Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Smik_4.6955.524ON1555153462940.0
YDR420W (HKR1)5.524ON180294524080.0
Skud_4.6945.524ON150494821640.0
Suva_2.5975.524ON179793320210.0
TDEL0A038805.524ON16964684731e-46
ZYRO0D12496g5.524ON23855304346e-42
KLLA0A01826g5.524ON14645394084e-39
Ecym_40605.524ON22014844014e-38
ADR200C5.524ON23385063996e-38
SAKL0G04862g5.524ON24443153891e-36
KNAG0C032605.524ON15304633711e-34
KAFR0E033205.524ON11904263602e-33
CAGL0F03003g5.524ON11852393404e-31
Kpol_363.145.524ON7612313357e-31
TPHA0L003605.524ON11613422842e-24
KLTH0G03696g5.524ON20853842512e-20
Kwal_47.186505.524ON21591102261e-17
TDEL0D030104.150ON11232202223e-17
TBLA0G012104.150ON18253292171e-16
SAKL0H23188g4.150ON1262972091e-15
KLLA0C17985g4.150ON9082512081e-15
NDAI0K025804.150ON9851321946e-14
Kwal_47.177034.150ON15681111921e-13
YGR014W (MSB2)4.150ON1306941902e-13
ZYRO0G11242g4.150ON14871361865e-13
KLTH0E08844g4.150ON1520891831e-12
NCAS0A052304.150ON785841812e-12
KAFR0F034704.150ON9492811794e-12
Ecym_73494.150ON1129931785e-12
Suva_7.2964.150ON1135851768e-12
KNAG0D035904.150ON994701686e-11
TBLA0G009505.524ON22531241687e-11
Skud_7.2994.150ON1169681652e-10
AGR019C4.150ON11052291642e-10
Smik_7.3024.150ON1189681562e-09
Kpol_1062.374.150ON973891453e-08
TPHA0K013904.150ON826801321e-06
CAGL0F08833g4.150ON936871302e-06
Suva_14.3896.345ON321107890.075
YNR034W (SOL1)6.345ON321107890.086
Skud_14.3666.345ON321107880.11
Smik_14.3646.345ON321107860.18
TBLA0F041506.345ON385105830.56
Kpol_325.56.345ON344107820.64
YHR115C (DMA1)2.157ON41673782.0
Smik_8.1932.157ON41673772.5
KNAG0D003506.345ON313106762.7
KLTH0A06864g6.345ON343104763.2
Ecym_25036.345ON336106763.3
KLLA0C08415g6.345ON321104736.6
Kpol_1028.376.345ON309104736.7
TPHA0H023206.345ON361104737.3
AER268W6.345ON329104737.7
Suva_15.3112.157ON26977727.8
TBLA0I024306.345ON329119728.6
Smik_3.1746.345ON312104728.7
ZYRO0D08096g6.345ON305104728.8
YCR073W-A (SOL2)6.345ON315104729.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Smik_4.695
         (1555 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Smik_4.695 Chr4 (1227757..1232424) [4668 bp, 1555 aa] {ON} YDR42...  2429   0.0  
YDR420W Chr4 (1306267..1311675) [5409 bp, 1802 aa] {ON}  HKR1Muc...   932   0.0  
Skud_4.694 Chr4 (1228095..1232609) [4515 bp, 1504 aa] {ON} YDR42...   838   0.0  
Suva_2.597 Chr2 (1058501..1059391,1059470..1059725,1059765..1059...   783   0.0  
TDEL0A03880 Chr1 (690387..695477) [5091 bp, 1696 aa] {ON} Anc_5....   186   1e-46
ZYRO0D12496g Chr4 (1047901..1055058) [7158 bp, 2385 aa] {ON} som...   171   6e-42
KLLA0A01826g Chr1 complement(163010..167404) [4395 bp, 1464 aa] ...   161   4e-39
Ecym_4060 Chr4 (125127..131732) [6606 bp, 2201 aa] {ON} similar ...   159   4e-38
ADR200C Chr4 complement(1051878..1058894) [7017 bp, 2338 aa] {ON...   158   6e-38
SAKL0G04862g Chr7 (392107..399441) [7335 bp, 2444 aa] {ON} some ...   154   1e-36
KNAG0C03260 Chr3 complement(639021..643613) [4593 bp, 1530 aa] {...   147   1e-34
KAFR0E03320 Chr5 complement(659303..662875) [3573 bp, 1190 aa] {...   143   2e-33
CAGL0F03003g Chr6 (289923..293480) [3558 bp, 1185 aa] {ON} some ...   135   4e-31
Kpol_363.14 s363 (25673..27781,27783..27959) [2286 bp, 761 aa] {...   133   7e-31
TPHA0L00360 Chr12 complement(50396..53881) [3486 bp, 1161 aa] {O...   114   2e-24
KLTH0G03696g Chr7 (286341..292598) [6258 bp, 2085 aa] {ON} some ...   101   2e-20
Kwal_47.18650 s47 complement(913245..919724) [6480 bp, 2159 aa] ...    92   1e-17
TDEL0D03010 Chr4 complement(564735..568106) [3372 bp, 1123 aa] {...    90   3e-17
TBLA0G01210 Chr7 (321555..327032) [5478 bp, 1825 aa] {ON} Anc_4....    88   1e-16
SAKL0H23188g Chr8 (2009677..2013465) [3789 bp, 1262 aa] {ON} som...    85   1e-15
KLLA0C17985g Chr3 complement(1596320..1599046) [2727 bp, 908 aa]...    85   1e-15
NDAI0K02580 Chr11 complement(574995..577952) [2958 bp, 985 aa] {...    79   6e-14
Kwal_47.17703 s47 (521283..525989) [4707 bp, 1568 aa] {ON} YNR04...    79   1e-13
YGR014W Chr7 (516943..520863) [3921 bp, 1306 aa] {ON}  MSB2Mucin...    78   2e-13
ZYRO0G11242g Chr7 (900370..904833) [4464 bp, 1487 aa] {ON} weakl...    76   5e-13
KLTH0E08844g Chr5 (804120..808682) [4563 bp, 1520 aa] {ON} some ...    75   1e-12
NCAS0A05230 Chr1 (1034523..1036880) [2358 bp, 785 aa] {ON} Anc_4...    74   2e-12
KAFR0F03470 Chr6 (689705..692554) [2850 bp, 949 aa] {ON} Anc_4.1...    74   4e-12
Ecym_7349 Chr7 complement(722484..725873) [3390 bp, 1129 aa] {ON...    73   5e-12
Suva_7.296 Chr7 (508904..512311) [3408 bp, 1135 aa] {ON} YGR014W...    72   8e-12
KNAG0D03590 Chr4 (657513..660497) [2985 bp, 994 aa] {ON} Anc_4.1...    69   6e-11
TBLA0G00950 Chr7 complement(232502..239263) [6762 bp, 2253 aa] {...    69   7e-11
Skud_7.299 Chr7 (520447..523956) [3510 bp, 1169 aa] {ON} YGR014W...    68   2e-10
AGR019C Chr7 complement(747644..750961) [3318 bp, 1105 aa] {ON} ...    68   2e-10
Smik_7.302 Chr7 (508666..512235) [3570 bp, 1189 aa] {ON} YGR014W...    65   2e-09
Kpol_1062.37 s1062 complement(78801..81722) [2922 bp, 973 aa] {O...    60   3e-08
TPHA0K01390 Chr11 complement(287666..290146) [2481 bp, 826 aa] {...    55   1e-06
CAGL0F08833g Chr6 (873849..876659) [2811 bp, 936 aa] {ON} weakly...    55   2e-06
Suva_14.389 Chr14 (671583..672548) [966 bp, 321 aa] {ON} YNR034W...    39   0.075
YNR034W Chr14 (690321..691286) [966 bp, 321 aa] {ON}  SOL1Protei...    39   0.086
Skud_14.366 Chr14 (658414..659379) [966 bp, 321 aa] {ON} YNR034W...    39   0.11 
Smik_14.364 Chr14 (648272..649237) [966 bp, 321 aa] {ON} YNR034W...    38   0.18 
TBLA0F04150 Chr6 complement(1024409..1025566) [1158 bp, 385 aa] ...    37   0.56 
Kpol_325.5 s325 (8203..9237) [1035 bp, 344 aa] {ON} (8203..9237)...    36   0.64 
YHR115C Chr8 complement(340109..341359) [1251 bp, 416 aa] {ON}  ...    35   2.0  
Smik_8.193 Chr8 complement(316475..317725) [1251 bp, 416 aa] {ON...    34   2.5  
KNAG0D00350 Chr4 complement(47512..48453) [942 bp, 313 aa] {ON} ...    34   2.7  
KLTH0A06864g Chr1 (573655..574686) [1032 bp, 343 aa] {ON} simila...    34   3.2  
Ecym_2503 Chr2 (985620..986630) [1011 bp, 336 aa] {ON} similar t...    34   3.3  
KLLA0C08415g Chr3 complement(738306..739271) [966 bp, 321 aa] {O...    33   6.6  
Kpol_1028.37 s1028 complement(89587..90516) [930 bp, 309 aa] {ON...    33   6.7  
TPHA0H02320 Chr8 (549721..550806) [1086 bp, 361 aa] {ON} Anc_6.3...    33   7.3  
AER268W Chr5 (1128915..1129904) [990 bp, 329 aa] {ON} Syntenic h...    33   7.7  
Suva_15.311 Chr15 complement(542475..543284) [810 bp, 269 aa] {O...    32   7.8  
TBLA0I02430 Chr9 (559084..560073) [990 bp, 329 aa] {ON} Anc_6.34...    32   8.6  
Smik_3.174 Chr3 (246682..247620) [939 bp, 312 aa] {ON} YCR073W-A...    32   8.7  
ZYRO0D08096g Chr4 complement(701552..702469) [918 bp, 305 aa] {O...    32   8.8  
YCR073W-A Chr3 (246963..247910) [948 bp, 315 aa] {ON}  SOL2Prote...    32   9.6  

>Smik_4.695 Chr4 (1227757..1232424) [4668 bp, 1555 aa] {ON} YDR420W
            (REAL)
          Length = 1555

 Score = 2429 bits (6294), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1289/1534 (84%), Positives = 1289/1534 (84%)

Query: 22   YSNDTTYSRLYSSEIEIGTSYLTSTAFNSRSSNNENSITSSPETTTLAGQYSESARVAVN 81
            YSNDTTYSRLYSSEIEIGTSYLTSTAFNSRSSNNENSITSSPETTTLAGQYSESARVAVN
Sbjct: 22   YSNDTTYSRLYSSEIEIGTSYLTSTAFNSRSSNNENSITSSPETTTLAGQYSESARVAVN 81

Query: 82   EEQSTGTPHQYSGALTTSQDADSTLSTQRSTEKAIPSSSEVPTPTNYYSGTSLFSQTLDD 141
            EEQSTGTPHQYSGALTTSQDADSTLSTQRSTEKAIPSSSEVPTPTNYYSGTSLFSQTLDD
Sbjct: 82   EEQSTGTPHQYSGALTTSQDADSTLSTQRSTEKAIPSSSEVPTPTNYYSGTSLFSQTLDD 141

Query: 142  NSKSILESSNEVTSSGFLTGIIISTSDGTAVPGKINPTFXXXXXXXXXXXQDFSYNDADT 201
            NSKSILESSNEVTSSGFLTGIIISTSDGTAVPGKINPTF           QDFSYNDADT
Sbjct: 142  NSKSILESSNEVTSSGFLTGIIISTSDGTAVPGKINPTFSSLSKEESTSSQDFSYNDADT 201

Query: 202  TTEMISGVSWLPSAATATRTDSFTSGLVRTEFTSALSRISQPSSIKPTTLVDSFSMGSVQ 261
            TTEMISGVSWLPSAATATRTDSFTSGLVRTEFTSALSRISQPSSIKPTTLVDSFSMGSVQ
Sbjct: 202  TTEMISGVSWLPSAATATRTDSFTSGLVRTEFTSALSRISQPSSIKPTTLVDSFSMGSVQ 261

Query: 262  TQLASTISSEVPTXXXXXXXXXXXXXNYDXXXXXXXXXXXXXEXXXXXXXXXXXXXXXXP 321
            TQLASTISSEVPT             NYD             E                P
Sbjct: 262  TQLASTISSEVPTEEEYIISELEISENYDSSLAIYLSAALIAEKKSSSLIINLLSSYSKP 321

Query: 322  ISTQTFLASHTGNRILTASTVSHPSSITSTTLVDSVSSGSPQTQLINVISISSKVSTDEY 381
            ISTQTFLASHTGNRILTASTVSHPSSITSTTLVDSVSSGSPQTQLINVISISSKVSTDEY
Sbjct: 322  ISTQTFLASHTGNRILTASTVSHPSSITSTTLVDSVSSGSPQTQLINVISISSKVSTDEY 381

Query: 382  TVSDLEFPINYGSSAGNYPDQELIVNSPYTYSTNKASSLITQSTRIESNPIMESSISTTK 441
            TVSDLEFPINYGSSAGNYPDQELIVNSPYTYSTNKASSLITQSTRIESNPIMESSISTTK
Sbjct: 382  TVSDLEFPINYGSSAGNYPDQELIVNSPYTYSTNKASSLITQSTRIESNPIMESSISTTK 441

Query: 442  ILFSSISHTKTSTSAFKTMSFASIHSFSSVPSPLDSVAVSSSRTSFPNGIXXXXXXXXXX 501
            ILFSSISHTKTSTSAFKTMSFASIHSFSSVPSPLDSVAVSSSRTSFPNGI          
Sbjct: 442  ILFSSISHTKTSTSAFKTMSFASIHSFSSVPSPLDSVAVSSSRTSFPNGIAPSSPLASVV 501

Query: 502  XXXXXXXXXNEVXXXXXXXXXXXXXYLSSQNRFXXXXXXXXXXXXXXXXXXXNEVXXXXX 561
                     NEV             YLSSQNRF                   NEV     
Sbjct: 502  VPSSHTSSPNEVSSSRPTSAAISSTYLSSQNRFPPSSPLASVVVPSSRTSSPNEVSSSPP 561

Query: 562  XXXXXXXXYLSSPNGXXXXXXXXXXXXXXXXXXXXNEXXXXXXXXXXXXXXYISLSSDYT 621
                    YLSSPNG                    NE              YISLSSDYT
Sbjct: 562  TSAAISSTYLSSPNGVAPPSPLASVVVPSSRTSSPNEVSSSPLASAAVPSAYISLSSDYT 621

Query: 622  LEFSSVDYSTTSVVPAIPVHSPSLGITNSLQQTSLAIQNIVSEFTSASSTFSQETYPXXX 681
            LEFSSVDYSTTSVVPAIPVHSPSLGITNSLQQTSLAIQNIVSEFTSASSTFSQETYP   
Sbjct: 622  LEFSSVDYSTTSVVPAIPVHSPSLGITNSLQQTSLAIQNIVSEFTSASSTFSQETYPSAI 681

Query: 682  XXXXXXXXXXNLFETSQMFLSTQLTPTYNTNLLASSTPRRLISTNAKASYEVTTQNIESS 741
                      NLFETSQMFLSTQLTPTYNTNLLASSTPRRLISTNAKASYEVTTQNIESS
Sbjct: 682  SVVSMSSSTSNLFETSQMFLSTQLTPTYNTNLLASSTPRRLISTNAKASYEVTTQNIESS 741

Query: 742  STSTMVSNFPYFSSSADKEKFSTIPKMTMVISSGIQAXXXXXXXXXXXXXXXXXGVLDSS 801
            STSTMVSNFPYFSSSADKEKFSTIPKMTMVISSGIQA                 GVLDSS
Sbjct: 742  STSTMVSNFPYFSSSADKEKFSTIPKMTMVISSGIQAHSIYASSSHHSSTGISIGVLDSS 801

Query: 802  KTSGLFASSLDHAPPSTSSANHPXXXXXXXXXXXXXQESSNSIKFASQPNSQFRNSEVRS 861
            KTSGLFASSLDHAPPSTSSANHP             QESSNSIKFASQPNSQFRNSEVRS
Sbjct: 802  KTSGLFASSLDHAPPSTSSANHPGKTASTGKSASSTQESSNSIKFASQPNSQFRNSEVRS 861

Query: 862  TLSTGSNAHFSFTSSLPAXXXXXXXXXXXXXXTITDNDEKTSSATRKTQNSGLSKTSESY 921
            TLSTGSNAHFSFTSSLPA              TITDNDEKTSSATRKTQNSGLSKTSESY
Sbjct: 862  TLSTGSNAHFSFTSSLPANSKVNSENSSKKGKTITDNDEKTSSATRKTQNSGLSKTSESY 921

Query: 922  SRPSTKISTGTITTAVQTQVISNLESPTPVLSIYSTNLDSSSNSYAWLPTAIIVQSSETD 981
            SRPSTKISTGTITTAVQTQVISNLESPTPVLSIYSTNLDSSSNSYAWLPTAIIVQSSETD
Sbjct: 922  SRPSTKISTGTITTAVQTQVISNLESPTPVLSIYSTNLDSSSNSYAWLPTAIIVQSSETD 981

Query: 982  TSTTLFNPTITGSLPNLIEPAVTASEPINHTLITVGFTAALNYVFLVQNPLSSAQIFNFL 1041
            TSTTLFNPTITGSLPNLIEPAVTASEPINHTLITVGFTAALNYVFLVQNPLSSAQIFNFL
Sbjct: 982  TSTTLFNPTITGSLPNLIEPAVTASEPINHTLITVGFTAALNYVFLVQNPLSSAQIFNFL 1041

Query: 1042 PLVLKYPFSDTSSGVESSNGELSSFILSYRSGTSTTTLSPQSKSSLSIVRXXXXXXXXXP 1101
            PLVLKYPFSDTSSGVESSNGELSSFILSYRSGTSTTTLSPQSKSSLSIVR         P
Sbjct: 1042 PLVLKYPFSDTSSGVESSNGELSSFILSYRSGTSTTTLSPQSKSSLSIVRKKKKGDKEKP 1101

Query: 1102 PTSTMDLYFPSINASSIAVKQIVPMMDSSKAYIIAVAEVYFPTEAVSYLQELILDVNSTL 1161
            PTSTMDLYFPSINASSIAVKQIVPMMDSSKAYIIAVAEVYFPTEAVSYLQELILDVNSTL
Sbjct: 1102 PTSTMDLYFPSINASSIAVKQIVPMMDSSKAYIIAVAEVYFPTEAVSYLQELILDVNSTL 1161

Query: 1162 YNNPQSPLRTLAGLIDNSIPLGSLTLYSSGNEGHVSSLFPSGVLDSSKENSKGIVATYKY 1221
            YNNPQSPLRTLAGLIDNSIPLGSLTLYSSGNEGHVSSLFPSGVLDSSKENSKGIVATYKY
Sbjct: 1162 YNNPQSPLRTLAGLIDNSIPLGSLTLYSSGNEGHVSSLFPSGVLDSSKENSKGIVATYKY 1221

