Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Smik_4.6975.527ON81781736840.0
YDR422C (SIP1)5.527ON81581530210.0
Skud_4.6965.527ON81181529960.0
Suva_2.5995.527ON82782928000.0
CAGL0F03047g5.527ON7447909141e-110
NDAI0H016005.527ON8423748781e-104
NCAS0F010905.527ON7873698681e-103
ZYRO0D12562g5.527ON8183998671e-103
TDEL0A039105.527ON7493968354e-99
SAKL0G04928g5.527ON8923828201e-95
KLTH0G03762g5.527ON7093637555e-88
ADR194C5.527ON6373617304e-85
Kwal_47.186425.527ON3093216884e-83
Ecym_40655.527ON7213266873e-78
KNAG0C032305.527ON5613716623e-76
TBLA0D016505.527ON10163596812e-75
KAFR0E033005.527ON4663496045e-69
Kpol_1004.215.527ON7553696042e-66
Kpol_1023.985.527ON6673745052e-53
TPHA0K005305.527ON6463763313e-31
Suva_5.1233.517ON4232851922e-14
Ecym_12103.517ON4502981922e-14
TBLA0I032703.517ON4332861876e-14
YER027C (GAL83)3.517ON4172851832e-13
Kwal_47.190403.517ON429771361e-07
KLLA0B00583g3.517ON486921361e-07
CAGL0A03696g3.517ON415761332e-07
KAFR0I023803.517ON409451323e-07
ZYRO0E08404g3.517ON3482861313e-07
KNAG0B006003.517ON389761313e-07
SAKL0F02002g3.517ON503461323e-07
TDEL0D058503.517ON404771305e-07
KNAG0B036905.527ON3261201295e-07
NCAS0F037303.517ON432771289e-07
NCAS0E006203.517ON500761272e-06
Kpol_195.23.517ON4351731262e-06
Smik_7.553.517ON415911262e-06
TPHA0A058103.517ON424451243e-06
KAFR0F041403.517ON348771233e-06
Smik_5.1503.517ON417401243e-06
Skud_5.1363.517ON418401243e-06
NDAI0B060103.517ON503481234e-06
KNAG0E015903.517ON423411225e-06
KLTH0G01848g3.517ON416461209e-06
Skud_7.603.517ON441771191e-05
NDAI0I028903.517ON582401191e-05
YGL208W (SIP2)3.517ON415761191e-05
Suva_7.533.517ON414771181e-05
AER361C3.517ON475571182e-05
CAGL0K09350g3.517ON432761128e-05
Smik_6.2153.481ON51344743.6
CAGL0K10648g1.377ON101264717.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Smik_4.697
         (817 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Smik_4.697 Chr4 complement(1236081..1238534) [2454 bp, 817 aa] {...  1423   0.0  
YDR422C Chr4 complement(1315326..1317773) [2448 bp, 815 aa] {ON}...  1168   0.0  
Skud_4.696 Chr4 complement(1236293..1238728) [2436 bp, 811 aa] {...  1158   0.0  
Suva_2.599 Chr2 complement(1068063..1070546) [2484 bp, 827 aa] {...  1083   0.0  
CAGL0F03047g Chr6 complement(298906..301140) [2235 bp, 744 aa] {...   356   e-110
NDAI0H01600 Chr8 complement(387297..389825) [2529 bp, 842 aa] {O...   342   e-104
NCAS0F01090 Chr6 complement(215542..217905) [2364 bp, 787 aa] {O...   338   e-103
ZYRO0D12562g Chr4 complement(1061702..1064158) [2457 bp, 818 aa]...   338   e-103
TDEL0A03910 Chr1 complement(701073..703322) [2250 bp, 749 aa] {O...   326   4e-99
SAKL0G04928g Chr7 complement(405798..408476) [2679 bp, 892 aa] {...   320   1e-95
KLTH0G03762g Chr7 complement(297935..300064) [2130 bp, 709 aa] {...   295   5e-88
ADR194C Chr4 complement(1039625..1041538) [1914 bp, 637 aa] {ON}...   285   4e-85
Kwal_47.18642 s47 (908641..909570) [930 bp, 309 aa] {ON} YDR422C...   269   4e-83
Ecym_4065 Chr4 (144003..146168) [2166 bp, 721 aa] {ON} similar t...   269   3e-78
KNAG0C03230 Chr3 (632659..634344) [1686 bp, 561 aa] {ON} Anc_5.5...   259   3e-76
TBLA0D01650 Chr4 (406397..409447) [3051 bp, 1016 aa] {ON} Anc_5....   266   2e-75
KAFR0E03300 Chr5 (654349..655749) [1401 bp, 466 aa] {ON} Anc_5.5...   237   5e-69
Kpol_1004.21 s1004 complement(41725..43992) [2268 bp, 755 aa] {O...   237   2e-66
Kpol_1023.98 s1023 (229891..231894) [2004 bp, 667 aa] {ON} (2298...   199   2e-53
TPHA0K00530 Chr11 (105141..107081) [1941 bp, 646 aa] {ON} Anc_5....   132   3e-31
Suva_5.123 Chr5 complement(184865..186136) [1272 bp, 423 aa] {ON...    79   2e-14
Ecym_1210 Chr1 (423627..424979) [1353 bp, 450 aa] {ON} similar t...    79   2e-14
TBLA0I03270 Chr9 complement(793849..795150) [1302 bp, 433 aa] {O...    77   6e-14
YER027C Chr5 complement(208979..210232) [1254 bp, 417 aa] {ON}  ...    75   2e-13
Kwal_47.19040 s47 complement(1073036..1074325) [1290 bp, 429 aa]...    57   1e-07
KLLA0B00583g Chr2 complement(44819..46279) [1461 bp, 486 aa] {ON...    57   1e-07
CAGL0A03696g Chr1 (377255..378502) [1248 bp, 415 aa] {ON} simila...    56   2e-07
KAFR0I02380 Chr9 (482219..483448) [1230 bp, 409 aa] {ON} Anc_3.5...    55   3e-07
ZYRO0E08404g Chr5 complement(672301..673347) [1047 bp, 348 aa] {...    55   3e-07
KNAG0B00600 Chr2 (97910..99079) [1170 bp, 389 aa] {ON} Anc_3.517...    55   3e-07
SAKL0F02002g Chr6 (167591..169102) [1512 bp, 503 aa] {ON} simila...    55   3e-07
TDEL0D05850 Chr4 complement(1062927..1064141) [1215 bp, 404 aa] ...    55   5e-07
KNAG0B03690 Chr2 (708946..709926) [981 bp, 326 aa] {ON} Anc_5.52...    54   5e-07
NCAS0F03730 Chr6 complement(750798..752096) [1299 bp, 432 aa] {O...    54   9e-07
NCAS0E00620 Chr5 (106661..108163) [1503 bp, 500 aa] {ON} Anc_3.517     54   2e-06
Kpol_195.2 s195 complement(4330..5637) [1308 bp, 435 aa] {ON} co...    53   2e-06
Smik_7.55 Chr7 (92235..93482) [1248 bp, 415 aa] {ON} YGL208W (REAL)    53   2e-06
TPHA0A05810 Chr1 complement(1317530..1318804) [1275 bp, 424 aa] ...    52   3e-06
KAFR0F04140 Chr6 complement(814903..815949) [1047 bp, 348 aa] {O...    52   3e-06
Smik_5.150 Chr5 complement(213879..215132) [1254 bp, 417 aa] {ON...    52   3e-06
Skud_5.136 Chr5 complement(206871..208127) [1257 bp, 418 aa] {ON...    52   3e-06
NDAI0B06010 Chr2 complement(1460221..1461732) [1512 bp, 503 aa] ...    52   4e-06
KNAG0E01590 Chr5 complement(317054..318325) [1272 bp, 423 aa] {O...    52   5e-06
KLTH0G01848g Chr7 (136780..138030) [1251 bp, 416 aa] {ON} simila...    51   9e-06
Skud_7.60 Chr7 (102699..104024) [1326 bp, 441 aa] {ON} YGL208W (...    50   1e-05
NDAI0I02890 Chr9 complement(682274..684022) [1749 bp, 582 aa] {O...    50   1e-05
YGL208W Chr7 (97338..98585) [1248 bp, 415 aa] {ON}  SIP2One of t...    50   1e-05
Suva_7.53 Chr7 (93895..95139) [1245 bp, 414 aa] {ON} YGL208W (REAL)    50   1e-05
AER361C Chr5 complement(1307677..1309104) [1428 bp, 475 aa] {ON}...    50   2e-05
CAGL0K09350g Chr11 complement(922651..923949) [1299 bp, 432 aa] ...    48   8e-05
Smik_6.215 Chr6 complement(354154..355695) [1542 bp, 513 aa] {ON...    33   3.6  
CAGL0K10648g Chr11 complement(1036025..1039063) [3039 bp, 1012 a...    32   7.5  

>Smik_4.697 Chr4 complement(1236081..1238534) [2454 bp, 817 aa] {ON}
           YDR422C (REAL)
          Length = 817

 Score = 1423 bits (3684), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 704/817 (86%), Positives = 704/817 (86%)

Query: 1   MGNSPSTQDPSHSTKKEHGYHFHETFNKDRQGSITSQLFNNRKSIHKRHVSHTSGHNGTI 60
           MGNSPSTQDPSHSTKKEHGYHFHETFNKDRQGSITSQLFNNRKSIHKRHVSHTSGHNGTI
Sbjct: 1   MGNSPSTQDPSHSTKKEHGYHFHETFNKDRQGSITSQLFNNRKSIHKRHVSHTSGHNGTI 60

Query: 61  PSRMQLLASHDSVTDCDDSVNDDTTIDKEPSLLFKKDYSLNNTADGNDTTLANLSLIDDH 120
           PSRMQLLASHDSVTDCDDSVNDDTTIDKEPSLLFKKDYSLNNTADGNDTTLANLSLIDDH
Sbjct: 61  PSRMQLLASHDSVTDCDDSVNDDTTIDKEPSLLFKKDYSLNNTADGNDTTLANLSLIDDH 120

Query: 121 DVGAPEEQVKSPSFLSPGPSMATVKQTKSDLENLSTSNYTTVDEATEDGRTNHPRHERHR 180
           DVGAPEEQVKSPSFLSPGPSMATVKQTKSDLENLSTSNYTTVDEATEDGRTNHPRHERHR
Sbjct: 121 DVGAPEEQVKSPSFLSPGPSMATVKQTKSDLENLSTSNYTTVDEATEDGRTNHPRHERHR 180

Query: 181 SSIIALKKTLLENXXXXXXXXXXXXXXXXXXMPPLTKMDSIDTPLKPAYSKKPSIHAYQY 240
           SSIIALKKTLLEN                  MPPLTKMDSIDTPLKPAYSKKPSIHAYQY
Sbjct: 181 SSIIALKKTLLENSATASPSPTRSSSVHSASMPPLTKMDSIDTPLKPAYSKKPSIHAYQY 240

Query: 241 QYLSPDPTFSGNSQAGKEKNSDNIDAEAGVLQSEDMVLNQSLLQNALKKDMQRLSRAXXX 300
           QYLSPDPTFSGNSQAGKEKNSDNIDAEAGVLQSEDMVLNQSLLQNALKKDMQRLSRA   
Sbjct: 241 QYLSPDPTFSGNSQAGKEKNSDNIDAEAGVLQSEDMVLNQSLLQNALKKDMQRLSRANSS 300

Query: 301 XXXXXXXXXXXXXXXXXXXXXXXXKEDSGSFNDNSNVPISATAKMMMKLYGDKTLMERDL 360
                                   KEDSGSFNDNSNVPISATAKMMMKLYGDKTLMERDL
Sbjct: 301 NSTCTIENSNNNNNYSSSENNIRNKEDSGSFNDNSNVPISATAKMMMKLYGDKTLMERDL 360

Query: 361 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQSKKSILTNSLNLQPLHPLHPIINDNES 420
                                           QSKKSILTNSLNLQPLHPLHPIINDNES
Sbjct: 361 NKHQTKTKKVQNKKLKSVSNSRRSSFASLHSLQSKKSILTNSLNLQPLHPLHPIINDNES 420

Query: 421 QYSAPQHREXXXXXXXXXXXXXXXXXXXXXXTLVILKWKNYSNMAVTTEVSIVSNDIASA 480
           QYSAPQHRE                      TLVILKWKNYSNMAVTTEVSIVSNDIASA
Sbjct: 421 QYSAPQHREMSHPSNSMSSMSSISSTNSAESTLVILKWKNYSNMAVTTEVSIVSNDIASA 480

Query: 481 LKEQREVDADESASLDSEKQLNPRIRMVYDNVHKEWFFPDLFLPPGIYRLQFSINGLLTH 540
           LKEQREVDADESASLDSEKQLNPRIRMVYDNVHKEWFFPDLFLPPGIYRLQFSINGLLTH
Sbjct: 481 LKEQREVDADESASLDSEKQLNPRIRMVYDNVHKEWFFPDLFLPPGIYRLQFSINGLLTH 540

Query: 541 SNYLPTATDSEGNFVNWFEVLPGYHTIEPFRNEADLGSQVEPVLEEESPIRPELXXXXXX 600
           SNYLPTATDSEGNFVNWFEVLPGYHTIEPFRNEADLGSQVEPVLEEESPIRPEL      
Sbjct: 541 SNYLPTATDSEGNFVNWFEVLPGYHTIEPFRNEADLGSQVEPVLEEESPIRPELKRFSSS 600

Query: 601 XXXXXXXXAKGVERPSTPFSDYRGLSRSSSVNMRDSFVRLKASSLDLMAEIKPEKLEYSN 660
                   AKGVERPSTPFSDYRGLSRSSSVNMRDSFVRLKASSLDLMAEIKPEKLEYSN
Sbjct: 601 SRKSSYYSAKGVERPSTPFSDYRGLSRSSSVNMRDSFVRLKASSLDLMAEIKPEKLEYSN 660

Query: 661 EIPNLFNIADGGTTSVIRESRDSSPQEQPSFTYKVVDCNQDDLFATLQQGGNIDAETAET 720
           EIPNLFNIADGGTTSVIRESRDSSPQEQPSFTYKVVDCNQDDLFATLQQGGNIDAETAET
Sbjct: 661 EIPNLFNIADGGTTSVIRESRDSSPQEQPSFTYKVVDCNQDDLFATLQQGGNIDAETAET 720

Query: 721 VFLSRYPIPDLPIYLNSSYLNKILNQSNPNSEPHDRDEGAINHIIPHVNLNHLLTSSIRD 780
           VFLSRYPIPDLPIYLNSSYLNKILNQSNPNSEPHDRDEGAINHIIPHVNLNHLLTSSIRD
Sbjct: 721 VFLSRYPIPDLPIYLNSSYLNKILNQSNPNSEPHDRDEGAINHIIPHVNLNHLLTSSIRD 780

Query: 781 EIISVACTTRYEGKFITQVIYAPCYYKTQKARGNNEN 817
           EIISVACTTRYEGKFITQVIYAPCYYKTQKARGNNEN
Sbjct: 781 EIISVACTTRYEGKFITQVIYAPCYYKTQKARGNNEN 817

>YDR422C Chr4 complement(1315326..1317773) [2448 bp, 815 aa] {ON}
           SIP1Alternate beta-subunit of the Snf1p kinase complex,
           may confer substrate specificity; vacuolar protein
           containing KIS (Kinase-Interacting Sequence) and ASC
           (Association with Snf1 kinase Complex) domains involved
           in protein interactions
          Length = 815

 Score = 1168 bits (3021), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 584/815 (71%), Positives = 630/815 (77%)

Query: 1   MGNSPSTQDPSHSTKKEHGYHFHETFNKDRQGSITSQLFNNRKSIHKRHVSHTSGHNGTI 60
           MGNSPSTQDPSHSTKKEHG+HFH+ FNKDRQGSITSQLFNNRKS HKR  SHTS HNG I
Sbjct: 1   MGNSPSTQDPSHSTKKEHGHHFHDAFNKDRQGSITSQLFNNRKSTHKRRASHTSEHNGAI 60

Query: 61  PSRMQLLASHDSVTDCDDSVNDDTTIDKEPSLLFKKDYSLNNTADGNDTTLANLSLIDDH 120
           P RMQLLASHD  TDCD  ++ DTTIDK PS LFKKDYSL++ AD NDTTLANL+L DDH
Sbjct: 61  PPRMQLLASHDPSTDCDGRMSSDTTIDKGPSHLFKKDYSLSSAADVNDTTLANLTLSDDH 120

Query: 121 DVGAPEEQVKSPSFLSPGPSMATVKQTKSDLENLSTSNYTTVDEATEDGRTNHPRHERHR 180
           DVGAPEEQVKSPSFLSPGPSMATVK+TKSDL++LST NYT VDE TE+ R + P HERHR
Sbjct: 121 DVGAPEEQVKSPSFLSPGPSMATVKRTKSDLDDLSTLNYTMVDETTENERNDKPHHERHR 180

Query: 181 SSIIALKKTLLENXXXXXXXXXXXXXXXXXXMPPLTKMDSIDTPLKPAYSKKPSIHAYQY 240
           SSIIALKK LLE+                  +P LTK DSID P++  YSKKPSIHAYQY
Sbjct: 181 SSIIALKKNLLESSATASPSPTRSSSVHSASLPALTKTDSIDIPVRQPYSKKPSIHAYQY 240

Query: 241 QYLSPDPTFSGNSQAGKEKNSDNIDAEAGVLQSEDMVLNQSLLQNALKKDMQRLSRAXXX 300
           QYL+ D TFS NSQ  KE NSD++DAEAGVLQSEDMVLNQSLLQNALKKDMQRLSR    
Sbjct: 241 QYLNNDETFSENSQMDKEGNSDSVDAEAGVLQSEDMVLNQSLLQNALKKDMQRLSRVNSS 300

Query: 301 XXXXXXXXXXXXXXXXXXXXXXXXKEDSGSFNDNSNVPISATAKMMMKLYGDKTLMERDL 360
                                   K ++G  ND+   PISATAKMMMKLYGDKTLMERDL
Sbjct: 301 NSMYTAERISHANNNGNIENNTRNKGNAGGSNDDFTAPISATAKMMMKLYGDKTLMERDL 360

Query: 361 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQSKKSILTNSLNLQPLHPLHPIINDNES 420
                                           QS+KSILTN LNLQPLHPLHPIINDNES
Sbjct: 361 NKHHNKTKKAQNKKIRSVSNSRRSSFASLHSLQSRKSILTNGLNLQPLHPLHPIINDNES 420

