Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Smik_4.6985.528ON39339315950.0
YDR423C (CAD1)5.528ON4093937752e-99
Suva_2.600singletonOFF3823644232e-47
KNAG0C032105.528ON3841191498e-10
NDAI0H016105.528ON5191261453e-09
CAGL0F03069g5.528ON4861341293e-07
NCAS0H025605.528ON587531293e-07
NDAI0C010605.528ON637531284e-07
TBLA0G009305.528ON608531275e-07
SAKL0G04950g5.528ON567531241e-06
TDEL0A039205.528ON466531231e-06
KAFR0C054005.528ON481531212e-06
NCAS0F011005.528ON4751001194e-06
ZYRO0D12584g5.528ON579491179e-06
CAGL0H04631g5.528ON588531179e-06
KLTH0G03784g5.528ON569531161e-05
KLLA0A01760g5.528ON583531152e-05
KNAG0B036805.528ON482531142e-05
YML007W (YAP1)5.528ON650531142e-05
Skud_13.1475.528ON665531142e-05
Smik_13.1445.528ON639531142e-05
Suva_13.1555.528ON645531132e-05
Kwal_47.186315.528ON584531114e-05
TBLA0D016405.528ON599521115e-05
TPHA0K005205.528ON560531097e-05
TPHA0D023405.528ON506541071e-04
Skud_4.6975.528ON3232932e-04
Kpol_1023.975.528ON591531000.001
Kpol_1004.225.528ON47553990.001
KAFR0E032905.528ON26554800.16
KAFR0L02140singletonON319673751.1
Ecym_40645.528ON42644694.6
CAGL0M01738g3.307ON138549686.8
NOTE: 1 genes in the same pillar as Smik_4.698 were not hit in these BLAST results
LIST: ADR195C

BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Smik_4.698
         (393 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Smik_4.698 Chr4 complement(1238807..1239642,1239673..1240018) [1...   619   0.0  
YDR423C Chr4 complement(1318046..1319275) [1230 bp, 409 aa] {ON}...   303   2e-99
Suva_2.600 Chr2 complement(1070824..1071000,1071004..1071024,107...   167   2e-47
KNAG0C03210 Chr3 (631277..632431) [1155 bp, 384 aa] {ON} Anc_5.5...    62   8e-10
NDAI0H01610 Chr8 complement(390369..391928) [1560 bp, 519 aa] {O...    60   3e-09
CAGL0F03069g Chr6 complement(301650..303110) [1461 bp, 486 aa] {...    54   3e-07
NCAS0H02560 Chr8 complement(509179..510942) [1764 bp, 587 aa] {O...    54   3e-07
NDAI0C01060 Chr3 (206067..207980) [1914 bp, 637 aa] {ON} Anc_5.5...    54   4e-07
TBLA0G00930 Chr7 (226547..228373) [1827 bp, 608 aa] {ON} Anc_5.5...    54   5e-07
SAKL0G04950g Chr7 complement(409365..411068) [1704 bp, 567 aa] {...    52   1e-06
TDEL0A03920 Chr1 complement(703498..704898) [1401 bp, 466 aa] {O...    52   1e-06
KAFR0C05400 Chr3 complement(1082243..1083688) [1446 bp, 481 aa] ...    51   2e-06
NCAS0F01100 Chr6 complement(218116..219543) [1428 bp, 475 aa] {O...    50   4e-06
ZYRO0D12584g Chr4 complement(1064627..1066366) [1740 bp, 579 aa]...    50   9e-06
CAGL0H04631g Chr8 complement(442448..444214) [1767 bp, 588 aa] {...    50   9e-06
KLTH0G03784g Chr7 complement(300734..302443) [1710 bp, 569 aa] {...    49   1e-05
KLLA0A01760g Chr1 (154859..156610) [1752 bp, 583 aa] {ON} unipro...    49   2e-05
KNAG0B03680 Chr2 (707204..708652) [1449 bp, 482 aa] {ON} Anc_5.5...    49   2e-05
YML007W Chr13 (253848..255800) [1953 bp, 650 aa] {ON}  YAP1Basic...    49   2e-05
Skud_13.147 Chr13 (240056..242053) [1998 bp, 665 aa] {ON} YML007...    49   2e-05
Smik_13.144 Chr13 (242566..244485) [1920 bp, 639 aa] {ON} YML007...    49   2e-05
Suva_13.155 Chr13 (244425..246362) [1938 bp, 645 aa] {ON} YML007...    48   2e-05
Kwal_47.18631 s47 (904593..906347) [1755 bp, 584 aa] {ON} YML007...    47   4e-05
TBLA0D01640 Chr4 (402610..404409) [1800 bp, 599 aa] {ON} Anc_5.5...    47   5e-05
TPHA0K00520 Chr11 (102027..103709) [1683 bp, 560 aa] {ON} Anc_5....    47   7e-05
TPHA0D02340 Chr4 complement(483713..485233) [1521 bp, 506 aa] {O...    46   1e-04
Skud_4.697 Chr4 complement(1239012..1239107) [96 bp, 32 aa] {ON}...    40   2e-04
Kpol_1023.97 s1023 (225050..226825) [1776 bp, 591 aa] {ON} (2250...    43   0.001
Kpol_1004.22 s1004 complement(45952..47379) [1428 bp, 475 aa] {O...    43   0.001
KAFR0E03290 Chr5 (653300..654097) [798 bp, 265 aa] {ON} Anc_5.52...    35   0.16 
KAFR0L02140 Chr12 (411877..421464) [9588 bp, 3196 aa] {ON}             33   1.1  
Ecym_4064 Chr4 (141770..143050) [1281 bp, 426 aa] {ON} similar t...    31   4.6  
CAGL0M01738g Chr13 (197743..201900) [4158 bp, 1385 aa] {ON} simi...    31   6.8  

>Smik_4.698 Chr4 complement(1238807..1239642,1239673..1240018) [1182
           bp, 393 aa] {ON} YDR423C (REAL)
          Length = 393

 Score =  619 bits (1595), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 324/393 (82%), Positives = 324/393 (82%)

