGVVTVKPGDHVIAL 96
           +E+ IK +Y  +   +AY   G  P  L P ILG E  G+V + G  V     GD V   
Sbjct: 37  NELLIKNKYAGINFIEAYFRKGIYPVQL-PQILGREATGVVVAKGQSVKNFDIGDKV--- 92

Query: 97  YTAECGKCKFCTSGKTNLCSAVRATQGKGVMPDGTTRFHNAKGKDIYHFMGCSTFSEYTV 156
                                                           +M  STF++YT 
Sbjct: 93  -----------------------------------------------AYMSSSTFAQYTK 105

Query: 157 VADVSVVAIDPKAPLD-------ASCLLGCGVTTGYGAAVKTANVQKGDTVAVF-GCGTV 208
            +   +++  P    D       A+ + G    T    A K   V++GD + ++   G V
Sbjct: 106 YSSSGLISKLPSETTDDQLKVYAAALIQGLTALTFLDEAYK---VKEGDYILLYAAAGGV 162

Query: 209 GLSVIQGAKLRGASKIIAVDINNNKKKYCSQFGATDFIN-PKEDLAKDQTIVEKLVEMT- 266
           GL + Q  K RGA   IAV     K++   +FGA   IN  KED      I+++ +E+T 
Sbjct: 163 GLLMDQLLKERGAHA-IAVVSTEEKEELAKKFGAEYVINSSKED------ILKRALEITN 215

Query: 267 DGGLDFTFDCTG 278
           D G+D  FD  G
Sbjct: 216 DKGVDAVFDSVG 227

>NDAI0H02060 Chr8 complement(502872..504071) [1200 bp, 399 aa] {ON} 
          Length = 399

 Score = 52.0 bits (123), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 72/307 (23%), Positives = 119/307 (38%), Gaps = 58/307 (18%)

Query: 13  IAAVAY----DAKKPSSVEEITVDAPKAHEVRIKIEYTAVCHTDAYTLSGS--------- 59
           + A+AY    D K  + + E  + AP   E+ I I +  +C TD +              
Sbjct: 1   MRALAYFGKNDIKFTNDLPEPKITAPD--ELIIDISWCGICGTDLHEFQDGPIFFPENGC 58

Query: 60  ----DPEGLFPCILGHEGAGIVESVGDGVVTVKPGDHVIALYTAECG------------- 102
                 EGL P  +GHE AGIV  +G  V   + GD V+   T  C              
Sbjct: 59  CHEISGEGL-PQAMGHEIAGIVSEIGPKVKKFQVGDRVVVEPTGTCKDRYRWPDAPNANQ 117

Query: 103 -KCKFCTSGKTNLCSAVRATQGKGVMPDGTTRFHNAKGKDIYHFMGCSTFSEYTVVADVS 161
            +C  C  G  N+CS +    G GV   G                    F+E  V+ +  
Sbjct: 118 EECAACKKGLYNICSNL-GLVGCGVQSGG--------------------FAERMVMNEAK 156

Query: 162 VVAIDPKAPLDASCLLGCGVTTGYGAAVKTANVQKGDTVAVFGCGTVGLSVIQGAKLRGA 221
              I     +D + L+     + +  AV+ +  + G +V + G G +GL  I      G 
Sbjct: 157 CYKIPEHLTMDVAALIQPIAVSWH--AVRVSKFKPGSSVLIIGGGPIGLGTILALNGHGV 214

Query: 222 SKIIAVDINNNKKKYCSQFGATDFINPKEDLAKDQTIVEKLVEMTDGGLDFTFDCTGNTK 281
           ++++  +    ++    + GA  +     D  +    +  +    D G D+TFDC+GN  
Sbjct: 215 TEVVVSEPAKIRRDLAEKMGAVVYDPMTRDHDESIKYLRSIAPGGD-GFDYTFDCSGNPA 273

Query: 282 IMRDALE 288
            ++ A+E
Sbjct: 274 TLKAAIE 280

>SAKL0D03872g Chr4 (316127..317173) [1047 bp, 348 aa] {ON} highly
           similar to uniprot|P38230 Saccharomyces cerevisiae
           YBR046C
          Length = 348

 Score = 51.6 bits (122), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 88/360 (24%), Positives = 130/360 (36%), Gaps = 80/360 (22%)

Query: 27  EEITVDAPKAHEVRIKIEYTAVCHTDAYTLSGSDPEGLFPCILGHEGAGIVESVGDGVVT 86
           E+  V    A EV IK +++ +   ++Y   G  P    P +LG E AG V + GD V  
Sbjct: 40  EDFPVPNINADEVLIKNKFSGINFIESYFRKGLYPSQK-PYVLGREAAGTVVAKGDAVSK 98

Query: 87  VKPGDHVIALYTAECGKCKFCTSGKTNLCSAVRATQGKGVMPDGTTRFHNAKGKDIYHFM 146
              GD V                                                   ++
Sbjct: 99  FNIGDKV--------------------------------------------------AYL 108

Query: 147 GCSTFSEYTVVADVSVVAIDPKAPLDASCLLGCGVTTGYGAAVKTAN----VQKGDTVAV 202
              TF++YT   +   +   PK   D       G       A+   N    V+KGD + +
Sbjct: 109 SPGTFAQYTKYPENGKILKLPKETTDEQLKFYAGSLVQGLTALTFVNDAYDVKKGDYILL 168

Query: 203 FGC-GTVGLSVIQGAKLRGASKIIAVDINNNKKKYCSQFGATDFINPKEDLAKDQTIVEK 261
           +   G  GL   Q  KL+GA   IAV   + K K   ++GA   IN     +KD T+  K
Sbjct: 169 YAAAGGAGLIFNQLLKLKGA-HTIAVASTDEKLKLAREYGAEYVINS----SKDDTL-SK 222

Query: 262 LVEMTDG-GLDFTFDCTGNTKIMRDALEACHK-----GWGQSXXXXXXXXXXXXSTRPFQ 315
           ++E+T+G G+   FD  G       +L+A  +      +G +            S++   
Sbjct: 223 VLEITNGEGVAAAFDSIGK-DTFEISLQAIKRKGTLVSFGNASGPVPPFSINRLSSKNL- 280

Query: 316 LVTGRVWKGSAFGGIKGRSEMG----GLIKDYQSGVLKVEEFITHRRPFKEINHAFEDLH 371
               +V +   FG I    E       LI+   SG LKV  FI+   P  E   A E L 
Sbjct: 281 ----KVLRPQVFGYITTSEEWNHYASKLIELLSSGDLKV--FISGTYPLSEYRAATEALE 334

>KLLA0F00638g Chr6 (51849..52997) [1149 bp, 382 aa] {ON} weakly
           similar to uniprot|P53912 Saccharomyces cerevisiae or
           YLR460C uniprot|P54007 Saccharomyces cerevisiae YLR460C
           Hypothetical ORFs
          Length = 382

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 60/247 (24%), Positives = 99/247 (40%), Gaps = 50/247 (20%)

Query: 35  KAHEVRIKIEYTAVCHTDAYTLSGSDPEGLFPCILGHEGAGIVESVGDGVVTVKPGDHVI 94
           K +E+ IK +Y  + H D  +         FP + G E +GIV         V+ G+ V 
Sbjct: 72  KPYEILIKNKYIGLNHVDWKSKKYRFSIYSFPWVNGRESSGIV---------VRRGEKV- 121

Query: 95  ALYTAECGKCKFCTSGKTNLCSAVRATQGKGVMPDGTTRFHNAKGKDIYHFMGCSTFSEY 154
                   + KF   G+  + S                          Y  +  STF EY
Sbjct: 122 -------DEEKFPLGGEVFIASTT------------------------YRDLRTSTFQEY 150

Query: 155 TVVADVSVVAIDPKAPLDASCLLGCGVTTGYGAAVKTANV----QKGDTVAVFGCGT-VG 209
           TV     V  +  +  LD +  +G  + T   A     NV    ++  ++ ++G  T VG
Sbjct: 151 TVFDSRLVWRVPERIGLDFASGIGVSLVTAGAALASKRNVKVQPEEKKSIVIWGGSTGVG 210

Query: 210 LSVIQGAKLRGASKIIAVDINNNKKKYCSQFGATDFINPKEDLAKDQTIVEKLVEMTDGG 269
           + V+Q AK  G +KII +  +   ++Y    GAT  I+ +E   K + IV ++ ++   G
Sbjct: 211 IFVVQLAKSLGFTKIITIT-SKKHEQYLLSLGATHIIHREE---KTEDIVNEIKKICPNG 266

Query: 270 LDFTFDC 276
           +    D 
Sbjct: 267 VSHGVDL 273

>SAKL0H22088g Chr8 (1934171..1935301) [1131 bp, 376 aa] {ON} similar
           to uniprot|Q04894 Saccharomyces cerevisiae YMR318C ADH6
           NADPH-dependent cinnamyl alcohol dehydrogenase family
           member with broad substrate specificity may be involved
           in fusel alcohol synthesis or in aldehyde tolerance
          Length = 376

 Score = 50.4 bits (119), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 60/256 (23%), Positives = 94/256 (36%), Gaps = 40/256 (15%)

Query: 35  KAHEVRIKIEYTAVCHTDAYTLSGSDPEGLFPC----------ILGHEGAGIVESVGDGV 84
           +AH+V I++E   +C ++ ++L          C          ++GHE  G V +VG  V
Sbjct: 34  EAHDVDIEVECCGICASELFSLKNEWKHEPLACLSSSYGPKSQVVGHEVVGKVVAVGSNV 93

Query: 85  VTVKPGDHV-IALYTAECGKCKFCTSGKTNLCSAVRATQGKGVMPDGTTRFHNAKGKDIY 143
                GD V +      C KC  C SG    C     T          +R+ +       
Sbjct: 94  TLCNIGDRVGLGAQAFSCMKCSRCNSGNEQYCPQAVGTY--------CSRYADG------ 139

Query: 144 HFMGCSTFSEYTVVADVSVVAIDPKAPLDASCLLGCGVTTGYGAAVKTANVQKGDTVAVF 203
            ++    ++ +    +     I    P +    L CG  T Y    +     K   VA+ 
Sbjct: 140 -YISQGGYASHVRAHEQFCFPIPDDIPSELVAPLQCGGLTVYSPIKRNIEGVKDPKVAII 198

Query: 204 GCGTVGLSVIQGAKLRGASKIIAVDINNNKKKYCSQFGATDFINPKEDLAKDQTIVEKLV 263
           G G +G   I  +K  GA ++ A     +KK+   + GA  FI   E             
Sbjct: 199 GIGGLGHMAIMISKALGA-EVTAFSRGYSKKEDALKMGAHHFIATGE------------- 244

Query: 264 EMTDGGLDFTFDCTGN 279
           E  + GL+ TFD   N
Sbjct: 245 EGWESGLNDTFDLILN 260

>KNAG0E04200 Chr5 complement(837232..838389) [1158 bp, 385 aa] {ON} 
          Length = 385

 Score = 50.4 bits (119), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 70/281 (24%), Positives = 109/281 (38%), Gaps = 58/281 (20%)

Query: 38  EVRIKIEYTAVCHTDAYTLSGSDPEGLFPC--------------ILGHEGAGIVESVGDG 83
           E+ + I Y  +C TD + L+  D    FP                +GHE AGIV +VG G
Sbjct: 28  ELLVDIVYCGICGTDLHELT--DGPIFFPLDNERNEISGNGLPQAMGHEMAGIVTAVGSG 85

Query: 84  VVTVKPGDHVIALYTAECGK--------------CKFCTSGKTNLCSAVRATQGKGVMPD 129
           V   + GDHV    T  C                C  C  G  N C  +    G GV   
Sbjct: 86  VKKFQVGDHVAIEPTGTCRDRYRWPDAPDAKKPVCTSCQRGMYNCCDYL-GLIGNGVQSG 144

Query: 130 GTTRFHNAKGKDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDASCLLGCGVTTGYGAAV 189
           G                    F+E  VV +          P + + L+       +  A+
Sbjct: 145 G--------------------FAERIVVNESHCYKCPDNLPWEVAALIQPIAVCWH--AI 182

Query: 190 KTANVQKGDTVAVFGCGTVGLSVIQGAKLRGASKIIAVDINNNKKKYCSQFGATDFINPK 249
             A  + G +V + G G +GL  I      G ++II  +    ++ Y  + GA  + +P 
Sbjct: 183 NIAQFKPGSSVLILGGGPIGLGTILALNGHGCTEIIVSEPVKLRRDYAEKMGAVVY-DPL 241

Query: 250 EDLAKDQTIVEKLVEMTDG--GLDFTFDCTGNTKIMRDALE 288
           +  + +Q+I   L +M  G  G D+ FDC+G    ++ ++E
Sbjct: 242 Q-CSHEQSI-PNLRKMAPGADGFDYCFDCSGTPATLKASIE 280

>NDAI0A06320 Chr1 (1438393..1439442) [1050 bp, 349 aa] {ON}
           Anc_3.253
          Length = 349

 Score = 50.1 bits (118), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 69/263 (26%), Positives = 101/263 (38%), Gaps = 58/263 (22%)

Query: 18  YDAKKPSSVEEITVDAPKAHEVRIKIEYTAVCHTDAYTLSGSDPEGLFPCILGHEGAGIV 77
           YD  K   +   T+  P  +++ IK +Y  V + ++Y   G  P  L P ILG E +G+V
Sbjct: 35  YDVIKYKDIATPTIQTP--NDIIIKNKYAGVNYIESYFRKGIYPCAL-PAILGREASGVV 91