Query: 421 QYSAPQHREXXXXXXXXXXXXXXXXXXXXXXTLVILKWKNYSNMAVTTEVSIVSNDIASA 480
           QYSAPQHRE                      TLV+LKWK+   +A TTEV IVS DIASA
Sbjct: 421 QYSAPQHREISHHSNSMSSMSSISSTNSTENTLVVLKWKDDGTVAATTEVFIVSTDIASA 480

Query: 481 LKEQREVDADESASLDSEKQLNPRIRMVYDNVHKEWFFPDLFLPPGIYRLQFSINGLLTH 540
           LKEQRE+  DE+ASLDSEKQLNPRIRMVYD+VHKEWF PDLFLP GIYRLQFSING+LTH
Sbjct: 481 LKEQRELTLDENASLDSEKQLNPRIRMVYDDVHKEWFVPDLFLPAGIYRLQFSINGILTH 540

Query: 541 SNYLPTATDSEGNFVNWFEVLPGYHTIEPFRNEADLGSQVEPVLEEESPIRPELXXXXXX 600
           SN+LPTATDSEGNFVNWFEVLPGYHTIEPFRNEAD+ SQVEP L+EE P RPEL      
Sbjct: 541 SNFLPTATDSEGNFVNWFEVLPGYHTIEPFRNEADIDSQVEPTLDEELPKRPELKRFPSS 600

Query: 601 XXXXXXXXAKGVERPSTPFSDYRGLSRSSSVNMRDSFVRLKASSLDLMAEIKPEKLEYSN 660
                   AKGVERPSTPFSDYRGLSRSSS+NMRDSFVRLKASSLDLMAE+KPE+L YSN
Sbjct: 601 SRKSSYYSAKGVERPSTPFSDYRGLSRSSSINMRDSFVRLKASSLDLMAEVKPERLVYSN 660

Query: 661 EIPNLFNIADGGTTSVIRESRDSSPQEQPSFTYKVVDCNQDDLFATLQQGGNIDAETAET 720
           EIPNLFNI DG T SV  +S D  PQE PSFT++VVDCNQDDLFATLQQGGNIDAETAE 
Sbjct: 661 EIPNLFNIGDGSTISVKGDSDDVHPQEPPSFTHRVVDCNQDDLFATLQQGGNIDAETAEA 720

Query: 721 VFLSRYPIPDLPIYLNSSYLNKILNQSNPNSEPHDRDEGAINHIIPHVNLNHLLTSSIRD 780
           VFLSRYP+PDLPIYLNSSYLN+ILNQSN NSE H+RDEGAINHIIPHVNLNHLLTSSIRD
Sbjct: 721 VFLSRYPVPDLPIYLNSSYLNRILNQSNQNSESHERDEGAINHIIPHVNLNHLLTSSIRD 780

Query: 781 EIISVACTTRYEGKFITQVIYAPCYYKTQKARGNN 815
           EIISVACTTRYEGKFITQV+YAPCYYKTQK++ +N
Sbjct: 781 EIISVACTTRYEGKFITQVVYAPCYYKTQKSQISN 815

>Skud_4.696 Chr4 complement(1236293..1238728) [2436 bp, 811 aa] {ON}
           YDR422C (REAL)
          Length = 811

 Score = 1158 bits (2996), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 584/815 (71%), Positives = 623/815 (76%), Gaps = 4/815 (0%)

Query: 1   MGNSPSTQDPSHSTKKEHGYHFHETFNKDRQGSITSQLFNNRKSIHKRHVSHTSGHNGTI 60
           MGNSPSTQDPSHS+K+ HGYH HE FNKDRQGSITSQLFNN+KS+HKRH SH S H   I
Sbjct: 1   MGNSPSTQDPSHSSKRNHGYHLHEAFNKDRQGSITSQLFNNKKSVHKRHTSHASSHKAAI 60

Query: 61  PSRMQLLASHDSVTDCDDSVNDDTTIDKEPSLLFKKDYSLNNTADGNDTTLANLSLIDDH 120
           P RMQLLASHD  +DCD SVN+DT IDKEPS LFKKDYSL N AD NDTTLANLSL DDH
Sbjct: 61  PHRMQLLASHDVASDCDSSVNNDTIIDKEPSPLFKKDYSLANAADENDTTLANLSLNDDH 120

Query: 121 DVGAPEEQVKSPSFLSPGPSMATVKQTKSDLENLSTSNYTTVDEATEDGRTNHPRHERHR 180
           D  APEEQVKSPSFLSPGPSMATVKQTKSDL++LST N T VDE  E+ R+ HP HERHR
Sbjct: 121 DGSAPEEQVKSPSFLSPGPSMATVKQTKSDLDDLSTVNCTVVDETMENERSGHPHHERHR 180

Query: 181 SSIIALKKTLLENXXXXXXXXXXXXXXXXXXMPPLTKMDSIDTPLKPAYSKKPSIHAYQY 240
           SSIIALKKTL+EN                  +PPLTK  SID P+K  YSKKPS+HAYQY
Sbjct: 181 SSIIALKKTLMENSATASPSPTRSSSVHSASLPPLTKTGSIDIPVKQTYSKKPSVHAYQY 240

Query: 241 QYLSPDPTFSGNSQAGKEKNSDNIDAEAGVLQSEDMVLNQSLLQNALKKDMQRLSRAXXX 300
           QYLSPDPTFSGNS  GKE N DNIDAEAGVLQSEDMVLNQSLLQNALKKDMQRLSRA   
Sbjct: 241 QYLSPDPTFSGNSHTGKEANGDNIDAEAGVLQSEDMVLNQSLLQNALKKDMQRLSRANSS 300

Query: 301 XXXXXXXXXXXXXXXXXXXXXXXXKEDSGSFNDNSNVPISATAKMMMKLYGDKTLMERDL 360
                                   KE+S   +D+S VPISATAKMMMKLYGDKTLMERDL
Sbjct: 301 NSTYTMGRENRINNSESNIDG---KENSIDPSDDSTVPISATAKMMMKLYGDKTLMERDL 357

Query: 361 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQSKKSILTNSLNLQPLHPLHPIINDNES 420
                                           QSKKSILTN LNLQPLHPLHPIINDNES
Sbjct: 358 NKHQNKTKKAQNKKLRSASNSRRSSFASLHSLQSKKSILTNGLNLQPLHPLHPIINDNES 417

Query: 421 QYSAPQHREXXXXXXXXXXXXXXXXXXXXXXTLVILKWKNYSNMAVTTEVSIVSNDIASA 480
           QYSAPQHRE                      TLV+LKWK+ +NM  TTEVSIVSNDIASA
Sbjct: 418 QYSAPQHREISHHSNSISSMSSISSTNSTENTLVVLKWKSDTNMTATTEVSIVSNDIASA 477

Query: 481 LKEQREVDADESASLDSEKQLNPRIRMVYDNVHKEWFFPDLFLPPGIYRLQFSINGLLTH 540
           LKEQREV+ D+ ASLDSEK LN RIRM+YD+VH+EWF PDLFLP GIYRLQFSINGLLTH
Sbjct: 478 LKEQREVNLDDDASLDSEKPLNSRIRMIYDSVHREWFVPDLFLPAGIYRLQFSINGLLTH 537

Query: 541 SNYLPTATDSEGNFVNWFEVLPGYHTIEPFRNEADLGSQVEPVLEEESPIRPELXXXXXX 600
           SN+LPTATDSEGNFVNWFEVLPGYHTIEPFR+EAD+  Q+   L+EE+PIRPE       
Sbjct: 538 SNFLPTATDSEGNFVNWFEVLPGYHTIEPFRDEADMDFQMRSTLDEEAPIRPE-PKRLSS 596

Query: 601 XXXXXXXXAKGVERPSTPFSDYRGLSRSSSVNMRDSFVRLKASSLDLMAEIKPEKLEYSN 660
                   AK  ERP TPFSDYRGLSRS+SV +R SFVRLKASSLDLMAEIKPEKLEYSN
Sbjct: 597 SRKSSYYSAKDGERPGTPFSDYRGLSRSNSVFLRGSFVRLKASSLDLMAEIKPEKLEYSN 656

Query: 661 EIPNLFNIADGGTTSVIRESRDSSPQEQPSFTYKVVDCNQDDLFATLQQGGNIDAETAET 720
           EIPNLFNI +  TT+        SPQ++PSFT+KVVDCNQDDLFATLQQGGNIDAETAE 
Sbjct: 657 EIPNLFNIGEASTTTSKDHFERLSPQDRPSFTHKVVDCNQDDLFATLQQGGNIDAETAEA 716

Query: 721 VFLSRYPIPDLPIYLNSSYLNKILNQSNPNSEPHDRDEGAINHIIPHVNLNHLLTSSIRD 780
           VFLSRYPIPDLPIYLNSSYLN+ILNQSNPNSE HD DEG INHIIPHVNLNHLLTSSIRD
Sbjct: 717 VFLSRYPIPDLPIYLNSSYLNRILNQSNPNSEFHDGDEGGINHIIPHVNLNHLLTSSIRD 776

Query: 781 EIISVACTTRYEGKFITQVIYAPCYYKTQKARGNN 815
           EIISVACTTRYEGKFITQVIYAPCYYKTQKA GNN
Sbjct: 777 EIISVACTTRYEGKFITQVIYAPCYYKTQKAGGNN 811

>Suva_2.599 Chr2 complement(1068063..1070546) [2484 bp, 827 aa] {ON}
           YDR422C (REAL)
          Length = 827

 Score = 1083 bits (2800), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 559/829 (67%), Positives = 603/829 (72%), Gaps = 18/829 (2%)

Query: 1   MGNSPSTQDPSHSTKKEHGYHFHETFNKDRQGSITSQLFNNRKSIHKRHVSHTSGHNGTI 60
           MGNSPSTQDPSHS KK+H +H HE FNKDRQGSITSQLFNNRKSIHKRH SH +  N  I
Sbjct: 1   MGNSPSTQDPSHSAKKDHSHHLHEAFNKDRQGSITSQLFNNRKSIHKRHSSHANYDNAAI 60

Query: 61  PSRMQLLASH---DSVTDCDDSVNDDTTIDKEPSLLFKKDYSLNNTADGNDTTLANLSLI 117
           P RMQLLAS     S +DCDDS N+D +   EPS LFKKDYS+   AD N+TTLANLSL 
Sbjct: 61  PPRMQLLASQPSTSSTSDCDDSTNNDVSAASEPSPLFKKDYSVAKAADDNETTLANLSLY 120

Query: 118 DDHDVGAPEEQVKSPSFLSPGPSMATVKQTKSDLENLSTSNYTTVDEATEDGRTNHPRHE 177
           D HD  APEEQVKSP+FLSPGPSMATVKQTK+  ++LST N T VDE   D R +HP HE
Sbjct: 121 DRHDASAPEEQVKSPTFLSPGPSMATVKQTKNYPDDLSTVNNTIVDETIGDERKDHPHHE 180

Query: 178 RHRSSIIALKKTLLENXXXXXXXXXXXXXXXXXXMPPLTKMDSIDTPLKPAYSKKPSIHA 237
           RHRSSIIALKKTLLEN                  + PL+K  SID P+K  YSKKPS+HA
Sbjct: 181 RHRSSIIALKKTLLENSATASPSPTRSSSIHSTSLLPLSKAGSIDIPIKQTYSKKPSVHA 240

Query: 238 YQYQYLSPDPTFSGNSQAGKEKNSDNIDAEAGVLQSEDMVLNQSLLQNALKKDMQRLSRA 297
           YQYQYL PDPT S +SQ  KE  SDNIDAEAGVLQSEDMVLNQSLLQNALKKD+QRLSR 
Sbjct: 241 YQYQYLDPDPTLSDDSQLDKESKSDNIDAEAGVLQSEDMVLNQSLLQNALKKDIQRLSRV 300

Query: 298 XXXXXXXXXXXXXXXXXXXXXXXXXXX-----------KEDSGSFNDNSNVPISATAKMM 346
                                                 KE+S   ND+S  PISATAKMM
Sbjct: 301 NSSNSTYTIDSATHNNNNNNNNNSNSNNSSNSENNIGYKENSSDSNDDSGAPISATAKMM 360

Query: 347 MKLYGDKTLMERDLXXXXXXXXXXXXXXXXXXXXXXXXXX-XXXXXXQSKKSILTNSLNL 405
           MKLYGDKTLMERDL                                 Q +KS+LTNSLNL
Sbjct: 361 MKLYGDKTLMERDLNKHQNKSLKKVQNKKLRSASNSRRSSFASLHSLQPRKSVLTNSLNL 420

Query: 406 QPLHPLHPIINDNESQYSAPQHREXXXXXXXXXXXXXXXXXXXXXXTLVILKWKNYSNMA 465
           QPLHPLHPIINDN+SQYS PQHRE                      TLVILKWKN SNM 
Sbjct: 421 QPLHPLHPIINDNDSQYSVPQHREIPHHYNSMSSMSSISSTNSSESTLVILKWKNNSNMP 480

Query: 466 VTTEVSIVSNDIASALKEQREVDADESASLDSEKQLNPRIRMVYDNVHKEWFFPDLFLPP 525
            TTEVSI+S+DIAS LKEQ EV+ DE ASLDSEKQLNPRIRM+YD VHKEWF P+LFLPP
Sbjct: 481 ATTEVSIISHDIASTLKEQLEVNLDEDASLDSEKQLNPRIRMIYDAVHKEWFVPELFLPP 540

Query: 526 GIYRLQFSINGLLTHSNYLPTATDSEGNFVNWFEVLPGYHTIEPFRNEADLGSQVEPVLE 585
           GIYRLQFSING+LTHSN+LPTATDSEG FVNWFEVLPGYHTIEPFR+EAD  SQV   ++
Sbjct: 541 GIYRLQFSINGILTHSNFLPTATDSEGKFVNWFEVLPGYHTIEPFRDEADTESQVGSTID 600

Query: 586 EESPIRPELXXXXXXXXXXXXXXAKGVERPSTPFSDYRGLSRSSSVNMRDSFVRLKASSL 645
            E+PIRPE               AKGVERPSTPFSDYRGLSRS+S N+RDSFVRLKASSL
Sbjct: 601 VEAPIRPEPKRLSSSSRKSSYYSAKGVERPSTPFSDYRGLSRSNSANLRDSFVRLKASSL 660

Query: 646 DLMAEIKPEKLEYSNEIPNLFNIADGGTTSVIRESRDSSPQEQPSFTYKVVDCNQDDLFA 705
           DLMA+IKPE LEYSNEIP+LF I +G  T +     D   Q+ PSFT+KVVDCNQDDLFA
Sbjct: 661 DLMAQIKPEILEYSNEIPSLFTIGNGSATPI---QEDLPSQDLPSFTHKVVDCNQDDLFA 717

Query: 706 TLQQGGNIDAETAETVFLSRYPIPDLPIYLNSSYLNKILNQSNPNSEPHDRDEGAINHII 765
           TLQQGGNIDAETAE VFLSRYPIPDLPIYLNSSYLNKILNQ NPNSE  D+DEGAINHII
Sbjct: 718 TLQQGGNIDAETAEIVFLSRYPIPDLPIYLNSSYLNKILNQGNPNSESGDKDEGAINHII 777

Query: 766 PHVNLNHLLTSSIRDEIISVACTTRYEGKFITQVIYAPCYYKTQKARGN 814
           PHVNLNHLLTSSIRDEIISVACTTRYEGKFITQVIYAPCYYKTQKA GN
Sbjct: 778 PHVNLNHLLTSSIRDEIISVACTTRYEGKFITQVIYAPCYYKTQKAHGN 826

>CAGL0F03047g Chr6 complement(298906..301140) [2235 bp, 744 aa] {ON}
           similar to uniprot|P32578 Saccharomyces cerevisiae
           YDR422c SIP1 multicopy suppressor of SNF1
          Length = 744

 Score =  356 bits (914), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 275/790 (34%), Positives = 371/790 (46%), Gaps = 136/790 (17%)

Query: 93  LFKKDYSLNNTA------DGNDTTLANLSLIDDHDVGAPEEQVKSPSFLSPGPSMATVKQ 146
           LFK+DYS+   A      +  D  +A LSL      G+      +    SPGPS ATV+ 
Sbjct: 4   LFKEDYSVTKEASEPEADESIDVNMAGLSLTSSMGDGS------ALHISSPGPSNATVQT 57

Query: 147 TKSDLENLSTSNYTTVDEA----TEDGRTNHPR-HERHRSSIIALKKTLLENXXXXXXXX 201
            K ++        T  DE+    ++D    H R    HR SI+ALK +L E         
Sbjct: 58  IKREV--------THGDESPQGDSDDINAQHSRAMSEHRPSIVALKMSLKEVAEAAAAKR 109

Query: 202 XXXXXXXXXXM----------------------PPLTKMDSIDTPL----KPAYSKKPSI 235
                     +                      P +T+  SID P     + + ++  + 
Sbjct: 110 KNLPFRTINNVMDSQRSSISSSRDEIFVDASPSPVVTRTASIDIPRSEDGRRSSNRLVNS 169

Query: 236 HAYQYQYLSPDPTFSGNSQAGKEKNSDNIDAEAGVLQSEDMVLNQSLLQNALKKDMQRLS 295
             Y Y Y  P     G             D + G+LQ  D+VLNQ LL+ ALK+DM+R  
Sbjct: 170 KPYLYNY-EPSGVPVG-------------DPDGGMLQGTDVVLNQELLEQALKRDMKR-K 214

Query: 296 RAXXXXXXXXXXXXXXXXXXXXXXXXXXXKEDSGSFNDNSNVPISATAKMMMKLYGDKTL 355
           RA                            ++     +    P SATA MMM+LYGD+TL
Sbjct: 215 RADTMQSSTVELNKKVDTNTSKNSNHTEIMKNPPETAE----PTSATAAMMMRLYGDRTL 270

Query: 356 MERDLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQSKKSILTN-SLNLQPLHPLHPI 414
           + + +                                  K+ IL+N +LNLQPL P+ P 
Sbjct: 271 LNQQITKQKEDENKYSHTITNAAYKKLKPFSGV------KRKILSNPNLNLQPLEPIRP- 323

Query: 415 INDNESQYSAPQHREXXXXXXXXXXXXXXXXXXXXXXTLVILKWKNYSNMAVTTE--VSI 472
              NE   S  +                         T VILKW++  N +   E  V +
Sbjct: 324 ---NEPPTSGQR--------TPNNSAHVHSESPSPDRTNVILKWRDSQNQSNNKELKVYL 372

Query: 473 VSNDIASALKEQREVDADESASLDSEKQLNPRIRMVYDNVHKEWFFPDLFLPPGIYRLQF 532
           VSN+I ++LK   ++ A+         Q N +I + YD+ + EW+ PDL+LP GIYRLQF
Sbjct: 373 VSNEICASLKNDDKLFAEGKLLATDNSQFN-KIPLSYDSHNNEWYVPDLYLPQGIYRLQF 431