Query: 1222 GALDDFTNSFTDSAPGWSYAARTIVFLAILTIGXXXXXXXXXXXXHYRNILLKRYPKDCI 1281
            GALDDFTNSFTDSAPGWSYAARTIVFLAILTIG            HYRNILLKRYPKDCI
Sbjct: 1222 GALDDFTNSFTDSAPGWSYAARTIVFLAILTIGALLWLLFAFFVFHYRNILLKRYPKDCI 1281

Query: 1282 EKSLGNERKFDSTALSRSSSGNQIFNEKPSGSENESVHSVTDDHYIITGENTVYSTTHGL 1341
            EKSLGNERKFDSTALSRSSSGNQIFNEKPSGSENESVHSVTDDHYIITGENTVYSTTHGL
Sbjct: 1282 EKSLGNERKFDSTALSRSSSGNQIFNEKPSGSENESVHSVTDDHYIITGENTVYSTTHGL 1341

Query: 1342 HYTINDDGDLFYKEATLNDLEETAEREDSGIDSILRDCVYDEHQESTEAYLNDEESISSI 1401
            HYTINDDGDLFYKEATLNDLEETAEREDSGIDSILRDCVYDEHQESTEAYLNDEESISSI
Sbjct: 1342 HYTINDDGDLFYKEATLNDLEETAEREDSGIDSILRDCVYDEHQESTEAYLNDEESISSI 1401

Query: 1402 VDVDENGNIRLYDSYSDDEEPNSFYLPXXXXXXXXXXXXXXXXHNTPETGSCTTDDPEAG 1461
            VDVDENGNIRLYDSYSDDEEPNSFYLP                HNTPETGSCTTDDPEAG
Sbjct: 1402 VDVDENGNIRLYDSYSDDEEPNSFYLPNEVIEEYNNNNVYKIKHNTPETGSCTTDDPEAG 1461

Query: 1462 NMITNEFSSSSQTCLPSTTYTTPLHTNSIKLQTLRYSEISLSQPNKALFSNHEDLEIDDI 1521
            NMITNEFSSSSQTCLPSTTYTTPLHTNSIKLQTLRYSEISLSQPNKALFSNHEDLEIDDI
Sbjct: 1462 NMITNEFSSSSQTCLPSTTYTTPLHTNSIKLQTLRYSEISLSQPNKALFSNHEDLEIDDI 1521

Query: 1522 DDNGSVSDIQIEELDALDEELYKRISKIAKQQNL 1555
            DDNGSVSDIQIEELDALDEELYKRISKIAKQQNL
Sbjct: 1522 DDNGSVSDIQIEELDALDEELYKRISKIAKQQNL 1555

>YDR420W Chr4 (1306267..1311675) [5409 bp, 1802 aa] {ON}  HKR1Mucin
            family member that functions as an osmosensor in the
            Sho1p-mediated HOG pathway with Msb2p; proposed to be a
            negative regulator of filamentous growth; mutant displays
            defects in beta-1,3 glucan synthesis and bud site
            selection
          Length = 1802

 Score =  932 bits (2408), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 535/945 (56%), Positives = 640/945 (67%), Gaps = 9/945 (0%)

Query: 613  YISLSSDYTLEFSSVDYSTTSVVPAIPVHSPSLGITNSLQQTSLAIQNIVSEFTSASSTF 672
            Y   SS Y  EFSS  YSTTS +    +HS    IT+ L QTS+AIQ+IVS+  S SST 
Sbjct: 858  YTYFSSAYAFEFSSERYSTTSTIAPTQIHSTLSRITDFLLQTSMAIQSIVSQQISTSSTL 917

Query: 673  SQETYPXXXXXXXXXXXXXNLFETSQMFLSTQLTPTYNTNLLASSTPRRLISTNAKASYE 732
            + E +              NL ETS +  STQ + T   N    S+ +  +S++ K  Y+
Sbjct: 918  NDEIH--SSALSVFNPSASNLVETSLIISSTQASITSPKNSAKISSLQSQLSSSTKNPYD 975

Query: 733  VTTQNIESSSTSTMVSNFPYFSSSA--DKEKFSTIPKMTMVISSGIQAXXXXXXXXXXXX 790
               +N E+S  ST+VSNF Y SS+A  D EKFS  P     ISS   A            
Sbjct: 976  TANKNTETSGRSTVVSNFLYTSSAAKPDNEKFSATPTEITTISSSSHAYSLSIPSSHNSV 1035

Query: 791  XXXXXGVLDSSKTSGLFASSLDHAPPSTSSANHPXXXXXXXXXXXXXQESSNSIKFASQP 850
                   +DSSK+    A+S  ++  S SS                 QE   S     + 
Sbjct: 1036 TGLSHNFVDSSKS----ATSFGYSSSSISSIKLSKETIPASKSVSNTQERITSFTSTLRA 1091

Query: 851  NSQFRNSEVRSTLSTGSNAHFSFTSSLPAXXXXXXXX-XXXXXXTITDNDEKTSSATRKT 909
            NSQ   SE R+++ +  ++H S   SL                 T+ +N E+T   T KT
Sbjct: 1092 NSQSEKSEGRNSVGSLQSSHISSNPSLSTNTKVDSKSLSRKVSKTMGENGEETGLTTTKT 1151

Query: 910  QNSGLSKTSESYSRPSTKISTGTITTAVQTQVISNLESPTPVLSIYSTNLDSSSNSYAWL 969
            Q    S+TS SYSR  TKIS G  TTAVQTQ  +N     P LS Y T    S NSYAWL
Sbjct: 1152 QYKSSSETSGSYSRSFTKISIGPATTAVQTQASTNSVFTAPALSTYPTTPYPSPNSYAWL 1211

Query: 970  PTAIIVQSSETDTSTTLFNPTITGSLPNLIEPAVTASEPINHTLITVGFTAALNYVFLVQ 1029
            PTAIIV+SSET  +T  FNP+ITGSLPN IEPAV  SEPINHTLIT+GFTAALNYVFLVQ
Sbjct: 1212 PTAIIVESSETGPTTASFNPSITGSLPNAIEPAVAVSEPINHTLITIGFTAALNYVFLVQ 1271

Query: 1030 NPLSSAQIFNFLPLVLKYPFSDTSSGVESSNGELSSFILSYRSGTSTTTLSPQSKSSLSI 1089
            NPLSSAQIFNFLPLVLKYPFS+TSS +++S GELS+FILSYRSG+STTTLSP+S SSLS+
Sbjct: 1272 NPLSSAQIFNFLPLVLKYPFSNTSSELDNSIGELSTFILSYRSGSSTTTLSPKSISSLSV 1331

Query: 1090 VRXXXXXXXXXPPTSTMDLYFPSINASSIAVKQIVPMMDSSKAYIIAVAEVYFPTEAVSY 1149
            V+            ST DL+ P ++ SSIAVK+IVPM+DSSKAYI++VAEVYFPTEAV+Y
Sbjct: 1332 VKKKKNQQKKNATKSTEDLHPPQVDTSSIAVKKIVPMVDSSKAYIVSVAEVYFPTEAVTY 1391

Query: 1150 LQELILDVNSTLYNNPQSPLRTLAGLIDNSIPLGSLTLYSSGNEGHVSSLFPSGVLDSSK 1209
            LQ+LILD NSTLY+NPQ+PLR+LAGLID+ IPLG LTLY SG+ G+V SL  S VLDSSK
Sbjct: 1392 LQQLILDENSTLYSNPQTPLRSLAGLIDSGIPLGGLTLYGSGDGGYVPSLTSSSVLDSSK 1451

Query: 1210 ENSKGIVATYKYGALDDFTNSFTDSAPGWSYAARTIVFLAILTIGXXXXXXXXXXXXHYR 1269
             NS+ I  TYKYGALDDF NSFTDSA    YA + I+FL +LTIG             +R
Sbjct: 1452 GNSQNIDGTYKYGALDDFINSFTDSASAGKYAVKIIIFLIVLTIGVLLWLFVAFFAFRHR 1511

Query: 1270 NILLKRYPKDCIEKSLGNERKFDSTALSRSSSGNQIFNEKPSGSENESVHSVTDDHYIIT 1329
            NILLKR+P++CI KSL NER+ +ST LSRSSSGNQ++NEKP  SENESV+S  DDHYI+T
Sbjct: 1512 NILLKRHPRNCIGKSLNNERELESTELSRSSSGNQVYNEKPPESENESVYSAVDDHYIVT 1571

Query: 1330 GENTVYSTTHGLHYTINDDGDLFYKEATLNDLEETAEREDSGIDSILRDCVYDEHQESTE 1389
            GENTVY+T H LHYTINDDGDL Y++A   D ++T   + SGIDSI+RDCVYD++Q++TE
Sbjct: 1572 GENTVYNTIHRLHYTINDDGDLLYRDAIPLDFDQTNGDDGSGIDSIVRDCVYDKNQDATE 1631

Query: 1390 AYLNDEESISSIVDVDENGNIRLYDSYSDDEEPNSFYLPXXXXXXXXXXXXXXXXHNTPE 1449
            A+LNDEESIS I+DVDENG+IRLYDSYSD+EE NSF+LP                 +   
Sbjct: 1632 AFLNDEESISGILDVDENGDIRLYDSYSDNEESNSFHLPDEVIENYNKNHLCETKLHGLG 1691

Query: 1450 TGSCTTDDPEAGNMITNEFSSSSQTCLPSTTYTTPLHTNSIKLQTLRYSEISLSQPNKAL 1509
            T SCTTDDP+ GN ITNEFS+ SQTCLPST YTTPLHTNSIKL TLRY+E SL +PN+ L
Sbjct: 1692 TESCTTDDPDTGNQITNEFSTGSQTCLPSTAYTTPLHTNSIKLHTLRYTESSLPKPNQTL 1751

Query: 1510 FSNHEDLEIDDIDDNGSVSDIQIEELDALDEELYKRISKIAKQQN 1554
            FSN EDLEI+DIDDNGSVSD+ IEELDALDEELYKR+SK+ KQQN
Sbjct: 1752 FSNLEDLEIEDIDDNGSVSDVHIEELDALDEELYKRMSKVIKQQN 1796

 Score =  103 bits (258), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 106/250 (42%), Positives = 137/250 (54%), Gaps = 28/250 (11%)

Query: 22  YSNDTTYSRLYSSEIEIGTSYLTSTAFNSRSSNNENSITSSPETTTLAGQYSESARVAVN 81
           YSNDT YS  Y++ IE   SY TS   ++ SSN EN+ITSS ETTT+AGQY ES    + 
Sbjct: 22  YSNDTIYSTSYNNGIESTPSYSTSAISSTGSSNKENAITSSSETTTMAGQYGESGSTTIM 81

Query: 82  EEQSTGTPHQYSGALTTSQDADSTLSTQRSTEKAIPSSSEVPTPTNYYSGTSLFSQTLDD 141
           +EQ TGT  QY    TT+Q +D+  S ++STE A PSSS VPTP   YS  S  SQTL  
Sbjct: 82  DEQETGTSSQYISVTTTTQTSDTMSSVKKSTEIATPSSSIVPTPLQSYSDESQISQTLSH 141

Query: 142 NSKSILESSNEVTSSGFLTGIIISTSDGTAVPGKINPTFXXXXXXXXXXXQDFSYNDADT 201
           N KS+ ES ++ TSS   + +IISTSD +AVP +I+P                      T
Sbjct: 142 NPKSVAESDSDTTSSESSSSVIISTSDSSAVPREISPII--------------------T 181

Query: 202 TTEMISGVSWLPSAATATRTDSFTSGLVRTEFTSALSRISQPSSIKPTTLVDSFSMGSVQ 261
           T   IS         T  +T S +     T     ++R+SQ SSI   + +D FS  S Q
Sbjct: 182 TDSQISK-----EEGTLAQTSSISE---TTRIAQMVTRVSQISSITAASTIDGFSSESTQ 233

Query: 262 TQLASTISSE 271
           T  ++T+S E
Sbjct: 234 TDFSNTVSFE 243

 Score = 72.4 bits (176), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 46/97 (47%), Positives = 61/97 (62%)

Query: 371 SISSKVSTDEYTVSDLEFPINYGSSAGNYPDQELIVNSPYTYSTNKASSLITQSTRIESN 430
           SI+   S D +++S++E    Y  SAGNYPDQELIV+ P T ST + SS  +Q    ESN
Sbjct: 313 SITQTTSIDSFSMSEVELSTYYDLSAGNYPDQELIVDRPATSSTAETSSEASQGVSRESN 372

Query: 431 PIMESSISTTKILFSSISHTKTSTSAFKTMSFASIHS 467
               SSISTT  + SS S T  STS+  T+ ++S+HS
Sbjct: 373 TFAVSSISTTNFIVSSASDTVVSTSSTNTVPYSSVHS 409

>Skud_4.694 Chr4 (1228095..1232609) [4515 bp, 1504 aa] {ON} YDR420W
            (REAL)
          Length = 1504

 Score =  838 bits (2164), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 499/948 (52%), Positives = 616/948 (64%), Gaps = 29/948 (3%)

Query: 623  EFSSVDYSTTS--VVPAIPVHSPSLGITNSLQQTSLAIQNIVSEFTSASSTFSQETYPXX 680
            EFSS  + +TS  V P I VH  S G TNSLQQ S+  Q   S  TS  S+ + + Y   
Sbjct: 569  EFSSKQFLSTSDGVTPVISVHIMSSGPTNSLQQNSMETQK--SHPTSTGSSLNSDAYSNT 626

Query: 681  XXXXXXXXXXXNLFETSQMFLSTQLTPTYNTNLLASSTPRRLISTNAKASYEVTTQNIES 740
                       N   TS    ST++ P+Y    + S+TP+R + T+A+ SY+V +QNIES
Sbjct: 627  ITVISIRFSSSNPAGTSAPISSTKINPSYADEPVESNTPQRQLLTSARTSYDVESQNIES 686

Query: 741  SSTSTMVSNFPYFSSSA--DKEKFSTIPKMTMVISSGIQAXXXXXXXXXXXXXXXXXGVL 798
            SST T+ SNFPY SS+   D E  S   + T  +SS +                    + 
Sbjct: 687  SSTFTIKSNFPYVSSTETPDNEDISITHEKTTTVSSNVHVYSLSDLRSRHSITEVSSDIF 746

Query: 799  DSSKTSGLFASSLDHAPPSTSSANHPXXXXXXXXXXXXXQESSNSIKFASQPNSQFRNSE 858
            DSS++SG +++S  ++  + SS  +              +E  +S+K  SQPN+    S 
Sbjct: 747  DSSRSSGSYSTSFGNSFSTISSIKYSKETELPSISISITEERLSSLKKTSQPNNLSEKST 806

Query: 859  VRSTLSTGSNAHFSFTSSLPAXXXXXXXXXXXXXXTITDNDEKTSSA------------T 906
             + TLS+    H   T S+P+                TD+ +KTS              T
Sbjct: 807  TKRTLSSSQGTH---TLSIPSGSMNSKVSS-------TDSFDKTSKMIIYSRLETPSLIT 856

Query: 907  RKTQNSGLSKTSESYSRPSTKISTGTITTAVQTQVISNLESPTPVLSIYSTNLDSSSNSY 966
             +T    LSK+SES S PST+ S G++ TA+QTQ I+  +S  PV   + T   + SN Y
Sbjct: 857  ERTHYISLSKSSESKSGPSTRASLGSVVTALQTQTITGSDSVIPVSFTHPTTPYTYSNDY 916

Query: 967  AWLPTAIIVQSSETDTSTTLFNPTITGSLPNLIEPAVTASEPINHTLITVGFTAALNYVF 1026
            AWLPT IIV+ S+T +ST  FNP+ITGSLP+LIEPAV  SEP NHTLITVGFTA LNY F
Sbjct: 917  AWLPTTIIVEPSQTGSSTAPFNPSITGSLPSLIEPAVAVSEPANHTLITVGFTAGLNYEF 976

Query: 1027 LVQNPLSSAQIFNFLPLVLKYPFSDTSSGVESSNGELSSFILSYRSGTSTTTLSPQSKSS 1086
            LVQNPLSSAQIFNFLPLVL YPFS+T   V+SS   LSSF+LSY+SGTSTTTLSP+S SS
Sbjct: 977  LVQNPLSSAQIFNFLPLVLGYPFSNTRLEVQSSTQGLSSFVLSYQSGTSTTTLSPKSVSS 1036

Query: 1087 LSIVRXXXXXXXXXPPTSTMDLYFPSINASSIAVKQIVPMMDSSKAYIIAVAEVYFPTEA 1146
            LSIV+            ST DLY PSI  SSI VKQIVPM++SSKAY+IAVAEVYFPTEA
Sbjct: 1037 LSIVKKKKKGEKRNATASTADLYLPSIETSSIVVKQIVPMVNSSKAYVIAVAEVYFPTEA 1096

Query: 1147 VSYLQELILDVNSTLYNNPQSPLRTLAGLIDNSIPLGSLTLYSSGNEGHVSSLFPSGVLD 1206
            +SYLQ+LILD +S +YNNPQ+PLRTLAGLID+ IPLG LT+Y + +  ++S L  S V D
Sbjct: 1097 ISYLQKLILDASSPIYNNPQTPLRTLAGLIDSRIPLGGLTVYGAEDGSYISGL-SSSVAD 1155

Query: 1207 SSKENSKGIVATYKYGALDDFTNSFTDSAPGWSYAARTIVFLAILTIGXXXXXXXXXXXX 1266
            SSKEN  G V T KYGALDDF NS TD +P   YA R IV L ILT              
Sbjct: 1156 SSKENPAGKVGTSKYGALDDFINSLTDYSPAGCYALRIIVILIILTAAVLLWLLLVFLAF 1215

Query: 1267 HYRNILLKRYPKDCIEKSLGNERKFDSTALSRSSSGNQIFNEKPSGSENESVHSVTDDHY 1326
             YRN LL+R P++CIEKS GNE K  + A+SRSSS NQ +NEK S +EN+S+HS+  DHY
Sbjct: 1216 RYRNELLRRRPRNCIEKSFGNESKLQNVAISRSSSDNQTYNEKTSKTENKSIHSIVGDHY 1275

Query: 1327 IITGENTVYSTTHGLHYTINDDGDLFYKEATLNDLEETAEREDSGIDSILRDCVYDEHQE 1386
            I+TGENT+YSTTHGLHYT+NDDGDLFY+EA  NDL +    ED  ID I+R+CVYD+ Q+
Sbjct: 1276 IVTGENTIYSTTHGLHYTMNDDGDLFYREAVPNDLNQLNGGEDLEIDVIVRECVYDKDQD 1335