Query: 78  ESVGDGVVTVKPGDHVIALYTAECGKCKFCTSGKTNLCSAVRATQGKGVMPDGTTRFHNA 137
              G  +   + GD V   Y   C   +F                         T+  N+
Sbjct: 92  VDKGTNIKNFEIGDKV--AYIGNCSMAQF-------------------------TKIDNS 124

Query: 138 KGKDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDASCLLGCGVTTGYGAAVKTANVQKG 197
               I      ST  +  + A              A  L G    T      +   V+KG
Sbjct: 125 M---IMKLSSDSTNEDLKLYA--------------AGILQGL---TALSFVTEAYEVKKG 164

Query: 198 DTVAVF-GCGTVGLSVIQGAKLRGASKIIAVDINNNKKKYCSQFGATDFINPKEDLAKDQ 256
           D + V+   G  GL   Q  K RGA  +IAV  ++ K +   + GA   IN K D     
Sbjct: 165 DYILVYAAAGGAGLIFDQLIKARGAH-VIAVCSSDEKLQLAKENGAEYLINSKTD----- 218

Query: 257 TIVEKLVEMTDG-GLDFTFDCTG 278
            I+ K++E+TD  G+   FD  G
Sbjct: 219 DILTKVMEITDNKGVQAAFDSVG 241

>KLTH0E07964g Chr5 (735214..736338) [1125 bp, 374 aa] {ON} similar
           to uniprot|P25377 Saccharomyces cerevisiae YCR105W ADH7
           NADPH-dependent cinnamyl alcohol dehydrogenase family
           member with broad substrate specificity may be involved
           in fusel alcohol synthesis
          Length = 374

 Score = 50.1 bits (118), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 64/272 (23%), Positives = 101/272 (37%), Gaps = 45/272 (16%)

Query: 37  HEVRIKIEYTAVCHTDAYTLSGSDPEGLFPC----------ILGHEGAGIVESVGDGVVT 86
            +V I++E   +C ++ + L          C          ++GHE  G V +VG  V  
Sbjct: 34  RDVDIEVECCGICASELFALKNDWTHEPLACLSSKYGPKTQVVGHEVVGKVVAVGPEVSL 93

Query: 87  VKPGDHV-IALYTAECGKCKFCTSGKTNLCSAVRATQGKGVMPDGTTRFHNAKGKDIYHF 145
            K GD V +    + C +C  C S     C+    T      PDG              +
Sbjct: 94  CKVGDRVGLGAQASACMQCSRCQSSNEQYCAQSIGTYCNP-YPDG--------------Y 138

Query: 146 MGCSTFSEYTVVADVSVVAIDPKAPLDASCLLGCGVTTGYGAAVKTANVQKGDTVAVFGC 205
           +    ++ +    +     I P+ P +    L CG  T +    +    +K   VA+ G 
Sbjct: 139 VSQGGYASHVRAHEQFCFPIPPEIPSELVAPLQCGGLTVFSPIKRNIQGKKNPRVAIIGI 198

Query: 206 GTVGLSVIQGAKLRGASKIIAVDINNNKKKYCSQFGATDFINPKEDLAKDQTIVEKLVEM 265
           G +G   I  +K  GA ++ AV    +K+    + GA  FI   E               
Sbjct: 199 GGLGHMAIMISKALGA-EVSAVSRGYSKRDDALKMGADHFIATSE-------------PN 244

Query: 266 TDGGLDFTFD----CTGNTKIM-RDALEACHK 292
            + GLD TFD    C  +T  +  +AL  C K
Sbjct: 245 WNAGLDDTFDLILNCASSTSSLDLNALLPCLK 276

>KAFR0A08730 Chr1 complement(1747657..1748739) [1083 bp, 360 aa]
           {ON} 
          Length = 360

 Score = 50.1 bits (118), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 76/265 (28%), Positives = 109/265 (41%), Gaps = 29/265 (10%)

Query: 19  DAKKPSSVEEITVDAPKA---HEVRIKIEYTAVCHTDAYTLSGSDPEGLFPCILGHEGAG 75
           D K P  V+      PK    +++ IKIE   VC +D +  SG+  +   P ++GHE  G
Sbjct: 17  DWKHPKKVQF----EPKTFYDNDIDIKIEACGVCGSDVHMASGNWGDVKKPLVVGHEIVG 72

Query: 76  IVESVGDGVVT-VKPGDHV-IALYTAECGKCKFCTSGKTNLCSAVRATQGKGVMPDGTTR 133
            V  VG    + +K GD V +      C  C  C +     C  V  T G    PDG   
Sbjct: 73  TVVKVGSKCTSGMKVGDRVGVGAQVHSCLTCDRCNNDNEQYCPNVVFTYGFD-YPDG--- 128

Query: 134 FHNAKGKDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDASCLLGCGVTTGYGAAVKTAN 193
            +N KG           ++ Y  V +   V I    P   +  L CG  T Y   ++   
Sbjct: 129 -YNGKG----------GYANYIRVHEHFAVPIPENIPTHLAAPLLCGGITVYSPLLRNG- 176

Query: 194 VQKGDTVAVFGCGTVGLSVIQGAKLRGASKIIAVDINNNKKKYCSQFGATDFINPKE--D 251
              G  V + G G +G   I  AK  GA ++ A+  ++ KK+   + GA  FI  K+  D
Sbjct: 177 CGPGKKVGILGIGGIGHMGIIFAKSMGA-EVYAISRSDAKKEDAFKLGADHFIATKDEPD 235

Query: 252 LAKDQTIVEKLVEMTDGGL-DFTFD 275
             K       L+ +  G L D  FD
Sbjct: 236 WGKKYFDTLDLIVICAGSLKDVDFD 260

>NCAS0D01220 Chr4 (223821..224909) [1089 bp, 362 aa] {ON} 
          Length = 362

 Score = 50.1 bits (118), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 45/175 (25%), Positives = 72/175 (41%), Gaps = 18/175 (10%)

Query: 19  DAKKPSSVEEITVDAPKAHEVRIKIEYTAVCHTDAYTLSGSDPEGLFPCILGHEGAGIVE 78
           D K P  ++         H+++IK+E   VC +D +  SG       P ++GHE  G V 
Sbjct: 17  DWKNPKKIQ-FKAKTFNDHDIQIKVECCGVCGSDIHAASGHWGNIPTPLVVGHEIVGRVV 75

Query: 79  SVGDGVVT-VKPGDHV-IALYTAECGKCKFCTSGKTNLCSAVRATQGKGVMPDGTTRFHN 136
            VGD     +K GD V +      C +C  C +   + C    AT G G  PDG      
Sbjct: 76  KVGDRCDNGLKVGDRVGVGAQVFSCLECNRCKTDNESYCPKWVATYG-GEYPDG------ 128

Query: 137 AKGKDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDASCLLGCGVTTGYGAAVKT 191
                   ++    ++++  V +  VV I    P + +  L CG  T +   ++ 
Sbjct: 129 --------YISKGGYADFVRVHEHFVVPIPENIPSEYAAPLLCGGLTVFSPLLRN 175

>NCAS0I01730 Chr9 (319449..320498) [1050 bp, 349 aa] {ON} Anc_3.253
          Length = 349

 Score = 48.9 bits (115), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 90/369 (24%), Positives = 146/369 (39%), Gaps = 82/369 (22%)

Query: 18  YDAKKPSSVEEITVDAPKAHEVRIKIEYTAVCHTDAYTLSGSDPEGLFPCIL----GHEG 73
           YD  K  +++  TV+   ++E+ IK  Y+ +   +AY       +G++PC L    G E 
Sbjct: 36  YDVIKYKTIQTPTVE--NSNEMVIKNSYSGINFIEAYF-----RKGIYPCELPYLPGREA 88

Query: 74  AGIVESVGDGVVTVKPGDHVIALYTAECGKCKFCTSGKTNLCSAVRATQGKGVMPDGTTR 133
           +GIV  VG  V   + GD V  L+                                    
Sbjct: 89  SGIVAEVGKDVKNFQIGDKVAYLH------------------------------------ 112

Query: 134 FHNAKGKDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDASCLLGCGVTTGYGAAVKTAN 193
                G+ +  F   +   E   +  +S  A D    L A+ LL     T      +   
Sbjct: 113 -----GETMAEF---TKIKETDPIIKLSKDASDENLKLYAAGLLQS--LTAITLINEAHE 162

Query: 194 VQKGDTVAVF-GCGTVGLSVIQGAKLRGASKIIAVDINNNKKKYCSQFGATDFINPKEDL 252
           V+KG+ V V+   G VGL + Q  K++GA   IAV     K +     GA   IN KE  
Sbjct: 163 VKKGEYVLVYAAAGGVGLLLDQLLKMKGAH-TIAVCSTKEKLELAKANGAEFSINSKE-- 219

Query: 253 AKDQTIVEKLVEMTDG-GLDFTFDCTGNTKIMRDALEACH-KG----WGQSXXXXXXXXX 306
              + +V++++E+T+  G+D  +D  G      D L A   KG    +G +         
Sbjct: 220 ---ENVVQRVMEITNNKGVDVAYDSIGKA-TFEDTLAALKLKGSLVSFGNASGPVPPLLI 275

Query: 307 XXXSTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQ----SGVLKVEEFITHRRPFKE 362
              S +  +LV  +++     G I    +     K++Q    SG L ++ F T+  P K+
Sbjct: 276 NRLSPKNLKLVRPQLY-----GYITNPEDWEKYSKEFQSLVDSGKLNIKIFKTY--PLKD 328

Query: 363 INHAFEDLH 371
              A ++L 
Sbjct: 329 YKIAVQELE 337

>Skud_2.162 Chr2 complement(299642..300646) [1005 bp, 334 aa] {ON}
           YBR046C (REAL)
          Length = 334

 Score = 47.8 bits (112), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 63/249 (25%), Positives = 102/249 (40%), Gaps = 67/249 (26%)

Query: 38  EVRIKIEYTAVCHTDAYTLSGSDPEGLFPC----ILGHEGAGIVESVGDGVVTVKPGDHV 93
           ++ IK +YT V + ++Y       +GL+PC    +LG E  G++ + G  V   + GD V
Sbjct: 37  DILIKNKYTGVNYIESYFR-----KGLYPCEKPYVLGREATGVIVAKGKDVTNFETGDQV 91

Query: 94  IALYTAECGK-CKFCTSGKTNLCSAVRATQGKGVMPDGTTRFHNAKGKDIYHFMGCSTFS 152
             +  +   +  KF + G                +P GT+                    
Sbjct: 92  AYISNSTFAQYTKFPSEGTIM------------KLPSGTS-------------------- 119

Query: 153 EYTVVADVSVVAIDPKAPLDASCLLGCGVTTGYGAAVKTANVQKGDTVAVF-GCGTVGLS 211
                        D K  L A+ LL     T      +  +V+KGD + V+   G VGL 
Sbjct: 120 -------------DEKMKLYAAGLLQA--LTALSFTNEAYHVKKGDYILVYAAAGGVGLI 164

Query: 212 VIQGAKLRGASKIIAVDINNNKKKYCSQFGATDFIN-PKEDLAKDQTIVEKLVEMTDG-G 269
           + Q  +++ A   IAV     K +    +GA   I+  KED      I+ +++E+TDG G
Sbjct: 165 LNQLLRMKDAHA-IAVASTYEKLETAKDYGAEFLIDSSKED------ILTRVLEITDGKG 217

Query: 270 LDFTFDCTG 278
           +D +FD  G
Sbjct: 218 VDASFDSVG 226

>CAGL0M14047g Chr13 complement(1386775..1387854) [1080 bp, 359 aa]
           {ON} highly similar to uniprot|Q04894 Saccharomyces
           cerevisiae YMR318c or uniprot|P25377 Saccharomyces
           cerevisiae YCR105w
          Length = 359

 Score = 47.4 bits (111), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 96/377 (25%), Positives = 146/377 (38%), Gaps = 51/377 (13%)

Query: 10  IKCIAAVAY-DAKKPSSVEEITVDAPKAHEVRIKIEYTAVCHTDAYTLSGSDPEGLFPCI 68
            K IA V + D K P  VE         ++V IKIE   VC +D +  +G+  +   P +
Sbjct: 6   FKGIAVVDHKDWKNPKKVE-FPAKPFYDNDVDIKIEACGVCGSDIHCAAGNWGQKQTPLV 64

Query: 69  LGHEGAGIVESVGDGVVT-VKPGDHV-IALYTAECGKCKFCTSGKTNLCSAVRATQGKGV 126
           +GHE  G V  VG    T +K GD V +      C +C+ C +     C+    T     
Sbjct: 65  VGHEIIGKVVKVGPKCKTGLKIGDRVGVGAQVFSCLECERCKNDNEPYCARFVTT----- 119

Query: 127 MPDGTTRFHNAKGKDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDASCLLGCGVTTGYG 186
                   ++   +D Y   G   ++ Y  V +   V I    P + +  L CG  T Y 
Sbjct: 120 --------YSQPYEDGYVSQG--GYANYVRVHEHFAVPIPENIPSEYAAPLLCGGLTVYS 169

Query: 187 AAVKTANVQKGDTVAVFGCGTVGLSVIQGAKLRGASKIIAVDINNNKKKYCSQFGATDFI 246
             ++      G  V + G G +G   I  AK  GA ++ A+  +N KK+   + GA  +I
Sbjct: 170 PLLRNG-CGPGKKVGILGIGGIGHMGILFAKAMGA-EVYAISRSNAKKEDSLKLGADHYI 227