Query: 533 SINGLLTHSNYLPTATDSEGNFVNWFEVLPGYHTIEPFRNEA----DLGSQVEPVLE--- 585
            +NG L HS++LPTATD +GN +NWFEVL GY  IEP+R+E+    D  S V+  LE   
Sbjct: 432 LVNGNLVHSDFLPTATDDQGNIMNWFEVLRGYDRIEPYRDESEIQSDYTSSVDTTLEGME 491

Query: 586 ----------------EESPIRPELXX----XXXXXXXXXXXXAKGVERPSTPFSDYRGL 625
                             +P+   L                  AK  E+  T FSDY G+
Sbjct: 492 NNGFQGSSDNSTTSMRNNNPVALNLQAPAPSKAQASRNSSYYSAKSFEKSITQFSDYTGV 551

Query: 626 SRSSSVNMRDSFVR---LKASSLDLMAEIKPEKLEYSNEIPNLFNIA--------DGGTT 674
           SR++S+    S +     + + L+    IKP+  EYSN IP LF I+        D GT 
Sbjct: 552 SRTNSMVSAVSPINNANTRDNDLEFFPPIKPKVYEYSNNIPALFRISCDMEDVDDDNGTE 611

Query: 675 SVIRESRDSSPQEQPSFTYKVVDCNQDDLFATLQQGGNIDAETAETVFLSRYPIPDLPIY 734
           +  R   D     +PSFT +VVDCNQD LF  LQ+GG +DAE AE +FL +Y +PDLP+Y
Sbjct: 612 NNPRAFYD-----RPSFTNRVVDCNQDALFGDLQKGGKMDAEEAENLFLKKYQVPDLPVY 666

Query: 735 LNSSYLNKILNQSNPNSEPHDRDEGAINHIIPHVNLNHLLTSSIRDEIISVACTTRYEGK 794
           LNS+YLNKI ++ +  + P  +D  +INHIIPHVNL HLLTSSIRD I+SVACTTRY GK
Sbjct: 667 LNSTYLNKIFHEFHQVAGPSTQD-SSINHIIPHVNLKHLLTSSIRDGIVSVACTTRYAGK 725

Query: 795 FITQVIYAPC 804
           FITQVIYAPC
Sbjct: 726 FITQVIYAPC 735

>NDAI0H01600 Chr8 complement(387297..389825) [2529 bp, 842 aa] {ON}
           Anc_5.527 YDR422C
          Length = 842

 Score =  342 bits (878), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 190/374 (50%), Positives = 244/374 (65%), Gaps = 26/374 (6%)

Query: 454 VILKWKNYSNMAVTTEVSIVSNDIASALKEQREVDADESASLDSEKQLNPRIRMVYDNVH 513
           V+LKW++  +     +++I+S+DI +AL    E  + +  S  +    N  + MV++ + 
Sbjct: 479 VVLKWRDQIDNPKKCKIAIISDDIVNAL----ESSSSKRKSNTNNNDNN-TLPMVFNPMI 533

Query: 514 KEWFFPDLFLPPGIYRLQFSINGLLTHSNYLPTATDSEGNFVNWFEVLPGYHTIEPFRNE 573
           KEW+ P+L LPPGIYRL+FSIN  +THSN+LPTATDS GN VNWFEVLPGY  +EP+R+E
Sbjct: 534 KEWYMPNLTLPPGIYRLKFSINNDITHSNFLPTATDSMGNIVNWFEVLPGYDAVEPYRDE 593

Query: 574 ADLGSQVEPVLEEESPIRPELX----XXXXXXXXXXXXXAKGVERPSTPFSDYRGLSRSS 629
                 +E      +P +  L                  AK      TP+SDY G+SRSS
Sbjct: 594 I-----IETTFHT-APSQGTLSVHDLTMIRSRRSSSFVSAKSDLSSFTPYSDYAGISRSS 647

Query: 630 S----VNMRDSFVRLKASS-LDLMAEIKPEKLEYSNEIPNLFNIADGGTTSVIRESRD-S 683
           S       + S V L+ ++ LDL   I+P+K+ YS EIP LF IA+   T+ +    D S
Sbjct: 648 SSVGTATKKASLVSLRGTNKLDLFTPIEPKKIAYSKEIPELFKIANSEDTNKMEIDDDGS 707

Query: 684 SPQEQPSFTYKVVDCNQDDLFATLQQGGNIDAETAETVFLSRYPIPDLPIYLNSSYLNKI 743
           SP E+PSFT+KV+DCNQD LFA LQ+ GNIDAETAE +FL+RYPIPDLPIYLNS+YLNKI
Sbjct: 708 SPFERPSFTHKVIDCNQDKLFADLQRDGNIDAETAEALFLNRYPIPDLPIYLNSTYLNKI 767

Query: 744 LN----QSNPNSEPHDRDEGAINHIIPHVNLNHLLTSSIRDEIISVACTTRYEGKFITQV 799
                 Q N  + P     G + HIIPHVNLNHLLTSSIRDEIISVACTTRY+GKFITQV
Sbjct: 768 FTQFQKQHNDPTLPASSSIG-LTHIIPHVNLNHLLTSSIRDEIISVACTTRYQGKFITQV 826

Query: 800 IYAPCYYKTQKARG 813
           +YAPC Y +Q+ + 
Sbjct: 827 MYAPCNYSSQENKA 840

 Score =  121 bits (304), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 127/416 (30%), Positives = 179/416 (43%), Gaps = 109/416 (26%)

Query: 1   MGNSPSTQDPSHST----KKEHGYHFHETFN-------KDRQGSITSQLFNNRKSIHKRH 49
           MGN+PST D  ++     +K+ G+H             K+R+GSITS LF+++ S  KRH
Sbjct: 1   MGNNPSTTDSENTAADLQEKKAGFHNKHLTRIQKQESPKERKGSITSHLFSSKGS-SKRH 59

Query: 50  VSHTSGHNGTIPSRMQL---LASHDSVTDCDDSVNDDTTIDKEPSLLFKKDYSLN----- 101
                     +P  ++    + SH+                     +FKKDYS++     
Sbjct: 60  --------ALMPKPIEAQGNIKSHN---------------------VFKKDYSMDEPLTN 90

Query: 102 ----NTADGND----TTLANLSLIDDHDVGAPEEQVKSPSFLSPGPSMATVKQTKSDLEN 153
                  D ND     T+A+LSL+   D     E+ KS SF  PGPS  TV+ TK D+ +
Sbjct: 91  KGGIKNNDFNDENIHETMASLSLVTSSD----NERKKSMSFARPGPSTPTVQPTKHDITS 146

Query: 154 L--STSNYTTVDEATEDGRTNHPRHERHRSSIIALKKTLLEN--------XXXXXXXXXX 203
           L  ST   T +D     G  N      HR SI+ALK TL E+                  
Sbjct: 147 LEGSTDVNTGIDNMNVAGDLN-----SHRPSIVALKNTLAESSIHPPSDLSKTVSTSSNC 201

Query: 204 XXXXXXXXMPPLTKMDSIDTPLKPAYS----------KKPSIHAYQYQYLSPDPTFSGNS 253
                      L K +SID P + +            K P++H+YQYQY + + T   N+
Sbjct: 202 QSFSTESSSSALHKTESIDIPRRHSQGFNENYNETMLKHPTVHSYQYQYFNNENT---NN 258

Query: 254 QAGKEKNSDNI----------DAEAGVLQSEDMVLNQSLLQNALKKDMQRLSRAXXXXXX 303
             G  K+ +N           D E+GVLQS D+V+NQS LQNALK+DM+R          
Sbjct: 259 DGGLHKHKENFNDMQLSTSNDDEESGVLQSADIVVNQSTLQNALKRDMKR---------- 308

Query: 304 XXXXXXXXXXXXXXXXXXXXXKEDSGSFNDNSNVPISATAKMMMKLYGDKTLMERD 359
                                K++  +        +SATA MM+KLYGD TL E++
Sbjct: 309 KRTDTISTNKSGAPTSDALKAKDEPEAKTKTEKPAMSATAAMMLKLYGDTTLKEKE 364

>NCAS0F01090 Chr6 complement(215542..217905) [2364 bp, 787 aa] {ON}
           Anc_5.527 YDR422C
          Length = 787

 Score =  338 bits (868), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 183/369 (49%), Positives = 236/369 (63%), Gaps = 35/369 (9%)

Query: 454 VILKWKNYSNMAVTTEVSIVSNDIASALKEQREVDADESASLDSEKQLNPRIRMVYDNVH 513
           V+LKW++  +     ++SIVS+DI+SA+  +    A ++           ++ M+++ + 
Sbjct: 430 VVLKWRDQIDNPKHCKISIVSDDISSAIPAK----ATKAG----------KLPMLFNPMI 475

Query: 514 KEWFFPDLFLPPGIYRLQFSINGLLTHSNYLPTATDSEGNFVNWFEVLPGYHTIEPFRNE 573
           KEW+ P+L LPPGIYRL+FSING LTHSN+LPTATDS GN VNWFEVLPGY T+EP+R+E
Sbjct: 476 KEWYVPNLLLPPGIYRLKFSINGDLTHSNFLPTATDSMGNIVNWFEVLPGYDTVEPYRDE 535

Query: 574 ADLGSQVEPVLE---EESPIRPELXXXXXXXXXXXXXXAKGVERPSTPFSDYRGLSRSSS 630
                 +E        +  +R                 A G     TP+SDY G+SRS+S
Sbjct: 536 I-----IETTFHTNGSQGTLRDNNPTTIRSRRSSSFVSANGDLASMTPYSDYTGISRSNS 590

Query: 631 V--NMRDSFVRLKA-SSLDLMAEIKPEKLEYSNEIPNLFNIADG-----GTTSVIRESRD 682
              + R S V L+    LDL   ++P+K+EYSNEIP LF I++              +  
Sbjct: 591 ALNSKRTSLVSLRGVGKLDLFTPMEPKKIEYSNEIPELFKISNSIEDEDDDEGDYGHNET 650

Query: 683 SSPQEQPSFTYKVVDCNQDDLFATLQQGGNIDAETAETVFLSRYPIPDLPIYLNSSYLNK 742
            SP E+PSFT +VVDCNQD LF+ LQ+ GNIDAETAE +FL++Y +PDLPIYLNSSYLNK
Sbjct: 651 LSPFEEPSFTNRVVDCNQDKLFSDLQKNGNIDAETAEMLFLNKYQVPDLPIYLNSSYLNK 710

Query: 743 ILNQ-----SNPNSEPHDRDEGAINHIIPHVNLNHLLTSSIRDEIISVACTTRYEGKFIT 797
           I  Q     ++P    +      I HIIPHVNLNHLLTSSIRDEIISVACTTRY+GKFIT
Sbjct: 711 IFLQFQKQHNDPTPSANTASTIGITHIIPHVNLNHLLTSSIRDEIISVACTTRYQGKFIT 770

Query: 798 QVIYAPCYY 806
           QV+YAPC Y
Sbjct: 771 QVMYAPCNY 779

 Score = 98.6 bits (244), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 109/413 (26%), Positives = 171/413 (41%), Gaps = 127/413 (30%)

Query: 1   MGNSPSTQDPSHSTKKE-------------HGYHFHETFNKDRQGSITSQLFNNRKSIHK 47
           MGN+PS+ + +   K+E             H  H  +    +R+GSI+S LF N+ S  K
Sbjct: 3   MGNNPSSSEHTQKDKEEEEEEEAIKDTIILHNKHL-DHLQDERKGSISSNLFTNKNS-SK 60

Query: 48  RHVSHTSGHNGTIPSRMQLLASHDSVTDCDDSVNDDTTIDKEPSLLFKKDYSLNNTA-DG 106
           RH +               + S   VT+       D   +   ++ FKK YS++ +  D 
Sbjct: 61  RHATS--------------IMSQSKVTN-------DNIQNPPETVFFKKGYSISRSMQDD 99

Query: 107 NDTTLANLSLIDDHDVGAP------------EEQVKSPSFLSPGPSMATVKQTKSDLENL 154
           +D      + +D  ++  P            +E  KS SF+SPGP+  TV+QTK D+   
Sbjct: 100 SDIKTEGQATVDSENIHEPMASLSLKTSMENDENRKSFSFMSPGPANPTVEQTKHDV--- 156

Query: 155 STSNYTTVDEATEDGRTNHPRHERHRSSIIALKKTL----------LENXXXXXXXXXXX 204
                           TN      HR SI+ LK+TL          ++            
Sbjct: 157 ----------------TNKENSFEHRPSIVTLKQTLSGTKVTNDNNIDKLNKTISSSSNS 200

Query: 205 XXXXXXXMPPLT-KMDSIDTPLKPAYS---------KKPSIHAYQYQYLSPDPTFSGNSQ 254
                     +  +  SID P +  Y+         K+ S+HAYQ+ Y + +   + N  
Sbjct: 201 QSVSTASSSSIANRTGSIDIPKENRYNFKDAMDTIPKQHSVHAYQHDYFTINDENARNGS 260

Query: 255 AGKEKNSDNIDAEAGVLQSEDMVLNQSLLQNALKKDMQRLSRAXXXXXXXXXXXXXXXXX 314
            G+   S + ++E GVLQ+ D+VLNQS L++A+K+DM+R                     
Sbjct: 261 DGRLSTSGD-NSEPGVLQNVDIVLNQSFLKDAMKRDMKR--------------------- 298

Query: 315 XXXXXXXXXXKEDSGSFNDNSNV--------PISATAKMMMKLYGDKTLMERD 359
                     + D+G+     ++        PISATA MM+KLYGDK  ME++
Sbjct: 299 ---------KRTDTGASTATPDIEKPTEKKKPISATAAMMLKLYGDKNQMEKE 342

>ZYRO0D12562g Chr4 complement(1061702..1064158) [2457 bp, 818 aa]
           {ON} some similarities with uniprot|P32578 Saccharomyces
           cerevisiae YDR422C SIP1 Alternate beta-subunit of the
           Snf1p kinase complex may confer substrate specificity
           vacuolar protein containing KIS (Kinase-Interacting
           Sequence) and ASC (Association with Snf1 kinase Complex)
           domains involved in protein interactions
          Length = 818

 Score =  338 bits (867), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 191/399 (47%), Positives = 235/399 (58%), Gaps = 66/399 (16%)

Query: 454 VILKWKNYSNMAVTTEVSIVSNDIASALKEQREVDADESASLDSEKQLNPRIRMVYDNVH 513
           V +KW+++  +  T  +S+VS DIAS L  +R+     +              M Y+   
Sbjct: 441 VAIKWRDHLPVDGTNRMSMVSEDIASTLSFERQKHGARNT-----------FPMRYEEET 489

Query: 514 KEWFFPDLFLPPGIYRLQFSINGLLTHSNYLPTATDSEGNFVNWFEVLPGYHTIEPFRNE 573
           KEW  PDL LP G+YRLQF ING LTHSNYLPTATDS GNFVNWFEV+PGY  +EP+R+E
Sbjct: 490 KEWVVPDLVLPVGVYRLQFLINGELTHSNYLPTATDSVGNFVNWFEVIPGYEKVEPYRDE 549

Query: 574 ADLGSQVEP-----------------------VLEEESP----IRPELXXXXXXXXXXXX 606
            +L S  +P                       VL E  P    +RP L            
Sbjct: 550 VELDSG-QPLNAGNNGIAGSVLSLENQGSEGTVLMEPVPGKVNVRPPLASMHHS------ 602

Query: 607 XXAKGVERPSTPFSDYRGLSRSSSVNMRDSFVRLKASSLDLMAEIKPEKLEYSNEIPNLF 666
             +  V R +TP+SDY G+SRSSS  +R S +    SSLDL   ++P+K +YSNEIP LF
Sbjct: 603 --SNRVIRSNTPYSDYTGISRSSSA-LRKSPINCTTSSLDLHTALQPKKYKYSNEIPELF 659

Query: 667 NIADGGTTSVIRESRD---------------SSPQEQPSFTYKVVDCNQDDLFATLQQGG 711
             A    T    E+ D                 P     F  +VVDCNQD+LF  LQQGG
Sbjct: 660 KTAP--ITKANDENEDFTFGHMEPPTYDWARGHPSSNAGFGNQVVDCNQDELFTELQQGG 717

Query: 712 NIDAETAETVFLSRYPIPDLPIYLNSSYLNKILNQSNPNSEPHDRDEGAINHIIPHVNLN 771
            +DAETAE +FL +YP+PDLPIYLNS YLN+I+++   N+ P     G INHIIPHVNLN
Sbjct: 718 LLDAETAEQLFLEKYPVPDLPIYLNSYYLNRIISEFQKNNYPGG-GSGGINHIIPHVNLN 776

Query: 772 HLLTSSIRDEIISVACTTRYEGKFITQVIYAPCYYKTQK 810
           HLLTSSIRDE+ISV CTTRYEGKFITQVIYAPCYY+  +
Sbjct: 777 HLLTSSIRDEMISVGCTTRYEGKFITQVIYAPCYYENGR 815

 Score = 55.5 bits (132), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 88/342 (25%), Positives = 128/342 (37%), Gaps = 106/342 (30%)

Query: 1   MGNSPST------------QDPSHSTKKEHGYHFHETFNKDRQGSITSQLFNNRKSIHKR 48
           MGN+PS             Q+ ++S+ +     +    +K RQ SITSQLF +RK+ H  
Sbjct: 1   MGNTPSAHQRVGRKGSENFQESNNSSNRYSQTKYLLEVDKGRQSSITSQLFPSRKTRHA- 59

Query: 49  HVSHTSGHNGTIPSRMQLLASHDSVTDCDDSVNDDTTIDKEPSLLFKKDYSLNNTADG-- 106
                SG  G +  + Q +  H                   P  LFKK+YSL   + G  
Sbjct: 60  ----PSGL-GNLKRKTQNVVPH-------------------PPSLFKKNYSLEEASAGAQ 95

Query: 107 ------------------------NDT---------TLANLSLIDDHDVGAPEEQVKSPS 133
                                   NDT          +A LS+   ++ G        P 
Sbjct: 96  GPNNNNNDNHNVTLMAADDDPRDFNDTKTSTESVRENMAGLSIKSSNETG--------PM 147

Query: 134 FLSPGPSMATVKQTKSDLENLSTSNYTTVDEATEDGRTNHPRHERHRSSIIALKKTLLEN 193
           F SPGP+  TV+ TK              +EA      N   H  +R S++ALKK L E+
Sbjct: 148 FFSPGPATPTVQPTK--------------EEAIPPMDDNMIFH--NRQSVVALKKNLEES 191