Query: 1387 STEAYLNDEESISSIVDVDENGNIRLYDSYSDDEEPNSFYLPXXXXXXXXXXXXXXXXHN 1446
            +TEAYLND ES+SSI+DVDENGNIRL+DSYSDD E N ++L                  +
Sbjct: 1336 TTEAYLNDGESVSSILDVDENGNIRLHDSYSDDGESNRYHLQDEVIDDYNNSHLYKIQLH 1395

Query: 1447 TPETGSCTTDDPEAGNMITNEFSSSSQTCLPSTTYTTPLHTNSIKLQTLRYSEISLSQPN 1506
               T SCTTDDP+  N++TN FSS SQT LPST YTTPLHTNSIK  TL ++E SL +PN
Sbjct: 1396 GLGTRSCTTDDPDTVNLVTNVFSSGSQTFLPSTAYTTPLHTNSIKFHTLHHAESSLQEPN 1455

Query: 1507 KALFSNHEDLEIDDIDDNGSVSDIQIEELDALDEELYKRISKIAKQQN 1554
            +A FS  E+L+IDDIDDNGSVSD+Q+EELDALDEELYKR+SK+ KQQN
Sbjct: 1456 QAFFSAAEELKIDDIDDNGSVSDVQVEELDALDEELYKRMSKVVKQQN 1503

 Score = 99.0 bits (245), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 69/155 (44%), Positives = 99/155 (63%)

Query: 22  YSNDTTYSRLYSSEIEIGTSYLTSTAFNSRSSNNENSITSSPETTTLAGQYSESARVAVN 81
           YSNDTTY  LYS   +I  SY TS  +N+ S+++++++ SSPETT LAGQYS+S RV++N
Sbjct: 22  YSNDTTYPSLYSRRTDIAPSYSTSAIYNTVSNSDDSALRSSPETTALAGQYSDSGRVSIN 81

Query: 82  EEQSTGTPHQYSGALTTSQDADSTLSTQRSTEKAIPSSSEVPTPTNYYSGTSLFSQTLDD 141
           E +ST   ++++    T++++DS L+  + TE   PSSS VP+   +Y+  S   QT +D
Sbjct: 82  ERKSTDASNEHTTTTATARNSDSMLTMGKLTEMVTPSSSMVPSSVQFYNERSSALQTSND 141

Query: 142 NSKSILESSNEVTSSGFLTGIIISTSDGTAVPGKI 176
           NSKS   S +         G+  STSDGTAVP  I
Sbjct: 142 NSKSGSRSKDATIPFESSNGMKKSTSDGTAVPRGI 176

 Score = 45.1 bits (105), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 49/125 (39%), Positives = 70/125 (56%), Gaps = 19/125 (15%)

Query: 372 ISSKVST---DEYTVSDLEFPINYGSSAGNYPDQELIVNSPYTYSTNKASSLITQSTRIE 428
           IS+K+ST   +EYT+ + +F   YGSS  +Y  QELIV+   T  T KASS+ +Q     
Sbjct: 237 ISTKLSTASIEEYTIDESDFSDYYGSSVNDYFAQELIVDLSSTPFTTKASSVTSQ----- 291

Query: 429 SNPIMESSISTTKILFSSISHTKTSTSAFKTMSFASIH---SFSSVPSPLDSVAVSSSRT 485
            NP +E S   T +  SS S  +T++S  KT+S +  H   +++S P     V +SS  T
Sbjct: 292 -NPDVEYSKLATDLRVSSTSFAETASS--KTVSSSYTHLSSTYASSP-----VLISSIYT 343

Query: 486 SFPNG 490
           S P G
Sbjct: 344 SSPYG 348

>Suva_2.597 Chr2
            (1058501..1059391,1059470..1059725,1059765..1059812,
            1059849..1059854,1059891..1061045,1061361..1064398) [5394
            bp, 1797 aa] {ON} YDR420W (REAL)
          Length = 1797

 Score =  783 bits (2021), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 474/933 (50%), Positives = 581/933 (62%), Gaps = 12/933 (1%)

Query: 633  SVVPAIPVHSPSLGITNSLQQTSLAIQNIVSEFTSASSTFSQETYPXXXXXXXXXXXXXN 692
            +V P I VH+ S   T S QQ          +    SS  S  T+              N
Sbjct: 865  TVTPVISVHTMSSKSTTSSQQVPPTPYKTTLQSRPISSISSDVTFSTTVSVTSIGSFASN 924

Query: 693  LFETSQMFLSTQLTPTYNTNLLASSTPRRLISTNAKASYEVTTQNIESSS--TSTMVSNF 750
              ET+ +   TQL+ TY      S+TP   +S+  +ASY +++QNI SSS  T+   SN 
Sbjct: 925  RVETTPLSSPTQLSSTYVAESPKSNTPLTQLSSGTEASYIMSSQNIASSSKLTTARQSNI 984

Query: 751  PYFSS--SADKEKFSTIPKMTMVISSGIQAXXXXXXXXXXXX-XXXXXGVLDSSKTSGLF 807
            PY SS  ++D   FST  + +   S+ +                     V  SSK  G  
Sbjct: 985  PYVSSMKTSDNGFFSTTLQASPTGSTKMHTFTSSTSTSRHSMPQIAASDVSGSSKDPGSH 1044

Query: 808  ASSLDHAPPSTSSANHPXXXXXXXXXXXXXQESSNSIKFASQPNSQFRNSEVRSTLSTGS 867
             +SL H+  S SS  +               E         Q NSQ   S V++T++T S
Sbjct: 1045 ITSLYHSASSVSSKKYSKETNIVTQSFSETHERLTGSTRTYQSNSQPSISNVKTTVNTQS 1104

Query: 868  NAHFSFTSSLPAXXXXXXXXXXXXXXTITDNDEKTSSATRKTQNSGLSKTSESYSRPSTK 927
            +   +  S                  TITD+  K S  T KT +    KT ES S  STK
Sbjct: 1105 HVLTTALSKSTKSKAGSTSSSNKLPETITDSRGKLSLTTTKTSHDSSLKTGESNSGVSTK 1164

Query: 928  ISTGTITTAVQTQVISNLESPTPVLSIYSTNLDSSSNSYAWLPTAIIVQSSETDTSTTLF 987
            +STGTI+ A QTQ I+   S T V   Y+TN  ++SN YAWLPTAIIV+ +++DTSTT F
Sbjct: 1165 LSTGTISIATQTQAITASTSITAVPFTYATNPYTTSNDYAWLPTAIIVEPTKSDTSTTSF 1224

Query: 988  NPTITGSLPNLIEPAVTASEPINHTLITVGFTAALNYVFLVQNPLSSAQIFNFLPLVLKY 1047
            NP+IT SLPN+I PA+  +EP NHTLIT+GFTA LNYVFLVQNPLSSAQIFNFLPLVLKY
Sbjct: 1225 NPSITASLPNVIAPAIAVTEPANHTLITIGFTAGLNYVFLVQNPLSSAQIFNFLPLVLKY 1284

Query: 1048 PFSDTSSGV-ESSNGEL--SSFILSYRSGTSTTTLSPQSKSSLSIVRXXXXXXXXXPPTS 1104
            PFSDT+S   ESS  E+  SSF+LSY+SG+STTTLSP+S SS+ IVR            S
Sbjct: 1285 PFSDTTSQQEESSTYEMGSSSFVLSYQSGSSTTTLSPESVSSIPIVRKKKKKGGKNSVMS 1344

Query: 1105 TMDLYFPSINASSIAVKQIVPMMDSSKAYIIAVAEVYFPTEAVSYLQELILDVNSTLYNN 1164
            T +L  PSI  SSI VKQIVPM+DSS++Y+IAVAEVYFPTEA+S LQELILD NSTLYNN
Sbjct: 1345 TANLDLPSIGNSSIVVKQIVPMIDSSRSYVIAVAEVYFPTEAISSLQELILDTNSTLYNN 1404

Query: 1165 PQSPLRTLAGLIDNSIPLGSLTLYSSGNEGHVSSLFPSGVLDSSKENSKGIVATYKYGAL 1224
            PQ+ L+TLAGLID+S+PLG LTLY S N   +     S V + S  NS     T KYGAL
Sbjct: 1405 PQTSLQTLAGLIDSSVPLGGLTLYGSNNGCSICDSSSSSVSEVSNTNSTKNGGTNKYGAL 1464

Query: 1225 DDFTNSFTDSAPGWSYAARTIVFLAILTIGXXXXXXXXXXXXHYRNILLKRYPKDCIEKS 1284
            DDFTNS TD  P W    R I++L  LT G             +RN+LL R P +CIEK+
Sbjct: 1465 DDFTNSLTDHMP-WRITKRFIIYLTCLTAGVLLWLLLALFAFRHRNVLLGRRPSNCIEKT 1523

Query: 1285 LGNERKFDSTAL--SRSSSGNQIFNEKPSGSENESVHSVTDDHYIITGENTVYSTTHGLH 1342
              NER  +   +  SRSSS N  +NEK   +E+ES +S+ DD YI TGENTVYS THGLH
Sbjct: 1524 PNNERGLEGVGVSTSRSSSDNHNYNEKKPNTESESFYSMEDDQYIPTGENTVYSATHGLH 1583

Query: 1343 YTINDDGDLFYKEATLNDLEETAEREDSGIDSILRDCVYDEHQESTEAYLNDEESISSIV 1402
            YT+++DGDLFY+++  ND++E  E EDSGIDSILR+CVYD HQ++TE YLNDEES+SSI+
Sbjct: 1584 YTVDEDGDLFYRKSMPNDIDEINENEDSGIDSILRECVYDRHQDTTEVYLNDEESMSSIL 1643

Query: 1403 DVDENGNIRLYDSYSDDEEPNSFYLPXXXXXXXXXXXXXXXXHNTPETGSCTT-DDPEAG 1461
            DVDENGNIRLYDSYS+D+EPN  +L                     E GS TT DDP+  
Sbjct: 1644 DVDENGNIRLYDSYSEDDEPNCPHLQEEVIEDYNNSHVYKMQLQGLEIGSYTTEDDPDTE 1703

Query: 1462 NMITNEFSSSSQTCLPSTTYTTPLHTNSIKLQTLRYSEISLSQPNKALFSNHEDLEIDDI 1521
            N+I NEFSS SQTCLPST YTTPL TNSIKL  L ++  SL +P++A  SNH++LEI+DI
Sbjct: 1704 NLIANEFSSGSQTCLPSTAYTTPLDTNSIKLHILGHAGSSLQKPDQAFISNHDELEIEDI 1763

Query: 1522 DDNGSVSDIQIEELDALDEELYKRISKIAKQQN 1554
            DDNGSVSDIQ+EELDALDEELYKR+SKI KQQN
Sbjct: 1764 DDNGSVSDIQVEELDALDEELYKRMSKIVKQQN 1796

 Score = 87.8 bits (216), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 55/103 (53%), Positives = 68/103 (66%), Gaps = 3/103 (2%)

Query: 22  YSNDTTYSRLYSSEIEIGTSYLTSTAFNSRSSNNENSITSSPETTTLAGQYSESARVAVN 81
           YSNDT+YS LYSS I+   SY  S  + + SSN+ N  TS+PETTTLAGQYSES R++ N
Sbjct: 22  YSNDTSYSYLYSSGIDSTPSYSISAMYATESSNDANGETSNPETTTLAGQYSESGRISTN 81

Query: 82  EEQSTGTPHQYSGALTTSQDADSTLSTQRSTEKAIPSSSEVPT 124
            EQS+ T  QY+ A  T  ++D      +ST  A PSSS VPT
Sbjct: 82  REQSSTTSQQYTTAAITVGNSD---FMSKSTTIATPSSSRVPT 121

>TDEL0A03880 Chr1 (690387..695477) [5091 bp, 1696 aa] {ON} Anc_5.524
            YDR420W
          Length = 1696

 Score =  186 bits (473), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 147/468 (31%), Positives = 229/468 (48%), Gaps = 37/468 (7%)

Query: 968  WLPTAIIVQSSETDTSTTLFNPTITGSLPNLIEPAVTASEPINHTLITVGFTAALNYVFL 1027
            WLP++I VQS  T + T+ F+P +T +LP LI P      P N + ITVGF   LNY FL
Sbjct: 1069 WLPSSIQVQSDPTRSGTSSFDPAVTATLPQLIAPPTAVPVPENASKITVGFKKNLNYEFL 1128

Query: 1028 VQNPLSSAQIFNFLPLVLKYPFSDTSSGVESSNGELSSFILSYRSGTSTTTLSPQSKSSL 1087
            V +  ++AQIF+FLP VL +PF +  +  + S     + ++S     +TTTL P      
Sbjct: 1129 VSSSTTAAQIFHFLPFVLSFPFEENGTK-DFSYKRRGTLLVSSFEFNNTTTLMPAQFHQE 1187

Query: 1088 SIVRXXXXXXXXXPPTSTMDLYFPSINASSIAVKQIVPMMDSSKAYIIAVAEVYFPTEAV 1147
            ++                 D  FP  NAS++ V QI+PM+   + Y+ ++A +YFP+  V
Sbjct: 1188 TVTGISKRS----------DSEFP-FNASAVDVIQIMPMIIKDRNYLTSIAVLYFPSAYV 1236

Query: 1148 SYLQELILDVNSTLYNNPQSPLRTLAGLIDNSIPLGSLTLYSSGNEGHVSSLFPSGVLDS 1207
            S LQ ++ D  S L+NNP   L  LA LID SIPL  L     G+ G ++   PS    S
Sbjct: 1237 SELQSMVSDDTSQLFNNPDPTLDALAALIDPSIPLTGLI---DGSTGSLNGGNPSTQSHS 1293

Query: 1208 SKENSKGIVATYKYGALDDFTNSFTDSAPGWSYAARTIVFLAILTIGXXXXXXXXXXXXH 1267
                 K   +    G+L   TNS   SA       R +++L  L  G             
Sbjct: 1294 PSSPYKSQSSDDNSGSLGTATNSGLSSA----VKKRLVIYLTCLVFGTLLWILVFMFLYK 1349

Query: 1268 Y----RNILLKRYPKDCIEKSLGNERKFDSTALSRSSS------GNQIFNEKPSGSENES 1317
            +    R I  + Y +D  ++   +    D T++  + +       + +  EK   S ++S
Sbjct: 1350 HLYGGRVIAKRAYQRDAAQEEKQHYNFADITSVHSAETEPANDKSDDVPQEKDVASASQS 1409

Query: 1318 VHSVTDDHYIITGENTVYSTTHGLHYTINDDGDLFYKE--ATLNDLEETAEREDSGIDSI 1375
             +S+ +D  +ITGENTVYS + GL Y + +DG  +Y     + ++  ET + + + I+ I
Sbjct: 1410 RYSLPED-LMITGENTVYSVSQGLQYFVAEDGSFYYAGPLQSTSEENETTKGDSADIEDI 1468

Query: 1376 LRDCVYDEHQESTEAYLNDEESISSI--VDVDENGNIRLYDSYSDDEE 1421
              D +Y   QE   + + +E+S   I  + +DE GN  + D   ++EE
Sbjct: 1469 -NDYLYSADQE--RSIVTNEQSSCDIGSLQIDEEGNFVVSDPSPNEEE 1513

>ZYRO0D12496g Chr4 (1047901..1055058) [7158 bp, 2385 aa] {ON} some
            similarities with uniprot|P41809 Saccharomyces cerevisiae
            YDR420W HKR1 Serine/threonine rich cell surface protein
            that contains an EF hand motif involved in the regulation
            of cell wall beta-1 3 glucan synthesis and bud site
            selection overexpression confers resistance to Hansenula
            mrakii killer toxin HM-1
          Length = 2385

 Score =  171 bits (434), Expect = 6e-42,   Method: Compositional matrix adjust.
 Identities = 164/530 (30%), Positives = 244/530 (46%), Gaps = 76/530 (14%)

Query: 925  STKIST---GTITTAVQTQVISNLESPTPVLSIYSTNLDSSSNSYAWLPTAIIVQSSETD 981
            ST+IST     +++ V    I+N+ S  P  S  S   +S++N   WLP +II+QS+ + 
Sbjct: 1607 STEISTSDTNDVSSLVSPSTITNIGSSVP--SATSAPTESNTN---WLPYSIIMQSTPSP 1661

Query: 982  TSTTLFNPTITGSLPNLIEPAVTASEPINHTLITVGFTAALNYVFLVQNPLSSAQIFNFL 1041
            +S   FNP +T +LP+ I P    SEP N + IT+GF   ++Y FLV NPLSSAQIF FL
Sbjct: 1662 SSAPSFNPEVTATLPHAIAPQTPVSEPPNSSTITIGFKRQIDYDFLVNNPLSSAQIFTFL 1721

Query: 1042 PLVLKYPFS-DTSSGVESSNGELSSFILSYRSGTSTTTLSPQSKSSLSIVRXXXXXXXXX 1100
            P VL YPF+ D +    +   E S +         TTTL P       +VR         
Sbjct: 1722 PDVLIYPFNYDQNIDKGTHTNESSHYKR------KTTTLQPYRD---VMVRTNKKHKVQM 1772

Query: 1101 PPTSTMDLYFPSINASSIAVKQIVPMMDSSKAYIIAVAEVYFPTEAVSYLQELILDVNST 1160
                        I+ ++++V QI+PM+   K+Y++AVAE+YFP + V+ L++ + + NS 
Sbjct: 1773 ------------ISTANVSVIQIMPMLSRDKSYLVAVAELYFPAQYVNKLKDYMKNSNSM 1820

Query: 1161 LYNNPQSPLRTLAGLIDNSIPLGSLTLYSSGNEGHVSSLFPSGVLDSSKENSKGIVATYK 1220
            LYNN    L  LA LID SIPL  +      + G V++            ++     +++
Sbjct: 1821 LYNNTNPTLFALADLIDPSIPLTGMV----DDNGDVNNGGSGSGSSGEGNHASQSPHSFQ 1876

Query: 1221 YGALDDFTNSFTDSAPGWSY-----AARTIVFLAILTIGXXXXXXXXXXXXHYRNILLKR 1275
             G  D   N   ++A   S+       R  +FL     G             +R I   +
Sbjct: 1877 NGNED---NGNLETANSTSHITGVITKRLAIFLNCFAFGVLLWILSFLFI--FRKIRKVQ 1931

Query: 1276 YPKDCIE----KSLGNERKFDSTA----LSRSSSGNQIFNEKPSGSE------------- 1314
             P++        + G+  K  S +     S SSSG Q F EK + ++             
Sbjct: 1932 PPEEGESYAELDTSGDVLKLPSGSGEDNASGSSSGPQFFQEKATNNDSQNQETVDRNATP 1991