Query: 247 NPKEDLAKDQTIVEKLVEMTDGGLDF--TFD-----CTGNTKIMRDALEACHKGWGQSXX 299
             KE+               D G  +  TFD      +  T +  D +    K  G+   
Sbjct: 228 ATKEE--------------PDWGTKYFDTFDLIVVCASSLTDVDFDVMPKAMKVGGRIVS 273

Query: 300 XXXXXXXXXXSTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQSGVLKVEEFITHRRP 359
                     + +PF L+ G     S  G I   +EM  L+K      +K+        P
Sbjct: 274 ISVPEQDEVLTMKPFGLI-GVSIANSILGSI---AEMKQLLKLVSENNIKI---WVETLP 326

Query: 360 FKE--INHAFEDLHNGD 374
             E  +  AFE +  GD
Sbjct: 327 VGEAGVKEAFERMDKGD 343

>Ecym_1093 Chr1 complement(195854..197005) [1152 bp, 383 aa] {ON}
           similar to Saccharomyces cerevisiae YMR318C ADH6 /
           YCR105W ADH7
          Length = 383

 Score = 47.8 bits (112), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 58/218 (26%), Positives = 93/218 (42%), Gaps = 19/218 (8%)

Query: 36  AHEVRIKIEYTAVCHTDAYTLSGSDPEGLFPCILGHEGAGIVESVGDGVVT-VKPGDHV- 93
           A ++ +K+E   VC +D +  +G       P ++GHE  G V  VG G    +K GD V 
Sbjct: 56  ARDIVLKVEACGVCGSDIHCAAGHWGPRNNPLVVGHEIIGRVIEVGSGCKEGLKVGDRVG 115

Query: 94  IALYTAECGKCKFCTSGKTNLCSAVRATQGKGVMPDGTTRFHNAKGKDIYHFMGCSTFSE 153
           +      C +C  C S     CS +  T      PDG              ++    ++ 
Sbjct: 116 VGAQALSCLECSRCESENEQYCSNMTGTYNFP-YPDG--------------YISQGGYAS 160

Query: 154 YTVVADVSVVAIDPKAPLDASCLLGCGVTTGYGAAVKTANVQKGDTVAVFGCGTVGLSVI 213
           + +V +   + I    P   +  L CG  T +   +++ NV  G +V V G G +G   +
Sbjct: 161 HVIVHEHFAIPIPDNIPSHLAAPLMCGGITAFSPLLRS-NVGPGTSVGVVGIGGIGHMAV 219

Query: 214 QGAKLRGASKIIAVDINNNKKKYCSQFGATDFINPKED 251
             AK  GA+ + A+   +NKK    + GA  +I   ED
Sbjct: 220 IFAKALGAN-VTAISRRSNKKDDALKLGADVYIAAVED 256

>KLTH0C07854g Chr3 (673945..675021) [1077 bp, 358 aa] {ON} similar
           to uniprot|P38230 Saccharomyces cerevisiae YBR046C ZTA1
           Zeta-crystallin homolog
          Length = 358

 Score = 47.4 bits (111), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 70/354 (19%), Positives = 124/354 (35%), Gaps = 86/354 (24%)

Query: 37  HEVRIKIEYTAVCHTDAYTLSGSDPEGLFPCILGHEGAGIVESVGDGVVTVKPGDHVIAL 96
           +E+ IK +Y  + + ++Y   G  P    P +LG E +G+V + GD V      D V   
Sbjct: 59  NEILIKNKYAGINYIESYFRKGIYPSKK-PYVLGREASGVVVAKGDAVTKFDVNDKV--- 114

Query: 97  YTAECGKCKFCTSGKTNLCSAVRATQGKGVMPDGTTRFHNAKGKDIYHFMGCSTFSEYTV 156
                                                           ++  +TF++YT 
Sbjct: 115 -----------------------------------------------AYLSSNTFAQYTK 127

Query: 157 VADVSVVAIDPKAPLDASCLLGCG----VTTGYGAAVKTANVQKGDTVAVFGCGTVGLSV 212
           +++   V+  P+   D    L  G      T      +   V+KGD + ++         
Sbjct: 128 ISEAGTVSKVPQDSTDEQLKLYAGSLVQALTSLAFVREAYPVKKGDYILLYAAAGGAGLA 187

Query: 213 IQGAKLRGASKIIAVDINNNKKKYCSQFGATDFINPKEDLAKDQTIVEKLVEMTDG-GLD 271
                 +  +  IAV   + K +   ++GA   IN  +D      ++ +++E+T+G G++
Sbjct: 188 FNQFLKKAGAHTIAVASTDEKLQLAKEYGAEFLINSSKD-----DVLARVLEITNGQGVE 242

Query: 272 FTFDCTGNTKIMRDALEACHKG---------WGQSXXXXXXXXXXXXSTRPFQLVTGRVW 322
             FD  G     +D  E   K          +G +            + +  +L+     
Sbjct: 243 AAFDSVG-----KDTFETSLKALKRKGTLVSFGNASGPVPPVAINILTPKNIKLL----- 292

Query: 323 KGSAFGGIKGRSEM----GGLIKDYQSGVLKVEEFITHRRPFKEINHAFEDLHN 372
           + S FG I    E       L     SG LK+   I+   P +E N A E L +
Sbjct: 293 RPSLFGYIATHEEWESYSSELFDLLHSGALKI--LISKTYPLEEYNQAAEQLES 344

>NDAI0H02940 Chr8 complement(717073..718158) [1086 bp, 361 aa] {ON} 
          Length = 361

 Score = 47.0 bits (110), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 66/238 (27%), Positives = 97/238 (40%), Gaps = 26/238 (10%)

Query: 19  DAKKPSSVEEITVDAPKA---HEVRIKIEYTAVCHTDAYTLSGSDPEGLFPCILGHEGAG 75
           D K P  VE      PK     +V IKIE   VC +D +  SG   +   P I+GHE  G
Sbjct: 18  DWKNPQRVEF----PPKPFHDRDVDIKIECCGVCGSDIHAASGHWGDIEKPLIVGHEIIG 73

Query: 76  IVESVGDGVVT-VKPGDHV-IALYTAECGKCKFCTSGKTNLCSAVRATQGKGVMPDGTTR 133
            V  +G      +K GD V +      C KC  C +   + C     T G    PDG   
Sbjct: 74  TVVKLGSKCENGLKLGDRVGMGAQCYSCLKCDRCLNNNESYCQHFVTTYGMN-YPDG--- 129

Query: 134 FHNAKGKDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDASCLLGCGVTTGYGAAVKTAN 193
            + +KG           ++E+  V +  V+ I    P   +  L CG  T +    +   
Sbjct: 130 -YASKG----------GYAEFVRVHEHFVIPIPENIPSHLAAPLMCGGNTIFSPLTRNG- 177

Query: 194 VQKGDTVAVFGCGTVGLSVIQGAKLRGASKIIAVDINNNKKKYCSQFGATDFINPKED 251
              G  V + G G +G   +  A   GA ++ A+   + K++   + GA  FI  KE+
Sbjct: 178 CGPGKKVGIMGIGGIGHMGLIFANALGA-EVYAISRTSKKREDAKKLGAHHFIATKEE 234

>SAKL0D14938g Chr4 complement(1235542..1236678) [1137 bp, 378 aa]
           {ON} similar to uniprot|Q04894 Saccharomyces cerevisiae
           YMR318C ADH6 NADPH-dependent cinnamyl alcohol
           dehydrogenase family member with broad substrate
           specificity may be involved in fusel alcohol synthesis
           or in aldehyde tolerance
          Length = 378

 Score = 47.0 bits (110), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 73/321 (22%), Positives = 117/321 (36%), Gaps = 48/321 (14%)

Query: 38  EVRIKIEYTAVCHTDAYTLSGSDPEGLFPC----------ILGHEGAGIVESVGDGVVTV 87
           +V I+IE   +C ++ + L  +  +    C          ++GHE  G V +VG+ V   
Sbjct: 39  DVDIEIECCGICGSELHALQNNWSDEPLACLSAKIGPKSQVVGHEIVGHVVNVGNKVTKF 98

Query: 88  KPGDHV-IALYTAECGKCKFCTSGKTNLCSAVRATQGKGVMPDGTTRFHNAKGKDIYHFM 146
             G+ V +      C KC  C +G    C+    T      PDG              ++
Sbjct: 99  HKGERVAMGAQCGSCMKCNRCINGYEQFCTGCIETYCSE-YPDG--------------YV 143

Query: 147 GCSTFSEYTVVADVSVVAIDPKAPLDASCLLGCGVTTGYGAAVKTAN--VQKGDTVAVFG 204
               ++ +    +  +V + P+        L CG  T Y    +       K   VA+ G
Sbjct: 144 SQGGYASHVRAHEHYIVHVPPQLDSKHVAPLQCGGLTVYSPIKRALKDVTDKKPRVAIIG 203

Query: 205 CGTVGLSVIQGAKLRGASKIIAVDINNNKKKYCSQFGATDFINPKEDLAKDQTIVEKLVE 264
            G +G   I  +K     ++ A+  +++KK+   + GA  F+N  E   KD         
Sbjct: 204 IGGLGHMAIMISKALDC-EVWALSTSDSKKEDAKKMGADHFVNTTE---KD--------- 250

Query: 265 MTDGGLDFTF----DCT-GNTKIMRDALEACHKGWGQSXXXXXXXXXXXXSTRPFQLVT- 318
              GGL  TF     CT   TK+  ++L       G+                P QL   
Sbjct: 251 -VWGGLQDTFHLILSCTISYTKLPFESLLGTLVATGKFISVGLPSKDQPLEIHPMQLAAH 309

Query: 319 GRVWKGSAFGGIKGRSEMGGL 339
           G  +  S  G IK   E+  L
Sbjct: 310 GVSFSASHLGSIKELEELLAL 330

>NDAI0A08470 Chr1 (1954035..1955126) [1092 bp, 363 aa] {ON} 
          Length = 363

 Score = 47.0 bits (110), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 95/389 (24%), Positives = 149/389 (38%), Gaps = 57/389 (14%)

Query: 1   MSAATVGKPIKCIAAVAY-DAKKPSSVEEITVDAPKA---HEVRIKIEYTAVCHTDAYTL 56
           M+++T     + IA + + D K P  VE      PK    +++ IKIE   VC +D +  
Sbjct: 1   MTSSTSPAKFQGIAVLDHKDWKNPKKVEF----EPKPFYPNDIDIKIECCGVCGSDIHAA 56

Query: 57  SGSDPEGLFPCILGHEGAGIVESVGDGVVT-VKPGDHV-IALYTAECGKCKFCTSGKTNL 114
           +G   +   P ++GHE  G V  +G+   + +K GD V +      C  C+ C S     
Sbjct: 57  AGHWGDLEKPLVVGHEVIGTVVRLGENCNSGLKLGDRVGVGAQVFSCLDCERCKSNNEPY 116

Query: 115 CSAVRATQGKGVMPDGTTRFHNAKGKDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDAS 174
           C +   T G+               KD Y   G   +++Y  V +   V I    P   +
Sbjct: 117 CPSFVTTYGQSY-------------KDGYSSKG--GYADYIRVHEHFAVPIPENIPSHLA 161

Query: 175 CLLGCGVTTGYGAAVKTANVQKGDTVAVFGCGTVGLSVIQGAKLRGASKIIAVDINNNKK 234
             L CG  T +   ++           V   G   + +I  AK  GA ++ A+   + KK
Sbjct: 162 APLMCGGITVFSPLLRNGCGPGKKVGIVGIGGIGHMGLIF-AKAMGA-EVYAISRTSAKK 219

Query: 235 KYCSQFGATDFINPKEDLAKDQTIVEKLVEMTDGGLDF--TFD----CTGN-TKIMRDAL 287
           +   + GA  FI  KE+               D G  +  TFD    C  + T +  + +
Sbjct: 220 EDAMKLGADHFIATKEE--------------PDWGTKYFDTFDLIVVCANSLTDVDFNVV 265

Query: 288 EACHKGWGQSXXXXXXXXXXXXSTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQSGV 347
               K  G              + +PF L+ G     SA GG+K   E+  L+       
Sbjct: 266 PKAMKVGGNIVSICVPEQNEVLNLKPFGLL-GVSISNSALGGVKEIKELLDLVSKNN--- 321

Query: 348 LKVEEFITHRRPFKE--INHAFEDLHNGD 374
           LK+        P  E  +  AFE +  GD
Sbjct: 322 LKI---WVETLPIGEEGVKQAFERMDKGD 347

>KLTH0B04972g Chr2 (408153..409235) [1083 bp, 360 aa] {ON} highly
           similar to uniprot|Q04894 Saccharomyces cerevisiae
           YMR318C ADH6 NADPH-dependent cinnamyl alcohol
           dehydrogenase family member with broad substrate
           specificity may be involved in fusel alcohol synthesis
           or in aldehyde tolerance
          Length = 360

 Score = 45.4 bits (106), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 77/311 (24%), Positives = 122/311 (39%), Gaps = 33/311 (10%)

Query: 37  HEVRIKIEYTAVCHTDAYTLSGSDPEGLFPCILGHEGAGIVESVGDGVVT-VKPGDHV-I 94
           ++V ++IE   +C +D +  SG+      P ++GHE  G V  VG    T VK GD V +
Sbjct: 34  YDVDVEIEACGICGSDTHCASGNWGPKSLPLVVGHEVIGRVVRVGPKCHTGVKVGDRVGV 93