Query: 194 XXXXXXXXXXXXXXXXXXMPPLTKMDSIDTPLKPAYSKKPSIHAYQYQYLSPDPTFSGNS 253
                                 T+   ID        ++    A      +   T +G  
Sbjct: 192 EQPSSRSGSSANME--------TRTTPIDNRRLKPLPRQAVAAAITATATTAPATPNGRP 243

Query: 254 QAGKEKNSDNID--AEAGVLQSEDMVLNQSLLQNALKKDMQR 293
               +  S +ID  ++ G L S+D+VLNQSLL N +K+DM+R
Sbjct: 244 SIDTDPESSDIDNISDDGYLHSKDIVLNQSLLHNVIKRDMKR 285

>TDEL0A03910 Chr1 complement(701073..703322) [2250 bp, 749 aa] {ON}
           Anc_5.527 YDR422C
          Length = 749

 Score =  326 bits (835), Expect = 4e-99,   Method: Compositional matrix adjust.
 Identities = 180/396 (45%), Positives = 232/396 (58%), Gaps = 60/396 (15%)

Query: 454 VILKWKNYSNMAVTTEVSIVSNDIASALKEQREVDADESASLD-SEKQLNPRIRMVYDNV 512
           VILKW++        +++I+S DIASAL            + D S+K  +    M YD  
Sbjct: 376 VILKWRDQIEDPSKCKITIISTDIASAL------------NFDPSDKSFHGTFSMKYDEK 423

Query: 513 HKEWFFPDLFLPPGIYRLQFSINGLLTHSNYLPTATDSEGNFVNWFEVLPGYHTIEPFRN 572
              ++ P+L LPPGIY+ QF ING + HSN LP+ATDS GN VNWFEV+PGY ++EPFRN
Sbjct: 424 ENNFYVPNLSLPPGIYKFQFVINGEIRHSNLLPSATDSVGNIVNWFEVIPGYESVEPFRN 483

Query: 573 EADLGSQ--VEPVLEEES--------------------PIRPELXXXXXXXXXXXXXXAK 610
           E D      ++P   + S                    P RP L                
Sbjct: 484 EIDYHENMGIDPPQSDSSTSTGKHHDESPGKVPLVQPVPGRPPLAARHTSSYSNKQ---- 539

Query: 611 GVERPSTPFSDYRGLSRSSSVNMRDSFVRLKASSLDLMAEIKPEKLEYSNEIPNLFNIAD 670
             ER  TP+SDY G+SR +S   +   +    SS+DL+  ++P+K EYSNEIP LF   +
Sbjct: 540 --ERSGTPYSDYTGVSRCNSAVRKSPLIHQTLSSIDLVTALQPKKYEYSNEIPELFKAGN 597

Query: 671 GGTTSVIRESRDS------------SPQEQPSFTYKVVDCNQDDLFATLQQGGNIDAETA 718
                V+ +S ++               +QPSF   VVDCNQD+LF +LQQGG +DAETA
Sbjct: 598 -----VLGQSDENQFPTPPPPPMNPPSYDQPSFLENVVDCNQDNLFVSLQQGGLLDAETA 652

Query: 719 ETVFLSRYPIPDLPIYLNSSYLNKILNQSNPNSEPHDRDEGAINHIIPHVNLNHLLTSSI 778
           E +FL +Y +PDLP+YLNS+YLNKI N+   ++       G +NHIIPHVNLNHLLTSSI
Sbjct: 653 EQLFLEKYTVPDLPVYLNSTYLNKIFNEFQKHNSLGSNSSG-LNHIIPHVNLNHLLTSSI 711

Query: 779 RDEIISVACTTRYEGKFITQVIYAPCYYKTQ-KARG 813
           RDE+ISV CTTRYEGKFITQV+YAPCYY +  KA G
Sbjct: 712 RDEMISVGCTTRYEGKFITQVVYAPCYYASGPKAEG 747

 Score = 80.1 bits (196), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 93/315 (29%), Positives = 129/315 (40%), Gaps = 79/315 (25%)

Query: 1   MGNSPSTQD----PSHSTKKEHGY---HFHETFNKDRQGSITSQLFNNRKSIHKRHVSHT 53
           MGNSPS Q+    P       H +         N  RQ SITSQLF +R +   RHV   
Sbjct: 1   MGNSPSVQEHQQQPHGVLDANHPFRRAQLGNEMNSGRQQSITSQLFPSRNT---RHVG-- 55

Query: 54  SGHNGTIPSRMQLLASHDSVTDCDDSVNDDTTIDKEPSLLFKKDYSLNNTADGNDTTLAN 113
                  P  M              +   +     +P  LFK DYSL +TA+       +
Sbjct: 56  -------PHSM--------------NAKRNRHPHPQPPSLFKSDYSLRSTAEETPANTGS 94

Query: 114 LSLIDDHDVG----APEEQVKSPSFLSPGPSMATVKQTK------SDLENLSTSNYTTVD 163
              I D+  G    +  E  + PSFL+PG S  TV+ T+      +DL+N   +      
Sbjct: 95  TENIRDNMAGLSLKSSNENAQVPSFLTPGHSTPTVQPTRQAAVPAADLKNKLQNGLNQQK 154

Query: 164 EATEDGRTNHPRHERHRSSIIALKKTLLENXXXXXXXXXXXXXXXXXXMPPLTKMDSIDT 223
           E +         H   R S++ALKKTLL++                     +    S+D 
Sbjct: 155 EISS--------HRFQRPSVVALKKTLLDDGELHSTSSRSTSGD-------VVSSASLDI 199

Query: 224 PLKPAYSKKPSIHAYQYQYLSPD-PTFSGNSQAGKEKNSDNID----AEAGVLQSEDMVL 278
                           Y  L+ D PT SG+     + + D  D    ++ G LQSED+VL
Sbjct: 200 ----------------YSALNLDSPTQSGSKAKDTDADPDTSDFDDISDDGYLQSEDVVL 243

Query: 279 NQSLLQNALKKDMQR 293
           NQSLLQN L++DM+R
Sbjct: 244 NQSLLQNVLRRDMKR 258

>SAKL0G04928g Chr7 complement(405798..408476) [2679 bp, 892 aa] {ON}
           some similarities with uniprot|P32578 Saccharomyces
           cerevisiae YDR422C SIP1 Alternate beta-subunit of the
           Snf1p kinase complex may confer substrate specificity
           vacuolar protein containing KIS (Kinase-Interacting
           Sequence) and ASC (Association with Snf1 kinase Complex)
           domains involved in protein interactions
          Length = 892

 Score =  320 bits (820), Expect = 1e-95,   Method: Compositional matrix adjust.
 Identities = 181/382 (47%), Positives = 235/382 (61%), Gaps = 54/382 (14%)

Query: 454 VILKWKNYSNMAVTTEVSIVSNDIASALKEQREVDADESASLDSEKQLNPRIRMVYDNVH 513
           V+LKW++      T ++S++S+DI++ L            +L S K    +I M Y+   
Sbjct: 528 VVLKWRDCIVDPKTCKISVISSDISAVL------------ALQSSK----KIPMEYETTE 571

Query: 514 KEWFFPDLFLPPGIYRLQFSINGLLTHSNYLPTATDSEGNFVNWFEVLPGYHTIEPFRN- 572
           K WF P+L LPPG+Y+LQF ING L HSN+LPTATDS GNFVNWFEVLPGY+ IEP R+ 
Sbjct: 572 KSWFVPNLKLPPGVYKLQFLINGELRHSNFLPTATDSFGNFVNWFEVLPGYYEIEPLRDV 631

Query: 573 -------EADLGSQVEPVLEEES------PI-RPELXXXXXXXXXXXXXXAKGVERPSTP 618
                   +DLG  ++  +   S      PI RP L              +K +ER +TP
Sbjct: 632 PVDSMNYGSDLGVSMKESVNGGSDFTITAPIPRPPL---LSQATSSSYRSSKYIERSTTP 688

Query: 619 FSDYRG-LSRSSSVNMRDSFVRLKASSLDLMAEIKPEKLEYSNEIPNLFNIAD------- 670
           +SDY G LSRS+S   R    + K+SS D+ A + P+K EYS +IP LF + D       
Sbjct: 689 YSDYTGILSRSNSA--RPLLNQKKSSSYDVFAPLPPKKYEYSTDIPELFKVNDEEDHDHD 746

Query: 671 -----GGTTSVIRESRDSSPQEQPSFTYKVVDCNQDDLFATLQQGGNIDAETAETVFLSR 725
                   +S+++ S      EQPSF  +V DCNQD LF+ LQQ   IDA+ AE  FL +
Sbjct: 747 IPEDPPSYSSLLKGSE----AEQPSFHCRVQDCNQDRLFSDLQQHDRIDAQAAEEFFLQK 802

Query: 726 YPIPDLPIYLNSSYLNKILNQSNPNSEPHDRDEGAINHIIPHVNLNHLLTSSIRDEIISV 785
           YP+PDLPIYLNSSYLNK+ NQ   ++   +  +  +N +IPHVNLNHLLTSSIR+EIISV
Sbjct: 803 YPVPDLPIYLNSSYLNKVFNQLQKDNNAGET-KAVVNPVIPHVNLNHLLTSSIREEIISV 861

Query: 786 ACTTRYEGKFITQVIYAPCYYK 807
            CTTRYEGKFIT V+YAPCYY+
Sbjct: 862 GCTTRYEGKFITHVVYAPCYYE 883

 Score = 37.4 bits (85), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 23/61 (37%), Positives = 35/61 (57%), Gaps = 1/61 (1%)

Query: 132 PSFLSPGPSMATVKQTKSDLENLSTSNYTTVDEATEDGRTNHPRHERHRSSIIALKKTLL 191
           P  LSPGP+  TV+ T+ + E L T +    +   +  R   P +  HR SI+ALK++L+
Sbjct: 199 PFPLSPGPASPTVEPTRHEAELLPTRSEVDGEAENDRYRDQFPSY-LHRPSIVALKRSLV 257

Query: 192 E 192
           E
Sbjct: 258 E 258

 Score = 33.5 bits (75), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 12/30 (40%), Positives = 23/30 (76%)

Query: 264 IDAEAGVLQSEDMVLNQSLLQNALKKDMQR 293
           +D   G L+  D++LN ++L++A++KDM+R
Sbjct: 355 LDLSEGFLEDNDVLLNNAVLESAIRKDMKR 384

 Score = 32.3 bits (72), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 34/117 (29%), Positives = 51/117 (43%), Gaps = 25/117 (21%)

Query: 1   MGNSPSTQDPSHSTKKEHGYHFHETFNKDRQGSITSQLFNNRKSIHKRHVSHTSGHN--- 57
           MGN+ ST +      +E  +H H    +DRQ SITSQLF  R + + +  S  S      
Sbjct: 1   MGNTASTVN-----LQEKRHHSH-LLPRDRQHSITSQLFPGRNTRNAQDDSPVSAAAAAA 54

Query: 58  --GTIPSRMQLLASHDSVTDCDDSVNDDTTIDKEPSLLFKKDYSLNNTADGNDTTLA 112
             G    R+              S+N    +   PS LFK +YS+N +++ +   L 
Sbjct: 55  APGKWKRRL--------------SLNHAPAVVSTPSPLFKPNYSMNESSNASIAGLG 97

>KLTH0G03762g Chr7 complement(297935..300064) [2130 bp, 709 aa] {ON}
           similar to uniprot|P32578 Saccharomyces cerevisiae
           YDR422C SIP1 Alternate beta-subunit of the Snf1p kinase
           complex may confer substrate specificity vacuolar
           protein containing KIS (Kinase-Interacting Sequence) and
           ASC (Association with Snf1 kinase Complex) domains
           involved in protein interactions
          Length = 709

 Score =  295 bits (755), Expect = 5e-88,   Method: Compositional matrix adjust.
 Identities = 168/363 (46%), Positives = 214/363 (58%), Gaps = 29/363 (7%)

Query: 452 TLVILKWKNYSNMAVTTEVSIVSNDIASALKEQREVDADESASLDSEKQLNPRIRMVYDN 511
           T VIL WK+      T ++SIVS DI+S L   ++                 +I MV+D 
Sbjct: 361 THVILNWKDNIVDPKTCKMSIVSKDISSTLNPHKKFS---------------KIPMVFDM 405

Query: 512 VHKEWFFPDLFLPPGIYRLQFSINGLLTHSNYLPTATDSEGNFVNWFEVLPGYHTIEPFR 571
               W   DL+LP G+Y+ QF ING L HS+YLPTATDS GN VNWFEV+ G+ +IEP R
Sbjct: 406 ERNCWTAHDLYLPSGVYKFQFLINGELRHSDYLPTATDSFGNCVNWFEVVEGHDSIEPSR 465

Query: 572 N----EADLGSQVEPVLEEESPIRPELXXXXXXXXXXXXXXAKGVERPSTPFSDYRGLSR 627
           +    E    S+ +  +E+ +P RP L              ++ VER  TPFSDY GL  
Sbjct: 466 DVISSEDVKLSKDQIAVEQPAPERPALGSDGSSSSNWKGS-SRHVERSGTPFSDYTGLCS 524

Query: 628 SSSVNMRDSFVRLKASSLDLMAEIKPEKLEYSNEIPNLFNI-ADGGTTSVIRESRD---S 683
            S +  +        SS DL+A +   K EY++EIP LF    DG       E R+    
Sbjct: 525 RSELT-KPELRHNNTSSYDLLAPVPRPKYEYTDEIPELFKANFDGSLVPPPYEERELTKD 583

Query: 684 SPQEQPSFTYKVVDCNQDDLFATLQQGGNIDAETAETVFLSRYPIPDLPIYLNSSYLNKI 743
             Q+ PSF ++V DCNQD LFA LQQ G ID++ AE  FL +YP PDLP+YL+SS+LN +
Sbjct: 584 GSQKPPSFLHRVQDCNQDVLFADLQQNGQIDSQAAEEAFLQQYPTPDLPVYLDSSFLNAV 643

Query: 744 LNQSNPNSEPHDRDEGAINHIIPHVNLNHLLTSSIRDEIISVACTTRYEGKFITQVIYAP 803
            +     ++   R    +NHI+PHVNLNHLLTSSIRDEIISV CTTRYEGKFITQ+IY P
Sbjct: 644 FSGFQDKTDSKTR----VNHIVPHVNLNHLLTSSIRDEIISVGCTTRYEGKFITQIIYTP 699

Query: 804 CYY 806
           CYY
Sbjct: 700 CYY 702

>ADR194C Chr4 complement(1039625..1041538) [1914 bp, 637 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR422C
           (SIP1)
          Length = 637

 Score =  285 bits (730), Expect = 4e-85,   Method: Compositional matrix adjust.
 Identities = 163/361 (45%), Positives = 208/361 (57%), Gaps = 36/361 (9%)

Query: 454 VILKWKNYSNMAVTTEVSIVSNDIASALKEQREVDADESASLDSEKQLNPRIRMVYDNVH 513
           VI+KW++       T++SIVS DIAS +                 K    ++ MV+    
Sbjct: 308 VIIKWRDCLLDPQRTKLSIVSPDIASVI----------------HKNSKRKVAMVFSKDE 351

Query: 514 KEWFFPDLFLPPGIYRLQFSINGLLTHSNYLPTATDSEGNFVNWFEVLPGYHTIEPFRNE 573
           + W  PDL LPPGIY+LQF ING L HSN+LPTATDS  N VNWFEV+P Y   EP+R+ 
Sbjct: 352 QFWVAPDLRLPPGIYKLQFLINGALRHSNFLPTATDSHSNIVNWFEVVPWYDRAEPYRDP 411

Query: 574 A--DLGSQVE-PVLEEESPIRPELXXXXXXXXXXXXXXAKGVERPSTPFSDYRGLSRSSS 630
           A  ++    E P L   +  RP L              A+ VER +TP SDY G+SRS S
Sbjct: 412 APEEVAMPPESPQLTAPAAGRPPLLKRGTSSSSR----ARVVERSNTPISDYTGISRSGS 467

Query: 631 VNMRDSFVRLKASSLDLMAEIKPEKLEYSNEIPNLFNIADGGTTSVIRESRDSSPQEQP- 689
              R      K+++   ++ I    L+YS EIP LF            E     P   P 
Sbjct: 468 A--RPLLAHHKSANSIELSPIPRCVLQYSTEIPELFK----------PEGCPPDPNTAPG 515

Query: 690 SFTYKVVDCNQDDLFATLQQGGNIDAETAETVFLSRYPIPDLPIYLNSSYLNKILNQSNP 749
           SF   + DCNQD+LF  LQ+   + A+ AE V + +YP+PDLP+YLNSSYLN+I  +   
Sbjct: 516 SFNENIQDCNQDELFRFLQEDWKMSAQEAEEVLVEKYPVPDLPVYLNSSYLNEIFTKLQR 575

Query: 750 NSEPHDRDEGAINHIIPHVNLNHLLTSSIRDEIISVACTTRYEGKFITQVIYAPCYYKTQ 809
           +S   D    +  HIIPHVNLNHLLTSSIRDEIISV CTTRYEGKFITQ++YAPCYY++ 
Sbjct: 576 SSVTGDVKRSSFTHIIPHVNLNHLLTSSIRDEIISVGCTTRYEGKFITQIMYAPCYYESS 635

Query: 810 K 810
           +
Sbjct: 636 R 636

 Score = 40.4 bits (93), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 62/271 (22%), Positives = 106/271 (39%), Gaps = 66/271 (24%)

Query: 27  NKDRQGSITSQLFNNRKSIHKRHVSHTSGHNGTIPSRMQLLASHDSVTDCDDSVNDDTTI 86
           ++ RQ SITSQLF+ R   H R             S+ +   + DS T     +      
Sbjct: 36  DRGRQQSITSQLFSGRH--HAR-------------SKWKFQGAGDSATGSSGGI------ 74

Query: 87  DKEPSLLFKKDYSLNNTADG----NDTTLANLSLIDDHDVGAPEEQVKSPSFLSPGPSMA 142
               + +FK DY+LN  A         T   +  +    + A  + ++     SPGPS A
Sbjct: 75  ----ASMFKCDYTLNADARSISSEQGETCQGMPNLAGLVLDACTQGIR-----SPGPSTA 125

Query: 143 TVKQTKSDLENLSTSNYTTVDEATEDGRTNHPRHERHRSSIIALKKTLLENXXXXXXXXX 202
           TV+ T     NL  S    +   T            HR SI ALK++L++          
Sbjct: 126 TVEHT-----NLEASMSPELASQT------------HRPSISALKQSLIQVQGQTNSRHR 168