Query: 1315 -----NESV----HSVTDDHYIITGENTVYSTTHGLHYTINDDGDLFYK-EATLNDLEET 1364
                 NE +     S   D  I+TGENTVYST HGL Y +++DG   Y     ++D   T
Sbjct: 1992 KLENSNEGIGGNAQSPISDDLIVTGENTVYSTLHGLEYFVDEDGQFHYAGNRQISDESGT 2051

Query: 1365 AEREDSGIDSILRDCVYDEHQESTEAYLNDEESISSIVDVDENGNIRLYD 1414
             + E   ID   +       + S       E  +SS+ +VDE GN  L +
Sbjct: 2052 TKDEHDEIDDFDKYMYAGSEEMSVHVSEAPEVDMSSL-EVDEEGNFVLMN 2100

 Score = 35.0 bits (79), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 22/46 (47%), Positives = 36/46 (78%), Gaps = 1/46 (2%)

Query: 1510 FSNHEDLEIDDIDDNGSVSDIQIEELDALDEELYKRISKIAKQQNL 1555
             S+ +D+ I+DIDD G V D+QI++ D LDEE+Y+R+SKI  ++++
Sbjct: 2231 ISDMDDVRIEDIDD-GKVDDLQIDDFDDLDEEMYQRLSKIMIERSI 2275

>KLLA0A01826g Chr1 complement(163010..167404) [4395 bp, 1464 aa] {ON}
            some similarities with uniprot|P41809 Saccharomyces
            cerevisiae YDR420W HKR1 Serine/threonine rich cell
            surface protein that contains an EF hand motif involved
            in the regulation of cell wall beta-1 3 glucan synthesis
            and bud site selection overexpression confers resistance
            to Hansenula mrakii killer toxin HM-1
          Length = 1464

 Score =  161 bits (408), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 156/539 (28%), Positives = 241/539 (44%), Gaps = 93/539 (17%)

Query: 921  YSRPSTKISTGTITTAVQTQVISNLESPTPVLSIYSTNLDSS------SNSYAWLPTAII 974
            +S  S+ I T TI +      IS  E+  P+ +  S  LD S      +++  WLPT ++
Sbjct: 671  HSLASSSIITQTINSGASASFIS--ETRQPMATSVSATLDGSIVNSGLTSNNNWLPTTLV 728

Query: 975  VQSSETDTSTTLFNPTI--TGSLPNLIEPAVTASEPINHTLITVGFTAALNYVFLVQNPL 1032
            ++ +    ++   +  +  T +LP  I PA     P  +T+ITVGF   LNY FL+ NPL
Sbjct: 729  IEPTAAHATSAATSADLGATSTLPQAINPASDVPLPDGYTVITVGFKEPLNYPFLIANPL 788

Query: 1033 SSAQIFNFLPLVLKYPFSDTSSGVESSNGELSSFILSYRSGTSTTTLSPQSKSSLSIVRX 1092
            +SAQIFNFLP VL  PF  T++G                        +P  + S +I + 
Sbjct: 789  ASAQIFNFLPKVLVRPFQLTTTGA-----------------------APVYRRSWNIFKK 825

Query: 1093 XXXXXXXXPPTSTMDLYFPSINASSIAVKQIVPMMDSSKAYIIAVAEVYFPTEAVSYLQE 1152
                        T D          + VK IVP++  + +YI+++AEVYFPTE+V  LQE
Sbjct: 826  GINTHLLSSSLPTYD---------DVQVKSIVPLVIQNVSYIVSIAEVYFPTESVHTLQE 876

Query: 1153 LILDVNSTLYNNPQSPLRTLAGLIDNSIPLGSLTLYSSGNEGHVSSLFPSGVLD------ 1206
            L+LD +S LY+NP S L  LA LI+ +IPL  LT   S      +        +      
Sbjct: 877  LVLDSSSILYSNPVSYLADLASLINPAIPLTGLTYSGSSGSSSGNGSGGDSDGNGNGSGE 936

Query: 1207 ------SSKENSKGIVATYKYGALDDFTNSFTDSAPGWSYAARTIVFLAILTIGXXXXXX 1260
                  + K+NS    A +  G+LD    S      G+      I F+ ++T+       
Sbjct: 937  GTGGNGAEKDNSSNNAALW--GSLDAGLTS------GFPNHDTVIRFVCMVTVLTAFILC 988

Query: 1261 XXXXXXHYRNILLKRYPKDCIEKSLGNERKF---------------DSTALSRSSSGNQI 1305
                   +   L KR   +C ++    E+ +               DS   +   SG+Q 
Sbjct: 989  LVGLILVFLKNLYKR--TNCAQRMHLTEKNWPEIPTFYSHHMNGSTDSPMRNMFYSGSQ- 1045

Query: 1306 FNEKPSGSENESVHSVTDDHYIITGENTVYSTTHGLHYTINDDGDLFYKEATLNDLEETA 1365
            F++  +  E+       DD  IITGENTVYS + G+ Y +++DG+ F+  A +     T+
Sbjct: 1046 FSDSDTTEEDSHSAEYIDDDLIITGENTVYSISQGITYYVDEDGNFFF--AGVGKDVHTS 1103

Query: 1366 EREDSGIDSILRDCVYDEHQESTEAYLNDEES---------ISSIVDVDENGNIRLYDS 1415
            E E   ++ I+ D       E    Y N+++              ++VDE+GNI L +S
Sbjct: 1104 EPEK--LEKIIHDKTETVTVEPILPYYNEKDDDLTDETEPFDMGELEVDEDGNIALPES 1160

>Ecym_4060 Chr4 (125127..131732) [6606 bp, 2201 aa] {ON} similar to
            Ashbya gossypii ADR200C
          Length = 2201

 Score =  159 bits (401), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 147/484 (30%), Positives = 220/484 (45%), Gaps = 75/484 (15%)

Query: 967  AWLPTAIIVQSSETD-TSTTLFNPTITGSLPNLIEPAVTASEPINHTLITVGFTAALNYV 1025
             WLPT I+  S +T    +T      T +LP  I PA   ++P N+ LIT+GF   LNY 
Sbjct: 1326 GWLPTTIVTASMQTSPKESTTVGSAATYTLPRAITPATPVAKPDNYDLITIGFVQGLNYA 1385

Query: 1026 FLVQNPLSSAQIFNFLPLVLKYPFSDTSSGV------ESSN---GELSSFILSYRSGTST 1076
            FLV NP++SAQIF+FLP +L YP+ +    +      ES+N   G   S   SY +    
Sbjct: 1386 FLVSNPVASAQIFSFLPHLLNYPYIENKEALLLRHINESNNNILGNRGSVSGSYFNIYGN 1445

Query: 1077 TTLSPQSKSSLSIVRXXXXXXXXXPPTSTMDLYFPSINASSIAVKQIVPMMDSSKAYIIA 1136
             +L  +  +S   V+           TS    Y      S I VKQIVP +     Y  +
Sbjct: 1446 LSLEHKHTNSTEPVKRRQNNEED---TSDEHGY------SQIVVKQIVPFLLQGADYTAS 1496

Query: 1137 VAEVYFPTEAVSYLQELILDVNSTLYNNPQSPLRTLAGLIDNSIPLGSLTLYSSGNEGHV 1196
            VAEVYFP+EAV+ L++++ D NS LY NP + L  LA L+D  IP+ ++T   SG+    
Sbjct: 1497 VAEVYFPSEAVTSLRKMVADKNSKLYLNPVATLNQLASLVDPRIPVLTIT---SGSSPSF 1553

Query: 1197 SSLFPSGVLDSSKENSKGIVATYKYGALDDFTNSFTDSAPGWSYAARTIVFLAILTIGXX 1256
            S+  P    D+S  ++    + +K G LD   +     A       R ++F    + G  
Sbjct: 1554 SNTDPDHSGDTSGSSNN-NSSDHKGGTLDLGAHRHMSPA----TRKRILIFSLAFSFGVL 1608

Query: 1257 XXXXXXXXXXHYRNILLKRYPKDCI-EKSLGNERKFDSTALSRSSSGNQIFNEKPSGSEN 1315
                           + K   K  + EKS+ N             S N  FN++ S  + 
Sbjct: 1609 LWILIFLFLLKRLYKVSKIRSKIVLREKSIPNNLGI---------SYNHQFNDRLSDLKT 1659

Query: 1316 ESVH------------------------SVTDDHYIITGENTVYSTTHGLHYTINDDGDL 1351
            ++ +                        S TDD  I+TGENTVYS + G+ Y I+++G+ 
Sbjct: 1660 DAFYDGDPERNFNSQSTNSSSNHDSVPDSFTDDDMIVTGENTVYSLSQGITYHIDEEGNY 1719

Query: 1352 FYKEATLNDLEETAEREDSGIDSILRDCVYDEHQESTEAYLNDEESISSIV---DVDENG 1408
            +Y  A +N    + E E         D +Y E    T   +N+ + +SS +   D+D+ G
Sbjct: 1720 YY--ARINPFSNSFEPE--------ADIMYQESGGET-ININEAQYMSSGIDLEDIDQEG 1768

Query: 1409 NIRL 1412
            NI +
Sbjct: 1769 NIEI 1772

 Score = 41.2 bits (95), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 18/36 (50%), Positives = 23/36 (63%)

Query: 1514 EDLEIDDIDDNGSVSDIQIEELDALDEELYKRISKI 1549
            +D   D   D   VSDI +EE DALDEE+Y+ +S I
Sbjct: 1921 KDPTEDSNGDENDVSDIMVEEFDALDEEMYRHLSVI 1956

>ADR200C Chr4 complement(1051878..1058894) [7017 bp, 2338 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YDR420W
            (HKR1)
          Length = 2338

 Score =  158 bits (399), Expect = 6e-38,   Method: Compositional matrix adjust.
 Identities = 159/506 (31%), Positives = 221/506 (43%), Gaps = 125/506 (24%)

Query: 968  WLPTAIIVQSSET----------DTSTTLFNPTITGSLPNLIEPAVTASEPINHTLITVG 1017
            WLP  II +S +             STTL        LP  I P         + LI++G
Sbjct: 1498 WLPATIITESVQQHLPNAASTTGGVSTTL--------LPAAIHPQSLVEGSDGYDLISIG 1549

Query: 1018 FTAALNYVFLVQNPLSSAQIFNFLPLVLKYPF-SDTSSGV------ESSNGELSSFILSY 1070
            F   LNYVF+    LSSAQIF FLP VL YPF S T   V      E    E    +  Y
Sbjct: 1550 FLKGLNYVFVTSFALSSAQIFTFLPPVLTYPFESHTEETVKIHDPTEKRQLERPPPVSFY 1609

Query: 1071 -RSGTSTTTLSPQSKSSLSIVRXXXXXXXXXPPTSTMDLYFPSINASSIAVKQIVPMMDS 1129
             R+   TTTLS  + S +  V+           +   DL F       + VKQ+ P +  
Sbjct: 1610 SRASRDTTTLSSFTHSQVIAVQKET--------SDVPDLSF-------VKVKQLAPDVSE 1654

Query: 1130 SKAYIIAVAEVYFPTEAVSYLQELILDVNSTLYNNPQSPLRTLAGLIDNSI--------- 1180
             + YI  +A VYFP++ V  LQELILD  S LYNNP   L+  A LID +I         
Sbjct: 1655 ERGYIATLAHVYFPSKLVPKLQELILDSESPLYNNPDVNLKIFASLIDPTIKVRIIQHDR 1714

Query: 1181 --PLGSLTLYSSGNEGHVSSLFPSGVL---DSSKENSKGIVATYKYGALDDFTNSFTDSA 1235
              P  +    +SG++G+     PSG     D S +NSK    T+K               
Sbjct: 1715 SNPRPAQGGGTSGSDGYS----PSGYANHGDGSLDNSKSPKITFK--------------- 1755

Query: 1236 PGWSYAARTIVFLAILTIGXXXXXXXXXXXXHYRNI---LLKRYPKDCIEKS---LGNER 1289
                   R ++FL +LT G             +R +   L +R  +    KS   LG ++
Sbjct: 1756 ----ITKRLLIFLTVLTFGVFL----------WRLVFLYLFRRLYRINKVKSKIVLGEKK 1801

Query: 1290 KFDSTALSRSSS-GNQIFNEKPSG---------------SENESVHS-VTDDHYIITGEN 1332
               S  L  S    N++ + KPS                  + SVH   TDD  I+TGEN
Sbjct: 1802 IPPSLGLFYSHQFNNRLSDLKPSALYEGDPEKQDGTATDGSSGSVHGYATDDDIIVTGEN 1861

Query: 1333 TVYSTTHGLHYTINDDGDLFYKEATLNDLEETAEREDSGIDSILRDCVYDEHQESTEAYL 1392
            TVYS + G+ Y I+++G+ +Y  A ++   +  E+E         DC+Y E  E     +
Sbjct: 1862 TVYSLSQGIAYHIDEEGNYYY--AGIDPFTDAFEQE--------ADCLYHE-SEVESVNV 1910

Query: 1393 NDEESISSIV---DVDENGNIRLYDS 1415
            N+ + +SS +   ++D +GNI LYDS
Sbjct: 1911 NNLDHLSSDIKEENIDLDGNIELYDS 1936

>SAKL0G04862g Chr7 (392107..399441) [7335 bp, 2444 aa] {ON} some
            similarities with uniprot|P41809 Saccharomyces cerevisiae
            YDR420W HKR1 Serine/threonine rich cell surface protein
            that contains an EF hand motif involved in the regulation
            of cell wall beta-1 3 glucan synthesis and bud site
            selection overexpression confers resistance to Hansenula
            mrakii killer toxin HM-1
          Length = 2444

 Score =  154 bits (389), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 118/315 (37%), Positives = 166/315 (52%), Gaps = 44/315 (13%)

Query: 914  LSKTSESYSRPSTKISTGTITTAVQTQVISNLESPTPVLSIYSTNLDSSSN--------- 964
            +SKT +S S  ST+  TG       +Q   + +SP  VL    T++  SSN         
Sbjct: 1417 VSKTGDSRSGFSTRYVTG----MQHSQKAFSTQSPYTVLE---TSVTPSSNDGPLHTSTI 1469

Query: 965  -SYAWLPTAIIVQSSETDT-STTLFNPTITGSLPNLIEPAVTASEPINHTLITVGFTAAL 1022
             ++ WLP ++IV+S +T T S+T  +   T +LP  I P     +P  H+LIT+GF  AL
Sbjct: 1470 STHNWLPYSLIVESKDTSTQSSTTVDLGATSTLPQAITPPTAVPQPAGHSLITIGFKEAL 1529

Query: 1023 NYVFLVQNPLSSAQIFNFLPLVLKYPFSDTSSGVE-SSNGELSSFILSYRSGTS------ 1075
            NY FL+ +PLSSAQIF+FLP VL+YPFS T+  V      ++    L  R  TS      
Sbjct: 1530 NYPFLISHPLSSAQIFSFLPRVLQYPFSSTAGSVPIYRRQDIEVMTLLQRRLTSSAAEID 1589

Query: 1076 TTTLSPQSKSSLSIVRXXXXXXXXXPPTSTMD--LYFPSINA----------------SS 1117
            T +LS Q+   + +V            T   +  L+  S+N                 S 
Sbjct: 1590 TCSLSFQNYDKIQLVSVKLALLKSTNRTDQENNSLHRRSVNDKVSVMNSTSDSSNIDYSQ 1649

Query: 1118 IAVKQIVPMMDSSKAYIIAVAEVYFPTEAVSYLQELILDVNSTLYNNPQSPLRTLAGLID 1177
            I VKQI+P++ SS  YI++VAEVYFP  ++  LQ L+ + NS LY NP++ L+ LA LID
Sbjct: 1650 IVVKQIIPLVSSSINYIVSVAEVYFPDHSIDTLQRLVRNQNSELYKNPENSLKALASLID 1709

Query: 1178 NSIPLGSLTLYSSGN 1192
             S+PL  L + S GN
Sbjct: 1710 PSVPLTGL-VDSDGN 1723

 Score = 60.5 bits (145), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 38/97 (39%), Positives = 56/97 (57%), Gaps = 7/97 (7%)

Query: 1324 DHYIITGENTVYSTTHGLHYTINDDGDLFYK--EATLNDLEETAEREDSG-IDSILRDCV 1380
            D  ++TG+NTVYST+ GL Y I+++G+ +Y   +  +N+ E+  E  D   + S+  + +
Sbjct: 1881 DDLVVTGDNTVYSTSRGLSYFIDENGNYYYAGMDFIVNENEQANEFVDHNQLQSM--EHI 1938

Query: 1381 YDEHQESTEAYLNDEESISSI--VDVDENGNIRLYDS 1415
            Y+ H       L DEE    I  VDVDE GNI L DS
Sbjct: 1939 YEGHDSIAGGALIDEEGAFDINAVDVDEEGNIELPDS 1975

>KNAG0C03260 Chr3 complement(639021..643613) [4593 bp, 1530 aa] {ON}
            Anc_5.524 YDR420W
          Length = 1530

 Score =  147 bits (371), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 144/463 (31%), Positives = 201/463 (43%), Gaps = 78/463 (16%)

Query: 961  SSSNSYAWLPTAIIVQSSETDTSTTLFNPTITGSLPNLIEPAVTASEPINHTLITVGFTA 1020
            S S    WLPT II+ S+   T T     T   SLP  I PA     P +  LIT+GF +
Sbjct: 881  SDSTDTVWLPTNIIIASNADSTHTARAEST--ASLPAAIAPAEELQSPPDFELITIGFLS 938

Query: 1021 ALNYVFLVQNPLSSAQIFNFLPLVLKYPFSDTSSGVESSNGELSSFILSYRSGTSTTTLS 1080
             LNY FLV NPLSSAQ+F+FLP VL +P  D +        E S  I    S  +TT ++
Sbjct: 939  GLNYAFLVGNPLSSAQVFDFLPHVLFFPIEDAA--------EKSKAIQPQSSDITTTLVA 990

Query: 1081 PQSKSSLSI--VRXXXXXXXXXPPTSTMDLYFPSINASS---------IAVKQIVPMMDS 1129
            P  K+  ++  +            +S+++L   S    S         I VKQI+P++  
Sbjct: 991  PLRKNRKTVTDMTRANVVNQNEATSSSLNLAVSSEATGSNDVELIFKNIRVKQIIPLVIE 1050

Query: 1130 SKAYIIAVAEVYFPTEAVSYLQELILDVNSTLYNNPQSPLRTLAGLIDNSIPLGSLTLYS 1189
               YI +VAEVYFPT  +  L  LI D NSTLY+NP+    TLA LID +IPL SL    
Sbjct: 1051 GNDYITSVAEVYFPTIYIDSLSALISDPNSTLYSNPKKNFATLASLIDKAIPLTSL---- 1106