Query: 95  ALYTAECGKCKFCTSGKTNLCSAVRATQGKGVMPDGTTRFHNAKGKDIYHFMGCSTFSEY 154
               + C  C  C S     C+    T  +   PDG    + ++G    H      F   
Sbjct: 94  GAQVSSCLDCDRCNSDFEPYCAEFITTYSQP-YPDG----YVSQGGYASHIRAHEHF--- 145

Query: 155 TVVADVSVVAIDPKAPLDASCLLGCGVTTGYGAAVKT--ANVQKGDTVAVFGCGTVGLSV 212
                  V+ I  K P   +  L CG  T +   +       +K   V + G G +GL  
Sbjct: 146 -------VIPIPEKIPTHLAAPLLCGGITVFSPLINNDCGPNKKVGIVGIGGIGHMGLIF 198

Query: 213 IQGAKLRGASKIIAVDINNNKKKYCSQFGATDFINPKEDLAKDQTIVEKLVEMTDGGLDF 272
              AK  GA ++ A+  ++ KK+   + GA  FI  KE+   ++             LD 
Sbjct: 199 ---AKALGA-EVYAISRSSAKKEDAMKLGADHFIATKEEPDWEKKYA--------STLDL 246

Query: 273 TFDCTGN-TKIMRDALEACHKGWGQSXXXXXXXXXXXXSTRPFQLVTGRVWKGSAFGGIK 331
              C  + T+I  + L    +  G+             + +PFQL +G     S  G  K
Sbjct: 247 VIVCASSLTEINLEQLIKTMRIKGRIISICVPKETEELNLKPFQL-SGITIGNSQLGSRK 305

Query: 332 GRSEMGGLIKD 342
              ++  L+ D
Sbjct: 306 ELIQLLQLVAD 316

>KLLA0E19889g Chr5 (1770061..1771161) [1101 bp, 366 aa] {ON} similar
           to uniprot|Q04894 Saccharomyces cerevisiae YMR318C ADH6
           NADPH-dependent cinnamyl alcohol dehydrogenase family
           member with broad substrate specificity may be involved
           in fusel alcohol synthesis or in aldehyde tolerance
          Length = 366

 Score = 43.9 bits (102), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 57/241 (23%), Positives = 96/241 (39%), Gaps = 20/241 (8%)

Query: 15  AVAYDAKKPSSVEEITVDAPK--AHEVRIKIEYTAVCHTDAYTLSGSDPEGLFPCILGHE 72
           AV    KK  S E++   A +    +V I+IE   VC +D +   G+  E   P ++GHE
Sbjct: 11  AVVDSHKKWLSPEKVVYPAKQFNPRDVDIEIEACGVCGSDVHCAKGNWGEMKLPLVVGHE 70

Query: 73  GAGIVESVGDGVVT-VKPGDHV-IALYTAECGKCKFCTSGKTNLCSAVRATQGKGVMPDG 130
             G V  +GD   T +K GD V +    + C  C  C +     C     T  +    DG
Sbjct: 71  IIGKVVRLGDKCDTGLKVGDRVGVGAQVSACLDCNRCNNDNEQYCPKFVTTYSQPYFEDG 130

Query: 131 TTRFHNAKGKDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDASCLLGCGVTTGYGAAVK 190
                         ++G   ++ +  V +  V+ I      +    L CG  T Y    +
Sbjct: 131 --------------YVGQGGYASHIRVHEHFVIPIPESLETNNVAPLLCGGATVYSPLKR 176

Query: 191 TANVQKGDTVAVFGCGTVGLSVIQGAKLRGASKIIAVDINNNKKKYCSQFGATDFINPKE 250
                      V   G   + ++  AK  GA ++ A+  ++ K++   Q GA  +I  ++
Sbjct: 177 NGCGPGKKVGIVGIGGIGHMGILL-AKAMGA-EVYAISRSHAKEETSKQLGADHYIATED 234

Query: 251 D 251
           +
Sbjct: 235 E 235

>CAGL0H06853g Chr8 complement(680184..681266) [1083 bp, 360 aa] {ON}
           highly similar to uniprot|Q04894 Saccharomyces
           cerevisiae YMR318c
          Length = 360

 Score = 43.5 bits (101), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 86/382 (22%), Positives = 137/382 (35%), Gaps = 58/382 (15%)

Query: 19  DAKKPSSVEEITVDAPKAHEVRIKIEYTAVCHTDAYTLSGSDPEGLFPCILGHEGAGIVE 78
           D K P  VE         H++ IKI+   VC +D +  +G+  +   P ++GHE  G V 
Sbjct: 17  DWKNPKKVE-FPAKPFYDHDIDIKIDACGVCGSDIHCAAGNWGKKQTPLVVGHEIIGKVV 75

Query: 79  SVGDGVVT-VKPGDHV-IALYTAECGKCKFCTSGKTNLCSAVRATQGKGVMPDGTTRFHN 136
            +G    T +K GD V +      C +C  C +     C     T  +    DG      
Sbjct: 76  KIGPKCNTGLKVGDRVGVGAQVFSCLECDRCKNDNEPYCPKFVTTYSQP-YEDG------ 128

Query: 137 AKGKDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDASCLLGCGVTTGYGAAVKTANVQK 196
                   ++    ++ Y  V +   V I    P   +  L CG  T Y   ++      
Sbjct: 129 --------YVSQGGYANYVRVHEHFAVKIPENIPDHLAAPLLCGGITVYSPLLRN----- 175

Query: 197 GDTVAVFGCGTVGLSV-----------IQGAKLRGASKIIAVDINNNKKKYCSQFGATDF 245
                  GCG                 +  AK  GA ++ A+  +N KK+   + GA  +
Sbjct: 176 -------GCGPGKKVGIVGIGGIGHMGLLFAKAMGA-EVYAISRSNAKKEDSLKLGADHY 227

Query: 246 INPKEDLAKDQTIVEKLVEMTDGGLDFTFDCTGN-TKIMRDALEACHKGWGQSXXXXXXX 304
           I  KE+    +   +          D    C  + T +  D +    K  G+        
Sbjct: 228 IATKEEPNWGEKYFDT--------FDLIVVCASSLTDVDFDVMPKAMKVGGRIVSISIPD 279

Query: 305 XXXXXSTRPFQLVTGRVWKGSAFGGIKGRSEMGGLIKDYQSGVLKVEEFITHRRPFKEIN 364
                + +PF L+ G     SA G IK   ++  L+ +    +  VE         KE  
Sbjct: 280 EDQTLTMKPFGLL-GVSIANSALGSIKEIEQLLKLVSEKDIKIW-VETLPVGEAGVKE-- 335

Query: 365 HAFEDLHNGDCLR--TVLKFDE 384
            AFE +  GD     T++ FD+
Sbjct: 336 -AFERMDKGDVKYRFTLVDFDK 356

>TDEL0A00140 Chr1 (23016..24233) [1218 bp, 405 aa] {ON} 
          Length = 405

 Score = 43.1 bits (100), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 70/285 (24%), Positives = 107/285 (37%), Gaps = 73/285 (25%)

Query: 35  KAHEVRIKIEYTAVCHTDAYTLSGSDPEGLFPCILGHEGAGIVESVGDGVVTVKPGDHVI 94
           K +E+ ++ +Y  + H D  +         FP I G E +GIV   G  V T        
Sbjct: 71  KEYEILVQNKYVGLNHVDWKSKKYRFNIYSFPWINGRESSGIVIRRGSKVDT-------- 122

Query: 95  ALYTAECGKCKFCTSGKTNLCSAVRATQGKGVMPDGTTRFHNAKGKDIYHFMGCSTFSEY 154
                     KF  S +  L S                          Y  +  STF EY
Sbjct: 123 ---------QKFPISAEVFLASTS------------------------YRDLETSTFQEY 149

Query: 155 TVVADVSVVAIDPKAPLDASCL-----------LGCGVTTGYGAAVKT---------ANV 194
           TV  D  +V   P+  L    L           +G G+ T  G+A+ +         A+ 
Sbjct: 150 TVF-DSRLVWKLPQYRLPNGRLHKRFDLEFAAGVGVGLVTA-GSAISSLVDLSLRDQADH 207

Query: 195 QK-GDTVAVFGCGTVGLSVIQGAKLRGASKIIAVDINNNKKKYCSQFGATDFINPKEDLA 253
           QK G+ V   G  +VGL VIQ AK     + I V   +  K+Y  + GA+  I+  +   
Sbjct: 208 QKLGNIVIWGGSSSVGLYVIQLAKASKMFEKIVVVSASKHKEYLLELGASCIIDRHQS-- 265

Query: 254 KDQTIVEKLVEMTDGGLDFTFDCTGN------TKIMRDALEACHK 292
            ++ I++ ++     G+DF  D          TKI+++  E   K
Sbjct: 266 -EEEILDDILSHCPEGIDFGIDVISKETATLLTKILQNNNENVKK 309

>Suva_13.513 Chr13 complement(894394..895476) [1083 bp, 360 aa] {ON}
           YMR318C (REAL)
          Length = 360

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 40/157 (25%), Positives = 64/157 (40%), Gaps = 17/157 (10%)

Query: 37  HEVRIKIEYTAVCHTDAYTLSGSDPEGLFPCILGHEGAGIVESVGDGVVT-VKPGDHV-I 94
           H+V IKIE   VC +D +  +G+  +   P ++GHE  G V  +G    + ++ G  V +
Sbjct: 34  HDVDIKIEACGVCGSDIHCAAGNWGKKKMPLVVGHEIVGTVVKLGSKSNSGLQVGQRVGM 93

Query: 95  ALYTAECGKCKFCTSGKTNLCSAVRATQGKGVMPDGTTRFHNAKGKDIYHFMGCSTFSEY 154
                 C +C  C S     C+    T G+    DG              ++    +++Y
Sbjct: 94  GAQVFSCLECDRCKSDNEPYCTKFVTTYGQP-YEDG--------------YVSQGGYADY 138

Query: 155 TVVADVSVVAIDPKAPLDASCLLGCGVTTGYGAAVKT 191
             V +  VV I    P   +  L CG  T Y   V+ 
Sbjct: 139 VRVHEHFVVPIPENIPSHLAAPLLCGGLTAYSPLVRN 175

>KNAG0K02680 Chr11 complement(531173..532252) [1080 bp, 359 aa] {ON}
           
          Length = 359

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 57/228 (25%), Positives = 92/228 (40%), Gaps = 19/228 (8%)

Query: 37  HEVRIKIEYTAVCHTDAYTLSGSDPEGLFPCILGHEGAGIVESVGDGVVT-VKPGDHV-I 94
           H++ IKIE   VC +D +  SG+  +   P ++GHE  G +  +G    +  K GD V +
Sbjct: 34  HDIDIKIEACGVCGSDVHCASGNWGDTPKPLVVGHEIIGTIVKMGPKCNSGYKIGDRVGM 93

Query: 95  ALYTAECGKCKFCTSGKTNLCSAVRATQGKGVMPDGTTRFHNAKGKDIYHFMGCSTFSEY 154
                 C +C  C +     C+ V  T         ++R                 ++ Y
Sbjct: 94  GAQAMSCLECDRCINDNEPYCAKVVCTYANPYEDGYSSR---------------GGYANY 138

Query: 155 TVVADVSVVAIDPKAPLDASCLLGCGVTTGYGAAVKTANVQKGDTVAVFGCGTVGLSVIQ 214
             V +   V I    P   +  L CG  T + + +K      G  V + G G +G   I 
Sbjct: 139 VRVHEHFAVPIPESIPSHLAAPLMCGGLTVF-SPLKRNGCGPGKKVGIIGIGGIGHMGII 197

Query: 215 GAKLRGASKIIAVDINNNKKKYCSQFGATDFINPKEDLAKDQTIVEKL 262
            AK  GA ++ A+   + K+    + GA  FI  KE+    +   +KL
Sbjct: 198 LAKAMGA-EVYAISRTSKKRDDAMKLGADHFIAIKEEPDWHKEYFDKL 244

>ZYRO0A03366g Chr1 (271779..272828) [1050 bp, 349 aa] {ON} highly
           similar to uniprot|P38230 Saccharomyces cerevisiae
           YBR046C ZTA1 Zeta-crystallin homolog
          Length = 349

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 62/251 (24%), Positives = 94/251 (37%), Gaps = 69/251 (27%)

Query: 37  HEVRIKIEYTAVCHTDAYTLSGSDPEGLFPCILGHEGAGIVESVGDGVVTVKPGDHVIAL 96
           +E+ +K +Y+ +   ++Y   G  P    P ILG E +G V + G+ V     GD V   
Sbjct: 52  NELLVKNKYSGINFIESYFRKGIYPSEK-PLILGRESSGTVVAKGNSVKDFDIGDKV--- 107

Query: 97  YTAECGKCKFCTSGKTNLCSAVRATQGKGVMPDGTTRFHNAKGKDIYHFMGCSTFSEYTV 156
                                                           ++  S F++YT 
Sbjct: 108 -----------------------------------------------AYLSGSAFAQYTK 120

Query: 157 VADVSVVAIDPKAPLDASC-LLGCGVTTGYGAAV---KTANVQKGDTVAVF-GCGTVGLS 211
           V     V   PK   D +  L   G+     A     +  NV+KGD +  +   G VGL 
Sbjct: 121 VDAAGKVVKLPKDANDETLKLYAAGLLQSLTALTFIDEAYNVKKGDFILNYAAAGGVGLI 180

Query: 212 VIQGAKLRGASKIIAVDINNN---KKKYCSQFGATDFINPKEDLAKDQTIVEKLVEMTDG 268
           + Q  K RGA  I  V         KK+ +++G    I+ KED      IV ++ E+T+ 
Sbjct: 181 LDQLLKERGAHTIAVVSTEEKLELAKKHGAEYG---IISSKED------IVTRVKEITNN 231