Query: 203 XXXXXXXXXMPPLTKMDSIDTPLKPAYSKKPSIHAYQYQYLSPDPTFSGNSQAGKEKNSD 262
                    +P  T    ID P        PS +     + + D +   +  +   ++ +
Sbjct: 169 AEDIDTAQYVPSAT----IDIPC-----SNPSTNTASVTHRADDSSTRSSLLSLFTQDVE 219

Query: 263 NIDAEAGVLQSEDMVLNQSLLQNALKKDMQR 293
                   +++ ++VLN+SL+ + ++KD++R
Sbjct: 220 E------YIEASEVVLNESLVDSVVRKDLRR 244

>Kwal_47.18642 s47 (908641..909570) [930 bp, 309 aa] {ON} YDR422C
           (SIP1) - SNF1 protein kinase substrate [contig 191]
           PARTIAL
          Length = 309

 Score =  269 bits (688), Expect = 4e-83,   Method: Compositional matrix adjust.
 Identities = 152/321 (47%), Positives = 190/321 (59%), Gaps = 26/321 (8%)

Query: 507 MVYDNVHKEWFFPDLFLPPGIYRLQFSINGLLTHSNYLPTATDSEGNFVNWFEVLPGYHT 566
           MV+D     W  PDL+LP G+Y+ QF ING L HS +LPTATDS GN VNWFEV+ G+  
Sbjct: 1   MVFDMESNCWIAPDLYLPAGVYKFQFLINGELRHSEFLPTATDSFGNCVNWFEVVAGHKV 60

Query: 567 IEPFR---------NEADLGSQVEPVLEEESPIRPELXXXXXXXXXXXXXXAKGVERPST 617
           IEP R         N+  + +  +P      PI                  AK +ER  T
Sbjct: 61  IEPSRDVISNDFTENQVAISAN-DPSASPRPPI-----LSGSSSFSNWKNSAKHIERSGT 114

Query: 618 PFSDYRGLSRSSSVNMRDSFVRLK-ASSLDLMAEIKPEKLEYSNEIPNLF--NIADGGTT 674
           P+SDY GL   S  ++    +R K  SS DL+A +     EYSNEIP LF  N     T 
Sbjct: 115 PYSDYTGLC--SRTDLAKPELRHKNTSSYDLLAPVPRPVYEYSNEIPELFKANFEGSSTP 172

Query: 675 SVIRESRDSS--PQEQPSFTYKVVDCNQDDLFATLQQGGNIDAETAETVFLSRYPIPDLP 732
              +ES  S    + QPSF ++V DCNQD LFA LQ+ G ID++ AE  FL +YP PDLP
Sbjct: 173 PPYQESVPSQNPVKNQPSFLHRVQDCNQDVLFADLQKNGEIDSQAAEEAFLQQYPTPDLP 232

Query: 733 IYLNSSYLNKILNQSNPNSEPHDRDEGAINHIIPHVNLNHLLTSSIRDEIISVACTTRYE 792
           +YL+SS+LN +        +  +  +  +NHI+PHVNLNHLLTSSIRDEIISV CTTRYE
Sbjct: 233 VYLDSSFLNAVFR----GFQEKNDTKSKLNHIVPHVNLNHLLTSSIRDEIISVGCTTRYE 288

Query: 793 GKFITQVIYAPCYYKTQKARG 813
           GKFITQ+IY PCYY  ++  G
Sbjct: 289 GKFITQIIYTPCYYGNKEKSG 309

>Ecym_4065 Chr4 (144003..146168) [2166 bp, 721 aa] {ON} similar to
           Ashbya gossypii ADR194C
          Length = 721

 Score =  269 bits (687), Expect = 3e-78,   Method: Compositional matrix adjust.
 Identities = 155/326 (47%), Positives = 202/326 (61%), Gaps = 28/326 (8%)

Query: 504 RIRMVYDNVHKEWFFPDLFLPPGIYRLQFSINGLLTHSNYLPTATDSEGNFVNWFEVLPG 563
           +I MVY    + W   DL LP GIY+L F ING + HSNYLPTATDS  N VNWFEV+PG
Sbjct: 399 KIPMVYLEQEQCWAAEDLKLPAGIYKLMFFINGQVRHSNYLPTATDSLSNIVNWFEVVPG 458

Query: 564 YHTIEPFR--------NEADLGSQVEPVLEEESP----IRPELXXXXXXXXXXXXXXAKG 611
           Y  IEP+R        NE    ++   +L  E+P    IRP L              A+ 
Sbjct: 459 YDQIEPYRDAAIERSPNELAAYNETSLLLTNETPSPANIRPPLINRGTSSSSR----ARV 514

Query: 612 VERPSTPFSDYRG-LSRSSSVNMRDSFVRLKAS-SLDLMAEIKPEKLEYSNEIPNLFNIA 669
           +ER +TP SDY G L+R+S  N   +  R K++ S D+    K   L YS+++P LF + 
Sbjct: 515 IERTNTPISDYTGVLARNSCSN--PAIYRHKSNNSTDVDILPKQPTLIYSSDVPELFKVG 572

Query: 670 D---GGTTSVIRESRDSSP----QEQPSFTYKVVDCNQDDLFATLQQGGNIDAETAETVF 722
           +   GG+     +++  +P    Q+ P+F   V DCNQD+LF  LQ+  N++A+ AE VF
Sbjct: 573 NASTGGSQQGSDKNKLQNPSKYLQDSPNFMKNVQDCNQDELFHYLQEKWNMNAQEAEEVF 632

Query: 723 LSRYPIPDLPIYLNSSYLNKILNQSNPNSEPHDR-DEGAINHIIPHVNLNHLLTSSIRDE 781
           L +Y +PDLPIYLNS+ LN+I N+   NS   D     ++ HIIPHVNLNHLLTS+IRDE
Sbjct: 633 LEKYSVPDLPIYLNSTSLNEIFNKLQQNSAMGDLPKRKSLTHIIPHVNLNHLLTSNIRDE 692

Query: 782 IISVACTTRYEGKFITQVIYAPCYYK 807
           IISV CTTRYEGKFITQ++YAPCYY+
Sbjct: 693 IISVGCTTRYEGKFITQIMYAPCYYE 718

 Score = 41.2 bits (95), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 46/174 (26%), Positives = 70/174 (40%), Gaps = 45/174 (25%)

Query: 23  HETFNKDRQGSITSQLFNNRKSIHKRHVSHTSGHNGTIPSRMQLLASHDSVTDCDDSVND 82
           H T  + RQ SITSQLF  R     +  S  +   G +            V   D     
Sbjct: 43  HGTKERVRQQSITSQLFPGRHQARSKWKSQRNVAPGAV----------SGVGGVDH---- 88

Query: 83  DTTIDKEPSLLFKKDYSLNN--TADGNDTTL--ANLSLIDDHDVGAPEEQVKSPSFLSPG 138
                     LFK+DYSL++  +A G +       + LI   +V   +   ++ + +SPG
Sbjct: 89  ----------LFKRDYSLSDDSSAVGMEGVQEEGGVDLIGMPNVAGLKLDSRAQAIMSPG 138

Query: 139 PSMATVKQTKSDLENLSTSNYTTVDEATEDGRTNHPRHERHRSSIIALKKTLLE 192
           PS ATV+ +K                  E   +     + HR SI+ALK+ L++
Sbjct: 139 PSSATVEHSK-----------------LEASISPELAAQVHRPSIVALKQNLIQ 175

>KNAG0C03230 Chr3 (632659..634344) [1686 bp, 561 aa] {ON} Anc_5.527
           YDR422C
          Length = 561

 Score =  259 bits (662), Expect = 3e-76,   Method: Compositional matrix adjust.
 Identities = 155/371 (41%), Positives = 210/371 (56%), Gaps = 41/371 (11%)

Query: 454 VILKWKN-----YSNMAVTTEVSIVSNDIASALKEQREVDADESASLDSEKQLNPRIRMV 508
           VILKW++     Y      T  +I S+DI S L+      A +S  +  E++    +  +
Sbjct: 217 VILKWRDPQLQPYQG----TGAAIKSHDIYSTLR------AIKSELITPERENKEDLLYL 266

Query: 509 -YDNVHKEWFFPDLFLPPGIYRLQFSINGLLTHSNYLPTATDSEGNFVNWFEVLPGYHTI 567
            YD   K+WF PDL+LPPGIYRL+F ING+L HSN+LPTATD+ G  VNWFEVLPGY TI
Sbjct: 267 DYDAKKKDWFVPDLYLPPGIYRLKFLINGMLLHSNFLPTATDAAGTIVNWFEVLPGYETI 326

Query: 568 EPFRNEADLGSQVEPVLEEESPIRPELXXXXXXXXXXXXXXAKGVERPSTPFSDYRGLSR 627
           EP+R+E+ +G   E +  +      ++                       P      L++
Sbjct: 327 EPYRDESMIGQDDESIDSQPYKSTTDVTDYAGISRSSSVVSKHSKSNLRLPNLHITSLNK 386

Query: 628 SSSVNMRDSFVRLKASSLDLMAEIKPEKLEYSNEIPNLFNIADGGT--TSVIRESRDSS- 684
            SS ++ ++    + + + L+ E    K EYS EIP LF   D  T  T+ I+E R  S 
Sbjct: 387 ESSASVNEANETNEGNDIQLLPE---PKYEYSTEIPELFQFDDVNTRKTNDIKEVRKESK 443

Query: 685 -----PQEQPSFTY-KVVDCNQDDLFATLQQGGNIDAETAETVFLSRYPIPDLPIYLNSS 738
                P  +  FT  +VV+ NQD LFA++Q+ G +  E AE  FL+++ + DLPIYLNS+
Sbjct: 444 LETLYPNGKFDFTLARVVNSNQDALFASIQKIGKMTTEEAEEYFLTKFKVSDLPIYLNST 503

Query: 739 YLNKILNQSNPNSEPHDRDEGAINHIIPHVNLNHLLTSSIRDEIISVACTTRYEGKFITQ 798
           YLNK  +             G +NHIIPHVNL HLLT+SI+++II V CTTRY GKFITQ
Sbjct: 504 YLNKNFS-------------GEVNHIIPHVNLRHLLTTSIKEDIICVGCTTRYAGKFITQ 550

Query: 799 VIYAPCYYKTQ 809
           VIYAPC Y  Q
Sbjct: 551 VIYAPCSYDKQ 561

 Score = 49.7 bits (117), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 29/102 (28%), Positives = 53/102 (51%), Gaps = 1/102 (0%)

Query: 259 KNSDNIDAEAGVLQSEDMVLNQSLLQNALKKDMQRLSRAXXXXXXXXXXXXXXXXXXXXX 318
           + ++ +D ++G++Q++D VLNQ++LQ+A+KKDM+R  R                      
Sbjct: 57  QGTEALDPDSGIVQNQDRVLNQAILQHAIKKDMKR-KRNDSNASGTAAAVLHNHRQQQQQ 115

Query: 319 XXXXXXKEDSGSFNDNSNVPISATAKMMMKLYGDKTLMERDL 360
                     G+    ++  +SATA +M+KLYGDK  +  ++
Sbjct: 116 EENVEGPTLVGAQTGAASGEMSATAAIMLKLYGDKNQLAHEV 157

>TBLA0D01650 Chr4 (406397..409447) [3051 bp, 1016 aa] {ON} Anc_5.527
            YDR422C
          Length = 1016

 Score =  266 bits (681), Expect = 2e-75,   Method: Compositional matrix adjust.
 Identities = 151/359 (42%), Positives = 221/359 (61%), Gaps = 34/359 (9%)

Query: 468  TEVSIVSNDIASALKEQREVDADESASLDSEKQLNPRIRMVYDNVHKEWFFPDLFLPPGI 527
            T++ ++S DI + L         ++  L +E   N ++ +VY+   K W  P+L LPPGI
Sbjct: 680  TKIQLISKDINTTLHY-------DTTDLLTE---NNKMELVYNKDEKAWILPNLMLPPGI 729

Query: 528  YRLQFSINGLLTHSNYLPTATDSEGNFVNWFEVLPGYHTIEPFRNE----ADL--GSQVE 581
            Y++QF +N  L HS++LPTATD  GN VNWFEVL GY  IEPFR+E    AD   G+ ++
Sbjct: 730  YQVQFLVNSDLKHSDFLPTATDDFGNIVNWFEVLSGYDFIEPFRDENISSADNSDGTLMQ 789

Query: 582  PVLEEESPIRPELXXXXXXXXXXXXXXAKGVERPSTPFSDYRGLSRSSSVNMRDSFVRLK 641
             ++ E+                     A    + STP S+Y G+SRS+S++   S    K
Sbjct: 790  NIIPEK------------LKTISMTKMAGNGSKGSTPRSNYTGVSRSNSLSASSSSSVWK 837

Query: 642  ASSLDLMAEIKPEKLEYSNEIPNLF-NIADGGTTSVIRESRDSSPQEQPSFTYKVVDCNQ 700
            + +++L   ++P K+EYS EIP +F N  +  T++   +      +++P   + VVDC+Q
Sbjct: 838  SVNVNLFTPLEPNKVEYSTEIPEIFKNTTENNTSNAPMQYHPE--RKRPGLLHNVVDCSQ 895

Query: 701  DDLFATLQQGGNIDAETAETVFLSRYPIPDLPIYLNSSYLNKI---LNQSNPNSEPHDRD 757
            ++LF  L   G +D ETAE +FL +YP+P+LPIYLNS Y+ +I   +NQ + +  P   +
Sbjct: 896  EELFGDLLADGLMDTETAEQMFLDKYPVPELPIYLNSKYMTQIVGEINQPSGSGPPSSLN 955

Query: 758  EGAINHIIPHVNLNHLLTSSIRDEIISVACTTRYEGKFITQVIYAPCYYKTQKARGNNE 816
               +NHIIPHVNL HLLTSSIR+E+ISVACTTRYEGKF+TQ++Y PC+Y+  K+  NNE
Sbjct: 956  NNDLNHIIPHVNLQHLLTSSIREEMISVACTTRYEGKFLTQILYTPCFYENLKSGENNE 1014

>KAFR0E03300 Chr5 (654349..655749) [1401 bp, 466 aa] {ON} Anc_5.527
           YDR422C
          Length = 466

 Score =  237 bits (604), Expect = 5e-69,   Method: Compositional matrix adjust.
 Identities = 142/349 (40%), Positives = 199/349 (57%), Gaps = 46/349 (13%)

Query: 455 ILKWKNYSNMAVTTEVSIVSNDIASALKEQREVDADESASLDSEKQLNPRIRMVYDNVHK 514
           ILKW+    +   + V+IVS DI S L    +       +    K+   +I ++YD V  
Sbjct: 157 ILKWR--EPIDHNSAVAIVSKDIVSTLLTIAKTHKSSIITFIERKKF--KINLLYDIVTN 212

Query: 515 EWFFPDLFLPPGIYRLQFSINGLLTHSNYLPTATDSEGNFVNWFEVLPGYHTIEPFRNEA 574
           EW+ P+LFLPPGIY+LQF ING L HSNYLPTAT++ GN VNWFEV+ GY TIEP+R+E 
Sbjct: 213 EWYLPNLFLPPGIYKLQFLINGNLIHSNYLPTATNANGNIVNWFEVICGYKTIEPYRDE- 271

Query: 575 DLGSQVEPVLEEESPIRPELXXXXXXXXXXXXXXAKGVERPSTPFSDYRGLSRSSSVNMR 634
                 E ++  E     E                      S   +DY G+SRSSS+   
Sbjct: 272 ------ERIIHREKSTANE-------------------SISSNSLTDYAGISRSSSIVSN 306

Query: 635 DSFVRLKASSLDLMAEIKPEKLEYSNEIPNLFNIADGGTTSVIRESRDSSPQEQPSFTYK 694
            S +   +  L  +  +  ++++Y+NEIP +F       ++V  ++ D S         K
Sbjct: 307 KSSLISSSLKLTNL-NLNDDEIKYTNEIPEIFKFDSTANSNVNNQAFDMSLS-------K 358

Query: 695 VVDCNQDDLFATLQQGGNIDAETAETVFLSRYPIPDLPIYLNSSYLNKILNQSNPNSEPH 754
           V+D NQD +FA+LQ+   ++ + AE  FL+R+ I DLPIYLNS++LNKI           
Sbjct: 359 VIDLNQDHVFASLQKIARMNTDEAENYFLNRFKIHDLPIYLNSNFLNKIF--------IR 410

Query: 755 DRDEGAINHIIPHVNLNHLLTSSIRDEIISVACTTRYEGKFITQVIYAP 803
           D +    N+ +PHVNLNHLLT+SI+D+ + VACTTRY GKFITQ++YAP
Sbjct: 411 DNNNETTNNTVPHVNLNHLLTTSIKDDTLCVACTTRYVGKFITQIMYAP 459

>Kpol_1004.21 s1004 complement(41725..43992) [2268 bp, 755 aa] {ON}
           complement(41725..43992) [2268 nt, 756 aa]
          Length = 755

 Score =  237 bits (604), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 141/369 (38%), Positives = 207/369 (56%), Gaps = 33/369 (8%)

Query: 454 VILKWKNYSNMAVTTEVSIVSNDIASALKEQREVDADESASLDSEKQLNPRIRMVYDNVH 513
           V LKW++  +      +SIVSN+I S +    ++D++ S S           RMVY    
Sbjct: 396 VFLKWRDLIDDIENANISIVSNEILSVIC-MNDLDSENSDSA----------RMVYYPDT 444

Query: 514 KEWFFPDLFLPPGIYRLQFSINGLLTHSNYLPTATDSEGNFVNWFEVLPGYHTIEPFRNE 573
            EW    LFLPPGIY+LQF++NG L HS+YLPTATD+ GN VNWFEV  GY +IEPFR+ 
Sbjct: 445 SEWVTKYLFLPPGIYKLQFNVNGSLRHSDYLPTATDNLGNIVNWFEVPRGYESIEPFRDN 504

Query: 574 ADLGSQVEPVLEEESPIRPELXXXXXXXXXXXXXXAKGVERPSTPFSDYRGLSRSSSVNM 633
             + +++   + +  P    +              +    RP+TP+SD+ G++RSS + +
Sbjct: 505 DYVKNEISGGILQPIPNTLGIPSVSSQLSSFSFHAS----RPTTPYSDFAGINRSSPLPL 560

Query: 634 RDSFVRLKASSLDL-MAEIKPE-KLEYSNEIPNLFNIAD---GGTTSVIRESRDSSPQEQ 688
           R+    +K+++ DL  +   PE K +Y+ EIP ++   D       +    + D    + 
Sbjct: 561 REKSPDVKSTNFDLEFSTAVPEPKYDYTTEIPEIYKAVDLDLTTAKATETTTDDEDITKP 620