Query: 1190 SGNEGHVSSLFPSGVLDSSKENS--KGIVATYKY----GALDDFTNSFTDSAPGWSYAAR 1243
              N+G  ++   S    +S E++         +Y    GA+D   ++   S    +   R
Sbjct: 1107 RKNDGQSNTSTDSSSDVNSNESTGDDAFQNAEEYLRVSGAMD--LSNIKVSKVNHTIRNR 1164

Query: 1244 TIVFLAILTIGXXXXXXXXXXXXHYRNILLKRYPKDCIEKSLGNERKFDSTALSRSSSGN 1303
             IVFL  LT G                + L       I +     RK   + L + S   
Sbjct: 1165 IIVFLFTLTTG----------------VFLWISTFLIIFRITNKSRKLKDSNLKKGSL-- 1206

Query: 1304 QIFNEKPSGSEN-----ESVHSVTDDHYII------------TGENTVYSTTHGLHYTIN 1346
             ++ + P   EN     ES  S  D HY               GEN +  +  G+ Y ++
Sbjct: 1207 PLYQQNPY-RENKQFSAESSESYIDIHYTTEKYSDYSASSPPIGENIIVDSAQGIQYKVD 1265

Query: 1347 DDGDLFYKEATLNDLEETAEREDSGIDSILRDCVYDEHQESTE 1389
            ++G+ +Y     N L E    ED           Y +  +STE
Sbjct: 1266 NEGNYYYNG---NHLAEGMPEEDE------ESARYKQENQSTE 1299

 Score = 33.1 bits (74), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 13/24 (54%), Positives = 19/24 (79%)

Query: 1531 QIEELDALDEELYKRISKIAKQQN 1554
            ++ ++D LD ELYKR+SKI K +N
Sbjct: 1479 RVGDIDELDVELYKRLSKIEKFKN 1502

>KAFR0E03320 Chr5 complement(659303..662875) [3573 bp, 1190 aa] {ON}
            Anc_5.524 YDR420W
          Length = 1190

 Score =  143 bits (360), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 135/426 (31%), Positives = 201/426 (47%), Gaps = 47/426 (11%)

Query: 964  NSYAWLPTAIIVQSSETDTSTTLFNPTITGSLPNLIEPAVTASEPINHTLITVGFTAALN 1023
            N+  WLP ++I  S ++D++ +  NP IT +LP  I     A +P N TL+T+GF   LN
Sbjct: 588  NTNDWLPNSMIFASDQSDSTFSSLNPEITATLPAEIAAPTEAVQPPNTTLVTIGFKKELN 647

Query: 1024 YVFLVQNPLSSAQIFNFLPLVLKYPFSDTSSGVESSNGELSSFI---LSYRSGTST--TT 1078
            Y+FL+ NPL+SAQIF FLPL L YPF  T     +S+ E++S     L Y     T  TT
Sbjct: 648  YIFLIDNPLASAQIFEFLPLTLSYPFLLTQ--YNASSEEITSLCSSSLYYEDDGRTILTT 705

Query: 1079 LSPQSKSSLSIVRX--------XXXXXXXXPPTSTMDLYFPS-------INASSIAVKQI 1123
                +  S   V+                 P +S      P         N+S++ VK I
Sbjct: 706  HESTTVDSTQFVKKIMGPASNLLTAQLASSPSSSPTQRPHPRESSPPPFFNSSNVVVKHI 765

Query: 1124 VPMMDSSKAYIIAVAEVYFPTEAVSYLQELILDVNSTLYNNPQSPLRTLAGLIDNSIPLG 1183
            +PM+ + + YI++VAEVYFPT+ +  LQ+ I   NS LY+NP +P  TL  LID   P  
Sbjct: 766  LPMISNQRDYIVSVAEVYFPTDTLGILQKFINKPNSPLYSNPSTPYSTLVHLID---PWI 822

Query: 1184 SLTLYSSGNEGHVSSLFPSGVLDS------SKENSKGIVA--TYKYGALD---DFTNSFT 1232
            SLT     N  +       G L S      +K N   + +  T + G+LD    +T+ F+
Sbjct: 823  SLTDLFQQNGMNNQGNNQDGSLSSNDSSFNTKTNPSNLTSTETERSGSLDLNSGYTSKFS 882

Query: 1233 DSAPGWSYAARTIVFLAILTIGXXXXXXXXXXXXHYRNILLKRYPKDCIEKSLGNER--K 1290
                    A  T VFL ++               H+   +  +  K  + K+L   R  +
Sbjct: 883  SKIKD-RLAIFTTVFLFVVFFW---IWLFLVAFKHWNKRIENKKAKKLLNKTLPTARFNR 938

Query: 1291 FDSTALSRSSSGNQIF---NEKPSGSENESVHSVTDDHYIITGENTVYSTTHGLHYTIND 1347
             D   LS +SS +      NEK + S  E  +   D   + + E  VY  ++G+ YT++ 
Sbjct: 939  VDLVTLSTASSMSSSSISPNEKQTYSSLE--NPFKDGTTVNSKEGVVYDQSNGMQYTVDY 996

Query: 1348 DGDLFY 1353
            DG+ +Y
Sbjct: 997  DGNFYY 1002

 Score = 39.7 bits (91), Expect = 0.071,   Method: Compositional matrix adjust.
 Identities = 16/26 (61%), Positives = 19/26 (73%)

Query: 1530 IQIEELDALDEELYKRISKIAKQQNL 1555
             Q+ ELD LDEELYKR+S I K Q +
Sbjct: 1162 FQVGELDGLDEELYKRMSSIMKLQRI 1187

>CAGL0F03003g Chr6 (289923..293480) [3558 bp, 1185 aa] {ON} some
            similarities with uniprot|P32334 Saccharomyces cerevisiae
            YGR014w MSB2 or uniprot|P41809 Saccharomyces cerevisiae
            YDR420w HKR1
          Length = 1185

 Score =  135 bits (340), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 91/239 (38%), Positives = 115/239 (48%), Gaps = 40/239 (16%)

Query: 947  SPTPVLSIYSTNLDSSSNSYAWLPTAIIVQSSETDTSTTLFNPTITGSLPNLIEPAVTAS 1006
            SP P        L S  N   WLP+ II QS    T ++ FNPT T SLP  I P     
Sbjct: 699  SPPPATPTGPKTLSSDEN---WLPSGIIFQSDFATTVSSSFNPTATKSLPQFIAPPKMTV 755

Query: 1007 EPINHTLITVGFTAALNYVFLVQNPLSSAQIFNFLPLVLKYPFSDTSSGVESSNGELSSF 1066
            +  N TL+T+G    LNY FL+ NPLSSAQIFNFLP VL YPFS  +      N  +   
Sbjct: 756  KSPNTTLVTIGLKQGLNYQFLIDNPLSSAQIFNFLPSVLTYPFSSYAPNDFPINSLIDDN 815

Query: 1067 ILSYRSGTSTTTLSPQSKSSLSIVRXXXXXXXXXPPTSTMDLYFPSINASSIAVKQIVPM 1126
             L++                                    +L+    NAS+I+V  IVP+
Sbjct: 816  ALAFLDS---------------------------------NLF----NASTISVHGIVPL 838

Query: 1127 MDSSKAYIIAVAEVYFPTEAVSYLQELILDVNSTLYNNPQSPLRTLAGLIDNSIPLGSL 1185
            +     + ++V EVYFP + +  L  LI D NS+LY+NP   L  LA LID SIPL  L
Sbjct: 839  LIPGHEFFVSVVEVYFPNDLLDSLSALIKDRNSSLYSNPNDSLSALARLIDPSIPLTGL 897

 Score = 39.7 bits (91), Expect = 0.074,   Method: Compositional matrix adjust.
 Identities = 15/22 (68%), Positives = 19/22 (86%)

Query: 1527 VSDIQIEELDALDEELYKRISK 1548
            V D+QIE++D  DEELYKR+SK
Sbjct: 1152 VKDLQIEDVDEFDEELYKRLSK 1173

>Kpol_363.14 s363 (25673..27781,27783..27959) [2286 bp, 761 aa] {ON}
            (25673..27781,27783..27959) [2286 nt, 762 aa]
          Length = 761

 Score =  133 bits (335), Expect = 7e-31,   Method: Compositional matrix adjust.
 Identities = 91/231 (39%), Positives = 128/231 (55%), Gaps = 14/231 (6%)

Query: 964  NSYAWLPTAIIVQSSETDTSTTLFNPTITGSLPNLIEP-AVTASEPINHTLITVGFTAAL 1022
            +S+AWLPT I+VQSS TD + +    T T  LP  I P AVT  +P +  LI++GF   L
Sbjct: 516  DSFAWLPTNIVVQSSNTDMTNSPETNTNTSGLPVRIAPTAVT--QPADSILISIGFKIEL 573

Query: 1023 NYVFLVQNPLSSAQIFNFLPLVLKYPFS--------DTSSGVESSNGELSSFILSYRSGT 1074
            NY FL++   +SAQIFNFLPL+L YPF         D S  ++S    +S+    Y S  
Sbjct: 574  NYPFLIKESYASAQIFNFLPLILTYPFEQDSSNYQLDPSISLQSDTSVISTEYQDYSSIF 633

Query: 1075 S-TTTLSPQSKSSLSIVRXXXXXXXXXPPTSTMDLYFPSINASSIAVKQIVPMMDSSKAY 1133
            S  TTLS    +   +           P  ++M+ Y    + SSI+VKQI+P++     Y
Sbjct: 634  SYETTLSNLGLTLYDLSDGETSVLEASPTVASMNKY--QRDTSSISVKQIIPILIPGNLY 691

Query: 1134 IIAVAEVYFPTEAVSYLQELILDVNSTLYNNPQSPLRTLAGLIDNSIPLGS 1184
            I ++AE  FP E V  LQ  I ++ S +Y NP   L+ +A LID++IP+ S
Sbjct: 692  ITSLAEGLFPGEKVDELQNYINNLTSIIYQNPDPRLKDMAALIDSTIPIFS 742

>TPHA0L00360 Chr12 complement(50396..53881) [3486 bp, 1161 aa] {ON} 
          Length = 1161

 Score =  114 bits (284), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 118/342 (34%), Positives = 164/342 (47%), Gaps = 68/342 (19%)

Query: 965  SYAWLPTAIIVQSSETDTSTTLFNPTI---TGSLPNLIEPAVTASEPINHTLITVGFTAA 1021
            S+ WLP+ I +QS  T  S     P+    T  LPN+I      + P N TLITV F   
Sbjct: 513  SFDWLPSEIAIQSDSTAES---MEPSFLIDTSGLPNIITAPTAITIPSNTTLITVAFKRE 569

Query: 1022 LNYVFLVQNPLSSAQIFNFLPLVLKYPFSDTSSGVESSNGE------LSSFILS------ 1069
            LNY FLV N  SSAQIFNFLP+++K+PF+   S  ES N +       + +IL+      
Sbjct: 570  LNYAFLVNNFYSSAQIFNFLPIIIKHPFTALVS--ESCNDDSVCSPLFTEYILNSYASSA 627

Query: 1070 -------------YRSGTSTTT---LSPQS---KSSLSIVRXXXXXXXXXPPTSTMDLYF 1110
                         ++SG   +    LS  S   ++++S            P  +  DL  
Sbjct: 628  ASSMSTSSVNNVDFQSGGKHSVNINLSLHSTIVQTAISPTGFQTNMTSQIPSLAKKDL-- 685

Query: 1111 PSINAS--------SIAVKQIVPMMDSSKAYIIAVAEVYFPTEAVSYLQELILDVNSTLY 1162
             S NAS         I V +I+P +  +  YII++AEVY P E V  LQELIL+  S+ Y
Sbjct: 686  -SKNASLQKQEISMDITVARIIPYIVQNNKYIISIAEVYVPNEIVETLQELILNPASSFY 744

Query: 1163 NNPQSPLRTLAGLIDNSIPLGSLTLYSSGN--EGHVSSLFPSGVLDSSKENSKG------ 1214
            N+  S L+TLA LID +IPL  + L S+GN   G +SS     + +SS ++S G      
Sbjct: 745  NSESSSLKTLAFLIDPNIPLTGM-LDSNGNLISGGLSS-SNGNIQNSSTKHSHGSGISDI 802

Query: 1215 IVATYKYGALDDFTNSFTDSAPGWS--YAARTIVFLAILTIG 1254
               T K G LD      + +  G S     R  +F+   T+G
Sbjct: 803  SSQTLKLGTLD------SSAYKGLSTNLKKRLSIFIVCFTVG 838

 Score = 40.0 bits (92), Expect = 0.061,   Method: Compositional matrix adjust.
 Identities = 16/31 (51%), Positives = 25/31 (80%), Gaps = 1/31 (3%)

Query: 1518 IDDIDDNGSVSDIQIEELDALDEELYKRISK 1548
            + DI+D+  V+D+ + ELD LDEE+YKRI++
Sbjct: 1110 VSDIEDD-EVNDVHVGELDELDEEIYKRITR 1139

>KLTH0G03696g Chr7 (286341..292598) [6258 bp, 2085 aa] {ON} some
            similarities with uniprot|P41809 Saccharomyces cerevisiae
            YDR420W HKR1 Serine/threonine rich cell surface protein
            that contains an EF hand motif involved in the regulation
            of cell wall beta-1 3 glucan synthesis and bud site
            selection overexpression confers resistance to Hansenula
            mrakii killer toxin HM-1
          Length = 2085

 Score =  101 bits (251), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 123/384 (32%), Positives = 181/384 (47%), Gaps = 55/384 (14%)

Query: 840  SSNSIKFASQPNSQFRNSEVRSTLSTGSNA-----HFSFT----SSLPAXXXXXXXXXXX 890
            S N I   S P+S F  S   +++S GS+      H S T    SS P            
Sbjct: 1074 SENLISTVSSPSSSFEASVKLTSISHGSSQSLTRLHSSKTPVPGSSTPTGALRSSYVESS 1133

Query: 891  X--------XXTITDNDEKTSSATR---------KTQNSGLSKTSESYSRPSTKISTGTI 933
                       + +   + TSS +R         KTQ S  S+ S+    P + ++T   
Sbjct: 1134 ASNFVAYTTSSSTSPGLQTTSSGSRLPEAESTSTKTQASRFSQNSQ---HPES-LTTAFQ 1189

Query: 934  TTAVQTQVISNLE-SPTP----VLSIYSTNLDSSSNSYAWLPTAIIVQSSETDTST-TLF 987
              + Q++   +++ S TP    VL+  STN + S+ S  WLP+ I+  S      T + F
Sbjct: 1190 PISSQSESFGSVQPSRTPSLATVLAPSSTNSEGST-SMDWLPSNIVTASYTGSAHTQSSF 1248

Query: 988  NPTITGSLPNLIEPAVTASEPINHTLITVGFTAALNYVFLVQNPLSSAQIFNFLPLVLKY 1047
            +   T +LP  I P    + P N++ IT+GF  +LNY FL++NPL+SAQIF FLP +L+Y
Sbjct: 1249 DADATATLPQAIMPPTPVTMPPNYSQITIGFKESLNYPFLIENPLASAQIFGFLPEILRY 1308

Query: 1048 PFSDTSSGVESSN--------GELSSFILSYRSGTSTTTLSPQS-KSSLSIVRXXXXXXX 1098
            PFS  +S   SS         G+  + +L      ST  L   + K+S+           
Sbjct: 1309 PFSVRASRSNSSTSSVKRDLVGDSGNLLLD----NSTLILDKLNWKTSIMNSLSSNVSVS 1364

Query: 1099 XXPPTSTMDLYFPSINASSIAVKQIVPMMDSSKAYIIAVAEVYFPTEAVSYLQELILDVN 1158
                 +     F  +  SSI     VP++ S   YI +VA VYFPTEAV  LQ++I++  
Sbjct: 1365 RNGSHNAFRANFSGVAVSSI-----VPLIVSGNDYITSVAVVYFPTEAVEVLQKMIINGA 1419

Query: 1159 STLYNNPQSPLRTLAGLIDNSIPL 1182
            S +Y NP   LR +A LID+ IP+
Sbjct: 1420 SRIYKNPDQSLRDMALLIDSKIPI 1443

 Score = 35.4 bits (80), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 16/36 (44%), Positives = 23/36 (63%), Gaps = 2/36 (5%)

Query: 1514 EDLEID-DIDDNGS-VSDIQIEELDALDEELYKRIS 1547
            ED  ID D ++ G  V+D+ + E D LDE +Y+R S
Sbjct: 1829 EDFNIDSDSEEEGEDVNDVHVGEFDELDEVMYRRFS 1864

>Kwal_47.18650 s47 complement(913245..919724) [6480 bp, 2159 aa] {ON}
            YDR420W (HKR1) - Type 1 membrane protein with EF hand
            motif [contig 191] FULL
          Length = 2159

 Score = 91.7 bits (226), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 49/110 (44%), Positives = 68/110 (61%), Gaps = 1/110 (0%)

Query: 941  VISNLESPTPVLSIYSTNLDSSSNSYAWLPTAIIVQSS-ETDTSTTLFNPTITGSLPNLI 999
            VIS     +  LS  S ++  S  S  WLPT ++  S+ E+  + + F+   T +LP  I
Sbjct: 1277 VISGDAPTSTFLSKPSQSVAGSRTSSDWLPTLLVTASATESVNTQSSFDTAATATLPQFI 1336

Query: 1000 EPAVTASEPINHTLITVGFTAALNYVFLVQNPLSSAQIFNFLPLVLKYPF 1049
             P+   S P N++ IT+GF  ALNY FL++NPL+SAQIF FLP VL+YPF
Sbjct: 1337 VPSTPVSIPANYSQITIGFQKALNYPFLIKNPLASAQIFGFLPDVLRYPF 1386

 Score = 70.1 bits (170), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 36/74 (48%), Positives = 48/74 (64%)

Query: 1112 SINASSIAVKQIVPMMDSSKAYIIAVAEVYFPTEAVSYLQELILDVNSTLYNNPQSPLRT 1171
            S N S + V  I+P++ S   YI +VA VYFPT AV+ LQ++IL+  S LY+NP S   +
Sbjct: 1453 SANFSEVVVSSIIPLIISGNDYIASVAIVYFPTSAVNVLQKMILNSASMLYSNPDSTQES 1512

Query: 1172 LAGLIDNSIPLGSL 1185
            LA LID  IP+  L
Sbjct: 1513 LALLIDPKIPITGL 1526

 Score = 37.0 bits (84), Expect = 0.57,   Method: Compositional matrix adjust.
 Identities = 13/24 (54%), Positives = 19/24 (79%)

Query: 1527 VSDIQIEELDALDEELYKRISKIA 1550
            V+DI I E D LDEE+Y+R+S ++
Sbjct: 1916 VNDIHIGEFDELDEEMYRRLSSVS 1939

>TDEL0D03010 Chr4 complement(564735..568106) [3372 bp, 1123 aa] {ON}
            Anc_4.150 YGR014W
          Length = 1123