Query: 269 -GLDFTFDCTG 278
            G+D  FD  G
Sbjct: 232 QGVDAAFDSIG 242

>ABL090W Chr2 (230699..231703) [1005 bp, 334 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YBR046C (ZTA1)
          Length = 334

 Score = 41.2 bits (95), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 69/266 (25%), Positives = 99/266 (37%), Gaps = 79/266 (29%)

Query: 27  EEITVDAPKAHEVRIKIEYTAVCHTDAYTLSGSDPEGLFPC----ILGHEGAGIVESVGD 82
           E+  V   +  ++ IK  Y  V   + Y  +G     L+PC    +LG E  G+V ++G 
Sbjct: 26  EDYPVPEVRGSDILIKNRYAGVNFIETYFRTG-----LYPCEKPYVLGREAVGVVAAIGA 80

Query: 83  GVVTVKPGDHVIALYTAECGKCKFCTSGKTNLCSAVRATQGKGVMPDGTTRFHNAKGKDI 142
            V   K GD V  L           +SG                                
Sbjct: 81  DVRRFKVGDRVACL-----------SSG-------------------------------- 97

Query: 143 YHFMGCSTFSEYTVVADVSVVAIDPKAPLD-------ASCLLGCGVTTGYGAAVKTANVQ 195
                  TF++YT V++ S V   P    D        S + G    T    A K    Q
Sbjct: 98  -------TFAQYTAVSEKSNVLKLPDDIQDGELQAVAGSLVNGLTALTLVDEAYKP---Q 147

Query: 196 KGDTVAVF-GCGTVGLSVIQGAKLRGASKIIAVDINNNKKKYCSQFGATDFIN-PKEDLA 253
            G+ V V+   G VG  +IQ    R   ++IAV   + K +     GA   IN  +ED  
Sbjct: 148 VGEIVLVYAAAGGVGQLLIQLLHARSV-RVIAVASTDEKLQIAKSRGAEFLINSSRED-- 204

Query: 254 KDQTIVEKLVEMTDG-GLDFTFDCTG 278
               IV K++E TDG G+  ++D  G
Sbjct: 205 ----IVAKVLEFTDGEGVGASYDSVG 226

>Smik_13.535 Chr13 complement(893727..894809) [1083 bp, 360 aa] {ON}
           YMR318C (REAL)
          Length = 360

 Score = 41.2 bits (95), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 40/157 (25%), Positives = 61/157 (38%), Gaps = 17/157 (10%)

Query: 37  HEVRIKIEYTAVCHTDAYTLSGSDPEGLFPCILGHEGAGIVESVGDGVVT-VKPGDHV-I 94
           H+V IKIE   VC +D +  +G       P ++GHE  G V  +GD   + +K G  V +
Sbjct: 34  HDVDIKIEACGVCGSDVHCAAGHWGNMKMPLVVGHEIVGKVVRLGDKSNSGLKVGQRVGV 93

Query: 95  ALYTAECGKCKFCTSGKTNLCSAVRATQGKGVMPDGTTRFHNAKGKDIYHFMGCSTFSEY 154
                 C +C  C S     C+    T  +    DG              ++    ++ Y
Sbjct: 94  GAQVFSCLECDRCKSDNEPYCTKFVTTYSQP-YEDG--------------YISQGGYANY 138

Query: 155 TVVADVSVVAIDPKAPLDASCLLGCGVTTGYGAAVKT 191
             V +  +V I    P   +  L CG  T Y   V+ 
Sbjct: 139 VRVHEHFIVPIPENVPSHLAAPLLCGGLTVYSPLVRN 175

>Kwal_26.9050 s26 (1055019..1056113) [1095 bp, 364 aa] {ON} YCR105W
           - Hypothetical ORF [contig 68] FULL
          Length = 364

 Score = 40.4 bits (93), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 32/110 (29%), Positives = 51/110 (46%), Gaps = 9/110 (8%)

Query: 12  CIAAVAYDA-KKPSSVEEITVDAPK--AHEVRIKIEYTAVCHTDAYTLSGSDPEGLFPCI 68
            I  V +D  KKP   E+ +   P     ++ ++IE   VC +D + ++G       P  
Sbjct: 9   AIGVVDFDQWKKP---EKFSYSPPLLGPEDIELEIEACGVCGSDIHAVAGDWGRLYKPFA 65

Query: 69  LGHEGAGIVESVGDGVVTVK--PGDHV-IALYTAECGKCKFCTSGKTNLC 115
           +GHE  G + ++G+ V   K   GD V +      CGKC  C+ G+   C
Sbjct: 66  VGHEIVGKISAMGEQVNKEKFHLGDRVGVGAQIDSCGKCTRCSRGRQQNC 115

>KLTH0B00506g Chr2 complement(53662..54858) [1197 bp, 398 aa] {ON}
           weakly similar to uniprot|P53912 Saccharomyces
           cerevisiae YNL134C
          Length = 398

 Score = 40.4 bits (93), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 66/280 (23%), Positives = 98/280 (35%), Gaps = 70/280 (25%)

Query: 37  HEVRIKIEYTAVCHTDAYTLSGSDPEGLFPCILGHEGAGIVESVGDGVVTVKPGDHVIAL 96
           HE+ I+ +YT + H D  +         FP I G E +GIV   G               
Sbjct: 72  HEILIRNKYTGLNHVDWKSKKYRFNIHSFPWINGRESSGIVVRRG--------------- 116

Query: 97  YTAECGKCKFCTSGKTNLCSAVRATQGKGVMPDGTTRFHNAKGKDIYHFMGCSTFSEYTV 156
             A+  + +F    +  L S                          Y  +  STF E+TV
Sbjct: 117 --AKVDRDRFPIGAEVFLASTC------------------------YRELKTSTFQEFTV 150

Query: 157 VADVSVVAIDPKAPLD---ASCLLGCGVTTGYGAAVKTA--------------NVQKGDT 199
             D  +V   P+  L         G     G G  + TA                 +G +
Sbjct: 151 F-DSRLVWRLPREILPDGTTRKRFGLDFAAGVGVPLVTAGSALSSFVDFNEIGKADQGRS 209

Query: 200 VAVFG-CGTVGLSVIQGAKLRGASKIIAVDINNNKKKYCSQFGATDFIN---PKEDLAKD 255
           + V+G   +VG+  IQ A+  G  K I    +   + Y  + GAT  I+   P E+L   
Sbjct: 210 LVVWGGSSSVGIFTIQLARNLGIFKNIIAVSSLRYEDYLKELGATAVIDRTLPSEEL--- 266

Query: 256 QTIVEKLVEMTDGGLDFTFDCTGNTKIMRDALEACHKGWG 295
              V+K  E+   G+D+  D   + K     LE    G G
Sbjct: 267 ---VQKFQELCPTGVDYGVDVI-SKKTAELVLEILKDGKG 302

>Kpol_526.18 s526 (51360..52445) [1086 bp, 361 aa] {ON}
           (51360..52445) [1086 nt, 362 aa]
          Length = 361

 Score = 40.4 bits (93), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 53/216 (24%), Positives = 85/216 (39%), Gaps = 19/216 (8%)

Query: 38  EVRIKIEYTAVCHTDAYTLSGSDPEGLFPCILGHEGAGIVESVGDGVVT-VKPGDHV-IA 95
           +V I+IE   VC +D +  SG   E     ++GHE  G V  +G    T +K GD V + 
Sbjct: 35  DVDIEIEACGVCGSDIHCASGDWGERRDKLVVGHEVIGRVIKLGPECHTGLKIGDRVGVG 94

Query: 96  LYTAECGKCKFCTSGKTNLCSAVRATQGKGVMPDGTTRFHNAKGKDIYHFMGCSTFSEYT 155
              A C  C+ C       C     T  +   PDG              ++    ++ + 
Sbjct: 95  AQVASCLDCERCEHDNEPYCPKFVTTYNQA-YPDG--------------YISQGGYASHI 139

Query: 156 VVADVSVVAIDPKAPLDASCLLGCGVTTGYGAAVKTANVQKGDTVAVFGCGTVGLSVIQG 215
            V +  V+ +  K P   +  L CG  T Y   V+           V   G   + ++  
Sbjct: 140 RVHEHFVIPVPEKIPTHLAAPLLCGGITVYSPLVRGGCAPGKKVGIVGIGGIGHMGIL-F 198

Query: 216 AKLRGASKIIAVDINNNKKKYCSQFGATDFINPKED 251
           AK  GA ++ A   + NK++   + GA  +I   E+
Sbjct: 199 AKAMGA-EVYAFSRHENKREDSMKLGADHYIATLEE 233

>CAGL0H09944g Chr8 complement(971519..972520) [1002 bp, 333 aa] {ON}
           similar to uniprot|P38230 Saccharomyces cerevisiae
           YBR046c ZTA1
          Length = 333

 Score = 40.0 bits (92), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 67/275 (24%), Positives = 99/275 (36%), Gaps = 67/275 (24%)

Query: 27  EEITVDAPKAHEVRIKIEYTAVCHTDAYTLSGSDPEGLFPCILGHEGAGIVESVGDGVVT 86
           ++  V +  + +V +K +Y  V   +AY   G  P  L P +LG E +G V  VG  V  
Sbjct: 25  QDFAVPSIGSTDVLVKNKYAGVNFIEAYFRKGYYPCEL-PYVLGREASGEVVQVGSEVKD 83

Query: 87  VKPGDHVIALYTAECGKCKFCTSGKTNLCSAVRATQGKGVMPDGTTRFHNAKGKDIYHFM 146
            K GD V                                                   ++
Sbjct: 84  FKIGDKV--------------------------------------------------AYL 93

Query: 147 GCSTFSEYTV------VADVSVVAIDPKAPLDASCLLGCGVTTGYGAAVKTANVQKGDTV 200
           G STF++YT       + ++     D    L  S L+ C   T      +   V +GD +
Sbjct: 94  GGSTFAQYTKKSTENHIMNLGQSCPDEDLKLYGSSLVQC--LTAISFIDEAYKVMEGDYI 151

Query: 201 AVFGC-GTVGLSVIQGAKLRGASKIIAVDINNNKKKYCSQFGATDFINPKEDLAKDQTIV 259
            V+   G VG  + Q    R A  +IAV  +  K     + GA   IN  ED      I+
Sbjct: 152 LVYAASGGVGSILCQLISQRKA-HVIAVASSAEKLAMAKENGAEFLINYAED-----DIL 205

Query: 260 EKLVEMTDG-GLDFTFDCTGNTKIMRDALEACHKG 293
           EK+++ T+G G+   FD  G      D      KG
Sbjct: 206 EKVMQYTNGKGVHAAFDSIGKDTFETDLAALRRKG 240

>SAKL0C00264g Chr3 complement(17429..18508) [1080 bp, 359 aa] {ON}
           highly similar to uniprot|Q04894 Saccharomyces
           cerevisiae YMR318C ADH6 NADPH-dependent cinnamyl alcohol
           dehydrogenase family member with broad substrate
           specificity may be involved in fusel alcohol synthesis
           or in aldehyde tolerance
          Length = 359

 Score = 39.3 bits (90), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 61/238 (25%), Positives = 93/238 (39%), Gaps = 26/238 (10%)

Query: 19  DAKKPSSVEEITVDAPKA---HEVRIKIEYTAVCHTDAYTLSGSDPEGLFPCILGHEGAG 75
           D K P  +E      PK    ++V I+I+   VC +D +  +G   +   P ++GHE  G
Sbjct: 17  DWKDPKKIEY----DPKPFYDNDVDIEIDACGVCGSDVHCAAGHWGDTQKPLVVGHEVIG 72

Query: 76  IVESVGDGVVT-VKPGDHV-IALYTAECGKCKFCTSGKTNLCSAVRATQGKGVMPDGTTR 133
            V  VG    T VK GD V +      C KC  C S     C     T  +    DG   
Sbjct: 73  RVVRVGPKCHTGVKIGDRVGVGAQVYSCLKCDRCKSDNEPYCPKFVTTYSQP-YEDG--- 128

Query: 134 FHNAKGKDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDASCLLGCGVTTGYGAAVKTAN 193
                      ++    ++ +    +  V+ I    P   +  L CG  T Y    +   
Sbjct: 129 -----------YVSQGGYASHIRCHEHFVIPIPENIPTHLAAPLLCGGITVYSPLSRNGC 177

Query: 194 VQKGDTVAVFGCGTVGLSVIQGAKLRGASKIIAVDINNNKKKYCSQFGATDFINPKED 251
                   V   G   + +I  AK  GA ++ A+  ++ KK+  S+ GA  FI  KE+
Sbjct: 178 GPGKKVGIVGIGGIGHMGLI-FAKAMGA-EVYAISRSSAKKEDASKLGADHFIATKEE 233

>TDEL0E00230 Chr5 (36310..37398) [1089 bp, 362 aa] {ON}   Added 3N
           and 2N to fix a STOP codon and a frameshift that cannot
           be fixed with the contigs.
          Length = 362

 Score = 38.9 bits (89), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 34/111 (30%), Positives = 50/111 (45%), Gaps = 7/111 (6%)

Query: 19  DAKKPSSVEEITVDAPKAHEVRIKIEYTAVCHTDAYTLSGSDPEGLFPC---ILGHEGAG 75
           D K P  +E         ++V ++IE   VC +D +  SG D  G +PC   ++GHE  G
Sbjct: 17  DWKHPKKIEFAPKPFXXDYDVDVQIEACGVCGSDVHRASG-DWMG-YPCQXLVVGHEIIG 74