Query: 1   MSEQVLANKDGIXXXXXXXXXXXXXDSEXXXXXXXXXXXXXXXXXXXKEARLKSLLERIE 60
           MSEQVLANKDGI             DSE                   KEARLKSLLERIE
Sbjct: 1   MSEQVLANKDGIPKRKVGRPGRKRVDSEAKNRRTAQNRAAQRAFRDRKEARLKSLLERIE 60

Query: 61  LLEQKDAQNKSVIDFLQSSLKSLLSEVTKYRAKNVNDERILAFLDDLXXXXXXXXXXXAS 120
           LLEQKDAQNKSVIDFLQSSLKSLLSEVTKYRAKNVNDERILAFLDDL           AS
Sbjct: 61  LLEQKDAQNKSVIDFLQSSLKSLLSEVTKYRAKNVNDERILAFLDDLQEQQEREKEKEAS 120

Query: 121 TKINETTETLPSFRVIRXXXXXXXXXXXXHLHSSRNSTWDVGLCSTPRLTNTWNFPSENR 180
           TKINETTETLPSFRVIR            HLHSSRNSTWDVGLCSTPRLTNTWNFPSENR
Sbjct: 121 TKINETTETLPSFRVIRNTTVNTDTEVETHLHSSRNSTWDVGLCSTPRLTNTWNFPSENR 180

Query: 181 TDPSAISDKSANDSKKLDFSLDVTFNDKLTGINHLDYDIRSHLSEHFGDFSSDKVEPLAF 240
           TDPSAISDKSANDSKKLDFSLDVTFNDKLTGINHLDYDIRSHLSEHFGDFSSDKVEPLAF
Sbjct: 181 TDPSAISDKSANDSKKLDFSLDVTFNDKLTGINHLDYDIRSHLSEHFGDFSSDKVEPLAF 240

Query: 241 PSETDNMYFLDEANDDILLSSVVSPAKENECNGKCNGKCAEDTPLLNKEIKCELITKRLL 300
           PSETDNMYFLDEANDDILLSSVVSPAKENECNGKCNGKCAEDTPLLNKEIKCELITKRLL
Sbjct: 241 PSETDNMYFLDEANDDILLSSVVSPAKENECNGKCNGKCAEDTPLLNKEIKCELITKRLL 300

Query: 301 NQESLDSIVPASAPYRENIGXXXXXXXXXXXXXXNQNTSCCHILKEISSLPKYSSLDIDN 360
           NQESLDSIVPASAPYRENIG              NQNTSCCHILKEISSLPKYSSLDIDN
Sbjct: 301 NQESLDSIVPASAPYRENIGIRSEAIRRISSAISNQNTSCCHILKEISSLPKYSSLDIDN 360

Query: 361 LCCELMTKAEFTDDCEIVVRAHDLQTTLVKQLL 393
           LCCELMTKAEFTDDCEIVVRAHDLQTTLVKQLL
Sbjct: 361 LCCELMTKAEFTDDCEIVVRAHDLQTTLVKQLL 393

>YDR423C Chr4 complement(1318046..1319275) [1230 bp, 409 aa] {ON}
           CAD1AP-1-like basic leucine zipper (bZIP)
           transcriptional activator involved in stress responses,
           iron metabolism, and pleiotropic drug resistance;
           controls a set of genes involved in stabilizing
           proteins; binds consensus sequence TTACTAA
          Length = 409

 Score =  303 bits (775), Expect = 2e-99,   Method: Compositional matrix adjust.
 Identities = 175/393 (44%), Positives = 224/393 (56%)

Query: 1   MSEQVLANKDGIXXXXXXXXXXXXXDSEXXXXXXXXXXXXXXXXXXXKEARLKSLLERIE 60
           M +Q+L NKDG              DSE                   KEA++KSL ER+E
Sbjct: 17  MKKQMLLNKDGTPKRKVGRPGRKRIDSEAKSRRTAQNRAAQRAFRDRKEAKMKSLQERVE 76

Query: 61  LLEQKDAQNKSVIDFLQSSLKSLLSEVTKYRAKNVNDERILAFLDDLXXXXXXXXXXXAS 120
           LLEQKDAQNK+  DFL  SLKSLLSE+TKYRAKN +DERILAFLDDL            S
Sbjct: 77  LLEQKDAQNKTTTDFLLCSLKSLLSEITKYRAKNSDDERILAFLDDLQEQQKRENEKGTS 136

Query: 121 TKINETTETLPSFRVIRXXXXXXXXXXXXHLHSSRNSTWDVGLCSTPRLTNTWNFPSENR 180
           T +++  + LPS                 H   +    W++G  + P LTN+W+ P  NR
Sbjct: 137 TAVSKAAKELPSPNSDENMTVNTSIEVQPHTQENEKVMWNIGSWNAPSLTNSWDSPPGNR 196

Query: 181 TDPSAISDKSANDSKKLDFSLDVTFNDKLTGINHLDYDIRSHLSEHFGDFSSDKVEPLAF 240
           T    I D+S N S+  DFSLD+  ND+ TG+  LDYDI ++  +H    +++K++  A 
Sbjct: 197 TGAVTIGDESINGSEMPDFSLDLVSNDRQTGLEALDYDIHNYFPQHSERLTAEKIDTSAC 256

Query: 241 PSETDNMYFLDEANDDILLSSVVSPAKENECNGKCNGKCAEDTPLLNKEIKCELITKRLL 300
             E D  Y   E  DD L  SV+  A  ++CN  CN KC    P  NKEIKC+LIT  LL
Sbjct: 257 QCEIDQKYLPYETEDDTLFPSVLPLAVGSQCNNICNRKCIGTKPCSNKEIKCDLITSHLL 316

Query: 301 NQESLDSIVPASAPYRENIGXXXXXXXXXXXXXXNQNTSCCHILKEISSLPKYSSLDIDN 360
           NQ+SL S++P +A + + I               N   SC HIL+EISSLPKYSSLDID+
Sbjct: 317 NQKSLASVLPVAASHTKTIRTQSEAIEHISSAISNGKASCYHILEEISSLPKYSSLDIDD 376

Query: 361 LCCELMTKAEFTDDCEIVVRAHDLQTTLVKQLL 393
           LC EL+ KA+ TDDC+IVV+A DLQ+ LV+QLL
Sbjct: 377 LCSELIIKAKCTDDCKIVVKARDLQSALVRQLL 409