 Score = 90.1 bits (222), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 73/220 (33%), Positives = 99/220 (45%), Gaps = 68/220 (30%)

Query: 968  WLPTAIIVQSSETDTSTTLFNPTITGSLPNLIEPAVTASEPINHTLITVGFTAALNYVFL 1027
            W+PT I+ Q+S+T +S T+   T T  LP  I  A   + P  +TLIT+GF  ALNY F+
Sbjct: 796  WVPTQIVTQTSQTTSSGTVGQATAT--LPQAIAAATQVARPDGYTLITLGFKRALNYNFV 853

Query: 1028 VQNPLSSAQIFNFLPLVLKYPFSDTSSGVESSNGELSSFILSYRSGTSTTTLSPQSK--S 1085
            V NP+SSAQIF FLP +L+ PF +                 SY + T    +  QSK  S
Sbjct: 854  VSNPISSAQIFAFLPEMLRTPFEN-----------------SYENITVQQLVPLQSKAVS 896

Query: 1086 SLSIVRXXXXXXXXXPPTSTMDLYFPSINASSIAVKQIVPMMDSSKAYIIAVAEVYFPTE 1145
             L+ V                ++YFP                                T 
Sbjct: 897  YLATV---------------AEVYFP--------------------------------TS 909

Query: 1146 AVSYLQELILDVNSTLYNNPQSPLRTLAGLIDNSIPLGSL 1185
             +S L +LI + +S LY + + P + LA LID SIPL  L
Sbjct: 910  EISALSKLISNTSSNLYTDVEGPAKYLAYLIDASIPLTGL 949

>TBLA0G01210 Chr7 (321555..327032) [5478 bp, 1825 aa] {ON} Anc_4.150
            YGR014W
          Length = 1825

 Score = 88.2 bits (217), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 89/329 (27%), Positives = 135/329 (41%), Gaps = 98/329 (29%)

Query: 968  WLPTAIIVQSS--ETDTSTTLFNPTITGSLPNLIEPAVTASEPINHTLITVGFTAALNYV 1025
            W+PT++ V S+   TDTST       T ++P  I        P NH+LIT+GF   LNY 
Sbjct: 1498 WIPTSLAVASTMNSTDTSTLP-----TQAIPQAIGSVEQPPAPENHSLITIGFKKELNYE 1552

Query: 1026 FLVQNPLSSAQIFNFLPLVLKYPFSDTSSGVESSNGELSSFILSYRSGTSTTTLSPQSKS 1085
            F                 V+ +P S    G +         I++Y               
Sbjct: 1553 F-----------------VVSHPMS----GAQ---------IINYL-------------- 1568

Query: 1086 SLSIVRXXXXXXXXXPPTSTMDLYFPSINASSIAVKQIVPMMDSSKAYIIAVAEVYFPTE 1145
                            P + ++ +F   N ++I+V  +VP  D+   Y+I +A VYFPT+
Sbjct: 1569 ----------------PNTLVNAFFG--NVTNISVNNLVPYNDTKSDYLITIATVYFPTD 1610

Query: 1146 AVSYLQELILDVNSTLYNNPQSPLRTLAGLIDNSIPLGSLTLYSSGNEGHVSSLFP---- 1201
             + +L+ELI D +S+ Y   Q   R LA L+D SIPL  L L+  GN    ++  P    
Sbjct: 1611 EIKHLRELIHDKSSSFYTASQDVARQLANLVDPSIPLTGLNLF--GNSDDTNNNNPYSPD 1668

Query: 1202 ------SGVLDSSKENSKGIVATYKYGALDDFTNSFTDSAPGWSYAARTIVFLAILTIGX 1255
                   G LD S  N K  V     GAL+      T    G       ++ L+I +IG 
Sbjct: 1669 NSNSEGIGTLDVSPIN-KVSVLKNNSGALNT-KGKVTGLIIGVVIGGCCLIALSIFSIG- 1725

Query: 1256 XXXXXXXXXXXHYRNILLKRYPKDCIEKS 1284
                       H+   ++KR+  +  E++
Sbjct: 1726 -----------HF---IMKRHNANVTEET 1740

>SAKL0H23188g Chr8 (2009677..2013465) [3789 bp, 1262 aa] {ON} some
            similarities with uniprot|P08640 Saccharomyces cerevisiae
            YIR019C MUC1 GPI-anchored cell surface glycoprotein
            required for diploid pseudohyphal formation and haploid
            invasive growth transcriptionally regulated by the MAPK
            pathway (via Ste12p and Tec1p) and the cAMP pathway (via
            Flo8p)
          Length = 1262

 Score = 85.1 bits (209), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 45/97 (46%), Positives = 63/97 (64%), Gaps = 7/97 (7%)

Query: 968  WLPTAIIVQSSETDT-------STTLFNPTITGSLPNLIEPAVTASEPINHTLITVGFTA 1020
            WLPTA++V+S+ TD        S T  +   T +LP  I  A   S+P  +TLIT+GF  
Sbjct: 902  WLPTAMLVESTATDNGQANAGGSGTGISTLATQTLPQAIAAATQVSQPDGYTLITIGFKK 961

Query: 1021 ALNYVFLVQNPLSSAQIFNFLPLVLKYPFSDTSSGVE 1057
            +LNY F+V +P+SSAQ+F++LP VL YPF+ T S V+
Sbjct: 962  SLNYPFVVSHPVSSAQLFSYLPNVLNYPFNYTFSDVQ 998

 Score = 64.7 bits (156), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 32/67 (47%), Positives = 45/67 (67%)

Query: 1116 SSIAVKQIVPMMDSSKAYIIAVAEVYFPTEAVSYLQELILDVNSTLYNNPQSPLRTLAGL 1175
            S + V Q+VP+  SS+ Y+I VA+VYFP+E V  LQ+LI +  + LY N     ++LA L
Sbjct: 995  SDVQVYQLVPLKSSSRDYLITVAKVYFPSEQVEVLQKLISNTAANLYFNSNPTEKSLASL 1054

Query: 1176 IDNSIPL 1182
            ID +IPL
Sbjct: 1055 IDPTIPL 1061

>KLLA0C17985g Chr3 complement(1596320..1599046) [2727 bp, 908 aa] {ON}
            some similarities with uniprot|P32334 Saccharomyces
            cerevisiae YGR014W MSB2 Mucin family member at the head
            of the Cdc42p- and MAP kinase-dependent filamentous
            growth signaling pathway also functions as an osmosensor
            in parallel to the Sho1p-mediated pathway potential
            Cdc28p substrate
          Length = 908

 Score = 84.7 bits (208), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 80/251 (31%), Positives = 111/251 (44%), Gaps = 67/251 (26%)

Query: 939  TQVISNLESPTPVLSIYSTNLDS--SSNSYAWLPTAIIVQ--SSETDTSTTLFNPTITGS 994
            T V+S +E   PV+S+ ST  +   S+    WLPT ++ +  +S T +++T  +   T +
Sbjct: 507  TSVVSTVE---PVVSLPSTTTEQPVSTTQQVWLPTTMVAEFETSGTQSTSTTSSKIATET 563

Query: 995  LPNLIEPAVTASEPINHTLITVGFTAALNYVFLVQNPLSSAQIFNFLPLVLKYPFSDTSS 1054
            LP  I  A    +P  +TLITVGF   LNY F V NP+S+AQIF FLP VL YPF     
Sbjct: 564  LPQAITAATEIVQPAGYTLITVGFKKELNYPFTVNNPVSNAQIFEFLPKVLNYPF----- 618

Query: 1055 GVESSNGELSSFILSYRSGTSTTTLSPQSKSSLSIVRXXXXXXXXXPPTSTMDLYFPSIN 1114
                 NG            TS   L P   +SL  +             +   +YFP   
Sbjct: 619  -----NGA------QKFDNTSVLELVPLKVTSLDYL------------VTVAKVYFPE-- 653

Query: 1115 ASSIAVKQIVPMMDSSKAYIIAVAEVYFPTEAVSYLQELILDVNSTLYNNPQSPLRTLAG 1174
                                          ++VS LQ  IL+ +S +YNN  + L+ L+ 
Sbjct: 654  ------------------------------DSVSTLQAQILNSSSVIYNNDVTALKQLSS 683

Query: 1175 LIDNSIPLGSL 1185
             ID SIPL  L
Sbjct: 684  YIDASIPLTGL 694

>NDAI0K02580 Chr11 complement(574995..577952) [2958 bp, 985 aa] {ON}
            Anc_4.150
          Length = 985

 Score = 79.3 bits (194), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 53/132 (40%), Positives = 80/132 (60%), Gaps = 10/132 (7%)

Query: 922  SRPSTKISTGTITTAVQTQVISNLESPTPVLSIYSTNLDSSSNSYAWLPTAIIVQSSE-T 980
            S PST IS  +    V++  IS      P ++   T   +SS++  W+PT +I QS++ +
Sbjct: 569  SEPSTPISAAS---PVKSSFIS------PSVTTTPTQTRASSDTNWWIPTVLITQSNQPS 619

Query: 981  DTSTTLFNPTITGSLPNLIEPAVTASEPINHTLITVGFTAALNYVFLVQNPLSSAQIFNF 1040
            ++++   + T T +LP +I    T  EP  ++LIT+GF   LNY F+V NP SSAQIF+F
Sbjct: 620  ESASVPTSNTATKTLPQVIAVGTTIPEPEGYSLITIGFKKPLNYEFIVANPKSSAQIFSF 679

Query: 1041 LPLVLKYPFSDT 1052
            LP VL  PF++T
Sbjct: 680  LPDVLNAPFNNT 691

 Score = 47.8 bits (112), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 40/70 (57%), Gaps = 2/70 (2%)

Query: 1118 IAVKQIVPMMDSSKAYIIAVAEVYFPTEAVSYLQELILD--VNSTLYNNPQSPLRTLAGL 1175
            I V Q+VP+ + S  Y++ VA+VYFPT+ +  L  LI D    S +Y   Q    +LA L
Sbjct: 695  ITVLQLVPLQNPSLNYLVTVAKVYFPTDMIDTLSSLIEDYTTPSLIYTINQGAKGSLANL 754

Query: 1176 IDNSIPLGSL 1185
            I + IPL  L
Sbjct: 755  ISSDIPLTGL 764

>Kwal_47.17703 s47 (521283..525989) [4707 bp, 1568 aa] {ON} YNR044W
            (AGA1) - anchorage subunit of a-agglutinin [contig 206]
            FULL
          Length = 1568

 Score = 78.6 bits (192), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 50/111 (45%), Positives = 62/111 (55%), Gaps = 8/111 (7%)

Query: 947  SPTPVLS--IYSTNLDSSSNSYAWLPTAIIVQ------SSETDTSTTLFNPTITGSLPNL 998
            SP P L+  + ST   SS+ S  WLPTA+I        +S TD+S        T +LP  
Sbjct: 1201 SPYPALTTDLISTPTASSATSSNWLPTAMITANANTESASPTDSSDPKDAQQATKTLPQA 1260

Query: 999  IEPAVTASEPINHTLITVGFTAALNYVFLVQNPLSSAQIFNFLPLVLKYPF 1049
            I       +P  +TLITVGF  ALNY F+V NP++SAQIF FLP  L  PF
Sbjct: 1261 IGAPTEVVQPEGYTLITVGFKKALNYPFVVGNPVTSAQIFAFLPDTLNSPF 1311

 Score = 51.2 bits (121), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 27/68 (39%), Positives = 40/68 (58%)

Query: 1118 IAVKQIVPMMDSSKAYIIAVAEVYFPTEAVSYLQELILDVNSTLYNNPQSPLRTLAGLID 1177
            I V ++ P+  SS+ Y++ VAEVYFP+  V  LQ+LI +  S  Y    +    +A L+D
Sbjct: 1318 ITVARLGPLKVSSRDYLLTVAEVYFPSAQVENLQKLIQNDASKFYFVNGTSRNVVASLVD 1377

Query: 1178 NSIPLGSL 1185
             +IPL  L
Sbjct: 1378 ATIPLTGL 1385

>YGR014W Chr7 (516943..520863) [3921 bp, 1306 aa] {ON}  MSB2Mucin
            family member involved in the Cdc42p- and MAP
            kinase-dependent filamentous growth signaling pathway;
            also functions as an osmosensor in parallel to the
            Sho1p-mediated pathway; potential Cdc28p substrate
          Length = 1306

 Score = 77.8 bits (190), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 42/94 (44%), Positives = 58/94 (61%), Gaps = 1/94 (1%)

Query: 959  LDSSSNSYAWLPTAIIVQSSET-DTSTTLFNPTITGSLPNLIEPAVTASEPINHTLITVG 1017
            L +SS++  W+PT +I Q+ E   T+++    T T +LP+ I  A    EP  +TLIT+G
Sbjct: 952  LVTSSDNNWWIPTELITQAPEAASTASSTVGGTQTMTLPHAIAAATQVPEPEGYTLITIG 1011

Query: 1018 FTAALNYVFLVQNPLSSAQIFNFLPLVLKYPFSD 1051
            F  ALNY F+V  P SSAQIF +LP  L  PF +
Sbjct: 1012 FKKALNYEFVVSEPKSSAQIFGYLPEALNTPFKN 1045

>ZYRO0G11242g Chr7 (900370..904833) [4464 bp, 1487 aa] {ON} weakly
            similar to uniprot|P32334 Saccharomyces cerevisiae
            YGR014W MSB2 Mucin family member at the head of the
            Cdc42p- and MAP kinase-dependent filamentous growth
            signaling pathway also functions as an osmosensor in
            parallel to the Sho1p-mediated pathway potential Cdc28p
            substrate
          Length = 1487

 Score = 76.3 bits (186), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 53/136 (38%), Positives = 74/136 (54%), Gaps = 3/136 (2%)

Query: 918  SESYSRPSTKISTGTITTAVQTQVISNLESPTPVLSIYSTNLDSSS--NSYAWLPTAIIV 975
            S++ S PS   ST T  +       S  +S  PV    +T   SSS  N   W+PT II 
Sbjct: 1107 SQAVSTPSVIPSTATTQSTSHRHGYSMTQSYWPVSGPTTTLAPSSSTTNDNWWVPTKIIT 1166

Query: 976  QSSETDTSTTLFNPTITGSLPNLIEPAVTASEPINHTLITVGFTAALNYVFLVQNPLSSA 1035
            Q +   T+++  +   T +LP  I  A     P  ++L+T+GF +ALNY FL+ +PLSSA
Sbjct: 1167 QPAPNTTASSTSS-QATATLPQAIAAATQQVRPKGYSLLTIGFKSALNYNFLISSPLSSA 1225

Query: 1036 QIFNFLPLVLKYPFSD 1051
            QIF FLP +L  PF +
Sbjct: 1226 QIFAFLPSILNDPFQN 1241

 Score = 58.2 bits (139), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 31/77 (40%), Positives = 45/77 (58%)

Query: 1118 IAVKQIVPMMDSSKAYIIAVAEVYFPTEAVSYLQELILDVNSTLYNNPQSPLRTLAGLID 1177
            +++ QIVP+   S  Y+  VAEVYFPT+ +S L  LI +  S+LY +     + LA LID
Sbjct: 1246 VSIYQIVPLKSESLDYLATVAEVYFPTKHISDLNSLITNNASSLYTDAHGSAKYLAELID 1305

Query: 1178 NSIPLGSLTLYSSGNEG 1194
             +IPL  L      ++G
Sbjct: 1306 PTIPLTGLVPTGDKSQG 1322

>KLTH0E08844g Chr5 (804120..808682) [4563 bp, 1520 aa] {ON} some
            similarities with uniprot|P32334 Saccharomyces cerevisiae
            YGR014W MSB2 Mucin family member at the head of the
            Cdc42p- and MAP kinase-dependent filamentous growth
            signaling pathway also functions as an osmosensor in
            parallel to the Sho1p-mediated pathway potential Cdc28p
            substrate
          Length = 1520

 Score = 75.1 bits (183), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 40/89 (44%), Positives = 56/89 (62%), Gaps = 5/89 (5%)

Query: 968  WLPTAIIVQSSETD---TSTTLFNPT--ITGSLPNLIEPAVTASEPINHTLITVGFTAAL 1022
            WLPTA++  SS+T+   + +T  N +   T +LP  I      S+P  +TLIT+GF  AL
Sbjct: 1179 WLPTALVTASSDTNDTQSGSTDSNGSQLATQTLPQAIGAPTEVSQPEGYTLITIGFKQAL 1238

Query: 1023 NYVFLVQNPLSSAQIFNFLPLVLKYPFSD 1051
            NY F+V N ++SAQIF +LP  L +PF D
Sbjct: 1239 NYPFVVTNAVTSAQIFAYLPETLNFPFDD 1267

>NCAS0A05230 Chr1 (1034523..1036880) [2358 bp, 785 aa] {ON} Anc_4.150
          Length = 785

 Score = 74.3 bits (181), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 38/84 (45%), Positives = 54/84 (64%), Gaps = 1/84 (1%)

Query: 968  WLPTAIIVQSSETDTSTTLFNPTITGSLPNLIEPAVTASEPINHTLITVGFTAALNYVFL 1027
            W+PT +I  S++  T + + +   T +LP +I  A +   P  +T+IT+GF  ALNY F+
Sbjct: 452  WIPTQLITASTQV-TGSAMVSSAATKTLPQVIGAATSVPTPEGYTVITIGFKEALNYEFI 510

Query: 1028 VQNPLSSAQIFNFLPLVLKYPFSD 1051
            V +P SSAQIF+FLP VL  PF D
Sbjct: 511  VSSPKSSAQIFSFLPYVLNTPFDD 534

 Score = 58.9 bits (141), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 32/68 (47%), Positives = 39/68 (57%)

Query: 1118 IAVKQIVPMMDSSKAYIIAVAEVYFPTEAVSYLQELILDVNSTLYNNPQSPLRTLAGLID 1177
            I V ++VP+      Y I VAEV FP  A++ L   I D NS+LY      LR+LA LID
Sbjct: 539  ITVSRLVPLQKKDIGYFITVAEVLFPESAIANLSVYIKDTNSSLYTKNDDALRSLALLID 598

Query: 1178 NSIPLGSL 1185
             SIPL  L
Sbjct: 599  PSIPLTGL 606

>KAFR0F03470 Chr6 (689705..692554) [2850 bp, 949 aa] {ON} Anc_4.150
            YGR014W
          Length = 949

 Score = 73.6 bits (179), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 84/281 (29%), Positives = 128/281 (45%), Gaps = 44/281 (15%)

Query: 1118 IAVKQIVPMMDSSKAYIIAVAEVYFPTEAVSYLQELILDVNSTLYNNPQSPLRTLAGLID 1177
            I+V QIVP+++SS  Y I VAEVYFP + ++ LQ++I D +S L+       +TL  LID
Sbjct: 679  ISVYQIVPLVESSLNYYITVAEVYFPEQEIASLQQMIKDNSSALFTENVGAPKTLVSLID 738

