Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Smik_4.6385.442ON34634618190.0
YDR372C (VPS74)5.442ON34534717270.0
Skud_4.6415.442ON34634617270.0
Suva_2.5445.442ON34634617050.0
TDEL0D025905.442ON33034614330.0
KAFR0D050605.442ON32634914130.0
CAGL0A02926g5.442ON32834614050.0
KNAG0B042005.442ON34434813920.0
SAKL0G02706g5.442ON33234613740.0
NCAS0F034305.442ON33234813610.0
KLTH0F15884g5.442ON32934613500.0
ZYRO0F10208g5.442ON33234613480.0
Kwal_55.213995.442ON32934613310.0
NDAI0B057205.442ON36536713300.0
Kpol_1016.25.442ON32834613250.0
TBLA0A064805.442ON33435213230.0
Ecym_45135.442ON33334413160.0
KLLA0E02355g5.442ON32434413050.0
ACL165C5.442ON33134412491e-173
TPHA0J026105.442ON32934712231e-169
Kpol_1062.245.442ON2762739171e-123
TBLA0A027805.442ON3873048661e-114
NCAS0H020905.442ON3452845973e-74
KAFR0C051107.39ON89174830.11
ZYRO0F02794g8.24ON17376692.2
KLTH0E09504g2.396ON38523684.6
TDEL0C048103.339ON142055695.3
Skud_5.481.485ON51780676.7
NCAS0A025604.267ON94175669.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Smik_4.638
         (346 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Smik_4.638 Chr4 complement(1141194..1142234) [1041 bp, 346 aa] {...   705   0.0  
YDR372C Chr4 complement(1221112..1222149) [1038 bp, 345 aa] {ON}...   669   0.0  
Skud_4.641 Chr4 complement(1144004..1145044) [1041 bp, 346 aa] {...   669   0.0  
Suva_2.544 Chr2 complement(971735..972775) [1041 bp, 346 aa] {ON...   661   0.0  
TDEL0D02590 Chr4 (497351..498343) [993 bp, 330 aa] {ON} Anc_5.44...   556   0.0  
KAFR0D05060 Chr4 complement(994966..995946) [981 bp, 326 aa] {ON...   548   0.0  
CAGL0A02926g Chr1 complement(304789..305775) [987 bp, 328 aa] {O...   545   0.0  
KNAG0B04200 Chr2 (799881..800915) [1035 bp, 344 aa] {ON} Anc_5.4...   540   0.0  
SAKL0G02706g Chr7 complement(222134..223132) [999 bp, 332 aa] {O...   533   0.0  
NCAS0F03430 Chr6 complement(690870..691868) [999 bp, 332 aa] {ON...   528   0.0  
KLTH0F15884g Chr6 (1292767..1293756) [990 bp, 329 aa] {ON} highl...   524   0.0  
ZYRO0F10208g Chr6 complement(824737..825735) [999 bp, 332 aa] {O...   523   0.0  
Kwal_55.21399 s55 (820851..821840) [990 bp, 329 aa] {ON} YDR372C...   517   0.0  
NDAI0B05720 Chr2 complement(1391179..1392276) [1098 bp, 365 aa] ...   516   0.0  
Kpol_1016.2 s1016 (4946..5932) [987 bp, 328 aa] {ON} (4946..5932...   514   0.0  
TBLA0A06480 Chr1 (1593225..1594229) [1005 bp, 334 aa] {ON} Anc_5...   514   0.0  
Ecym_4513 Chr4 complement(1023828..1024829) [1002 bp, 333 aa] {O...   511   0.0  
KLLA0E02355g Chr5 complement(217222..218196) [975 bp, 324 aa] {O...   507   0.0  
ACL165C Chr3 complement(66499..67494) [996 bp, 331 aa] {ON} Synt...   485   e-173
TPHA0J02610 Chr10 complement(579213..580202) [990 bp, 329 aa] {O...   475   e-169
Kpol_1062.24 s1062 (55671..56501) [831 bp, 276 aa] {ON} (55671.....   357   e-123
TBLA0A02780 Chr1 (670848..672011) [1164 bp, 387 aa] {ON} Anc_5.4...   338   e-114
NCAS0H02090 Chr8 complement(405561..406598) [1038 bp, 345 aa] {O...   234   3e-74
KAFR0C05110 Chr3 (1013807..1016482) [2676 bp, 891 aa] {ON} Anc_7...    37   0.11 
ZYRO0F02794g Chr6 (237327..237848) [522 bp, 173 aa] {ON} similar...    31   2.2  
KLTH0E09504g Chr5 complement(860113..861270) [1158 bp, 385 aa] {...    31   4.6  
TDEL0C04810 Chr3 (867670..871932) [4263 bp, 1420 aa] {ON} Anc_3....    31   5.3  
Skud_5.48 Chr5 (71966..73519) [1554 bp, 517 aa] {ON} YEL042W (REAL)    30   6.7  
NCAS0A02560 Chr1 (487074..489899) [2826 bp, 941 aa] {ON} Anc_4.2...    30   9.8  