Query: 76  IVESVGDGVVT-VKPGDHV-IALYTAECGKCKFCTSGKTNLCSAVRATQGK 124
            +  +G    + VK GD V I      C  C+ C +G    CS    T  +
Sbjct: 75  RIVKLGPKYHSGVKIGDRVGIGAQVFSCLNCRRCNNGDEPYCSKFVTTYSQ 125

>KNAG0B06990 Chr2 (1393058..1394134) [1077 bp, 358 aa] {ON} 
          Length = 358

 Score = 38.9 bits (89), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 81/343 (23%), Positives = 125/343 (36%), Gaps = 37/343 (10%)

Query: 37  HEVRIKIEYTAVCHTDAYTLSGSDPEGLFPCILGHEGAGIVESVGDGVVT-VKPGDHV-I 94
           H++ I++    VC +D +  SG   E   P ++GHE  GIV   G    + +K  D V +
Sbjct: 34  HDIDIRVLACGVCGSDIHCASGHWGEIPKPLVVGHEIIGIVVKTGPRCDSGLKVEDRVGV 93

Query: 95  ALYTAECGKCKFCTSGKTNLCSAVRATQGKGVMPDGTTRFHNAKGKDIYHFMGCSTFSEY 154
                 C  C  CT      C    +T  K    DG              ++    +++Y
Sbjct: 94  GAQALSCLDCDRCTHDNEPYCPNRVSTYAKSYR-DG--------------YVSQGGYADY 138

Query: 155 TVVADVSVVAIDPKAPLDASCLLGCGVTTGYGAAVKTANVQKGDTVAVFGCGTVGLSVIQ 214
             V +   V I    P   +  L CG  T +   ++      G  V + G G +G   + 
Sbjct: 139 VRVHEHFAVLIPESIPSHLAAPLMCGGLTVFSPLLRNG-CGPGKKVGILGIGGIGHMGVL 197

Query: 215 GAKLRGASKIIAVDINNNKKKYCSQFGATDFINPKEDLAKDQTIVEKLVEMTDGGLDFTF 274
            AK  GA ++ A+   ++KK    + G   FI  KE+    +   +         LD   
Sbjct: 198 LAKAMGA-EVYAISRTSSKKADAVKLGTDHFIATKEEPDWHEKYFDT--------LDLLV 248

Query: 275 DCTGN-TKIMRDALEACHKGWGQSXXXXXXXXXXXXSTRPFQLVTGRVWKGSAFGGIKGR 333
            C G+ T +  D L       G+               +PF LV G     S  G +K  
Sbjct: 249 ICAGSLTDVDFDTLPKIMTVGGRVVSIAIPEQHEILKLKPFGLV-GVSIANSLLGSMKEL 307

Query: 334 SEMGGLIKDYQSGVLKVEEFITHRRPFKE--INHAFEDLHNGD 374
            E+  L+      +  VE       P  E  +N AF  +  GD
Sbjct: 308 KELLELVAKNNIKIW-VETI-----PIGEKGVNEAFTRMEKGD 344

>SAKL0H00374g Chr8 (45725..47011) [1287 bp, 428 aa] {ON} weakly
           similar to uniprot|P07246 Saccharomyces cerevisiae
           YMR083W ADH3 Alcohol dehydrogenase isoenzyme III, shows
           a high affinity for alcohols with a double bond
           conjugated to the alcohol group
          Length = 428

 Score = 38.9 bits (89), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 32/104 (30%), Positives = 47/104 (45%), Gaps = 11/104 (10%)

Query: 19  DAKKPSSVEEITVDAPKAHEVRIKIEYTAVCHTDAYTLSGSDPEGLFPCILGHEGAG-IV 77
           +  K   +E   V + K H+  +KI+   +CH+D   L G  P       +GHE  G +V
Sbjct: 93  ENNKLEYLENYRVQSLKPHQGLLKIKAVGLCHSDLTILKGGFPASQR-YAMGHEICGELV 151

Query: 78  ESVGDGVVTVKPGDHVIALYT----AECGKCKFCTSGKTNLCSA 117
           ++  D     +P   V  LYT    A CG C  C  G  + C+A
Sbjct: 152 QTYAD-----EPKYAVGELYTVVGNAPCGGCDSCKKGWESCCTA 190

>YCR105W Chr3 (309070..310155) [1086 bp, 361 aa] {ON}
           ADH7NADPH-dependent medium chain alcohol dehydrogenase
           with broad substrate specificity; member of the cinnamyl
           family of alcohol dehydrogenases; may be involved in
           fusel alcohol synthesis or in aldehyde tolerance
          Length = 361

 Score = 38.9 bits (89), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 81/346 (23%), Positives = 131/346 (37%), Gaps = 42/346 (12%)

Query: 37  HEVRIKIEYTAVCHTDAYTLSGSD---PEGLFPCILGHEGAGIVESVGDGVVT-VKPGDH 92
           H+V ++IE   +C +D +   G+    PE     ILGHE  G V  VG    T VK GD 
Sbjct: 34  HDVDVEIEACGICGSDFHIAVGNWGPVPENQ---ILGHEIIGRVVKVGSKCHTGVKIGDR 90

Query: 93  V-IALYTAECGKCKFCTSGKTNLCSAVRATQGKGVMPDGTTRFHNAKGKDIYHFMGCSTF 151
           V +      C +C+ C S     C+            DG              ++    F
Sbjct: 91  VGVGAQALACFECERCKSDNEQYCTNDHVLTMWTPYKDG--------------YISQGGF 136

Query: 152 SEYTVVADVSVVAIDPKAPLDASCLLGCGVTTGYGAAVKTANVQKGDTVAVFGCGTVGLS 211
           + +  + +   + I    P   +  L CG  T +   ++      G  V + G G +G  
Sbjct: 137 ASHVRLHEHFAIQIPENIPSPLAAPLLCGGITVFSPLLRNG-CGPGKRVGIVGIGGIGHM 195

Query: 212 VIQGAKLRGASKIIAVDINNNKKKYCSQFGATDFINPKEDLAKDQTIVEKLVEMTDGGLD 271
            I  AK  GA ++ A    ++K++   + GA  +I   ED        +   E     LD
Sbjct: 196 GILLAKAMGA-EVYAFSRGHSKREDSMKLGADHYIAMLED--------KGWTEQYSNALD 246

Query: 272 FTFDCTGN-TKIMRDALEACHKGWGQSXXXXXXXXXXXXSTRPFQLVTGRVWKGSAFGGI 330
               C+ + +K+  D++    K  G                +P  L+ G     SA G  
Sbjct: 247 LLVVCSSSLSKVNFDSIVKIMKIGGSIVSIAAPEVNEKLVLKPLGLM-GVSISSSAIG-- 303

Query: 331 KGRSEMGGLIKDYQSGVLKVEEFITHRRPFKE--INHAFEDLHNGD 374
             R E+  L+K      +K+      + P  E  ++HAF  + +GD
Sbjct: 304 -SRKEIEQLLKLVSEKNVKI---WVEKLPISEEGVSHAFTRMESGD 345

>Skud_13.494 Chr13 complement(884038..885120) [1083 bp, 360 aa] {ON}
           YMR318C (REAL)
          Length = 360

 Score = 38.5 bits (88), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 38/157 (24%), Positives = 60/157 (38%), Gaps = 17/157 (10%)

Query: 37  HEVRIKIEYTAVCHTDAYTLSGSDPEGLFPCILGHEGAGIVESVGDGVVT-VKPGDHV-I 94
           H+V IKIE   VC +D +  +G       P ++GHE  G V  +G    + +K G  V +
Sbjct: 34  HDVDIKIEACGVCGSDVHCAAGHWGNKQLPLVVGHEIVGKVVKLGPKSNSGLKIGQRVGV 93

Query: 95  ALYTAECGKCKFCTSGKTNLCSAVRATQGKGVMPDGTTRFHNAKGKDIYHFMGCSTFSEY 154
                 C +C  C S     C+    T  +    DG              ++    ++ Y
Sbjct: 94  GAQVFSCLECNRCKSDNEPYCTKFVTTYSQP-YEDG--------------YVSQGGYANY 138

Query: 155 TVVADVSVVAIDPKAPLDASCLLGCGVTTGYGAAVKT 191
             V +  VV +    P   +  L CG  T Y   ++ 
Sbjct: 139 VRVHEHFVVPVPKNIPSHLAAPLLCGGLTVYSPLIRN 175

>ZYRO0G10318g Chr7 (831554..832684) [1131 bp, 376 aa] {ON} similar
           to uniprot|Q04894 Saccharomyces cerevisiae YMR318C ADH6
           NADPH-dependent cinnamyl alcohol dehydrogenase family
           member with broad substrate specificity may be involved
           in fusel alcohol synthesis or in aldehyde tolerance
          Length = 376

 Score = 38.1 bits (87), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 28/110 (25%), Positives = 45/110 (40%), Gaps = 14/110 (12%)

Query: 18  YDAKKPSSVEEITVDAPKAHEVRIKIEYTAVCHTDAYTLSGSDPEGLFPC---------- 67
           +D  K +  E    DA   H+V I++E   +C ++ ++L          C          
Sbjct: 20  WDHPKLTKFEPKKFDA---HDVDIEVECCGICASELFSLKNEWSSEPLTCMTSSYGPKSQ 76

Query: 68  ILGHEGAGIVESVGDGVVTVKPGDHV-IALYTAECGKCKFCTSGKTNLCS 116
           ++GHE  G V +VGD V   K GD + +    + C  C  C       C+
Sbjct: 77  VVGHEVVGKVVAVGDKVSLCKVGDRIGLGAQASSCMSCPRCHGNNEQYCA 126

>Kwal_8.605 s8 (25017..26156) [1140 bp, 379 aa] {ON} YCR105W -
           Hypothetical ORF [contig 311] FULL
          Length = 379

 Score = 37.7 bits (86), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 69/249 (27%), Positives = 103/249 (41%), Gaps = 25/249 (10%)

Query: 13  IAAVAYDA-KKPSSVEEITVDAPK--AHEVRIKIEYTAVCHTDAYTLSGSDPEGLFPCIL 69
           I  V +D  KKP   E+ +   P     ++ ++IE   VC +D + +SG       P  +
Sbjct: 25  IGVVDFDQWKKP---EKFSYSPPLLGPEDIELEIEACGVCGSDIHAVSGDWGRLYKPFAV 81

Query: 70  GHEGAGIVESVGDGVVTVK--PGDHV-IALYTAECGKCKFCTSGKTNLCSAVRATQGKGV 126
           GHE  G + ++G  V   K   GD V +   T  CG C  C+  +   C     T     
Sbjct: 82  GHEIIGKISAMGAQVNKEKFHLGDRVGVGAQTNSCGDCTRCSRDRQQNCKKSVLTY---T 138

Query: 127 MPDGTTRFHNAKGKDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDASCLLGCGVTTGYG 186
             D    F   +G    H    S F      A  S VA    AP      L CG  TG+ 
Sbjct: 139 CVDERNGFET-QGGYASHIRANSGFVFKIPDALDSAVA----AP------LLCGGITGFR 187

Query: 187 AAVKTANVQKGDTVAVFGCGTVGLSVIQGAKLRGASKIIAVDINNNKKKYCSQFGATDFI 246
             + T  V++G  + V G G +G   I  AK  GA ++ A+  +N K     + GA  F+
Sbjct: 188 PLL-TGGVKEGSKLGVVGIGGIGHMSILFAKALGA-EVTAISRSNRKFDDAKKLGADHFL 245

Query: 247 NPKEDLAKD 255
              ++ ++D
Sbjct: 246 AMSDEKSRD 254

>TDEL0F02300 Chr6 complement(421372..422511) [1140 bp, 379 aa] {ON} 
          Length = 379

 Score = 36.6 bits (83), Expect = 0.091,   Method: Compositional matrix adjust.
 Identities = 54/226 (23%), Positives = 86/226 (38%), Gaps = 27/226 (11%)

Query: 37  HEVRIKIEYTAVCHTDAYTLSGSDPEGLFPC----------ILGHEGAGIVESVGDGVVT 86
           H++ I++E   +C ++ ++L          C          ++GHE  G V  VG+ V  
Sbjct: 38  HDIDIEVECCGICASELFSLKNEWSNAPLACLSSSYGPKSQVVGHEVIGKVVKVGEKVTL 97

Query: 87  VKPGDHV-IALYTAECGKCKFCTSGKTNLCSAVRATQGKGVMPDGTTRFHNAKGKDIYHF 145
            K G  V +    + C +C  C+S     C     T      PDG    + ++G    H 
Sbjct: 98  AKLGQRVGLGAQASSCMQCGRCSSNNEQYCLKSVGTYCSR-YPDG----YVSQGGYASHV 152

Query: 146 MGCSTFSEYTVVADVSVVAIDPKAPLDASCLLGCGVTTGYGAAVKTANVQKGDTVAVFGC 205
                F  + +  DV    + P         L CG  T Y    +     +   V + G 
Sbjct: 153 RAHEQFC-FPIPDDVPSAFVAP---------LMCGGLTVYSPIKRNIEGVEKPKVGIIGI 202

Query: 206 GTVGLSVIQGAKLRGASKIIAVDINNNKKKYCSQFGATDFINPKED 251
           G +G   I  AK  GA ++ A   +N KK    + GA  F+   E+
Sbjct: 203 GGLGHMAIMIAKALGA-EVTAFSRSNKKKDDAIKMGAQYFVATGEE 247