>Suva_2.600 Chr2
           complement(1070824..1071000,1071004..1071024,
           1071028..1071144,1071132..1071362,1071366..1071527,
           1071531..1071734,1071738..1071752,1071756..1071953,
           1071957..1071977) [1146 bp, 382 aa] {OFF} YDR423C
           (PSEUDO)
          Length = 382

 Score =  167 bits (423), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 131/364 (35%), Positives = 185/364 (50%), Gaps = 30/364 (8%)

Query: 48  KEARLKSLLERIELLEQKDAQNKSVIDFLQSSLKSLLSEVTKYRAKNVNDERIL--AFLD 105
           KE + K L E+ ELLE +DAQ+K   D+LQ SL+SLL E  K     V+ E  L   +L 
Sbjct: 31  KEDKWKQLEEKTELLESRDAQSKVATDYLQGSLRSLLLENDK-----VSSECGLHPGWLT 85

Query: 106 DLXXXXXXXXXXXAS-----TKINETTETLPSFRVIRXXXXXXXXXXXXHLHSSRNSTWD 160
           +                     +N +T+  PS                  +   R + W 
Sbjct: 86  ETAGGNKKMGSCKWGRPRIPVMVNNSTKEPPSPSSSGSLAANTNTEAEACMQEIRIAAWS 145

Query: 161 V--GLCSTPRLTNTWNFPSENRTDPSAISDKSANDSKKLDFSLDVTFNDKL-----TGIN 213
           +    C++  +TN  + P    T  S +  +    +K L   +  +F  K      T I 
Sbjct: 146 LMDSDCNSNFITND-SIPDLKNTWASPLGSQKCTINKALMVVIRFSFGLKFALNNGTDIE 204

Query: 214 HLDYDIRSHLSEHFGDFSSDKVEPLAFPSETDNMYFLDEANDDILLSSVVSPAKENECNG 273
            L+YD++   +E F  F S  V  LAF  + D  Y L++A++D LLS+  +P    +CN 
Sbjct: 205 ELEYDLQPRTAEVFEGFQSKGVRSLAFSDKIDQEYLLNDASND-LLSANQTPISL-KCN- 261

Query: 274 KCNGKCAEDTPL----LNKEIKCELITKRLLNQESLDSIVPASAPYRENIGXXXXXXXXX 329
            CNGKC +  P     L+K+IK  LIT+ L+NQE LDSI+PASAP R  +          
Sbjct: 262 -CNGKCMKAIPCPIKRLDKKIKYGLITRHLINQEPLDSILPASAP-RGGV-LKLHPEPFT 318

Query: 330 XXXXXNQNTSCCHILKEISSLPKYSSLDIDNLCCELMTKAEFTDDCEIVVRAHDLQTTLV 389
                N+   C HIL+ ISS+PK+SSLDIDNLCCELM KA+ + DC+I+V+AH LQ+ L 
Sbjct: 319 SKMPYNETFFCSHILRHISSIPKHSSLDIDNLCCELMVKAKCSGDCQIMVQAHGLQSVLA 378

Query: 390 KQLL 393
           +QLL
Sbjct: 379 RQLL 382

>KNAG0C03210 Chr3 (631277..632431) [1155 bp, 384 aa] {ON} Anc_5.528
           YDR423C gene spans a gap in the genome sequence
          Length = 384

 Score = 62.0 bits (149), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 35/119 (29%), Positives = 57/119 (47%), Gaps = 28/119 (23%)

Query: 275 CNGKCAEDTPLLNKEIKCELITKRLLNQESLDSIVPASAPYRENIGXXXXXXXXXXXXXX 334
           C G+C  D       IKC+L+T+R++N ESL SI+                         
Sbjct: 291 CGGRCLTD-------IKCDLLTRRVMNNESLRSII--------------------AEKRC 323

Query: 335 NQNTSCCHILKEISSLPKYSSLDIDNLCCELMTKAEF-TDDCEIVVRAHDLQTTLVKQL 392
             N +C H+++ ++  P Y   D+++LC ELM K +F T D  I V   D+++ L + +
Sbjct: 324 GSNDTCAHVIRTLTQSPHYQENDLEDLCQELMVKCKFDTHDASITVGREDVRSALERHI 382

>NDAI0H01610 Chr8 complement(390369..391928) [1560 bp, 519 aa] {ON}
           Anc_5.528 YDR423C
          Length = 519

 Score = 60.5 bits (145), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 39/126 (30%), Positives = 63/126 (50%), Gaps = 17/126 (13%)

Query: 275 CNGKCAEDTPLLNKEIKCELITKRLLNQESLDSIVPASAPYRENIGXXXXXXXXXXXXXX 334
           CN +C  D    ++EI+CEL+++ LLN ES+ SI+        N+               
Sbjct: 403 CNDQCNSD----DEEIECELLSRNLLNDESMKSIIKEKQTRPSNVAPSCCNGGYG----- 453

Query: 335 NQNTSCCHILKEIS--------SLPKYSSLDIDNLCCELMTKAEFTDDCEIVVRAHDLQT 386
           N+   C  I + I+        S P++   DID+LC ELMTKA  + +  IV++  D++ 
Sbjct: 454 NRFAKCSKIWERINNKMNIETNSGPRFKDSDIDDLCNELMTKARCSTNGSIVIKTGDIKQ 513

Query: 387 TLVKQL 392
           +L+K  
Sbjct: 514 SLMKHF 519

 Score = 41.2 bits (95), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 32/53 (60%)

Query: 52  LKSLLERIELLEQKDAQNKSVIDFLQSSLKSLLSEVTKYRAKNVNDERILAFL 104
           +K L ++I  LE+   +N     FL+S +  L++EV K+R KN  D +IL +L
Sbjct: 1   MKELEDKISSLEKIKDENSIETSFLRSYMTDLINEVNKFRPKNTTDSKILKYL 53

>CAGL0F03069g Chr6 complement(301650..303110) [1461 bp, 486 aa] {ON}
           some similarities with uniprot|P24813 Saccharomyces
           cerevisiae YDR423c CAD1 transcriptional activator
          Length = 486

 Score = 54.3 bits (129), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 39/134 (29%), Positives = 59/134 (44%), Gaps = 17/134 (12%)