Query: 1178 NSIPLGSL--------------TLYSSGNEGHVSSLFPSGVLDSSKENSKGIVATYKYGA 1223
             SIPL  L              +  S+ N G V+S       DS   + KG V++   G+
Sbjct: 739  PSIPLVGLLSSTTSNSSTSATGSSASTTNSGQVNS---GSNSDSDSSSGKGSVSSNDIGS 795

Query: 1224 LDDFTNSFTDSAPGWSYAARTIVFLAI-LTIGXXXXXXXXXXXXHYRNILLKRYPKDCIE 1282
            L D++   T +A G + + R ++ L + + IG            H R  + K       +
Sbjct: 796  L-DYSEKSTSAAAGKTTSNRKLIILIVCVVIGGLLFITLTAYILHVRITVFKD------Q 848

Query: 1283 KSLGNERKFDSTALSRSSSGNQIFNEKPSGSENESVHS------VTDDHYIITGENTVYS 1336
            K       FD  + +  SSG  ++NEK   ++NESV S      + + H+    EN  Y 
Sbjct: 849  KRKAANMSFDVLS-TTDSSGGSVYNEKEKLNDNESVVSDKINAWMNNAHF----ENAAYY 903

Query: 1337 TTHGLHYTINDDGDLFYKEATLNDLEETAEREDSGIDSILR 1377
              +      N+DG    +E    D+     R + GI  I R
Sbjct: 904  ANN-----TNNDGAANGEEI---DVANVGVRVNGGIKIISR 936

 Score = 67.4 bits (163), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 44/116 (37%), Positives = 66/116 (56%), Gaps = 2/116 (1%)

Query: 938  QTQVI--SNLESPTPVLSIYSTNLDSSSNSYAWLPTAIIVQSSETDTSTTLFNPTITGSL 995
            QT V+  SN+   + +  + S    S SN   W+ + ++  S E  T+T     T TGSL
Sbjct: 559  QTTVLPASNVPVSSSITLVTSATTTSHSNPNWWVASDLMTASEEASTTTRASATTATGSL 618

Query: 996  PNLIEPAVTASEPINHTLITVGFTAALNYVFLVQNPLSSAQIFNFLPLVLKYPFSD 1051
            P  I      + P +++LIT+GF  ALNY F+V  P SSAQ+F++LP+ L  PF++
Sbjct: 619  PQAIAAPTEVTAPDDYSLITIGFKKALNYEFVVNTPESSAQLFSYLPIALNTPFNN 674

>Ecym_7349 Chr7 complement(722484..725873) [3390 bp, 1129 aa] {ON}
            similar to Ashbya gossypii AGR019C
          Length = 1129

 Score = 73.2 bits (178), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 45/93 (48%), Positives = 53/93 (56%), Gaps = 11/93 (11%)

Query: 968  WLPTAIIVQSSE--------TDTST---TLFNPTITGSLPNLIEPAVTASEPINHTLITV 1016
            WLPTAI+ +S          TDT T   T    T   +LP  I  A       N+TLITV
Sbjct: 776  WLPTAILTESDADSEPTVTVTDTETKPTTSMASTAIQTLPKFISSANGKIPEGNYTLITV 835

Query: 1017 GFTAALNYVFLVQNPLSSAQIFNFLPLVLKYPF 1049
            GF   LNY F+V NP+SSAQIF+FLP VL YP+
Sbjct: 836  GFKRRLNYPFVVSNPVSSAQIFDFLPNVLNYPY 868

 Score = 55.1 bits (131), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 27/76 (35%), Positives = 47/76 (61%), Gaps = 1/76 (1%)

Query: 1108 LYFP-SINASSIAVKQIVPMMDSSKAYIIAVAEVYFPTEAVSYLQELILDVNSTLYNNPQ 1166
            L +P     ++++V +++P+   S+ Y++ VA V+FPTE +  L  L+ D  S+LY++  
Sbjct: 864  LNYPYGFRCANVSVWRLLPLKSGSRDYLVTVAAVFFPTEHLDELARLVADNTSSLYSSYD 923

Query: 1167 SPLRTLAGLIDNSIPL 1182
               +T+A LID  IPL
Sbjct: 924  ETGKTMASLIDPMIPL 939

>Suva_7.296 Chr7 (508904..512311) [3408 bp, 1135 aa] {ON} YGR014W
            (REAL)
          Length = 1135

 Score = 72.4 bits (176), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 40/85 (47%), Positives = 53/85 (62%), Gaps = 1/85 (1%)

Query: 968  WLPTAIIVQSSETDTS-TTLFNPTITGSLPNLIEPAVTASEPINHTLITVGFTAALNYVF 1026
            W+PT +I Q +E  +S +T    T T +LP+ I  A   +EP  ++LIT+GF  ALNY F
Sbjct: 790  WIPTQLITQETEAASSASTTTGGTQTMTLPHAIAAATQIAEPDGYSLITIGFKKALNYEF 849

Query: 1027 LVQNPLSSAQIFNFLPLVLKYPFSD 1051
            +V  P SSAQIF +LP  L  PF D
Sbjct: 850  VVSEPKSSAQIFAYLPEALNTPFKD 874

 Score = 62.8 bits (151), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 28/68 (41%), Positives = 44/68 (64%)

Query: 1118 IAVKQIVPMMDSSKAYIIAVAEVYFPTEAVSYLQELILDVNSTLYNNPQSPLRTLAGLID 1177
            I+V QIVP+ D   +Y+++VAEVYFPT  +  L  LI + +S+ Y +     +++A ++D
Sbjct: 879  ISVLQIVPLQDDLFSYLVSVAEVYFPTAEIETLSSLITNTSSSFYTDGMGTAKSMAAMVD 938

Query: 1178 NSIPLGSL 1185
             SIPL  L
Sbjct: 939  ASIPLTGL 946

>KNAG0D03590 Chr4 (657513..660497) [2985 bp, 994 aa] {ON} Anc_4.150
            YGR014W
          Length = 994

 Score = 69.3 bits (168), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 34/70 (48%), Positives = 48/70 (68%)

Query: 1116 SSIAVKQIVPMMDSSKAYIIAVAEVYFPTEAVSYLQELILDVNSTLYNNPQSPLRTLAGL 1175
            S+I+V Q+VP+ DSS +Y + VAEVYFPT  ++ L +L+ D +S LY      L+TLA +
Sbjct: 735  SNISVLQLVPLQDSSISYYVTVAEVYFPTAEITNLSQLVKDTSSILYTEVSESLKTLADM 794

Query: 1176 IDNSIPLGSL 1185
            ID SIP+  L
Sbjct: 795  IDPSIPITGL 804

>TBLA0G00950 Chr7 complement(232502..239263) [6762 bp, 2253 aa] {ON}
            Anc_5.524 YDR420W
          Length = 2253

 Score = 69.3 bits (168), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 43/124 (34%), Positives = 68/124 (54%), Gaps = 3/124 (2%)

Query: 961  SSSNSYAWLPTAIIVQSSETDTSTTLFNPTITGSLPNLIEPAVTASEP--INHTLITVGF 1018
            S SN   WLP+ ++V+++ + ++   FNP+ T   P  I P     +P  ++  LI V  
Sbjct: 1549 SVSNGSNWLPSTLVVENNPSGSANMQFNPSETFKWPRAITPENQNEKPAPVDSQLILVAL 1608

Query: 1019 TAALNYVFLVQNPLSSAQIFNFLPLVLKYPFSDTSSGVESSNG-ELSSFILSYRSGTSTT 1077
               LNY FL++N +SSAQ+ N++P +L Y   D S    SS     +++ +S    + TT
Sbjct: 1609 DRPLNYPFLIENLVSSAQVMNYIPFILSYSLIDFSPAAPSSYSLSGTAYDISSEINSGTT 1668

Query: 1078 TLSP 1081
            TLSP
Sbjct: 1669 TLSP 1672

 Score = 62.4 bits (150), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 30/78 (38%), Positives = 45/78 (57%)

Query: 1118 IAVKQIVPMMDSSKAYIIAVAEVYFPTEAVSYLQELILDVNSTLYNNPQSPLRTLAGLID 1177
            I VKQI+P++   + Y +A  +VY P   V  LQ  I D++S LY+NP    R L+  ID
Sbjct: 1777 IEVKQIIPLLIEDRDYWVAGVQVYVPNNVVDQLQAYIYDLDSILYHNPVYIARELSNFID 1836

Query: 1178 NSIPLGSLTLYSSGNEGH 1195
            +SIP+     Y +  +G+
Sbjct: 1837 SSIPIVGSGKYWTAYDGN 1854

 Score = 33.1 bits (74), Expect = 8.9,   Method: Compositional matrix adjust.
 Identities = 11/20 (55%), Positives = 18/20 (90%)

Query: 1526 SVSDIQIEELDALDEELYKR 1545
            SV DI I+ELD+LD+E++++
Sbjct: 2230 SVDDIDIDELDSLDQEIFRK 2249

>Skud_7.299 Chr7 (520447..523956) [3510 bp, 1169 aa] {ON} YGR014W
            (REAL)
          Length = 1169

 Score = 68.2 bits (165), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 32/68 (47%), Positives = 44/68 (64%)

Query: 1118 IAVKQIVPMMDSSKAYIIAVAEVYFPTEAVSYLQELILDVNSTLYNNPQSPLRTLAGLID 1177
            I V QIVP+ D S  Y+I+VAEVYFPT  V  L  LI++ +ST Y +     +++A ++D
Sbjct: 912  ITVLQIVPLQDDSLNYLISVAEVYFPTAEVEELSNLIMNTSSTFYTDGTGTAKSMAAMVD 971

Query: 1178 NSIPLGSL 1185
             SIPL  L
Sbjct: 972  PSIPLTGL 979

>AGR019C Chr7 complement(747644..750961) [3318 bp, 1105 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YGR014W
            (MSB2)
          Length = 1105

 Score = 67.8 bits (164), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 61/229 (26%), Positives = 92/229 (40%), Gaps = 74/229 (32%)

Query: 968  WLPTAIIVQSSETDTST-------TLFNPTIT---GSLPNLIEPAVTASEPINHTLITVG 1017
            WLPT II  + +   ST       +   PT T    +LP +I      +   ++TLIT+G
Sbjct: 757  WLPTVIITATEQEVVSTESPQNTQSKPKPTATPNIQTLPQVIAAPDRVTPKKDYTLITIG 816

Query: 1018 FTAALNYVFLVQNPLSSAQIFNFLPLVLKYPFSDTSSGVESSNGELSSFILSYRSGTSTT 1077
            F   LNY                 P +   PF++               I  Y  G    
Sbjct: 817  FKKQLNY-----------------PFIAMNPFANAQ-------------IFDYLPGI--- 843

Query: 1078 TLSPQSKSSLSIVRXXXXXXXXXPPTSTMDLYFP-SINASSIAVKQIVPMMDSSKAYIIA 1136
                                          L +P +   + I+V Q+VP+  +SK YI  
Sbjct: 844  ------------------------------LNYPFNFEYADISVIQLVPLKANSKDYIAT 873

Query: 1137 VAEVYFPTEAVSYLQELILDVNSTLYNNPQSPLRTLAGLIDNSIPLGSL 1185
            +A+VYFP+E V  L +L++D NS LY++  + ++  A LID  +PL  L
Sbjct: 874  IAQVYFPSEKVDELAKLVVDTNSELYSSYDANMKVFASLIDPQLPLTGL 922

>Smik_7.302 Chr7 (508666..512235) [3570 bp, 1189 aa] {ON} YGR014W
            (REAL)
          Length = 1189

 Score = 64.7 bits (156), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 30/68 (44%), Positives = 45/68 (66%)

Query: 1118 IAVKQIVPMMDSSKAYIIAVAEVYFPTEAVSYLQELILDVNSTLYNNPQSPLRTLAGLID 1177
            I+V QIVP+ D S +Y+++VAEVYFPT  +  L  LI + +ST Y +     +++A ++D
Sbjct: 931  ISVLQIVPLQDDSLSYLVSVAEVYFPTAELEELSNLITNTSSTFYTSGTGTAKSMAAMVD 990

Query: 1178 NSIPLGSL 1185
             SIPL  L
Sbjct: 991  PSIPLTGL 998

>Kpol_1062.37 s1062 complement(78801..81722) [2922 bp, 973 aa] {ON}
            complement(78801..81722) [2922 nt, 974 aa]
          Length = 973

 Score = 60.5 bits (145), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 33/89 (37%), Positives = 53/89 (59%)

Query: 968  WLPTAIIVQSSETDTSTTLFNPTITGSLPNLIEPAVTASEPINHTLITVGFTAALNYVFL 1027
            W+PT++I +S  TD++ T    + T S+P  I  +   + P   +L+T+GF  ALNY F+
Sbjct: 643  WVPTSLITESDVTDSAVTTRTLSATKSVPLAIAASTQTATPEGCSLVTIGFKEALNYQFV 702

Query: 1028 VQNPLSSAQIFNFLPLVLKYPFSDTSSGV 1056
            + + ++ AQIF FLP  L  PF +  + V
Sbjct: 703  LSSSVTVAQIFAFLPGGLIAPFEEQLANV 731

 Score = 43.5 bits (101), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 24/70 (34%), Positives = 35/70 (50%)

Query: 1116 SSIAVKQIVPMMDSSKAYIIAVAEVYFPTEAVSYLQELILDVNSTLYNNPQSPLRTLAGL 1175
            +++ V ++ P+   +  Y + VAEVYFPT  +  L   + D  S LY N       L  L
Sbjct: 729  ANVTVYRLSPLNYGNFNYTLTVAEVYFPTSKIDELAAFVADSESALYVNASGTEEELVSL 788

Query: 1176 IDNSIPLGSL 1185
            ID  IP+  L
Sbjct: 789  IDPRIPITGL 798

>TPHA0K01390 Chr11 complement(287666..290146) [2481 bp, 826 aa] {ON}
            Anc_4.150 YGR014W
          Length = 826

 Score = 55.5 bits (132), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 32/80 (40%), Positives = 46/80 (57%)

Query: 1106 MDLYFPSINASSIAVKQIVPMMDSSKAYIIAVAEVYFPTEAVSYLQELILDVNSTLYNNP 1165
            +DL F   N SS+++ ++VP   S+  Y + VAEVYFP++++  L  LI D +S LY   
Sbjct: 566  LDLPFQFANDSSVSILKLVPYSLSNYNYTVLVAEVYFPSDSIDELSSLIKDSDSPLYTLN 625

Query: 1166 QSPLRTLAGLIDNSIPLGSL 1185
                  L  LID +IPL  L
Sbjct: 626  TGSRLALVNLIDQNIPLTGL 645

>CAGL0F08833g Chr6 (873849..876659) [2811 bp, 936 aa] {ON} weakly
            similar to uniprot|P32334 Saccharomyces cerevisiae
            YGR014w MSB2 multicopy suppressor of a CDC24 bud
            emergence defect
          Length = 936

 Score = 54.7 bits (130), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 35/87 (40%), Positives = 51/87 (58%), Gaps = 4/87 (4%)

Query: 967  AWLPTAIIVQSSETD---TSTTLFNPTITGSLPNLI-EPAVTASEPINHTLITVGFTAAL 1022
            AW+PT++I+  +ET+   T T   + T   SLP +I   A + S P  +++IT+GF   L
Sbjct: 590  AWIPTSLIIAPTETESESTPTESNDGTQLSSLPKVIYGSAYSESVPEGYSVITIGFKKPL 649

Query: 1023 NYVFLVQNPLSSAQIFNFLPLVLKYPF 1049
            NY F+V    SSAQI  +LP +L   F
Sbjct: 650  NYPFVVSESKSSAQIMYYLPKLLNANF 676

>Suva_14.389 Chr14 (671583..672548) [966 bp, 321 aa] {ON} YNR034W
            (REAL)
          Length = 321

 Score = 38.9 bits (89), Expect = 0.075,   Method: Compositional matrix adjust.
 Identities = 26/107 (24%), Positives = 47/107 (43%), Gaps = 16/107 (14%)

Query: 1104 STMDLYFPSINASSIAVKQIVPMMDSSKAYIIAVAEVYFPTEAVSYLQELILDVNSTLYN 1163
               D+YF        A +++VP   S   Y +A  E++   +   Y    I  ++ +L +
Sbjct: 118  GKWDIYF--------ADERLVPFSSSESNYGLAKREIFDLIDTEKYGTPRIYHIDESLID 169

Query: 1164 NPQSP--------LRTLAGLIDNSIPLGSLTLYSSGNEGHVSSLFPS 1202
            +PQ          ++  AG     +P+  L L     +GH++SLFP+
Sbjct: 170  DPQECADNYEKILIKRFAGRDSVKLPMFDLFLLGCAPDGHIASLFPN 216

>YNR034W Chr14 (690321..691286) [966 bp, 321 aa] {ON}  SOL1Protein
            with a possible role in tRNA export; shows similarity to
            6-phosphogluconolactonase non-catalytic domains but does
            not exhibit this enzymatic activity; homologous to Sol2p,
            Sol3p, and Sol4p
          Length = 321

 Score = 38.9 bits (89), Expect = 0.086,   Method: Compositional matrix adjust.
 Identities = 26/107 (24%), Positives = 47/107 (43%), Gaps = 16/107 (14%)

Query: 1104 STMDLYFPSINASSIAVKQIVPMMDSSKAYIIAVAEVYFPTEAVSYLQELILDVNSTLYN 1163
               D+YF        A +++VP   S   Y +A  +++   +   Y    I  ++ +L N
Sbjct: 118  GKWDIYF--------ADERLVPFSSSESNYGLAKRKIFDLIDTEKYGTPKIYHIDESLIN 169

Query: 1164 NPQSP--------LRTLAGLIDNSIPLGSLTLYSSGNEGHVSSLFPS 1202
            +PQ          ++  AG     +P+  L L     +GH++SLFP+
Sbjct: 170  DPQECADNYEKILIKGFAGRDSVKLPMFDLFLLGCAPDGHIASLFPN 216

>Skud_14.366 Chr14 (658414..659379) [966 bp, 321 aa] {ON} YNR034W
            (REAL)
          Length = 321

 Score = 38.5 bits (88), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 26/107 (24%), Positives = 47/107 (43%), Gaps = 16/107 (14%)

Query: 1104 STMDLYFPSINASSIAVKQIVPMMDSSKAYIIAVAEVYFPTEAVSYLQELILDVNSTLYN 1163
            S  D+YF        A +++VP       Y +A  E++   +   Y    I  ++ +L +
Sbjct: 118  SKWDIYF--------ADERLVPFSSGESNYGLAKREIFDLIDTKKYGTPRIYHIDESLIS 169