Query: 689 P--------SFTYKVVDCNQDDLFATLQQ--GGNIDAETAETVFLSRYPIPDLPIYLNSS 738
           P        S    V+ C+Q DLF  L +  G  ++ +  E +FL++YPI DLPIYLN+ 
Sbjct: 621 PLYLGTGGNSIFNDVIGCSQRDLFEKLSKNTGKGLNTDELEKIFLAKYPITDLPIYLNTD 680

Query: 739 YLNKILNQSNPNSEPHD---RDEGAINHIIPHVNLNHLLTSSIRDEIISVACTTRYEGKF 795
           Y+NK L Q        D    +   +NHI+PHVN+ HLLT +I+D +I+VACT RY GKF
Sbjct: 681 YMNKALEQHRNIVGVDDVMQEEINVVNHIVPHVNIKHLLTHNIQDSVIAVACTVRYGGKF 740

Query: 796 ITQVIYAPC 804
           ITQV+Y+PC
Sbjct: 741 ITQVVYSPC 749

 Score = 48.9 bits (115), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 52/173 (30%), Positives = 83/173 (47%), Gaps = 31/173 (17%)

Query: 28  KDRQGSITSQLFNNRKSIHKRHVSHTSGHNGTIPSRMQLLASHDSVTDCDDSVNDDTTID 87
           K RQGSI S+LF +R + ++  +                LA+ +++T    ++N   T  
Sbjct: 36  KQRQGSIRSELFTSRNNSNRNKI-------------YSELAARNNLT----TINSSNTNV 78

Query: 88  KEPSLLFKKDYSL-------NNTADGNDTTLANLSLIDDHDVGAPEEQVKSPSFLSPGPS 140
           KE   LFKKDYS+       N+  +  D T  + +      + +  +   +PSF S GPS
Sbjct: 79  KES--LFKKDYSMGRHPNTVNHVKNRVDFTRNSSNEYSSSSLSSNTDSAYTPSFFSLGPS 136

Query: 141 MATVKQTKSDLENLSTSNYTTVDEAT-EDGRTNHPRHERHRSSIIALKKTLLE 192
            ATV+Q+   +  L   ++   + A+ +D   NH     HR SI+ALK+ L E
Sbjct: 137 TATVEQSTEKVIRLDEQHHPHQNLASKKDIVINH----EHRPSILALKQNLYE 185

>Kpol_1023.98 s1023 (229891..231894) [2004 bp, 667 aa] {ON}
           (229891..231894) [2004 nt, 668 aa]
          Length = 667

 Score =  199 bits (505), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 126/374 (33%), Positives = 190/374 (50%), Gaps = 50/374 (13%)

Query: 454 VILKWKN-YSNMAVTTEVSIVSNDIASALKEQREVDADESASLDSEKQLNPRIRMVYDNV 512
           V+L+W++ Y        VSI+S DI ++++ Q           +S   L     M YD  
Sbjct: 312 VVLRWRDSYIQNETCKSVSIISEDILTSVQAQ-----------NSGVLLISNFSMTYDKN 360

Query: 513 HKEWFFPDLFLPPGIYRLQFSINGL-LTHSNYLPTATDSEGNFVNWFEVLPGYHTIEPFR 571
              W  PDLFLPPG YRL+F I+     +SNYLP   D  G  +N  E+LPGY ++EPF 
Sbjct: 361 ENNWVLPDLFLPPGKYRLRFLIDHHDFRYSNYLPVTEDELGTIINEIEILPGYKSVEPFE 420

Query: 572 NEADLGSQVEPV-----------LEEESPIRPELXXXXXXXXXXXXXXAKGVERPSTPFS 620
           +   +  Q   +           L+ E P  PEL                  E  +  +S
Sbjct: 421 HNNHIMIQENIINSELSLNNSRQLQSEPPSYPELEENFSSPIESIISED---ELDNDQYS 477

Query: 621 DYRGLSRSSSVNMRDSFVRLKASSLDLMAEIKPEKLEYSNEIPNLFNIADGGTTSVIRES 680
              G  R++S+    + + +K      ++E+      Y+NEIP LF I D     ++ E+
Sbjct: 478 KVYG-KRNNSIGQSKTSLSIKP----CISEVT-----YTNEIPQLFKITDNNC--IVNEN 525

Query: 681 RDSS------PQEQPSFTYKVVDCNQDDLFATLQQGGNIDAETAETVFLSRYPIPDLPIY 734
            +           +P    +V+DCNQD LFAT QQ G +D E AE +FL +YP+PDLP++
Sbjct: 526 YERYGFVEPPSYGEPGLENRVIDCNQDILFATFQQNGAVDVELAEQLFLEKYPVPDLPVF 585

Query: 735 LNSSYLNKILNQSNPNSEPHDRDEGAI-----NHIIPHVNLNHLLTSSIRDEIISVACTT 789
           L+S +  K+ + ++ +   +D +   I        IPHVNLNH+LT+ I + +ISVACTT
Sbjct: 586 LDSHFSEKLFDNNDSSKNLNDMNGEDIQIKNNGQDIPHVNLNHVLTNKISNGMISVACTT 645

Query: 790 RYEGKFITQVIYAP 803
           RY+ KF+T ++Y+P
Sbjct: 646 RYKRKFVTHILYSP 659

>TPHA0K00530 Chr11 (105141..107081) [1941 bp, 646 aa] {ON} Anc_5.527
           YDR422C
          Length = 646

 Score =  132 bits (331), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 110/376 (29%), Positives = 170/376 (45%), Gaps = 67/376 (17%)

Query: 452 TLVILKW-------KNYSNMAVTTEVSIVSNDIASALKEQREVDADESASLDSEKQLNPR 504
           T V L+W        NY +      VSI+S DI   +   R           S      R
Sbjct: 312 TRVTLRWIDSKFKPNNYQS------VSIISEDIIDVINFYR-----------SNNDKIKR 354

Query: 505 IRMVYDNVHKEWFFPDLFLPPGIYRLQFSINGL-LTHSNYLPTATDSEGNFVNWFEVLPG 563
           + + YD++  EW   DLFLP G Y   F IN   + HS ++ T  D  G  VN+FEV   
Sbjct: 355 LPLKYDSLTHEWKISDLFLPAGYYEFSFLINETDVHHSLHICTKMDRFGKRVNYFEVPKY 414

Query: 564 YHTIEPFRNEADLGSQVEPVLEEESPIRPELXXXXXXXXXXXXXXAKGVERPSTPFSDYR 623
             T EP +    L S +  V + +     E                    + S+ F    
Sbjct: 415 VRTFEPLQ----LSSALYTVTQADDRRHIE------------------CSKTSSEF---- 448

Query: 624 GLSRSSSVNMRDSFVRLKASSLDLMAEIKPEKLEYSNEIPNLFNIADGGTTSVIRESRDS 683
            L+   + ++R  +     S  +          +Y+N+IP LF  ++     +  E+  +
Sbjct: 449 -LNLLDNYDIRTRYNANFYSHNESGTGNNFNNNKYTNQIPELFKFSEKNIRELSTETEIT 507

Query: 684 SPQ----EQPSFTYKVVDCNQDDLFATLQQGGNIDAETAETVFLSRYPIPDLPIYLNSSY 739
             +     +PSF   +VDC+Q+ LF +LQQ G +D+  AE V L RYP+ +LPI+  +  
Sbjct: 508 FLEPPSYGEPSFYNNIVDCSQEKLFLSLQQNGAVDSYVAEQVILQRYPVSELPIFFENIS 567

Query: 740 LNKILNQSNPNSEPHDRD---EGAI----NHII----PHVNLNHLLTSSIRDEIISVACT 788
           + K+ + +N  ++ H      EG      ++I     PHV LNHL+T  I   ++SVA T
Sbjct: 568 MEKLASHNNNLNKSHTNKHWLEGLTPNESDNITPKEPPHVILNHLVTQKISRNVVSVAVT 627

Query: 789 TRYEGKFITQVIYAPC 804
           TRY+ K+ITQ++Y+P 
Sbjct: 628 TRYKQKYITQILYSPI 643

>Suva_5.123 Chr5 complement(184865..186136) [1272 bp, 423 aa] {ON}
           YER027C (REAL)
          Length = 423

 Score = 78.6 bits (192), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 83/285 (29%), Positives = 120/285 (42%), Gaps = 70/285 (24%)

Query: 521 LFLPPGIYRLQFSINGLLTHSNYLPTATDSEGNFVNWFEV-LPGYHTIEPFRNEADLGSQ 579
           L LPPG +R +F ++  L  S+YLPTATD  GNFVN+ EV  P   + EP +  +D  S 
Sbjct: 207 LQLPPGTHRFRFIVDNELRFSDYLPTATDQMGNFVNYMEVTAPPDWSNEPQQQASDNKSN 266

Query: 580 VEPVLEEESPIRPELXXXXXXXXXXXXXXAKGVERPSTPFSDYRGLSRSSSVNMRDSFVR 639
                                        ++  +RP +  S           +M D + R
Sbjct: 267 -------------------------HADDSQSAKRPMSARSRIALEIEKEPDDMGDGYTR 301

Query: 640 LKASSLDLMAEIKPEKLEYSNEIPNLFNIADGGTTSVIRESRDSSPQEQPSFTYKVVDCN 699
                    A  KP+ LEY+ +IP +F               D +  EQ           
Sbjct: 302 FHDE-----APPKPD-LEYTQDIPAVFT--------------DPNVMEQ----------- 330

Query: 700 QDDLFATLQQGGNIDAETAETVFLSRYPIPDLPIYLNSSYLNKILNQSNPNSEPHDRDEG 759
               + TL Q  N     A   +L+    P LP +L +  LN   N SN  ++ ++   G
Sbjct: 331 ---YYLTLDQQQNNHQNMA---WLTP---PQLPPHLENVILN---NYSNAQTDNNENTSG 378

Query: 760 AINHIIPHVNLNHLLTSSIRDEIISVACTTRYEGKFITQVIYAPC 804
           A+  I  HV LNHL TSSI+   + VA   RY+ K++TQ++Y P 
Sbjct: 379 AL-PIPNHVILNHLATSSIKHNTLCVASIVRYKQKYVTQILYTPL 422

>Ecym_1210 Chr1 (423627..424979) [1353 bp, 450 aa] {ON} similar to
           Ashbya gossypii AER361C
          Length = 450

 Score = 78.6 bits (192), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 79/298 (26%), Positives = 121/298 (40%), Gaps = 69/298 (23%)

Query: 517 FFPDLFLPPGIYRLQFSINGLLTHSNYLPTATDSEGNFVNWFEVLPGYHTIEPFRNEADL 576
           F   L LPPG +R +F ++  L  S++LPTATD  GNFVN+ E++       P   E   
Sbjct: 213 FHIKLQLPPGTHRFRFIVDNELRFSDFLPTATDQMGNFVNYMEIV-----ASPPSQEQQP 267

Query: 577 GSQVEPVLEEESPIRPELXXXXXXXXXXXXXXAKGVERPSTPFSDYRGLSRSSSV----- 631
            S ++ V  +E PI   +                  +  S    + RG+S  S +     
Sbjct: 268 ASDLQYV-SDEGPISKHVENIREGRS----------DAASAAVDEERGMSSRSKLALQIE 316

Query: 632 ----NMRDSFVRLKASSLDLMAEIKPEKLEYSNEIPNLFNIADGGTTSVIRESRDSSPQE 687
               +M D + R +  S ++         E++ +IP +F               D S   
Sbjct: 317 DDPDDMGDGYTRFREESKEIPV------YEFTQDIPAVFT--------------DPSVMG 356

Query: 688 QPSFTYKVVDCNQDDLFATLQQGGNIDAETAETVFLSRYPIPDLPIYLNSSYLNKILNQS 747
           Q   T      NQ +L                  +L+    P LP +L     + ILN  
Sbjct: 357 QYYLTLDQQKNNQQNL-----------------AWLTP---PQLPPHLE----HVILNHY 392

Query: 748 NPNSEPHDRDEGAINHIIPHVNLNHLLTSSIRDEIISVACTTRYEGKFITQVIYAPCY 805
           N +++    +      I  HV LNHL TSSI+   + VA   RY+ K+ TQ++YAP +
Sbjct: 393 NKSADGASENTSGALPIPNHVVLNHLATSSIKHNTLCVASIVRYKSKYATQILYAPLH 450

>TBLA0I03270 Chr9 complement(793849..795150) [1302 bp, 433 aa] {ON}
           Anc_3.517 YER027C
          Length = 433

 Score = 76.6 bits (187), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 80/286 (27%), Positives = 122/286 (42%), Gaps = 57/286 (19%)

Query: 521 LFLPPGIYRLQFSINGLLTHSNYLPTATDSEGNFVNWFEVLPGYHTIEPFRNEADLGSQV 580
           L LPPG +R +F ++  L  S++LPTATD  GNFVN+ EV+    T++      ++G  +
Sbjct: 202 LQLPPGTHRFRFIVDNELRFSDFLPTATDQMGNFVNYLEVVAPPTTVD-----ENIGGNL 256

Query: 581 EPVLEEESPIRPELXXXXXXXXXXXXXXAKGVERPSTPFSDYRGLSRSSSVNMRDSFVRL 640
                + S  + ++               K   +P +  S           ++ D F R 
Sbjct: 257 PNQTADSSNYQQDMGAGKPIYKQDNQAQTK---QPMSARSRIAFEIEKEPDDLGDGFTRF 313

Query: 641 KASSLDLMAEIKPEK--LEYSNEIPNLFNIADGGTTSVIRESRDSSPQEQPSFTYKVVDC 698
                    E KP K  +EY+ +IP +F               D +  EQ          
Sbjct: 314 H--------EEKPLKQDVEYTQDIPAVFT--------------DPTVMEQ---------- 341

Query: 699 NQDDLFATLQQGGNIDAETAETVFLSRYPIPDLPIYLNSSYLNKILNQSNPNSEPHDRDE 758
                + TL Q  N     A   +L+    P LP +L     N ILN  + +   ++   
Sbjct: 342 ----YYLTLDQQQNNHQNMA---WLTP---PQLPPHLE----NVILNSYSGSGSDNENTS 387

Query: 759 GAINHIIPHVNLNHLLTSSIRDEIISVACTTRYEGKFITQVIYAPC 804
           GA+  I  HV LNHL TSSI+   + VA   RY+ K++TQ++YAP 
Sbjct: 388 GAL-PIPNHVVLNHLATSSIKHNTLCVASIVRYKSKYVTQILYAPL 432

>YER027C Chr5 complement(208979..210232) [1254 bp, 417 aa] {ON}
           GAL83One of three possible beta-subunits of the Snf1
           kinase complex, allows nuclear localization of the Snf1
           kinase complex in the presence of a nonfermentable
           carbon source; contains glycogen-binding domain
          Length = 417

 Score = 75.1 bits (183), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 82/285 (28%), Positives = 116/285 (40%), Gaps = 73/285 (25%)

Query: 521 LFLPPGIYRLQFSINGLLTHSNYLPTATDSEGNFVNWFEVLPGYHTIEPFRNEADLGSQV 580
           L LPPG +R +F ++  L  S+YLPTATD  GNFVN+ EV              D G++ 
Sbjct: 204 LQLPPGTHRFRFIVDNELRFSDYLPTATDQMGNFVNYMEV----------SAPPDWGNEP 253

Query: 581 EPVLEEESPIRPELXXXXXXXXXXXXXXAKGVERPSTPFSDYRGLSRSSSVNMRDSFVRL 640
           +  L E+                     +K  +RP +  S           +M D + R 
Sbjct: 254 QQHLAEKK--------------ANHVDDSKLSKRPMSARSRIALEIEKEPDDMGDGYTRF 299

Query: 641 KASSLDLMAEIKPEKLEYSNEIPNLFNIADGGTTSVIRESRDSSPQEQPSFTYKVVDCNQ 700
              +       KP  LEY+ +IP +F               D +  EQ            
Sbjct: 300 HDET-----PAKP-NLEYTQDIPAVFT--------------DPNVMEQ------------ 327

Query: 701 DDLFATLQQGGNIDAETAETVFLSRYPIPDLPIYLNSSYLNKILNQSNPNSEPHDRDEGA 760
              + TL Q  N     A   +L+    P LP +L +  LN   N    N+       GA
Sbjct: 328 --YYLTLDQQQNNHQNMA---WLTP---PQLPPHLENVILNSYSNAQTDNTS------GA 373

Query: 761 INHIIP-HVNLNHLLTSSIRDEIISVACTTRYEGKFITQVIYAPC 804
           +   IP HV LNHL TSSI+   + VA   RY+ K++TQ++Y P 
Sbjct: 374 L--PIPNHVILNHLATSSIKHNTLCVASIVRYKQKYVTQILYTPL 416

>Kwal_47.19040 s47 complement(1073036..1074325) [1290 bp, 429 aa]
           {ON} YER027C (GAL83) - glucose repression protein, a
           component of the Snf1 complex [contig 188] FULL
          Length = 429

 Score = 57.0 bits (136), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 32/77 (41%), Positives = 45/77 (58%), Gaps = 3/77 (3%)

Query: 729 PDLPIYLNSSYLNKILNQSNPNSEPHDRDEGAINHIIP-HVNLNHLLTSSIRDEIISVAC 787
           P LP +L +  LN   +QS P     + + GA+   IP HV LNHL TSSI+   + VA 
Sbjct: 354 PQLPPHLENVILNNYSSQSEPGDSGSENNSGALP--IPNHVVLNHLATSSIKHSTLCVAS 411

Query: 788 TTRYEGKFITQVIYAPC 804
             RY+ K+ TQ++Y+P 
Sbjct: 412 IVRYKRKYATQILYSPL 428

 Score = 51.6 bits (122), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 22/45 (48%), Positives = 31/45 (68%)

Query: 517 FFPDLFLPPGIYRLQFSINGLLTHSNYLPTATDSEGNFVNWFEVL 561
           F   L LPPG +R +F ++  L  S++LPTATD  GNFVN+ E++
Sbjct: 164 FHIKLQLPPGTHRFRFIVDNELRFSDFLPTATDQMGNFVNYLEIV 208

>KLLA0B00583g Chr2 complement(44819..46279) [1461 bp, 486 aa] {ON}
           uniprot|Q00995 Kluyveromyces lactis FOG1 protein
          Length = 486

 Score = 57.0 bits (136), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 35/92 (38%), Positives = 46/92 (50%), Gaps = 4/92 (4%)