Query: 268 ENECNGKCNGKCAEDTPLLNKEIKCELITKRLLNQESLDSIVPASAPYRENIGXXXXXXX 327
           ENE      GK   D  L + E++CEL+T+ ++ +E L +++      R           
Sbjct: 359 ENEAKATPVGKKIADMNLDDVELRCELLTQHIIYREPLSTVLQLLKRTRHERDARSSEGK 418

Query: 328 XXXXXXXNQNTSCCHILKEISSLPKYSSLDIDNLCCELMTKAEFTDDCE---------IV 378
                       C  I   +     Y SLD +NLC ELM KA+ +DD +         +V
Sbjct: 419 PVLR--------CEDICGTVGPSIGYDSLDFENLCAELMNKAKISDDGDGTDIVPKRHVV 470

Query: 379 VRAHDLQTTLVKQL 392
           ++A DLQ TL K +
Sbjct: 471 IKAGDLQRTLAKHI 484

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 24/60 (40%), Positives = 39/60 (65%)

Query: 48  KEARLKSLLERIELLEQKDAQNKSVIDFLQSSLKSLLSEVTKYRAKNVNDERILAFLDDL 107
           KEA+L++L E I +L+  +++  S  ++L+  L  LL+EVTKYR  N  D+ IL  L ++
Sbjct: 40  KEAKLRALEETIVVLKGMNSKKNSETEYLKECLSELLTEVTKYRPANEKDQGILKRLKEI 99

>NCAS0H02560 Chr8 complement(509179..510942) [1764 bp, 587 aa] {ON}
           Anc_5.528 YDR423C
          Length = 587

 Score = 54.3 bits (129), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 27/53 (50%), Positives = 34/53 (64%), Gaps = 1/53 (1%)

Query: 340 CCHILKEISSLPKYSSLDIDNLCCELMTKAEFTDDCEIVVRAHDLQTTLVKQL 392
           C  I   IS+ PKYS LDID LC ELMTKA+ ++   +VV A D+Q  L K +
Sbjct: 535 CSEIWDRISAHPKYSDLDIDGLCSELMTKAKCSERG-VVVNAEDVQLALTKHM 586

 Score = 40.4 bits (93), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 20/57 (35%), Positives = 36/57 (63%)

Query: 48  KEARLKSLLERIELLEQKDAQNKSVIDFLQSSLKSLLSEVTKYRAKNVNDERILAFL 104
           KE ++K L E++  L +   QN+   +FL+  L +L++E+ KYR  N N+ ++L +L
Sbjct: 86  KERKMKELEEKVNNLTKIQKQNEIESEFLRGQLITLVNELKKYRDPNPNESKVLEYL 142

>NDAI0C01060 Chr3 (206067..207980) [1914 bp, 637 aa] {ON} Anc_5.528
           YDR423C
          Length = 637

 Score = 53.9 bits (128), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 26/53 (49%), Positives = 34/53 (64%), Gaps = 1/53 (1%)

Query: 340 CCHILKEISSLPKYSSLDIDNLCCELMTKAEFTDDCEIVVRAHDLQTTLVKQL 392
           C  I   I++ PKYS LDID LC ELMTKA+ ++   +VV A D+Q  L K +
Sbjct: 585 CSEIWDRITAHPKYSELDIDGLCSELMTKAKCSERG-VVVNAEDVQMALTKHM 636

 Score = 39.3 bits (90), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 19/57 (33%), Positives = 36/57 (63%)

Query: 48  KEARLKSLLERIELLEQKDAQNKSVIDFLQSSLKSLLSEVTKYRAKNVNDERILAFL 104
           KE ++K L E++  L +   QN+   +FL+S L +L++E+ KY+  N N  ++L ++
Sbjct: 95  KERKMKELEEKVANLTKIQKQNEIESEFLRSQLITLVNELKKYKPNNENASKVLNYI 151

>TBLA0G00930 Chr7 (226547..228373) [1827 bp, 608 aa] {ON} Anc_5.528
           YDR423C
          Length = 608

 Score = 53.5 bits (127), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 26/53 (49%), Positives = 34/53 (64%), Gaps = 1/53 (1%)

Query: 340 CCHILKEISSLPKYSSLDIDNLCCELMTKAEFTDDCEIVVRAHDLQTTLVKQL 392
           C  +   I+S PKYS LDID LC ELM KA+ ++   +VV+A D+Q  L K L
Sbjct: 556 CSEVWDRITSHPKYSDLDIDGLCTELMHKAKCSEKG-VVVKADDVQKALTKHL 607

 Score = 35.0 bits (79), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 16/57 (28%), Positives = 35/57 (61%)

Query: 48  KEARLKSLLERIELLEQKDAQNKSVIDFLQSSLKSLLSEVTKYRAKNVNDERILAFL 104
           +E +++ L ++++ LE+   +++    FL+  LK LL E+ +YR +  ND ++  +L
Sbjct: 68  RERKMQELEDKVKSLEEVHKKSEIESQFLRDQLKVLLGELQRYRPERQNDAKVKEYL 124

>SAKL0G04950g Chr7 complement(409365..411068) [1704 bp, 567 aa] {ON}
           weakly similar to uniprot|P19880 YML007W Saccharomyces
           cerevisiae YAP1 bZip transcription factor required for
           oxidative stress tolerance
          Length = 567

 Score = 52.4 bits (124), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 26/53 (49%), Positives = 33/53 (62%), Gaps = 1/53 (1%)

Query: 340 CCHILKEISSLPKYSSLDIDNLCCELMTKAEFTDDCEIVVRAHDLQTTLVKQL 392
           C  I   I+S PKYS LDID LC EL TKA+ ++   +VV A D+Q  L K +
Sbjct: 515 CGEIWDRITSHPKYSDLDIDGLCMELRTKAKCSEKG-VVVNADDVQKALAKHM 566

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 21/57 (36%), Positives = 36/57 (63%)

Query: 48  KEARLKSLLERIELLEQKDAQNKSVIDFLQSSLKSLLSEVTKYRAKNVNDERILAFL 104
           KE ++K L +++  LE    QN+   +FL+S L +L+SE+ KYR +   D ++L +L
Sbjct: 77  KERKMKELEDKVTHLETVREQNEVETEFLRSQLMTLISELKKYRPEQSMDTQVLEYL 133