Query: 1164 NPQSP--------LRTLAGLIDNSIPLGSLTLYSSGNEGHVSSLFPS 1202
            +PQ          ++  AG     +P+  L L     +GH++SLFP+
Sbjct: 170  DPQECADNYEKILIKGFAGRDSVKLPMFDLFLLGCAPDGHIASLFPN 216

>Smik_14.364 Chr14 (648272..649237) [966 bp, 321 aa] {ON} YNR034W
            (REAL)
          Length = 321

 Score = 37.7 bits (86), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 26/107 (24%), Positives = 46/107 (42%), Gaps = 16/107 (14%)

Query: 1104 STMDLYFPSINASSIAVKQIVPMMDSSKAYIIAVAEVYFPTEAVSYLQELILDVNSTLYN 1163
               D+YF        A +++VP   S   Y +A  E++       +    I  ++ +L N
Sbjct: 118  GKWDIYF--------ADERLVPFSSSESNYGLAKREIFDLINTEKHGTPRIYHIDESLIN 169

Query: 1164 NPQSP--------LRTLAGLIDNSIPLGSLTLYSSGNEGHVSSLFPS 1202
            +PQ          ++  AG     +P+  L L     +GH++SLFP+
Sbjct: 170  DPQECADNYEKILIKGFAGRDSVKLPMFDLFLLGCAPDGHIASLFPN 216

>TBLA0F04150 Chr6 complement(1024409..1025566) [1158 bp, 385 aa] {ON}
            Anc_6.345 YCR073W-A
          Length = 385

 Score = 36.6 bits (83), Expect = 0.56,   Method: Compositional matrix adjust.
 Identities = 25/105 (23%), Positives = 47/105 (44%), Gaps = 16/105 (15%)

Query: 1106 MDLYFPSINASSIAVKQIVPMMDSSKAYIIAVAEVYFPTEAVSYLQELILDVNSTLYNNP 1165
             D+YF        A +++VP       Y  A  +++   ++  + +  I  ++ +L NNP
Sbjct: 169  WDIYF--------ADERLVPFDSVDSNYGQAKRKIFDLIDSEKFGKPNIYHIDESLINNP 220

Query: 1166 QSP--------LRTLAGLIDNSIPLGSLTLYSSGNEGHVSSLFPS 1202
            Q          ++  AG     +P+  L L     +GH++SLFP+
Sbjct: 221  QECADNYEKTLIKGFAGRDSVKLPMFDLFLLGCAPDGHIASLFPN 265

>Kpol_325.5 s325 (8203..9237) [1035 bp, 344 aa] {ON} (8203..9237)
            [1035 nt, 345 aa]
          Length = 344

 Score = 36.2 bits (82), Expect = 0.64,   Method: Compositional matrix adjust.
 Identities = 24/107 (22%), Positives = 47/107 (43%), Gaps = 16/107 (14%)

Query: 1104 STMDLYFPSINASSIAVKQIVPMMDSSKAYIIAVAEVYFPTEAVSYLQELILDVNSTLYN 1163
               D+YF        A +++VP       Y +A  +++   E   + +  I  ++ +L +
Sbjct: 139  GKWDIYF--------ADERLVPFESEHSNYGLAKRKIFDMIETEKFGKPNIYHIDESLID 190

Query: 1164 NPQSP--------LRTLAGLIDNSIPLGSLTLYSSGNEGHVSSLFPS 1202
            +PQ          ++  AG     +P+  L L     +GH++SLFP+
Sbjct: 191  DPQECADDYEKILIKGFAGRDSVKLPMFDLFLLGCAPDGHIASLFPN 237

>YHR115C Chr8 complement(340109..341359) [1251 bp, 416 aa] {ON}
            DMA1Ubiquitin-protein ligase (E3); controls septin
            dynamics and the spindle position checkpoint (SPOC) along
            with functionally redundant ligase Dma2p by regulating
            the recruitment of Elm1p to the bud neck; regulates
            levels of the translation initiation factor eIF2 subunit
            Gcd11p, as well as abundance, localization, and
            ubiquitination of Cdk inhibitory kinase Swe1p; ortholog
            of human RNF8 protein, with sequence similarity to human
            Chfr; contains FHA and RING finger domains
          Length = 416

 Score = 34.7 bits (78), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 17/73 (23%), Positives = 38/73 (52%), Gaps = 1/73 (1%)

Query: 1284 SLGNERKFDSTALSRSSSGNQIFNEKPSGSENESVHSVTDDHYIITGENTVYSTTHGLHY 1343
            S+ N+  F    +  + +G+QI   + +    E++  + D ++ +  ++ V S THG  +
Sbjct: 168  SVANQGLFFDPIIRTAGAGSQIIIGRYTERVREAISKIPDQYHPVVFKSKVISRTHGC-F 226

Query: 1344 TINDDGDLFYKEA 1356
             ++D G+ F K+ 
Sbjct: 227  KVDDQGNWFLKDV 239

>Smik_8.193 Chr8 complement(316475..317725) [1251 bp, 416 aa] {ON}
            YHR115C (REAL)
          Length = 416

 Score = 34.3 bits (77), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 17/73 (23%), Positives = 38/73 (52%), Gaps = 1/73 (1%)

Query: 1284 SLGNERKFDSTALSRSSSGNQIFNEKPSGSENESVHSVTDDHYIITGENTVYSTTHGLHY 1343
            S+ N+  F    +  + +G+QI   + +    E++  + D ++ +  ++ V S THG  +
Sbjct: 168  SVANQGLFFDPIIRTAGAGSQIIIGRYTERVREAISKIPDQYHPVVFKSKVISRTHGC-F 226

Query: 1344 TINDDGDLFYKEA 1356
             ++D G+ F K+ 
Sbjct: 227  KVDDQGNWFLKDV 239

>KNAG0D00350 Chr4 complement(47512..48453) [942 bp, 313 aa] {ON}
            Anc_6.345 YCR073W-A
          Length = 313

 Score = 33.9 bits (76), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 25/106 (23%), Positives = 44/106 (41%), Gaps = 16/106 (15%)

Query: 1104 STMDLYFPSINASSIAVKQIVPMMDSSKAYIIAVAEVYFPTEAVSYLQELILDVNSTLYN 1163
               D+YF        A +++VP       Y  A  +++   +   Y    I  ++ +L +
Sbjct: 106  GKWDIYF--------ADERLVPFESDQSNYGQAKRKIFDLIDTEKYGTPNIYHIDESLID 157

Query: 1164 NPQSP--------LRTLAGLIDNSIPLGSLTLYSSGNEGHVSSLFP 1201
            +PQ          +R  AG     +P+  L L     +GH++SLFP
Sbjct: 158  DPQECADSYEKVLIRGFAGRDSVKLPMFDLFLLGCAPDGHIASLFP 203

>KLTH0A06864g Chr1 (573655..574686) [1032 bp, 343 aa] {ON} similar to
            uniprot|P50278 Saccharomyces cerevisiae YNR034W
          Length = 343

 Score = 33.9 bits (76), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 24/104 (23%), Positives = 44/104 (42%), Gaps = 16/104 (15%)

Query: 1106 MDLYFPSINASSIAVKQIVPMMDSSKAYIIAVAEVYFPTEAVSYLQELILDVNSTLYNNP 1165
             D+YF        A +++VP   S   +     ++    +  +Y    +  +N +L N+P
Sbjct: 133  WDIYF--------ADERLVPFESSESNFGNTKRKILDLIDTCTYGTPRVYHINESLINDP 184

Query: 1166 QSP--------LRTLAGLIDNSIPLGSLTLYSSGNEGHVSSLFP 1201
            Q          ++  AG     +P+  L L     +GH++SLFP
Sbjct: 185  QECADDYEKELIKGFAGRDSVKLPMFDLFLLGCAPDGHIASLFP 228

>Ecym_2503 Chr2 (985620..986630) [1011 bp, 336 aa] {ON} similar to
            Ashbya gossypii AER268W
          Length = 336

 Score = 33.9 bits (76), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 23/106 (21%), Positives = 44/106 (41%), Gaps = 16/106 (15%)

Query: 1104 STMDLYFPSINASSIAVKQIVPMMDSSKAYIIAVAEVYFPTEAVSYLQELILDVNSTLYN 1163
               D+YF        A +++VP   +   Y  A  +++   +   Y +  +  +N +L  
Sbjct: 130  GKWDIYF--------ADERLVPFKSNESNYGQAKRQIFDLIDTDKYGKPNVHHINESLIG 181

Query: 1164 NPQSP--------LRTLAGLIDNSIPLGSLTLYSSGNEGHVSSLFP 1201
             PQ          ++  AG     +P+  L L     +GH++SL+P
Sbjct: 182  EPQECADDYEKILIKGFAGRDSVKLPMFDLLLLGCAPDGHIASLYP 227

>KLLA0C08415g Chr3 complement(738306..739271) [966 bp, 321 aa] {ON}
            highly similar to uniprot|P50278 Saccharomyces cerevisiae
            YNR034W
          Length = 321

 Score = 32.7 bits (73), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 24/104 (23%), Positives = 43/104 (41%), Gaps = 16/104 (15%)

Query: 1106 MDLYFPSINASSIAVKQIVPMMDSSKAYIIAVAEVYFPTEAVSYLQELILDVNSTLYNNP 1165
             D+YF        A +++VP   +   Y  A  ++        Y    +  ++ +L N+P
Sbjct: 121  WDIYF--------ADERLVPFESNESNYGQAKRQISDQINTEKYGTPNVFHIDESLINDP 172

Query: 1166 QSP--------LRTLAGLIDNSIPLGSLTLYSSGNEGHVSSLFP 1201
            Q          ++  AG     +P+  L L     +GH++SLFP
Sbjct: 173  QECADDYEKILIKGFAGRDSVKLPMFDLFLLGCAPDGHIASLFP 216

>Kpol_1028.37 s1028 complement(89587..90516) [930 bp, 309 aa] {ON}
            complement(89587..90516) [930 nt, 310 aa]
          Length = 309

 Score = 32.7 bits (73), Expect = 6.7,   Method: Composition-based stats.
 Identities = 24/104 (23%), Positives = 46/104 (44%), Gaps = 16/104 (15%)

Query: 1107 DLYFPSINASSIAVKQIVPMMDSSKAYIIAVAEVYFPTEAVSYLQELILDVNSTLYNNPQ 1166
            D+YF        A +++VP       + +A  E+    +  +Y +  +  +N +L  +PQ
Sbjct: 113  DIYF--------ADERLVPFDSEHSNFGLAKREILDQIDTEAYGKPNVFHINESLIKDPQ 164

Query: 1167 SP--------LRTLAGLIDNSIPLGSLTLYSSGNEGHVSSLFPS 1202
                      ++  AG     +P+  L L     +GH++SLFP+
Sbjct: 165  ECADDYEKILIKGFAGRDSVKLPMFDLFLLGCAPDGHIASLFPN 208

>TPHA0H02320 Chr8 (549721..550806) [1086 bp, 361 aa] {ON} Anc_6.345
            YCR073W-A
          Length = 361

 Score = 32.7 bits (73), Expect = 7.3,   Method: Composition-based stats.
 Identities = 25/104 (24%), Positives = 46/104 (44%), Gaps = 16/104 (15%)

Query: 1107 DLYFPSINASSIAVKQIVPMMDSSKAYIIAVAEVYFPTEAVSYLQELILDVNSTLYNNPQ 1166
            D+YF        A +++VP    +  Y +A  +++   +   Y +  +  VN  L  +PQ
Sbjct: 160  DIYF--------ADERLVPFDSENSNYGLAKRKIFDLIDTKKYGKPKVYHVNEKLIKDPQ 211

Query: 1167 SP--------LRTLAGLIDNSIPLGSLTLYSSGNEGHVSSLFPS 1202
                      ++  AG     +P+  L L     +GH++SLFP+
Sbjct: 212  ECADNYEKILIKGFAGRDSVKLPMFDLFLLGCAPDGHIASLFPN 255

>AER268W Chr5 (1128915..1129904) [990 bp, 329 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YNR034W (SOL1) and
            YCR073W-A (SOL2)
          Length = 329

 Score = 32.7 bits (73), Expect = 7.7,   Method: Composition-based stats.
 Identities = 25/104 (24%), Positives = 45/104 (43%), Gaps = 16/104 (15%)

Query: 1107 DLYFPSINASSIAVKQIVPMMDSSKAYIIAVAEVYFPTEAVSYLQELILDVNSTLYNNPQ 1166
            D+YF        A +++VP       Y  A  +++   +   Y +  +  +N  L  +PQ
Sbjct: 130  DIYF--------ADERLVPFESPESNYGQAKRQIFDMIDTEHYGEPNVYHINEALIVDPQ 181

Query: 1167 --------SPLRTLAGLIDNSIPLGSLTLYSSGNEGHVSSLFPS 1202
                    + +R  AG     +P+  L L     +GH++SLFP+
Sbjct: 182  ECADDYEKALIRGFAGRDSVKLPMFDLLLLGCAPDGHIASLFPN 225

>Suva_15.311 Chr15 complement(542475..543284) [810 bp, 269 aa] {ON}
            YHR115C (REAL)
          Length = 269

 Score = 32.3 bits (72), Expect = 7.8,   Method: Composition-based stats.
 Identities = 18/77 (23%), Positives = 38/77 (49%), Gaps = 1/77 (1%)

Query: 1279 DCIEKSLGNERKFDSTALSRSSSGNQIFNEKPSGSENESVHSVTDDHYIITGENTVYSTT 1338
            D    S  N+  F    +  + +G+QI   + +    E++  + D ++ +  ++ V S T
Sbjct: 16   DTTSSSAANQGLFFDPIIRTAGAGSQIIIGRYTERVREAISKIPDQYHPVVFKSKVISRT 75

Query: 1339 HGLHYTINDDGDLFYKE 1355
            HG  + ++D G+ F K+
Sbjct: 76   HGC-FKVDDQGNWFLKD 91

>TBLA0I02430 Chr9 (559084..560073) [990 bp, 329 aa] {ON} Anc_6.345
            YCR073W-A
          Length = 329

 Score = 32.3 bits (72), Expect = 8.6,   Method: Compositional matrix adjust.
 Identities = 27/119 (22%), Positives = 51/119 (42%), Gaps = 17/119 (14%)

Query: 1106 MDLYFPSINASSIAVKQIVPMMDSSKAYIIAVAEVYFPTEAVSYLQELILDVNSTLYNNP 1165
             D+YF        A +++VP       Y  A  +++   +   Y +  I  +   L ++P
Sbjct: 122  WDIYF--------ADERLVPFDSQDSNYGQAKRKIFDLIDTEKYGEPNIYHIEEDLISDP 173

Query: 1166 QSP--------LRTLAGLIDNSIPLGSLTLYSSGNEGHVSSLFPSGVLDSSKENSKGIV 1216
            Q          ++  AG     +P+  L L     +GH++SLFP+   +S +EN   ++
Sbjct: 174  QECADRYEKVLIKGFAGRDSVKLPMFDLFLLGCAPDGHIASLFPN-FQESLRENLAWVI 231

>Smik_3.174 Chr3 (246682..247620) [939 bp, 312 aa] {ON} YCR073W-A
            (REAL)
          Length = 312

 Score = 32.3 bits (72), Expect = 8.7,   Method: Composition-based stats.
 Identities = 24/104 (23%), Positives = 45/104 (43%), Gaps = 16/104 (15%)

Query: 1107 DLYFPSINASSIAVKQIVPMMDSSKAYIIAVAEVYFPTEAVSYLQELILDVNSTLYNNPQ 1166
            D+YF        A +++VP   +   Y  A  ++    +   Y    +  ++ +L ++PQ
Sbjct: 117  DIYF--------ADERLVPFSSNESNYGCAKRKILDLIDTAKYGTPKVYHIDESLIDDPQ 168

Query: 1167 SP--------LRTLAGLIDNSIPLGSLTLYSSGNEGHVSSLFPS 1202
                      +R  AG     +P+  L L     +GH++SLFP+
Sbjct: 169  ECADNYEKVLIRGFAGRDSVKLPMFDLFLLGCAPDGHIASLFPN 212

>ZYRO0D08096g Chr4 complement(701552..702469) [918 bp, 305 aa] {ON}
            similar to uniprot|P50278 Saccharomyces cerevisiae
            YNR034W
          Length = 305

 Score = 32.3 bits (72), Expect = 8.8,   Method: Composition-based stats.
 Identities = 24/104 (23%), Positives = 45/104 (43%), Gaps = 16/104 (15%)

Query: 1107 DLYFPSINASSIAVKQIVPMMDSSKAYIIAVAEVYFPTEAVSYLQELILDVNSTLYNNPQ 1166
            D+YF        A +++VP       +  A  +++   +   Y +  +  VN  L ++PQ
Sbjct: 109  DIYF--------ADERLVPFESGESNFGQAKRKIFDLIDVEKYGKPNVFHVNEKLISDPQ 160

Query: 1167 SP--------LRTLAGLIDNSIPLGSLTLYSSGNEGHVSSLFPS 1202
                      ++  AG     +P+  L L     +GH++SLFP+
Sbjct: 161  ECADNYEKVLIKGFAGRDSVKLPMFDLLLLGCAPDGHIASLFPN 204

>YCR073W-A Chr3 (246963..247910) [948 bp, 315 aa] {ON}  SOL2Protein
            with a possible role in tRNA export; shows similarity to
            6-phosphogluconolactonase non-catalytic domains but does
            not exhibit this enzymatic activity; homologous to Sol1p,
            Sol3p, and Sol4p
          Length = 315

 Score = 32.3 bits (72), Expect = 9.6,   Method: Composition-based stats.
 Identities = 24/104 (23%), Positives = 45/104 (43%), Gaps = 16/104 (15%)

Query: 1107 DLYFPSINASSIAVKQIVPMMDSSKAYIIAVAEVYFPTEAVSYLQELILDVNSTLYNNPQ 1166
            D+YF        A +++VP   +   Y  A  ++    +   Y    +  ++ +L ++PQ
Sbjct: 117  DIYF--------ADERLVPFSSNESNYGCAKRKILDLIDTAKYGTPKVYHIDESLIDDPQ 168

Query: 1167 SP--------LRTLAGLIDNSIPLGSLTLYSSGNEGHVSSLFPS 1202
                      +R  AG     +P+  L L     +GH++SLFP+
Sbjct: 169  ECADNYEKVLIRGFAGRDSVKLPMFDLFLLGCAPDGHIASLFPN 212

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.306    0.121    0.325 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 134,802,304
Number of extensions: 5630390
Number of successful extensions: 40584
Number of sequences better than 10.0: 823
Number of HSP's gapped: 36442
Number of HSP's successfully gapped: 3505
Length of query: 1555
Length of database: 53,481,399
Length adjustment: 123
Effective length of query: 1432
Effective length of database: 39,377,481
Effective search space: 56388552792
Effective search space used: 56388552792
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.6 bits)
S2: 73 (32.7 bits)