Query: 713 IDAETAETVFLSRYPIPDLPIYLNSSYLNKILNQSNPNSEPHDRDEGAINHIIPHVNLNH 772
           +D +      +S    P LP  L     N ILN  N N+EP   +      I  HV LNH
Sbjct: 398 LDQQQNNQQNMSWLTPPQLPPQLE----NVILNNYNKNAEPGSENNSGALPIPNHVVLNH 453

Query: 773 LLTSSIRDEIISVACTTRYEGKFITQVIYAPC 804
           L TSSI+   + VA   RY+ K+ TQ++YAP 
Sbjct: 454 LATSSIKHNTLCVASIVRYKRKYATQILYAPL 485

 Score = 55.5 bits (132), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 23/46 (50%), Positives = 32/46 (69%)

Query: 517 FFPDLFLPPGIYRLQFSINGLLTHSNYLPTATDSEGNFVNWFEVLP 562
           F   L LPPG +R +F ++  L  S++LPTATD  GNFVN+ E++P
Sbjct: 237 FHIKLQLPPGTHRFRFIVDNELRFSDFLPTATDQMGNFVNYLEIVP 282

>CAGL0A03696g Chr1 (377255..378502) [1248 bp, 415 aa] {ON} similar
           to uniprot|Q04739 Saccharomyces cerevisiae YER027c GAL83
           glucose repression protein
          Length = 415

 Score = 55.8 bits (133), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 32/76 (42%), Positives = 45/76 (59%), Gaps = 4/76 (5%)

Query: 729 PDLPIYLNSSYLNKILNQSNPNSEPHDRDEGAINHIIPHVNLNHLLTSSIRDEIISVACT 788
           P LP +L +  LN     SN   E ++ + GA+  I  HV LNHL TSSI+   + VA  
Sbjct: 343 PQLPPHLENVILNSY---SNAQGESNENNSGAL-PIPNHVILNHLATSSIKHNTLCVASI 398

Query: 789 TRYEGKFITQVIYAPC 804
            RY+ K++TQ++YAP 
Sbjct: 399 VRYKRKYVTQILYAPL 414

 Score = 53.1 bits (126), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 24/48 (50%), Positives = 32/48 (66%)

Query: 521 LFLPPGIYRLQFSINGLLTHSNYLPTATDSEGNFVNWFEVLPGYHTIE 568
           L LPPG +R +F ++  L  S++LPTATD  GNFVN+ E+ P   T E
Sbjct: 202 LQLPPGTHRFRFIVDNELRFSDFLPTATDQMGNFVNYLEIAPVAGTDE 249

>KAFR0I02380 Chr9 (482219..483448) [1230 bp, 409 aa] {ON} Anc_3.517
           YER027C
          Length = 409

 Score = 55.5 bits (132), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 24/45 (53%), Positives = 32/45 (71%)

Query: 517 FFPDLFLPPGIYRLQFSINGLLTHSNYLPTATDSEGNFVNWFEVL 561
           F+  L LPPG +R +F ++  L  S+YLPTATD  GNFVN+ EV+
Sbjct: 174 FYVKLQLPPGTHRFRFIVDNELRFSDYLPTATDQMGNFVNYLEVI 218

 Score = 54.3 bits (129), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 33/77 (42%), Positives = 44/77 (57%), Gaps = 6/77 (7%)

Query: 729 PDLPIYLNSSYLNKILNQSNPNSEPHDRDEGAINHIIP-HVNLNHLLTSSIRDEIISVAC 787
           P LP +L +  LN     SN   E ++   GA+   IP HV LNHL TSSI+   + VA 
Sbjct: 337 PQLPPHLENVILNSY---SNSQGESNENTSGALP--IPNHVILNHLATSSIKHNTLCVAS 391

Query: 788 TTRYEGKFITQVIYAPC 804
             RY  K++TQ++YAP 
Sbjct: 392 IVRYRQKYVTQILYAPL 408

>ZYRO0E08404g Chr5 complement(672301..673347) [1047 bp, 348 aa] {ON}
           some similarities with uniprot|Q04739 Saccharomyces
           cerevisiae YER027C GAL83 One of three possible beta-
           subunits of the Snf1 kinase complex allows nuclear
           localization of the Snf1 kinase complex in the presence
           of a nonfermentable carbon source contains
           glycogen-binding domain and some similarities with
           YGL208W uniprot|P34164 Saccharomyces cerevisiae YGL208W
           SIP2 Member of a family of proteins including Sip1p and
           Gal83p that interact with Snf1p and Snf4p and are
           involved in the response to glucose starvation component
           of Snf1 protein complex involved in response to glucose
           starvation
          Length = 348

 Score = 55.1 bits (131), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 73/286 (25%), Positives = 108/286 (37%), Gaps = 95/286 (33%)

Query: 521 LFLPPGIYRLQFSINGLLTHSNYLPTATDSEGNFVNWFEVLPGYHTIEPFRNEADLGSQV 580
           L LP G +R +F ++  L  S+YLPTATD  GN                F N  ++G   
Sbjct: 155 LQLPIGTHRFRFIVDNELRFSDYLPTATDQMGN----------------FVNYLEIGRGQ 198

Query: 581 EPVLEEESPIRPELXXXXXXXXXXXXXXAKGVERPSTPFSDYRGLSRSSSVNMRDSFVRL 640
           +  L   S I  E+                                 +   ++ + F R 
Sbjct: 199 KDTLSARSRIAMEI--------------------------------ENEPDDIGNGFTRF 226

Query: 641 KASSLDLMAEIKPEKLEYSNEIPNLFNIADGGTTSVIRESRDSSPQEQPSFTYKVVDCNQ 700
           K         +KP+ +EY+ +IP +F               D S  EQ   T        
Sbjct: 227 KEE-----IPLKPQ-VEYTQDIPAVFT--------------DPSVMEQYYLT-------- 258

Query: 701 DDLFATLQQGGNIDAETAETVFLSRYPIPDLPIYLNSSYLNKILN-QSNPNSEPHDRDEG 759
                       +D +      ++    P LP +L    LN     Q + N+E    + G
Sbjct: 259 ------------LDQQQHNHQNMAWLTPPTLPPHLEDVPLNSYNGIQGDSNNE---NNSG 303

Query: 760 AINHIIP-HVNLNHLLTSSIRDEIISVACTTRYEGKFITQVIYAPC 804
           A+   IP HV LNHL TSSI+   + VA   RY+ K++TQ++YAP 
Sbjct: 304 ALP--IPNHVVLNHLATSSIKHNTLCVASIVRYKRKYVTQILYAPL 347

>KNAG0B00600 Chr2 (97910..99079) [1170 bp, 389 aa] {ON} Anc_3.517
           YER027C
          Length = 389

 Score = 55.1 bits (131), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 31/76 (40%), Positives = 41/76 (53%), Gaps = 10/76 (13%)

Query: 729 PDLPIYLNSSYLNKILNQSNPNSEPHDRDEGAINHIIP-HVNLNHLLTSSIRDEIISVAC 787
           P+LP  L       ILN  N      D D G      P +V LNHLLTSSI++ ++ + C
Sbjct: 321 PELPSQLERC----ILNNKN-----EDTDNGPCELTTPNYVTLNHLLTSSIKNNMLCLGC 371

Query: 788 TTRYEGKFITQVIYAP 803
           + RY  K++TQV Y P
Sbjct: 372 SVRYRQKYVTQVYYTP 387

 Score = 52.4 bits (124), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 23/48 (47%), Positives = 32/48 (66%)

Query: 521 LFLPPGIYRLQFSINGLLTHSNYLPTATDSEGNFVNWFEVLPGYHTIE 568
           L LP G ++ +F ++  L  S++LPTATD  GNFVN+ EV P   T+E
Sbjct: 193 LKLPVGTHKFRFVVDNELRFSDFLPTATDQTGNFVNYIEVKPSEETLE 240

>SAKL0F02002g Chr6 (167591..169102) [1512 bp, 503 aa] {ON} similar
           to gnl|GLV|CAGL0A03696g Candida glabrata CAGL0A03696g
           and similar to YER027C uniprot|Q04739 Saccharomyces
           cerevisiae YER027C GAL83 One of three possible
           beta-subunits of the Snf1 kinase complex allows nuclear
           localization of the Snf1 kinase complex in the presence
           of a nonfermentable carbon source contains
           glycogen-binding domain and similar to YGL208W
           uniprot|P34164 Saccharomyces cerevisiae YGL208W SIP2
           Member of a family of proteins including Sip1p and
           Gal83p that interact with Snf1p and Snf4p and are
           involved in the response to glucose starvation component
           of Snf1 protein complex involved in response to glucose
           starvation
          Length = 503

 Score = 55.5 bits (132), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 24/46 (52%), Positives = 32/46 (69%)

Query: 517 FFPDLFLPPGIYRLQFSINGLLTHSNYLPTATDSEGNFVNWFEVLP 562
           F   L LPPG +R +F ++  L  S+YLPTATD  GNFVN+ E++P
Sbjct: 249 FHIKLQLPPGTHRFRFIVDNELRFSDYLPTATDQMGNFVNYMEIVP 294

 Score = 51.2 bits (121), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 36/96 (37%), Positives = 47/96 (48%), Gaps = 8/96 (8%)

Query: 713 IDAETAETVFLSRYPIPDLPIYLNSSYLNKILNQSNPNSEPHDRDEGAINH----IIPHV 768
           +D +      LS    P LP +L     N ILN  + NS   +   G  N     I  HV
Sbjct: 411 LDQQQNNQQSLSWLTPPQLPPHLE----NVILNNYSANSAQAEESGGENNSGALPIPNHV 466

Query: 769 NLNHLLTSSIRDEIISVACTTRYEGKFITQVIYAPC 804
            LNHL TSSI+   + VA   RY+ K+ TQ++YAP 
Sbjct: 467 VLNHLATSSIKHNTLCVASIVRYKSKYATQILYAPL 502

>TDEL0D05850 Chr4 complement(1062927..1064141) [1215 bp, 404 aa]
           {ON} Anc_3.517 YER027C
          Length = 404

 Score = 54.7 bits (130), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 33/77 (42%), Positives = 46/77 (59%), Gaps = 6/77 (7%)

Query: 729 PDLPIYLNSSYLNKILNQSNPNSEPHDRDEGAINHIIP-HVNLNHLLTSSIRDEIISVAC 787
           P LP +L +  LN   N  N ++E    + GA+   IP HV LNHL TSSI+   + VA 
Sbjct: 332 PQLPPHLENVPLNSYTNSQNDSNE---NNSGAL--PIPNHVVLNHLATSSIKHNTLCVAS 386

Query: 788 TTRYEGKFITQVIYAPC 804
             RY+ K++TQ++YAP 
Sbjct: 387 IVRYKRKYVTQILYAPL 403

 Score = 51.2 bits (121), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 23/49 (46%), Positives = 31/49 (63%)

Query: 513 HKEWFFPDLFLPPGIYRLQFSINGLLTHSNYLPTATDSEGNFVNWFEVL 561
           H +     L LP G +R +F ++  L  S+YLPTATD  GNFVN+ EV+
Sbjct: 179 HPDLLHVKLQLPVGTHRFRFIVDNELRFSDYLPTATDQMGNFVNYLEVI 227

>KNAG0B03690 Chr2 (708946..709926) [981 bp, 326 aa] {ON} Anc_5.527
           YDR422C
          Length = 326

 Score = 54.3 bits (129), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 36/120 (30%), Positives = 57/120 (47%), Gaps = 20/120 (16%)

Query: 470 VSIVSNDIASALKEQREVDADESASLDSEKQLNPRIRMVYDNVHKEWFFPDLFLPPGIYR 529
           V+I   DI S L+   ++   +            +I + ++    EW  PDL+LPPG Y+
Sbjct: 89  VAIQGTDITSKLQRTGKMGGLQ------------QIPLQFEGDSSEWVAPDLYLPPGEYK 136

Query: 530 LQFSINGLLT-HSNYLPTATDSEGNFVNWFEVLPGYHTIE-------PFRNEADLGSQVE 581
            +F IN   + HS YLP  T  +G   N+F V+     +E       P   ++ LG++VE
Sbjct: 137 FRFVINDTCSMHSEYLPILTVGDGIAYNYFVVIENDEVVEPAVAADAPMGQDSPLGARVE 196

 Score = 36.6 bits (83), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 39/152 (25%), Positives = 59/152 (38%), Gaps = 26/152 (17%)

Query: 655 KLEYSNEIPNLFNIADGGTTSVIRESRDSSPQEQPSFTYKVVDCNQDDLFATLQQGGNID 714
           ++EY+NEI  LF   +G   S   +  D + Q +P         NQ   F    Q  +  
Sbjct: 194 RVEYTNEILPLF---EGYCDS---QQIDHTAQYKPK-----THMNQKTFFYYAFQEQDAA 242

Query: 715 AETAETVFLSRYPIPDLPIYLNSSYLNKILNQSNPNSEPHDRDEGAINHIIPHVNLNHLL 774
           +   +  F  RY +P +P Y    Y   I  Q N    P           I   NLN  +
Sbjct: 243 SGDYDAQFCERYTVPIIPPYF---YSIDITPQDNTLKVPLP---------IQLANLNRTI 290

Query: 775 TSS---IRDEIISVACTTRYEGKFITQVIYAP 803
             S   I ++ + + C   Y GK++  + Y P
Sbjct: 291 FPSPEDICNDYLCIGCVISYRGKYMAHLFYRP 322

>NCAS0F03730 Chr6 complement(750798..752096) [1299 bp, 432 aa] {ON}
           Anc_3.517 YER027C
          Length = 432

 Score = 53.9 bits (128), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 33/77 (42%), Positives = 45/77 (58%), Gaps = 6/77 (7%)

Query: 729 PDLPIYLNSSYLNKILNQSNPNSEPHDRDEGAINHIIP-HVNLNHLLTSSIRDEIISVAC 787
           P LP +L +  LN   N    N+E    + GA+   IP HV LNHL TSSI+   + VA 
Sbjct: 360 PQLPPHLENVILNSYSNSQGTNNE---NNSGAL--PIPNHVILNHLATSSIKHNTLCVAS 414

Query: 788 TTRYEGKFITQVIYAPC 804
             RY+ K++TQ++YAP 
Sbjct: 415 IVRYKRKYVTQILYAPL 431

 Score = 51.6 bits (122), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 22/40 (55%), Positives = 29/40 (72%)

Query: 521 LFLPPGIYRLQFSINGLLTHSNYLPTATDSEGNFVNWFEV 560
           L LPPG +R +F ++  L  S+YLPTATD  GNFVN+ E+
Sbjct: 207 LQLPPGTHRFRFIVDNELRFSDYLPTATDQMGNFVNYLEI 246

>NCAS0E00620 Chr5 (106661..108163) [1503 bp, 500 aa] {ON} Anc_3.517
          Length = 500

 Score = 53.5 bits (127), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 31/76 (40%), Positives = 45/76 (59%), Gaps = 7/76 (9%)

Query: 729 PDLPIYLNSSYLNKILNQSNPNSEPHDRDEGAINHIIPHVNLNHLLTSSIRDEIISVACT 788
           P LP +L +  LN   + SN N+       GA+  I  HV LNHL+T+SI+   + VA  
Sbjct: 431 PQLPPHLENIILNSSQDTSNENTS------GAL-PIPNHVVLNHLVTTSIKHNTLCVASI 483

Query: 789 TRYEGKFITQVIYAPC 804
            RY+ K++TQ++YAP 
Sbjct: 484 IRYKHKYVTQILYAPL 499

 Score = 49.7 bits (117), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 22/44 (50%), Positives = 29/44 (65%)

Query: 517 FFPDLFLPPGIYRLQFSINGLLTHSNYLPTATDSEGNFVNWFEV 560
           F   L LP G +R +F ++  L  S++LPTATD  GNFVN+ EV
Sbjct: 267 FHVKLQLPAGTHRFRFIVDNELKFSDFLPTATDQTGNFVNYLEV 310

>Kpol_195.2 s195 complement(4330..5637) [1308 bp, 435 aa] {ON}
           complement(4330..5637) [1308 nt, 436 aa]
          Length = 435

 Score = 53.1 bits (126), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 52/173 (30%), Positives = 72/173 (41%), Gaps = 44/173 (25%)

Query: 632 NMRDSFVRLKASSLDLMAEIKPEKLEYSNEIPNLFNIADGGTTSVIRESRDSSPQEQPSF 691
           +M D F R +         +KP+ LEY+ +IP +F               D +  EQ   
Sbjct: 306 DMGDGFTRFREEK-----PLKPQ-LEYTQDIPAVFT--------------DPTVMEQ--- 342

Query: 692 TYKVVDCNQDDLFATLQQGGNIDAETAETVFLSRYPIPDLPIYLNSSYLNKILNQSNPNS 751
                       + TL Q  N          LS    P LP +L     N ILN  + NS
Sbjct: 343 -----------YYLTLDQQQNNHQN------LSWLTPPQLPPHLE----NVILNSYSSNS 381

Query: 752 EPHDRDEGAINHIIPHVNLNHLLTSSIRDEIISVACTTRYEGKFITQVIYAPC 804
               ++      I  HV LNHL TSSI+   + VA   RY+ K++TQ++YAP 
Sbjct: 382 PETGQNNSGSLPIPNHVVLNHLATSSIKHNTLCVASIVRYKRKYVTQILYAPL 434

 Score = 48.5 bits (114), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 20/41 (48%), Positives = 29/41 (70%)

Query: 521 LFLPPGIYRLQFSINGLLTHSNYLPTATDSEGNFVNWFEVL 561
           L LPPG ++ +F ++  L  S++LPTATD  GNFVN+ E +
Sbjct: 178 LQLPPGTHKFRFIVDNELRFSDFLPTATDQMGNFVNYLEAV 218

>Smik_7.55 Chr7 (92235..93482) [1248 bp, 415 aa] {ON} YGL208W (REAL)
          Length = 415

 Score = 53.1 bits (126), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 32/91 (35%), Positives = 47/91 (51%), Gaps = 4/91 (4%)

Query: 474 SNDIASALKEQREVDADESAS----LDSEKQLNPRIRMVYDNVHKEWFFPDLFLPPGIYR 529
           S +I S+L    E+   +  S      S  +    I ++ D+ H   F   L L PG +R
Sbjct: 155 STEIKSSLMVPVEIKWQQGGSKVYVTGSFTKWRKMIGLIPDSKHSGAFHVKLRLLPGTHR 214

Query: 530 LQFSINGLLTHSNYLPTATDSEGNFVNWFEV 560
            +F ++  L  S++LPTATD  GNFVN+ EV
Sbjct: 215 FRFVVDNELRVSDFLPTATDQMGNFVNYIEV 245