>TDEL0A03920 Chr1 complement(703498..704898) [1401 bp, 466 aa] {ON}
           Anc_5.528 YDR423C
          Length = 466

 Score = 52.0 bits (123), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 24/53 (45%), Positives = 36/53 (67%), Gaps = 1/53 (1%)

Query: 340 CCHILKEISSLPKYSSLDIDNLCCELMTKAEFTDDCEIVVRAHDLQTTLVKQL 392
           C  +   I++ PKYS++DID LC ELMTKA+ ++   +VV+A D+Q  L K +
Sbjct: 413 CSEVWDRITTHPKYSAIDIDGLCGELMTKAKCSEKG-VVVQAEDVQRVLDKHM 464

 Score = 40.0 bits (92), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 20/57 (35%), Positives = 36/57 (63%)

Query: 48  KEARLKSLLERIELLEQKDAQNKSVIDFLQSSLKSLLSEVTKYRAKNVNDERILAFL 104
           KE ++K L ++++ LEQ +       +FL+S L +L++E+ KYR    ND ++L +L
Sbjct: 77  KEKKMKELEDKVQSLEQANRDTVVESEFLRSQLLTLVNELKKYRPAKANDLQVLDYL 133

>KAFR0C05400 Chr3 complement(1082243..1083688) [1446 bp, 481 aa]
           {ON} Anc_5.528 YDR423C
          Length = 481

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 24/53 (45%), Positives = 34/53 (64%), Gaps = 1/53 (1%)

Query: 340 CCHILKEISSLPKYSSLDIDNLCCELMTKAEFTDDCEIVVRAHDLQTTLVKQL 392
           C  +   I++ PKYS +DID LC ELM KA+ ++   +VV A D+Q+ L K L
Sbjct: 429 CSEVWDRITAHPKYSDIDIDGLCGELMAKAKCSEKG-VVVNAEDVQSALSKHL 480

 Score = 41.2 bits (95), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 20/57 (35%), Positives = 35/57 (61%)

Query: 48  KEARLKSLLERIELLEQKDAQNKSVIDFLQSSLKSLLSEVTKYRAKNVNDERILAFL 104
           KE ++K L  +++ L     QN+   +FL+S L +L+ E+ KYR +  ND ++L +L
Sbjct: 65  KERKMKELEAKVDHLSNIQKQNEIESEFLRSQLITLVKELKKYRPETANDSQVLNYL 121

>NCAS0F01100 Chr6 complement(218116..219543) [1428 bp, 475 aa] {ON}
           Anc_5.528 YDR423C
          Length = 475

 Score = 50.4 bits (119), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 33/100 (33%), Positives = 51/100 (51%), Gaps = 14/100 (14%)

Query: 294 LITKRLLNQESLDSIVPASAPYRENIGXXXXXXXXXXXXXXNQNTSCCHILKEISSL-PK 352
            I++ LLN ES+ SI+         +               N+ + C  I K   +  PK
Sbjct: 389 FISRNLLNNESIPSILRDKTSIDGGMAC-------------NKYSKCSAIWKRFKTQKPK 435

Query: 353 YSSLDIDNLCCELMTKAEFTDDCEIVVRAHDLQTTLVKQL 392
           +S  DID+LC EL+TKA+ +D+  IV+R+ D++ TL K  
Sbjct: 436 FSDDDIDSLCQELITKAKCSDEGTIVIRSRDVKNTLRKHF 475

 Score = 35.4 bits (80), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 18/57 (31%), Positives = 32/57 (56%)

Query: 48  KEARLKSLLERIELLEQKDAQNKSVIDFLQSSLKSLLSEVTKYRAKNVNDERILAFL 104
           KE ++K L ++I  LE+    N+    FL+  +  L+ ++ KYR  N  D ++L +L
Sbjct: 52  KERKMKELEDKISDLERIKDNNEVESTFLRDYMMDLICDMQKYRPNNSTDSKVLKYL 108

>ZYRO0D12584g Chr4 complement(1064627..1066366) [1740 bp, 579 aa]
           {ON} weakly similar to uniprot|P19880 YML007W
           Saccharomyces cerevisiae YAP1 bZip transcription factor
           required for oxidative stress tolerance
          Length = 579

 Score = 49.7 bits (117), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 23/49 (46%), Positives = 32/49 (65%), Gaps = 1/49 (2%)

Query: 340 CCHILKEISSLPKYSSLDIDNLCCELMTKAEFTDDCEIVVRAHDLQTTL 388
           C  +   I+S PKYS +DID LC ELM KA+ ++   +VV+A D+Q  L
Sbjct: 527 CSEVWDRITSHPKYSDMDIDGLCQELMAKAKCSERG-VVVQAEDVQYAL 574

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 20/57 (35%), Positives = 39/57 (68%)

Query: 48  KEARLKSLLERIELLEQKDAQNKSVIDFLQSSLKSLLSEVTKYRAKNVNDERILAFL 104
           KE ++K L +++  LE+ + Q+    +FL+S L +L++E+ +YR +N ND ++L +L
Sbjct: 67  KEKKMKELEDKVHALEELNQQSLVETEFLRSQLVTLVTELKRYRPENPNDSQVLQYL 123

>CAGL0H04631g Chr8 complement(442448..444214) [1767 bp, 588 aa] {ON}
           similar to uniprot|P19880 Saccharomyces cerevisiae
           YML007w YAP1
          Length = 588

 Score = 49.7 bits (117), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 23/53 (43%), Positives = 33/53 (62%), Gaps = 1/53 (1%)

Query: 340 CCHILKEISSLPKYSSLDIDNLCCELMTKAEFTDDCEIVVRAHDLQTTLVKQL 392
           C  I   I++ PKYS +DID LC ELM KA+ ++   +V+ A D+Q  L K +
Sbjct: 536 CSEIWDRITAHPKYSDIDIDGLCSELMAKAKCSERG-VVINADDVQVALNKHM 587

 Score = 34.3 bits (77), Expect = 0.62,   Method: Compositional matrix adjust.
 Identities = 18/58 (31%), Positives = 32/58 (55%)