>YMR318C Chr13 complement(911061..912143) [1083 bp, 360 aa] {ON}
           ADH6NADPH-dependent medium chain alcohol dehydrogenase
           with broad substrate specificity; member of the cinnamyl
           family of alcohol dehydrogenases; may be involved in
           fusel alcohol synthesis or in aldehyde tolerance
          Length = 360

 Score = 36.6 bits (83), Expect = 0.096,   Method: Compositional matrix adjust.
 Identities = 38/157 (24%), Positives = 60/157 (38%), Gaps = 17/157 (10%)

Query: 37  HEVRIKIEYTAVCHTDAYTLSGSDPEGLFPCILGHEGAGIVESVGDGVVT-VKPGDHV-I 94
           H++ IKIE   VC +D +  +G       P ++GHE  G V  +G    + +K G  V +
Sbjct: 34  HDIDIKIEACGVCGSDIHCAAGHWGNMKMPLVVGHEIVGKVVKLGPKSNSGLKVGQRVGV 93

Query: 95  ALYTAECGKCKFCTSGKTNLCSAVRATQGKGVMPDGTTRFHNAKGKDIYHFMGCSTFSEY 154
                 C +C  C +     C+    T  +    DG              ++    ++ Y
Sbjct: 94  GAQVFSCLECDRCKNDNEPYCTKFVTTYSQP-YEDG--------------YVSQGGYANY 138

Query: 155 TVVADVSVVAIDPKAPLDASCLLGCGVTTGYGAAVKT 191
             V +  VV I    P   +  L CG  T Y   V+ 
Sbjct: 139 VRVHEHFVVPIPENIPSHLAAPLLCGGLTVYSPLVRN 175

>Kwal_27.12835 s27 complement(1395770..1396864) [1095 bp, 364 aa]
           {ON} YCR105W - Hypothetical ORF [contig 261] FULL
          Length = 364

 Score = 36.6 bits (83), Expect = 0.097,   Method: Compositional matrix adjust.
 Identities = 32/109 (29%), Positives = 49/109 (44%), Gaps = 9/109 (8%)

Query: 13  IAAVAYDA-KKPSSVEEITVDAPK--AHEVRIKIEYTAVCHTDAYTLSGSDPEGLFPCIL 69
           I  V +D  KKP   E+ +   P     ++ ++IE   VC +D + +SG       P  +
Sbjct: 10  IGVVDFDQWKKP---EKFSYSPPLLGPEDIELEIEACGVCGSDIHAVSGDWGRLYKPFAV 66

Query: 70  GHEGAGIVESVGDGVVTVK--PGDHV-IALYTAECGKCKFCTSGKTNLC 115
           GHE  G + ++G  V   K   GD V +   T  CG C  C+  +   C
Sbjct: 67  GHEIIGKISAMGAQVNKEKFHLGDRVGVGAQTNSCGGCTRCSRDRQQNC 115

>Smik_3.203 Chr3 (301227..301247,301251..301589) [360 bp, 120 aa]
           {ON} YCR105W (REAL)
          Length = 120

 Score = 33.9 bits (76), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 36/107 (33%), Positives = 51/107 (47%), Gaps = 13/107 (12%)

Query: 17  AYDAKKPSSVEEITVDAPKA---HEVRIKIEYTAVCHTDAYTLSGSDPEGLFP--CILGH 71
           A D K P+ V   T D PK    H++ I+IE   +C +D +  +G+   G  P   +LGH
Sbjct: 14  AEDWKHPTLV---TFD-PKPFADHDIDIEIEDCGICGSDFHIAAGN--WGPVPKNQVLGH 67

Query: 72  EGAGIVESVGDGVVT-VKPGDHV-IALYTAECGKCKFCTSGKTNLCS 116
           E  G V  VG    T +K GD V +      C +C+ C S     C+
Sbjct: 68  EIIGRVVKVGPKCHTGIKIGDRVGVGAQALACLECERCKSDNEQYCT 114

>Smik_26.3 Chr26 (2136..2513) [378 bp, 125 aa] {ON} YMR318C (REAL)
          Length = 125

 Score = 33.5 bits (75), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 23/80 (28%), Positives = 35/80 (43%), Gaps = 2/80 (2%)

Query: 38  EVRIKIEYTAVCHTDAYTLSGSDPEGLFPCILGHEGAGIVESVGDGVVTVKPGDHVIAL- 96
           +V IK+E   VC +D +  +G       P + GHE  G +  +G    +    D  + + 
Sbjct: 35  DVEIKVEACGVCGSDIHCAAGHWGPRNDPLVAGHEIVGRIVRMGSRCSSQLKVDMRVGMG 94

Query: 97  -YTAECGKCKFCTSGKTNLC 115
             T  C KC  C  G+ N C
Sbjct: 95  AITFSCLKCSGCKKGEENYC 114

>Skud_3.175 Chr3 (288164..289249) [1086 bp, 361 aa] {ON} YCR105W
           (REAL)
          Length = 361

 Score = 35.0 bits (79), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 63/248 (25%), Positives = 98/248 (39%), Gaps = 31/248 (12%)

Query: 17  AYDAKKPSSVEEITVDAPKA---HEVRIKIEYTAVCHTDAYTLSGSDPEGLFP--CILGH 71
           A D K P+ V   T D PK    H+V I+IE   +C +D +  +G+   G  P   +LGH
Sbjct: 15  AEDWKHPTLV---TFD-PKPFCDHDVDIEIEACGICGSDFHIAAGN--WGPVPKNQVLGH 68

Query: 72  EGAGIVESVGDGVVT-VKPGDHV-IALYTAECGKCKFCTSGKTNLCSAVRATQGKGVMPD 129
           E  G V  VG    T +K GD V +      C +C+ C S     C+            D
Sbjct: 69  EIIGRVVKVGPKCHTGIKLGDRVGVGAQALACLECERCKSDNEQYCTIDHVLTMWTPYKD 128

Query: 130 GTTRFHNAKGKDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDASCLLGCGVTTGYGAAV 189
           G              ++    F+ +  + +   + I    P   +  L CG  T +   +
Sbjct: 129 G--------------YIAQGGFASHVRLHEHFAIPIPENIPSPLAAPLLCGGITVFSPLL 174

Query: 190 KTANVQKGDTVAVFGCGTVGLSVIQGAKLRGASKIIAVDINNNKKKYCSQFGATDFINPK 249
           +           V   G   + ++  AK  GA ++ A    ++KK+   + GA  +I   
Sbjct: 175 RNGCGPGKKVGIVGIGGIGHMGILL-AKAMGA-EVYAFSRGHSKKEDSMRLGADHYIATL 232

Query: 250 EDLAKDQT 257
           ED  KD T
Sbjct: 233 ED--KDWT 238

>Suva_6.13 Chr6 (21861..22031,22035..22067) [204 bp, 68 aa] {ON}
           YJR159W (REAL)
          Length = 68

 Score = 32.0 bits (71), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 20/59 (33%), Positives = 30/59 (50%), Gaps = 1/59 (1%)

Query: 188 AVKTANVQKGDTVAVFGCGTVGLSVIQGAKLRGASKIIAVDINNNKKKYCSQFGATDFI 246
           AV+   V+ GD V V     +GL V    +  G  K++ +   ++KK+   QFG T FI
Sbjct: 11  AVRLPQVKYGDCVVVISVRAIGLLVDAVFREFGVDKVVLMSTQDSKKQ-SEQFGGTGFI 68

>KAFR0C01550 Chr3 complement(318350..319429) [1080 bp, 359 aa] {ON} 
          Length = 359

 Score = 34.3 bits (77), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 59/241 (24%), Positives = 97/241 (40%), Gaps = 29/241 (12%)

Query: 19  DAKKPSSVEEITVDAPK---AHEVRIKIEYTAVCHTDAYTLSGSDPEGLFPCILGHEGAG 75
           DAK  +  +++T D PK   +H+V I+IE   VC +D +  +    E     ++GHE  G
Sbjct: 14  DAKDWTHPKKVTYD-PKPFDSHDVDIEIECCGVCGSDIHCAASHWSEVREDLVVGHEVIG 72

Query: 76  IVESVGDGVVT-VKPGDHV-IALYTAECGKCKFCTSGKTNLCSAVRATQGKGVMPDGTTR 133
            V  VG    T +K GD V +      C +C  C       C     T  +         
Sbjct: 73  RVVKVGPECNTGLKLGDRVGVGAQVFSCLECDRCKEDNEPYCQKFVTTYNQPY------- 125

Query: 134 FHNAKGKDIYHFMGCSTFSEYTVVADVSVVAIDPKAPLDASCLLGCGVTTGYGAAVKT-- 191
              A G     ++    ++ +  V +  VV I  + P + +  L CG  T +   ++   
Sbjct: 126 ---ANG-----YISQGGYASHIRVHEHFVVPIPDEIPSELAAPLMCGGITVFSPLLRNGC 177

Query: 192 -ANVQKGDTVAVFGCGTVGLSVIQGAKLRGASKIIAVDINNNKKKYCSQFGATDFINPKE 250
             N + G            L     AK  GA ++ A   +++KK+   + GA  +I  K+
Sbjct: 178 GPNKKVGIVGIGGIGHMGVLF----AKAMGA-EVYAFSRSDSKKEDSLKLGADHYIATKD 232

Query: 251 D 251
           D
Sbjct: 233 D 233

>TPHA0A00140 Chr1 (14857..15945) [1089 bp, 362 aa] {ON} 
          Length = 362

 Score = 33.9 bits (76), Expect = 0.66,   Method: Compositional matrix adjust.
 Identities = 81/367 (22%), Positives = 135/367 (36%), Gaps = 61/367 (16%)

Query: 37  HEVRIKIEYTAVCHTDAYTLSGSDPEGLFPCILGHEGAGIVESVGDGV-VTVKPGDHV-I 94
           ++V IKIE   VC +D +  S +        ++GHE  G V  +G    + +K GD V +
Sbjct: 34  YDVDIKIEACGVCGSDVHRASSNWGPVKANQVVGHEIVGRVVKLGPKCKLGLKVGDRVGV 93

Query: 95  ALYTAECGKCKFCTSGKTNLC-SAVRATQGKGVMPDGTTRFHNAKGKDIYHFMGCSTFSE 153
                 C  CK C S     C S  R     G   DG              ++    ++ 
Sbjct: 94  GAQAKSCLNCKRCKSDNEPYCKSKDRVGTYSGTYSDG--------------YVSQGGYAS 139

Query: 154 YTVVADVSVVAIDPKAPLDASCLLGCGVTTGYGAAVKTANVQKGDTVAVFGCGTVGLSVI 213
           +    +  V  I    P + +  L CG  T +   ++             GCG      +
Sbjct: 140 HVRTHEHFVFKIPDNIPTELAAPLLCGGVTVFSPLLRN------------GCGPGKKVGV 187

Query: 214 QG-----------AKLRGASKIIAVDINNNKKKYCSQFGATDFINPKEDLAKDQTIVEKL 262
            G           AK  GA ++ A+  +++KK+   + GA  +I  +E+     T  +  
Sbjct: 188 VGIGGIGHMGILFAKAMGA-EVYAISRSSSKKEDSLKLGADYYIATQEEKDWATTYADT- 245

Query: 263 VEMTDGGLDFTFDCTGN-TKIMRDALEACHKGWGQSXXXXXXXXXXXXSTRPFQLVTGRV 321
                  LD    C  + + I  D L A     G+             + +PF L+ G  
Sbjct: 246 -------LDLIVLCASSLSDINIDDLVATMTIGGKIVSIAIPDASQQLTLKPFGLL-GVY 297

Query: 322 WKGSAFGGIKGRSEMGGLIKDYQSGVLKVEEFITHRRPFKE--INHAFEDLHNGDCLR-- 377
              SA G  K   ++  L+ +      K++ ++    P  E  +N  FE +  GD     
Sbjct: 298 ISNSALGSRKEIIQLLDLVSEK-----KIKPWV-QTVPISEAGVNEVFERMEKGDVKYRF 351

Query: 378 TVLKFDE 384
           T++ FD+
Sbjct: 352 TLVDFDK 358

>TPHA0E00730 Chr5 (139190..142126) [2937 bp, 978 aa] {ON} Anc_7.413
           YER114C
          Length = 978

 Score = 33.9 bits (76), Expect = 0.85,   Method: Compositional matrix adjust.
 Identities = 18/60 (30%), Positives = 28/60 (46%), Gaps = 1/60 (1%)

Query: 48  VCHTDAYTLSGSDPEGLFPCILGHEGAGIVESVGDGVVTVKPGDHVIALYTAECGKCKFC 107
           V  T  +TL G+     F         G+++  G  VV  K  D +++LY A  GK ++C
Sbjct: 773 VWKTRFFTLHGTR-LSYFSSTTDTREKGLIDITGHRVVPAKDDDKIVSLYAASTGKGRYC 831

>TBLA0C01490 Chr3 complement(343276..345864) [2589 bp, 862 aa] {ON}
           Anc_1.400 YLR176C
          Length = 862

 Score = 33.5 bits (75), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 20/74 (27%), Positives = 31/74 (41%), Gaps = 5/74 (6%)

Query: 89  PGDHVIALYTAECGKCKFCTSGKTNLCSAVRATQGKGVMPDGTTRFHNAKGKDIYHFMGC 148
           P   + A Y + C         + +L   +RA     V PD TTR    +G+  YH+ G 
Sbjct: 331 PRGRIFAQYASSCASNSLKPLSQASLGKLIRA-----VFPDLTTRRLGIRGQSKYHYCGL 385