 Score = 50.4 bits (119), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 30/73 (41%), Positives = 44/73 (60%), Gaps = 11/73 (15%)

Query: 733 IYLNSSYLNKILNQSNPNSEPHDRDEGAINHIIP-HVNLNHLLTSSIRDEIISVACTTRY 791
           + LN  Y+ +  +Q N N      + GA+   IP HV LNHL+TSSI+   + VA   RY
Sbjct: 350 VILNKYYMTQ--DQFNEN------NSGALP--IPNHVVLNHLITSSIKHNTLCVASIVRY 399

Query: 792 EGKFITQVIYAPC 804
           + K++TQ++YAP 
Sbjct: 400 KQKYVTQILYAPI 412

>TPHA0A05810 Chr1 complement(1317530..1318804) [1275 bp, 424 aa]
           {ON} Anc_3.517 YER027C
          Length = 424

 Score = 52.4 bits (124), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 22/45 (48%), Positives = 31/45 (68%)

Query: 521 LFLPPGIYRLQFSINGLLTHSNYLPTATDSEGNFVNWFEVLPGYH 565
           L LPPG ++ +F ++  L  S++LPTATD  GNFVN+ E +P  H
Sbjct: 183 LQLPPGTHKFRFIVDNELRFSDFLPTATDQMGNFVNYLEAVPRTH 227

 Score = 46.6 bits (109), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 19/38 (50%), Positives = 27/38 (71%)

Query: 767 HVNLNHLLTSSIRDEIISVACTTRYEGKFITQVIYAPC 804
           HV L+HL TSSI+   + VA   RY+ K++TQ++YAP 
Sbjct: 386 HVVLHHLATSSIKHNTLCVASIVRYKRKYVTQILYAPL 423

>KAFR0F04140 Chr6 complement(814903..815949) [1047 bp, 348 aa] {ON}
           Anc_3.517 YER027C
          Length = 348

 Score = 52.0 bits (123), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 30/77 (38%), Positives = 45/77 (58%), Gaps = 7/77 (9%)

Query: 729 PDLPIYLNSSYLNKILNQSNPNSEPHDRDEGAINHIIP-HVNLNHLLTSSIRDEIISVAC 787
           P +P + +   LN      + NS  H  D  A    IP HV LNHL+ +S++  +++++ 
Sbjct: 277 PQIPPHFDVVILN------DQNSLQHTDDSNAGFLPIPNHVVLNHLIVNSVKSNMLAIST 330

Query: 788 TTRYEGKFITQVIYAPC 804
           TTRY+ KFITQV Y+P 
Sbjct: 331 TTRYKEKFITQVCYSPI 347

 Score = 47.4 bits (111), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 25/64 (39%), Positives = 36/64 (56%)

Query: 505 IRMVYDNVHKEWFFPDLFLPPGIYRLQFSINGLLTHSNYLPTATDSEGNFVNWFEVLPGY 564
           I +V    + +W    L LPPG +R +F ++  L  S+ +P+ATDS GN VN+ EV P  
Sbjct: 132 IALVEHPTNPDWARVRLKLPPGNHRFRFVVDNELRFSDDVPSATDSMGNLVNYIEVKPSK 191

Query: 565 HTIE 568
              E
Sbjct: 192 RQYE 195

>Smik_5.150 Chr5 complement(213879..215132) [1254 bp, 417 aa] {ON}
           YER027C (REAL)
          Length = 417

 Score = 52.4 bits (124), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 23/40 (57%), Positives = 29/40 (72%)

Query: 521 LFLPPGIYRLQFSINGLLTHSNYLPTATDSEGNFVNWFEV 560
           L LPPG +R +F ++  L  S+YLPTATD  GNFVN+ EV
Sbjct: 204 LQLPPGTHRFRFIVDNELRFSDYLPTATDQMGNFVNYMEV 243

 Score = 50.4 bits (119), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 31/77 (40%), Positives = 42/77 (54%), Gaps = 9/77 (11%)

Query: 729 PDLPIYLNSSYLNKILNQSNPNSEPHDRDEGAINHIIP-HVNLNHLLTSSIRDEIISVAC 787
           P LP +L +  LN   N    N+       GA+   IP HV LNHL TSSI+   + VA 
Sbjct: 348 PQLPPHLENVILNSYSNAQTDNTS------GAL--PIPNHVILNHLATSSIKHNTLCVAS 399

Query: 788 TTRYEGKFITQVIYAPC 804
             RY+ K++TQ++Y P 
Sbjct: 400 IVRYKQKYVTQILYTPL 416

>Skud_5.136 Chr5 complement(206871..208127) [1257 bp, 418 aa] {ON}
           YER027C (REAL)
          Length = 418

 Score = 52.4 bits (124), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 23/40 (57%), Positives = 29/40 (72%)

Query: 521 LFLPPGIYRLQFSINGLLTHSNYLPTATDSEGNFVNWFEV 560
           L LPPG +R +F ++  L  S+YLPTATD  GNFVN+ EV
Sbjct: 205 LQLPPGTHRFRFIVDNELRFSDYLPTATDQMGNFVNYMEV 244

 Score = 50.1 bits (118), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 31/76 (40%), Positives = 42/76 (55%), Gaps = 9/76 (11%)

Query: 729 PDLPIYLNSSYLNKILNQSNPNSEPHDRDEGAINHIIP-HVNLNHLLTSSIRDEIISVAC 787
           P LP +L +  LN   N    N+       GA+   IP HV LNHL TSSI+   + VA 
Sbjct: 349 PQLPPHLENVILNSYSNAQTDNTS------GAL--PIPNHVILNHLATSSIKHNTLCVAS 400

Query: 788 TTRYEGKFITQVIYAP 803
             RY+ K++TQ++Y P
Sbjct: 401 IVRYKQKYVTQILYTP 416

>NDAI0B06010 Chr2 complement(1460221..1461732) [1512 bp, 503 aa]
           {ON} Anc_3.517 YER027C
          Length = 503

 Score = 52.0 bits (123), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 23/48 (47%), Positives = 30/48 (62%)

Query: 513 HKEWFFPDLFLPPGIYRLQFSINGLLTHSNYLPTATDSEGNFVNWFEV 560
           H       L LPPG +R +F ++  L  S+YLPTATD  GNFVN+ E+
Sbjct: 243 HPNLLHVKLQLPPGTHRFRFIVDNELRFSDYLPTATDQMGNFVNYLEI 290

>KNAG0E01590 Chr5 complement(317054..318325) [1272 bp, 423 aa] {ON}
           Anc_3.517 YER027C
          Length = 423

 Score = 51.6 bits (122), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 22/41 (53%), Positives = 30/41 (73%)

Query: 521 LFLPPGIYRLQFSINGLLTHSNYLPTATDSEGNFVNWFEVL 561
           L LPPG ++ +F ++  L  S+YLPTATD  GNFVN+ EV+
Sbjct: 192 LQLPPGTHKFRFIVDNELRFSDYLPTATDQMGNFVNYLEVV 232

 Score = 51.2 bits (121), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 32/77 (41%), Positives = 45/77 (58%), Gaps = 6/77 (7%)

Query: 729 PDLPIYLNSSYLNKILNQSNPNSEPHDRDEGAINHIIP-HVNLNHLLTSSIRDEIISVAC 787
           P LP +L +  LN     S+   E ++ + GA+   IP HV LNHL TSSI+   + VA 
Sbjct: 351 PQLPPHLENVILNSY---SSLQGESNENNSGALP--IPNHVILNHLATSSIKHNTLCVAS 405

Query: 788 TTRYEGKFITQVIYAPC 804
             RY+ K+ TQ++YAP 
Sbjct: 406 IVRYKQKYATQILYAPL 422

>KLTH0G01848g Chr7 (136780..138030) [1251 bp, 416 aa] {ON} similar
           to uniprot|P34164 Saccharomyces cerevisiae YGL208W SIP2
           Member of a family of proteins including Sip1p and
           Gal83p that interact with Snf1p and Snf4p and are
           involved in the response to glucose starvation component
           of Snf1 protein complex involved in response to glucose
           starvation and similar to YER027C uniprot|Q04739
           Saccharomyces cerevisiae YER027C GAL83 One of three
           possible beta-subunits of the Snf1 kinase complex allows
           nuclear localization of the Snf1 kinase complex in the
           presence of a nonfermentable carbon source contains
           glycogen-binding domain
          Length = 416

 Score = 50.8 bits (120), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 23/46 (50%), Positives = 30/46 (65%)

Query: 517 FFPDLFLPPGIYRLQFSINGLLTHSNYLPTATDSEGNFVNWFEVLP 562
           F   L LPPG +R +F ++  L  S+YL TATD  GNFVN+ E+ P
Sbjct: 164 FHIKLQLPPGTHRFRFIVDNELRFSDYLATATDQMGNFVNYLEISP 209

>Skud_7.60 Chr7 (102699..104024) [1326 bp, 441 aa] {ON} YGL208W
           (REAL)
          Length = 441

 Score = 50.4 bits (119), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 31/77 (40%), Positives = 44/77 (57%), Gaps = 6/77 (7%)

Query: 729 PDLPIYLNSSYLNKILNQSNPNSEPHDRDEGAINHIIP-HVNLNHLLTSSIRDEIISVAC 787
           P LP  L +  LNK     +  +E    + GA+   IP HV LNHL+TSSI+   + VA 
Sbjct: 367 PQLPPQLENVILNKYYATQDQFNE---NNSGALP--IPNHVVLNHLVTSSIKHNTLCVAS 421

Query: 788 TTRYEGKFITQVIYAPC 804
             RY+ K++TQ++Y P 
Sbjct: 422 IVRYKQKYVTQILYTPI 438

 Score = 48.1 bits (113), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 24/56 (42%), Positives = 33/56 (58%)

Query: 505 IRMVYDNVHKEWFFPDLFLPPGIYRLQFSINGLLTHSNYLPTATDSEGNFVNWFEV 560
           I ++ D      F   L L PG +R +F ++  L  S++LPTATD  GNFVN+ EV
Sbjct: 216 IGLIPDANKNGLFHVKLRLLPGTHRFRFIVDNELRVSDFLPTATDQMGNFVNYIEV 271

>NDAI0I02890 Chr9 complement(682274..684022) [1749 bp, 582 aa] {ON}
           Anc_3.517 YER027C
          Length = 582

 Score = 50.4 bits (119), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 22/40 (55%), Positives = 28/40 (70%)

Query: 521 LFLPPGIYRLQFSINGLLTHSNYLPTATDSEGNFVNWFEV 560
           L LP G +R +F ++  L  S+YLPTATD  GNFVN+ EV
Sbjct: 280 LQLPEGTHRFRFIVDNELRFSDYLPTATDQTGNFVNYLEV 319

 Score = 45.1 bits (105), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 18/38 (47%), Positives = 26/38 (68%)

Query: 767 HVNLNHLLTSSIRDEIISVACTTRYEGKFITQVIYAPC 804
           HV LNHL+T+SI+   + VA   RY+ K+ TQ++Y P 
Sbjct: 544 HVVLNHLVTTSIKHNTLCVASIIRYKHKYATQILYTPL 581

>YGL208W Chr7 (97338..98585) [1248 bp, 415 aa] {ON}  SIP2One of
           three beta subunits of the Snf1 serine/threonine protein
           kinase complex involved in the response to glucose
           starvation; null mutants exhibit accelerated aging;
           N-myristoylprotein localized to the cytoplasm and the
           plasma membrane
          Length = 415

 Score = 50.4 bits (119), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 31/76 (40%), Positives = 44/76 (57%), Gaps = 6/76 (7%)

Query: 729 PDLPIYLNSSYLNKILNQSNPNSEPHDRDEGAINHIIP-HVNLNHLLTSSIRDEIISVAC 787
           P LP  L +  LNK     +  +E    + GA+   IP HV LNHL+TSSI+   + VA 
Sbjct: 341 PQLPPQLENVILNKYYATQDQFNE---NNSGALP--IPNHVVLNHLVTSSIKHNTLCVAS 395

Query: 788 TTRYEGKFITQVIYAP 803
             RY+ K++TQ++Y P
Sbjct: 396 IVRYKQKYVTQILYTP 411

 Score = 48.9 bits (115), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 24/56 (42%), Positives = 35/56 (62%)

Query: 505 IRMVYDNVHKEWFFPDLFLPPGIYRLQFSINGLLTHSNYLPTATDSEGNFVNWFEV 560
           I ++ D+ +   F   L L PG +R +F ++  L  S++LPTATD  GNFVN+ EV
Sbjct: 190 IGLIPDSDNNGSFHVKLRLLPGTHRFRFIVDNELRVSDFLPTATDQMGNFVNYIEV 245

>Suva_7.53 Chr7 (93895..95139) [1245 bp, 414 aa] {ON} YGL208W (REAL)
          Length = 414

 Score = 50.1 bits (118), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 29/77 (37%), Positives = 45/77 (58%), Gaps = 6/77 (7%)

Query: 729 PDLPIYLNSSYLNKILNQSNPNSEPHDRDEGAINHIIP-HVNLNHLLTSSIRDEIISVAC 787
           P LP  L +  LNK     +   + ++ + GA+   IP HV LNHL+TSSI+   + V+ 
Sbjct: 340 PQLPPQLENVILNKYCTTQD---QVNENNSGALP--IPNHVVLNHLITSSIKHNTLCVSS 394

Query: 788 TTRYEGKFITQVIYAPC 804
             RY+ K++TQ++Y P 
Sbjct: 395 IVRYKQKYVTQILYTPI 411

 Score = 49.3 bits (116), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 25/56 (44%), Positives = 34/56 (60%)

Query: 505 IRMVYDNVHKEWFFPDLFLPPGIYRLQFSINGLLTHSNYLPTATDSEGNFVNWFEV 560
           I +V D+     F   L L PG +R +F ++  L  S++LPTATD  GNFVN+ EV
Sbjct: 189 IGLVPDSDKSGSFHVKLRLLPGTHRFRFVVDNELRVSDFLPTATDQMGNFVNYIEV 244

>AER361C Chr5 complement(1307677..1309104) [1428 bp, 475 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YER027C
           (GAL83) and YGL208W (SIP2)
          Length = 475

 Score = 50.1 bits (118), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 24/57 (42%), Positives = 34/57 (59%)

Query: 505 IRMVYDNVHKEWFFPDLFLPPGIYRLQFSINGLLTHSNYLPTATDSEGNFVNWFEVL 561
           I +V D      F   L LPPG +R +F ++  L  S++L TATD  GNFVN+ E++
Sbjct: 220 IGLVADPARPGVFQIKLQLPPGTHRFRFIVDNELRFSDFLLTATDQMGNFVNYLEIV 276

 Score = 49.7 bits (117), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 29/76 (38%), Positives = 41/76 (53%), Gaps = 4/76 (5%)

Query: 729 PDLPIYLNSSYLNKILNQSNPNSEPHDRDEGAINHIIPHVNLNHLLTSSIRDEIISVACT 788
           P LP +L     + ILN  N +++    +      I  HV LNHL TSSI+   + VA  
Sbjct: 403 PQLPPHLE----HVILNHYNKSADGVSENTSGALPIPNHVVLNHLATSSIKHNTLCVASI 458

Query: 789 TRYEGKFITQVIYAPC 804
            RY+ K+ TQ++YAP 
Sbjct: 459 VRYKQKYATQILYAPL 474

>CAGL0K09350g Chr11 complement(922651..923949) [1299 bp, 432 aa]
           {ON} similar to uniprot|P34164 Saccharomyces cerevisiae
           YGL208w SIP2 or uniprot|Q04739 Saccharomyces cerevisiae
           YER027c GAL83
          Length = 432

 Score = 47.8 bits (112), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 29/76 (38%), Positives = 42/76 (55%), Gaps = 6/76 (7%)

Query: 729 PDLPIYLNSSYLNKILNQSNPNSEPHDRDEGAINHIIP-HVNLNHLLTSSIRDEIISVAC 787
           P LP  L +  LNK      P S+  + + GA+   IP H  LNHL+T+SI+   + VA 
Sbjct: 361 PQLPPQLENVILNKF---GEPLSQSTENNAGALP--IPNHSVLNHLVTTSIKHNTLCVAT 415

Query: 788 TTRYEGKFITQVIYAP 803
             RY  K+++Q+ Y P
Sbjct: 416 NNRYRQKYVSQIYYVP 431

 Score = 47.8 bits (112), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 22/44 (50%), Positives = 28/44 (63%)

Query: 517 FFPDLFLPPGIYRLQFSINGLLTHSNYLPTATDSEGNFVNWFEV 560
           F   L L PG +R +F ++  L  S+ LPTATD  GNFVN+ EV
Sbjct: 209 FKIKLQLAPGTHRFRFIVDNQLRFSDNLPTATDQMGNFVNYLEV 252

>Smik_6.215 Chr6 complement(354154..355695) [1542 bp, 513 aa] {ON}
           YGR123C (REAL)
          Length = 513

 Score = 33.1 bits (74), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 14/44 (31%), Positives = 23/44 (52%)

Query: 530 LQFSINGLLTHSNYLPTATDSEGNFVNWFEVLPGYHTIEPFRNE 573
           +QF   G+L      P   DS+GN      ++PG+  ++P RN+
Sbjct: 441 VQFEQKGMLMTVFSAPNYCDSQGNLGGVIHIVPGHGVLQPGRND 484

>CAGL0K10648g Chr11 complement(1036025..1039063) [3039 bp, 1012 aa]
           {ON} weakly similar to uniprot|P43597 Saccharomyces
           cerevisiae YFR016c
          Length = 1012

 Score = 32.0 bits (71), Expect = 7.5,   Method: Compositional matrix adjust.
 Identities = 20/64 (31%), Positives = 32/64 (50%), Gaps = 1/64 (1%)

Query: 50  VSHTSGHNGTIPSRMQLLASHDSVTDCDDSVNDDTTIDKEPSLLFKKDYSLNNTADGNDT 109
           V      N   PS +++L + D+++D  +    D T+DKEP    K    LN+  D   +
Sbjct: 622 VDKAGAENSHKPSNLKVLEAKDTLSDTMNETKQDETMDKEPKSTAKL-IKLNDEVDEEAS 680

Query: 110 TLAN 113
           TLA+
Sbjct: 681 TLAD 684

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.311    0.128    0.364 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 82,745,125
Number of extensions: 3579255
Number of successful extensions: 11607
Number of sequences better than 10.0: 109
Number of HSP's gapped: 11944
Number of HSP's successfully gapped: 166
Length of query: 817
Length of database: 53,481,399
Length adjustment: 118
Effective length of query: 699
Effective length of database: 39,950,811
Effective search space: 27925616889
Effective search space used: 27925616889
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 70 (31.6 bits)