Query: 48  KEARLKSLLERIELLEQKDAQNKSVIDFLQSSLKSLLSEVTKYRAKNVNDERILAFLD 105
           KE ++K L  ++  LE     N+   +FL+  L  L+ E+ KYR +   D ++L +L+
Sbjct: 46  KERKMKELERKVVDLENLTKLNEVETNFLRDQLSILVKELRKYRPETKQDHKVLKYLE 103

>KLTH0G03784g Chr7 complement(300734..302443) [1710 bp, 569 aa] {ON}
           weakly similar to uniprot|P19880 YML007W Saccharomyces
           cerevisiae YAP1 bZip transcription factor required for
           oxidative stress tolerance
          Length = 569

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 23/53 (43%), Positives = 34/53 (64%), Gaps = 1/53 (1%)

Query: 340 CCHILKEISSLPKYSSLDIDNLCCELMTKAEFTDDCEIVVRAHDLQTTLVKQL 392
           C  I   I++ PKYS +DID LC EL TKA+ ++   +VV + D+Q+ L K +
Sbjct: 517 CSEIWDRITAHPKYSDIDIDGLCMELRTKAKCSEKG-VVVNSDDVQSALAKHM 568

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 20/57 (35%), Positives = 39/57 (68%)

Query: 48  KEARLKSLLERIELLEQKDAQNKSVIDFLQSSLKSLLSEVTKYRAKNVNDERILAFL 104
           KE +++ L E++E LE+   Q++   +FL+S L+ L++E+ KYR +  +D ++L +L
Sbjct: 53  KERKMRELEEQVERLEKVREQSEMESEFLRSQLQMLIAEIQKYRPQQSSDSQVLKYL 109

>KLLA0A01760g Chr1 (154859..156610) [1752 bp, 583 aa] {ON}
           uniprot|P56095 Kluyveromyces lactis KLLA0A01760g YAP1
           AP- 1-like transcription factor
          Length = 583

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 22/53 (41%), Positives = 33/53 (62%), Gaps = 1/53 (1%)

Query: 340 CCHILKEISSLPKYSSLDIDNLCCELMTKAEFTDDCEIVVRAHDLQTTLVKQL 392
           C  +   I++ P+YS LDID LC EL TKA+ ++   +VV A D+Q  L+  +
Sbjct: 531 CSEVWDRITAHPRYSDLDIDGLCLELRTKAKCSEKG-VVVNAEDVQKALISHM 582

>KNAG0B03680 Chr2 (707204..708652) [1449 bp, 482 aa] {ON} Anc_5.528
           YDR423C
          Length = 482

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 24/53 (45%), Positives = 34/53 (64%), Gaps = 1/53 (1%)

Query: 340 CCHILKEISSLPKYSSLDIDNLCCELMTKAEFTDDCEIVVRAHDLQTTLVKQL 392
           C  I   I++ PKYS LDID LC ELMTKA+ ++   +VV A D++  L + +
Sbjct: 430 CSEIWDRITAHPKYSDLDIDGLCGELMTKAKCSERG-VVVNADDVKDALNRHI 481

 Score = 40.4 bits (93), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 19/57 (33%), Positives = 35/57 (61%)

Query: 48  KEARLKSLLERIELLEQKDAQNKSVIDFLQSSLKSLLSEVTKYRAKNVNDERILAFL 104
           KE ++K L  +++ L +   QN+   +FL+  L +L+ E+ KYR +  ND ++L +L
Sbjct: 68  KERKMKELEAKVDKLTRIQKQNEVESEFLRGQLVTLVHELKKYRPETSNDSKVLEYL 124

>YML007W Chr13 (253848..255800) [1953 bp, 650 aa] {ON}  YAP1Basic
           leucine zipper (bZIP) transcription factor required for
           oxidative stress tolerance; activated by H2O2 through
           the multistep formation of disulfide bonds and transit
           from the cytoplasm to the nucleus; mediates resistance
           to cadmium
          Length = 650

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 22/53 (41%), Positives = 33/53 (62%), Gaps = 1/53 (1%)

Query: 340 CCHILKEISSLPKYSSLDIDNLCCELMTKAEFTDDCEIVVRAHDLQTTLVKQL 392
           C  I   I++ PKYS +D+D LC ELM KA+ ++   +V+ A D+Q  L K +
Sbjct: 598 CSEIWDRITTHPKYSDIDVDGLCSELMAKAKCSERG-VVINAEDVQLALNKHM 649

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 20/57 (35%), Positives = 36/57 (63%)

Query: 48  KEARLKSLLERIELLEQKDAQNKSVIDFLQSSLKSLLSEVTKYRAKNVNDERILAFL 104
           KE ++K L ++++ LE    QN+    FL+  L +L++E+ KYR +  ND ++L +L
Sbjct: 85  KERKMKELEKKVQSLESIQQQNEVEATFLRDQLITLVNELKKYRPETRNDSKVLEYL 141

>Skud_13.147 Chr13 (240056..242053) [1998 bp, 665 aa] {ON} YML007W
           (REAL)
          Length = 665

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 22/53 (41%), Positives = 33/53 (62%), Gaps = 1/53 (1%)

Query: 340 CCHILKEISSLPKYSSLDIDNLCCELMTKAEFTDDCEIVVRAHDLQTTLVKQL 392
           C  I   I++ PKYS +D+D LC ELM KA+ ++   +V+ A D+Q  L K +
Sbjct: 613 CSEIWDRITTHPKYSDIDVDGLCSELMAKAKCSERG-VVINAEDVQLALNKHM 664

 Score = 40.0 bits (92), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 19/57 (33%), Positives = 35/57 (61%)

Query: 48  KEARLKSLLERIELLEQKDAQNKSVIDFLQSSLKSLLSEVTKYRAKNVNDERILAFL 104
           KE ++  L ++++ LE    QN+    FL+  L +L++E+ KYR +  ND ++L +L
Sbjct: 85  KERKMMELEKKVQGLENIQQQNEVEATFLRDQLVTLVNELKKYRPETRNDSKVLEYL 141

>Smik_13.144 Chr13 (242566..244485) [1920 bp, 639 aa] {ON} YML007W
           (REAL)
          Length = 639

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 22/53 (41%), Positives = 33/53 (62%), Gaps = 1/53 (1%)