Query: 149 STFSEYTVVADVSV 162
              S+  V  + S+
Sbjct: 386 KLLSDEPVPPEESL 399

>KLTH0C10538g Chr3 complement(873623..874444) [822 bp, 273 aa] {ON}
           conserved hypothetical protein
          Length = 273

 Score = 32.7 bits (73), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 41/145 (28%), Positives = 63/145 (43%), Gaps = 22/145 (15%)

Query: 152 SEYTVVADVSVVAIDPK-APLDASCLLGCGVTTGYGAAVKTANVQKGDTVAVFGC-GTVG 209
           +EY VV++   VA+ PK      +  LG  +TT    A++ A V+  D V+V G  G+VG
Sbjct: 51  AEYCVVSE-DAVALKPKNVTFAQAACLGVPLTTA-SLALQRAAVEPSDCVSVIGASGSVG 108

Query: 210 LSVIQGAKLRGASKIIAVDINNNKKKYCSQFGATDFINPKEDLAKDQTIVEKLVEMTDG- 268
             V+Q A+  G   + A     +    C              +A+D+     L  +T G 
Sbjct: 109 SYVVQLAQSMGCRVLRAA--RQSPTDVC--------------IAEDEEF-SALTSLTQGR 151

Query: 269 GLDFTFDCTGNTKIMRDALEACHKG 293
           G+D   D  G   +M+ A E    G
Sbjct: 152 GVDVVIDTVGMPALMKAAAEKLAHG 176

>Kpol_1018.107 s1018 complement(282640..286023) [3384 bp, 1127 aa]
           {ON} complement(282640..286023) [3384 nt, 1128 aa]
          Length = 1127

 Score = 33.1 bits (74), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 13/33 (39%), Positives = 20/33 (60%)

Query: 75  GIVESVGDGVVTVKPGDHVIALYTAECGKCKFC 107
           G+++  G  VV  K  D +I+LY A  GK ++C
Sbjct: 894 GLIDITGHRVVPAKEDDKLISLYAASTGKGRYC 926

>KAFR0H03770 Chr8 complement(715399..716496) [1098 bp, 365 aa] {ON} 
          Length = 365

 Score = 32.3 bits (72), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 30/111 (27%), Positives = 50/111 (45%), Gaps = 6/111 (5%)

Query: 19  DAKKPSSVEEITVDAPKA---HEVRIKIEYTAVCHTDAYTLSGSDPEGLFPCILGHEGAG 75
           D K  +  + +T + PKA   H+V I+IE   VC +D +T +    E     ++GHE  G
Sbjct: 20  DTKDWTHPKRVTYE-PKAFGPHDVDIEIECCGVCGSDIHTAASHWRELRDKMVVGHEIVG 78

Query: 76  IVESVGDGVVT-VKPGDHV-IALYTAECGKCKFCTSGKTNLCSAVRATQGK 124
            +  +G    + +K GD V +   +  C +C  C       C    +T  +
Sbjct: 79  RIVKLGPECDSGLKIGDRVGVGAQSFSCLECDRCKENNEPYCPKFVSTYNR 129

>TPHA0P00330 Chr16 (63488..65419) [1932 bp, 643 aa] {ON} Anc_8.67
           YFL009W
          Length = 643

 Score = 32.7 bits (73), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 21/86 (24%), Positives = 36/86 (41%), Gaps = 11/86 (12%)

Query: 52  DAYTLSGSDPE----------GLFPCILGHEG-AGIVESVGDGVVTVKPGDHVIALYTAE 100
           D Y +SG+D +           L   + GHEG    ++ V DG++     D  + ++  E
Sbjct: 275 DDYIISGADDKVIRVYSSKDKKLLKSLTGHEGGVWALKYVDDGIIVSGSTDRTVRIWDIE 334

Query: 101 CGKCKFCTSGKTNLCSAVRATQGKGV 126
            G C     G T+    +   + KG+
Sbjct: 335 LGCCTHVFKGHTSTVRCLEVVEYKGI 360

>KNAG0I01300 Chr9 (248944..251364) [2421 bp, 806 aa] {ON} Anc_1.400
           YLR176C
          Length = 806

 Score = 32.3 bits (72), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 24/85 (28%), Positives = 36/85 (42%), Gaps = 8/85 (9%)

Query: 78  ESVGDGVVTVKPGDHVIALYTAECGKCKFCTSGKTNLCSAVRATQGKGVMPDGTTRFHNA 137
           ES  D  V   P   + A Y + C + +     + +L   +R      V PD TTR    
Sbjct: 325 ESKHDSYV---PRGRIFAQYASSCSQNELKPLSQASLGKLIRT-----VFPDLTTRRLGT 376

Query: 138 KGKDIYHFMGCSTFSEYTVVADVSV 162
           +G+  YH+ G    ++    AD SV
Sbjct: 377 RGQSKYHYCGLKLITDEGEDADDSV 401

>SAKL0A10560g Chr1 (928213..929442) [1230 bp, 409 aa] {ON} similar
           to gnl|GLV|KLLA0F00638g Kluyveromyces lactis
           KLLA0F00638g and weakly similar to uniprot|P53912
           Saccharomyces cerevisiae YNL134C
          Length = 409

 Score = 32.0 bits (71), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 44/162 (27%), Positives = 63/162 (38%), Gaps = 34/162 (20%)

Query: 143 YHFMGCSTFSEYTVVADVSVVAIDPK------AP-----LDASCLLGCGVTTGYGAAVKT 191
           Y  +  STF EYTVV D  +    P+      AP     LD +  +G G+ T   A    
Sbjct: 138 YRDLRTSTFQEYTVV-DSRLAWRVPRTKAGSSAPGRQFGLDFAAGIGVGLVTAGCALSNL 196

Query: 192 ANVQK-----------------GDTVAVFGCGTVGLSVIQGAKLRGA-SKIIAVDINNNK 233
              +                  G  V   G  +VG+ VIQ A+  G   KI+A+    N 
Sbjct: 197 VAFEPEDHGSGCGSSGGGAEKLGSLVIWGGSSSVGIFVIQLARASGKFDKIVAISSKKN- 255

Query: 234 KKYCSQFGATDFINPKEDLAKDQTIVEKLVEMTDGGLDFTFD 275
             Y  + G T  I+    L  +  IVE++ E    G+ +  D
Sbjct: 256 ASYLKELGTTHVID---RLQPEDRIVEQVSESCPEGVRYGID 294

>YNL223W Chr14 (227370..228854) [1485 bp, 494 aa] {ON}
           ATG4Conserved cysteine protease required for autophagy;
           cleaves Atg8p to a form required for autophagosome and
           Cvt vesicle generation
          Length = 494

 Score = 32.3 bits (72), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 21/89 (23%), Positives = 37/89 (41%), Gaps = 4/89 (4%)

Query: 61  PE-GLFPCILGHEGAGIVESVGDGVVTVKPGDHVIALYTAECGKCKFCTSGKTNLCSAVR 119
           PE G+  CI+      I E+  + V    P   ++ L   + G      S + ++C  + 
Sbjct: 233 PECGIDDCIVSVSSGDIYENEVEKVFAENPNSRILFLLGVKLGINAVNESYRESICGILS 292

Query: 120 ATQGKGV---MPDGTTRFHNAKGKDIYHF 145
           +TQ  G+    P  +  F   +G +  HF
Sbjct: 293 STQSVGIAGGRPSSSLYFFGYQGNEFLHF 321

>NDAI0G00520 Chr7 complement(112068..113795) [1728 bp, 575 aa] {ON}
           Anc_1.450 YEL020C
          Length = 575

 Score = 32.0 bits (71), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 24/79 (30%), Positives = 36/79 (45%), Gaps = 4/79 (5%)

Query: 157 VADVSVVAIDPKAPLDASCLLGCGVTTGYGAAVKTAN---VQKGDTVAVFGCGTVGLSVI 213
           +A +S  ++ PK  LDA      GV  GYG A + +      K D + + G    G S I
Sbjct: 406 IARISFPSLKPKQRLDAGTNATMGVGLGYGIAARLSQDYMKSKPDILVIQGDSAFGFSAI 465

Query: 214 Q-GAKLRGASKIIAVDINN 231
           +    +R    +I + INN
Sbjct: 466 EIETAVRFKLGLIIIVINN 484

>KLTH0H14102g Chr8 (1226474..1228129) [1656 bp, 551 aa] {ON} similar
           to uniprot|P39994 Saccharomyces cerevisiae YEL020C
           Hypothetical ORF
          Length = 551

 Score = 32.0 bits (71), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 29/83 (34%), Positives = 38/83 (45%), Gaps = 7/83 (8%)

Query: 157 VADVSVVAIDPKAPLDASCLLGCGVTTGYGAAVKTANVQKGDTVAVFGCGTVGLSVIQGA 216
           VA +S     PK  +DA      GV  GY  A K A+ QK + +A+ G    G S   G 
Sbjct: 387 VARISFPTDYPKLRMDAGTNATMGVGLGYAIAAKIAHPQK-NVIAIQGDSAFGFS---GM 442

Query: 217 KLRGASKI---IAVDINNNKKKY 236
           +L  AS+    I V + NN   Y
Sbjct: 443 ELETASRYKLGITVVVMNNSGIY 465

>ZYRO0E04642g Chr5 complement(349593..352016) [2424 bp, 807 aa] {ON}
           some similarities with uniprot|P48743 Saccharomyces
           cerevisiae YLR176C
          Length = 807

 Score = 31.6 bits (70), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 18/60 (30%), Positives = 26/60 (43%), Gaps = 5/60 (8%)

Query: 89  PGDHVIALYTAECGKCKFCTSGKTNLCSAVRATQGKGVMPDGTTRFHNAKGKDIYHFMGC 148
           P   + A Y A C +       + +L   +RA     V PD TTR    +G+  YH+ G 
Sbjct: 302 PRGRIFAQYAASCAQNGLKPLSQASLGKLIRA-----VFPDLTTRRLGMRGQSRYHYCGL 356

>Ecym_1360 Chr1 (739963..741597) [1635 bp, 544 aa] {ON} similar to
           Ashbya gossypii AEL055C
          Length = 544

 Score = 31.6 bits (70), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 36/124 (29%), Positives = 51/124 (41%), Gaps = 16/124 (12%)

Query: 119 RATQGKGVMPDGTT-RFHNAKGK---------DIYHFMGCSTFSEYTVVADVSVVAIDPK 168
           +A + K ++P+G+  R+H    K          I    G +T      +A VS      K
Sbjct: 341 KAMKEKEIIPEGSALRYHGVYAKLREFIDDKSTIMVLEGANTMD----IARVSFPTSYQK 396

Query: 169 APLDASCLLGCGVTTGYGAAVKTANVQKGDTVAVFGCGTVGLSVIQGAKL-RGASKIIAV 227
             LDA      GV  GY  A K AN  K   VA+ G    G S ++   + R    I+ V
Sbjct: 397 HRLDAGTSATMGVGIGYAMAAKVANPSK-FVVALEGDSAFGFSAMELETIARNKLGIVVV 455

Query: 228 DINN 231
            +NN
Sbjct: 456 VMNN 459

>TPHA0K00720 Chr11 (147285..150320) [3036 bp, 1011 aa] {ON}
           Anc_7.413 YER114C
          Length = 1011

 Score = 31.6 bits (70), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 11/33 (33%), Positives = 20/33 (60%)

Query: 75  GIVESVGDGVVTVKPGDHVIALYTAECGKCKFC 107
           G+++  G  VV  +  D +++LY A  GK ++C
Sbjct: 718 GLIDITGHRVVPAREDDKLVSLYAASTGKGRYC 750

>Skud_86.1 Chr86 complement(469..738) [270 bp, 89 aa] {ON} YJR159W
           (REAL)
          Length = 89

 Score = 29.3 bits (64), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 19/59 (32%), Positives = 33/59 (55%), Gaps = 2/59 (3%)

Query: 222 SKIIAVDINNNKKKYCSQFGAT-DFINPKEDLAKDQTIVEKLVEMTDG-GLDFTFDCTG 278
           S +I VD+ +NK +    FGAT  F + K  + + Q + ++L ++  G   D  F+C+G
Sbjct: 1   SDVIFVDVFDNKLQRAKDFGATGTFNSSKFSVDEAQQLADELEKLLGGHQADVVFECSG 59

>KLTH0C06182g Chr3 (535274..538351) [3078 bp, 1025 aa] {ON} similar
           to uniprot|P39969 Saccharomyces cerevisiae YER114C BOI2
           Protein implicated in polar growth functionally
           redundant with Boi1p interacts with bud- emergence
           protein Bem1p contains an SH3 (src homology 3) domain
           and a PH (pleckstrin homology) domain
          Length = 1025

 Score = 31.2 bits (69), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 12/33 (36%), Positives = 19/33 (57%)

Query: 75  GIVESVGDGVVTVKPGDHVIALYTAECGKCKFC 107
           G+++     VV  K  D ++ALY A  GK ++C
Sbjct: 822 GLIDITAHRVVPAKDDDKLVALYAASTGKGRYC 854

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.135    0.410 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 38,706,199
Number of extensions: 1561983
Number of successful extensions: 3649
Number of sequences better than 10.0: 207
Number of HSP's gapped: 3494
Number of HSP's successfully gapped: 219
Length of query: 386
Length of database: 53,481,399
Length adjustment: 111
Effective length of query: 275
Effective length of database: 40,753,473
Effective search space: 11207205075
Effective search space used: 11207205075
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 67 (30.4 bits)