Query: 340 CCHILKEISSLPKYSSLDIDNLCCELMTKAEFTDDCEIVVRAHDLQTTLVKQL 392
           C  I   I++ PKYS +D+D LC ELM KA+ ++   +V+ A D+Q  L K +
Sbjct: 587 CSEIWDRITTHPKYSDIDVDGLCSELMAKAKCSERG-VVINAEDVQLALNKHM 638

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 20/57 (35%), Positives = 36/57 (63%)

Query: 48  KEARLKSLLERIELLEQKDAQNKSVIDFLQSSLKSLLSEVTKYRAKNVNDERILAFL 104
           KE ++K L ++++ LE    QN+    FL+  L +L++E+ KYR +  ND ++L +L
Sbjct: 85  KERKMKELEKKVQSLESIQQQNEVEATFLRDQLVTLVNELKKYRPETRNDSKVLEYL 141

>Suva_13.155 Chr13 (244425..246362) [1938 bp, 645 aa] {ON} YML007W
           (REAL)
          Length = 645

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 22/53 (41%), Positives = 33/53 (62%), Gaps = 1/53 (1%)

Query: 340 CCHILKEISSLPKYSSLDIDNLCCELMTKAEFTDDCEIVVRAHDLQTTLVKQL 392
           C  I   I++ PKYS +D+D LC ELM KA+ ++   +V+ A D+Q  L K +
Sbjct: 593 CSEIWDRITTHPKYSDIDVDGLCSELMAKAKCSERG-VVINAEDVQLALNKHM 644

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 20/57 (35%), Positives = 35/57 (61%)

Query: 48  KEARLKSLLERIELLEQKDAQNKSVIDFLQSSLKSLLSEVTKYRAKNVNDERILAFL 104
           KE ++K L +++  LE    +N+    FL+  L +L+SE+ KYR +  ND ++L +L
Sbjct: 85  KERKMKELEKKVHSLESIQQENEVEATFLRDQLVTLVSELKKYRPETRNDSKVLEYL 141

>Kwal_47.18631 s47 (904593..906347) [1755 bp, 584 aa] {ON} YML007W
           (YAP1) - jun-like transcription factor [contig 192] FULL
          Length = 584

 Score = 47.4 bits (111), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 23/53 (43%), Positives = 32/53 (60%), Gaps = 1/53 (1%)

Query: 340 CCHILKEISSLPKYSSLDIDNLCCELMTKAEFTDDCEIVVRAHDLQTTLVKQL 392
           C  +   I+S PKYS +DID LC EL TKA+ ++   +VV   D+Q  L K +
Sbjct: 532 CSEVWDRITSHPKYSDIDIDGLCLELRTKAKCSEKG-VVVNIDDVQRALTKHM 583

 Score = 47.4 bits (111), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 22/57 (38%), Positives = 39/57 (68%)

Query: 48  KEARLKSLLERIELLEQKDAQNKSVIDFLQSSLKSLLSEVTKYRAKNVNDERILAFL 104
           KE +++ L E++E LE+   Q++   +FL+S L+ LL+E+ KYR +  +D ++L FL
Sbjct: 53  KERKMRELEEQVERLERVREQSELESEFLRSQLQKLLAEIQKYRPRQSSDSQVLNFL 109

>TBLA0D01640 Chr4 (402610..404409) [1800 bp, 599 aa] {ON} Anc_5.528
           YDR423C
          Length = 599

 Score = 47.4 bits (111), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 23/52 (44%), Positives = 35/52 (67%), Gaps = 1/52 (1%)

Query: 340 CCHILKEISSLPKYSSLDIDNLCCELMTKAEFTDDCEIVVRAHDLQTTLVKQ 391
           C  I   I++LPKY+S DI+NLC ELM+KA+ +D   +VV + D+   L+ +
Sbjct: 539 CTKIWDRITALPKYTSADIENLCNELMSKAKCSDKG-VVVSSLDVDKVLLNE 589

>TPHA0K00520 Chr11 (102027..103709) [1683 bp, 560 aa] {ON} Anc_5.528
           YDR423C
          Length = 560

 Score = 46.6 bits (109), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 22/53 (41%), Positives = 32/53 (60%), Gaps = 1/53 (1%)

Query: 340 CCHILKEISSLPKYSSLDIDNLCCELMTKAEFTDDCEIVVRAHDLQTTLVKQL 392
           C  +   ++  PKYS LDID LC ELM +A+ ++   +VV + D+Q  L K L
Sbjct: 507 CSQVWSRLTEHPKYSELDIDGLCTELMLQAKCSEKG-VVVESRDVQKALSKYL 558

 Score = 38.5 bits (88), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 21/57 (36%), Positives = 34/57 (59%)

Query: 48  KEARLKSLLERIELLEQKDAQNKSVIDFLQSSLKSLLSEVTKYRAKNVNDERILAFL 104
           KE +LK L +++  LEQ +   +   +FL+S LKS+  E+ KYR    +D  +L +L
Sbjct: 59  KERKLKELEDKVLALEQVNEAKELETNFLRSRLKSMADELKKYRPAQSSDLEVLEYL 115

>TPHA0D02340 Chr4 complement(483713..485233) [1521 bp, 506 aa] {ON}
           Anc_5.528 YDR423C
          Length = 506

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 21/54 (38%), Positives = 34/54 (62%), Gaps = 1/54 (1%)

Query: 340 CCHILKEISSLPKYSSLDIDNLCCELMTKAEFTDDCEIVVRAHDLQTTLVKQLL 393
           C  I   I++ P+YS +DID LC ELM  A+ +D   ++V + D+Q  L ++L+
Sbjct: 454 CGEIWDRITTYPRYSDIDIDGLCEELMASAKCSDKG-VLVSSDDVQKVLSRRLV 506

 Score = 34.3 bits (77), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 33/53 (62%)

Query: 48  KEARLKSLLERIELLEQKDAQNKSVIDFLQSSLKSLLSEVTKYRAKNVNDERI 100
           KE ++K L E++  LE  + +N+    FL++ L SL++E+ KYR    +D R+
Sbjct: 37  KEKKMKELQEKVRKLENINEKNEIETVFLRTQLLSLVNELKKYRIDKNDDFRL 89

>Skud_4.697 Chr4 complement(1239012..1239107) [96 bp, 32 aa] {ON}
           YDR423C (INTER)
          Length = 32

 Score = 40.4 bits (93), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 17/32 (53%), Positives = 23/32 (71%)

Query: 349 SLPKYSSLDIDNLCCELMTKAEFTDDCEIVVR 380
           +LPKYS L+ DNLC +LM  A FTDD   +++
Sbjct: 1   TLPKYSPLNTDNLCRQLMVNARFTDDSRAMLQ 32

>Kpol_1023.97 s1023 (225050..226825) [1776 bp, 591 aa] {ON}
           (225050..226825) [1776 nt, 592 aa]
          Length = 591

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 31/53 (58%), Gaps = 1/53 (1%)

Query: 340 CCHILKEISSLPKYSSLDIDNLCCELMTKAEFTDDCEIVVRAHDLQTTLVKQL 392
           C  +   I++ P+YS +DID LC ELM  A+ +D   +VV + D+Q  L   +
Sbjct: 539 CSEVWDRITAHPRYSDIDIDGLCQELMHNAKCSDKG-VVVDSKDVQKALSNHM 590

 Score = 37.4 bits (85), Expect = 0.058,   Method: Compositional matrix adjust.
 Identities = 18/57 (31%), Positives = 35/57 (61%)

Query: 48  KEARLKSLLERIELLEQKDAQNKSVIDFLQSSLKSLLSEVTKYRAKNVNDERILAFL 104
           KE ++K L +++  LE+   QN    +FL++ L  ++ E+ KYR +  +D ++L +L
Sbjct: 75  KERKMKELEDKVHELEKVKQQNDVESEFLRNQLTLMIDELKKYRPEKSSDIKVLEYL 131

>Kpol_1004.22 s1004 complement(45952..47379) [1428 bp, 475 aa] {ON}
           complement(45952..47379) [1428 nt, 476 aa]
          Length = 475

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 21/53 (39%), Positives = 31/53 (58%), Gaps = 1/53 (1%)

Query: 340 CCHILKEISSLPKYSSLDIDNLCCELMTKAEFTDDCEIVVRAHDLQTTLVKQL 392
           C  I   I++ P+Y+ LDID LC ELM  A+ +D   +VV + D+   L K +
Sbjct: 423 CSEIWDRITTNPRYTDLDIDGLCEELMFSAKCSDKG-VVVASKDVHKVLAKHM 474

 Score = 37.0 bits (84), Expect = 0.069,   Method: Compositional matrix adjust.
 Identities = 18/57 (31%), Positives = 36/57 (63%)

Query: 48  KEARLKSLLERIELLEQKDAQNKSVIDFLQSSLKSLLSEVTKYRAKNVNDERILAFL 104
           KE ++K L  ++  LE    +N+   +FL+S + +L++E+ KYR++  +D +IL  +
Sbjct: 62  KEKKMKELENKVNSLENIHQKNEVETEFLRSQVLTLVNELKKYRSETTSDSKILKLV 118

>KAFR0E03290 Chr5 (653300..654097) [798 bp, 265 aa] {ON} Anc_5.528
           YDR423C
          Length = 265

 Score = 35.4 bits (80), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 17/54 (31%), Positives = 34/54 (62%)

Query: 48  KEARLKSLLERIELLEQKDAQNKSVIDFLQSSLKSLLSEVTKYRAKNVNDERIL 101
           KEA+LK L   ++ L+ ++     +I+FL+ ++ +LL E+  YR +   D+++L
Sbjct: 40  KEAKLKLLENEVDKLQLENLSKAEIIEFLKQNVMTLLGEIKNYRKQTNKDKKLL 93

>KAFR0L02140 Chr12 (411877..421464) [9588 bp, 3196 aa] {ON} 
          Length = 3196

 Score = 33.5 bits (75), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 24/73 (32%), Positives = 30/73 (41%), Gaps = 12/73 (16%)

Query: 170 TNTWNFPSENRTDPSAISDKSANDSKKLDFSLDVTFNDKLTGINHLDYDIRSHLSEHFGD 229
           T T ++   N  DP+A    S  DS      LD T    L+G N LD      LS     
Sbjct: 649 TATGSYSGSNSVDPTATGSYSGTDS------LDATATGSLSGTNSLDATATGSLSG---- 698

Query: 230 FSSDKVEPLAFPS 242
             S+ V+P A  S
Sbjct: 699 --SNSVDPTATGS 709

>Ecym_4064 Chr4 (141770..143050) [1281 bp, 426 aa] {ON} similar to
           Ashbya gossypii ADR195C
          Length = 426

 Score = 31.2 bits (69), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 15/44 (34%), Positives = 29/44 (65%)

Query: 48  KEARLKSLLERIELLEQKDAQNKSVIDFLQSSLKSLLSEVTKYR 91
           KE ++K L +++  LE++  Q++  +  L++ + SLL E+ KYR
Sbjct: 73  KERKMKDLEDKVRKLEEQRLQSEREVQSLRNQVVSLLRELKKYR 116

>CAGL0M01738g Chr13 (197743..201900) [4158 bp, 1385 aa] {ON} similar
           to uniprot|P35177 Saccharomyces cerevisiae YBR081c SPT7
           Transcriptional activator
          Length = 1385

 Score = 30.8 bits (68), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 21/49 (42%), Positives = 28/49 (57%), Gaps = 7/49 (14%)

Query: 52  LKSLLERIELLEQKDAQNKSVIDFLQSSLKSLLSEVTKYRAKNVNDERI 100
           LK LL RI+        NK+ ++     LK LL+EV K R+K  +DERI
Sbjct: 376 LKHLLSRIQ-------SNKNKLNISDYELKHLLTEVRKNRSKWTSDERI 417

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.313    0.130    0.368 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 35,508,868
Number of extensions: 1481379
Number of successful extensions: 3819
Number of sequences better than 10.0: 48
Number of HSP's gapped: 3918
Number of HSP's successfully gapped: 72
Length of query: 393
Length of database: 53,481,399
Length adjustment: 112
Effective length of query: 281
Effective length of database: 40,638,807
Effective search space: 11419504767
Effective search space used: 11419504767
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 67 (30.4 bits)