>Smik_4.638 Chr4 complement(1141194..1142234) [1041 bp, 346 aa] {ON}
           YDR372C (REAL)
          Length = 346

 Score =  705 bits (1819), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 346/346 (100%), Positives = 346/346 (100%)

Query: 1   MSTLQRRRVNRADSGDTSSMQPSANNINAKGDKIASVAVDDDDNGTNKKIAYDPEESKLR 60
           MSTLQRRRVNRADSGDTSSMQPSANNINAKGDKIASVAVDDDDNGTNKKIAYDPEESKLR
Sbjct: 1   MSTLQRRRVNRADSGDTSSMQPSANNINAKGDKIASVAVDDDDNGTNKKIAYDPEESKLR 60

Query: 61  DNINIPTLTLMEEVLLMGLRDREGYLSFWNDSISYALRGCIIIELALRGKIRILDDSARK 120
           DNINIPTLTLMEEVLLMGLRDREGYLSFWNDSISYALRGCIIIELALRGKIRILDDSARK
Sbjct: 61  DNINIPTLTLMEEVLLMGLRDREGYLSFWNDSISYALRGCIIIELALRGKIRILDDSARK 120

Query: 121 RFDLSERLIEVIDGSKTGEVLLDETLQLMKNDEPLTISNWIDLLSGETWNLLKINYQLKQ 180
           RFDLSERLIEVIDGSKTGEVLLDETLQLMKNDEPLTISNWIDLLSGETWNLLKINYQLKQ
Sbjct: 121 RFDLSERLIEVIDGSKTGEVLLDETLQLMKNDEPLTISNWIDLLSGETWNLLKINYQLKQ 180

Query: 181 VRERLAKGLVDKGVLRTEMKNFFLFDMATHPIADASCKEAIKRRVLSVLVSRNMELSYNE 240
           VRERLAKGLVDKGVLRTEMKNFFLFDMATHPIADASCKEAIKRRVLSVLVSRNMELSYNE
Sbjct: 181 VRERLAKGLVDKGVLRTEMKNFFLFDMATHPIADASCKEAIKRRVLSVLVSRNMELSYNE 240

Query: 241 YFPETTSFKIIRTLALICGSYGANVLENVLTTLEYEKRDKAISRAEEIMAQFSQFPFDLE 300
           YFPETTSFKIIRTLALICGSYGANVLENVLTTLEYEKRDKAISRAEEIMAQFSQFPFDLE
Sbjct: 241 YFPETTSFKIIRTLALICGSYGANVLENVLTTLEYEKRDKAISRAEEIMAQFSQFPFDLE 300

Query: 301 KETELGISVNLNKEVKEEMESNPGHNLQLEVIAGVFEVFSRMDMLL 346
           KETELGISVNLNKEVKEEMESNPGHNLQLEVIAGVFEVFSRMDMLL
Sbjct: 301 KETELGISVNLNKEVKEEMESNPGHNLQLEVIAGVFEVFSRMDMLL 346

>YDR372C Chr4 complement(1221112..1222149) [1038 bp, 345 aa] {ON}
           VPS74Protein required for Golgi localization of
           glycosyltransferases; binds the cytosolic domains of
           Golgi glycosyltransferases; binding to PtdIns4P required
           for Golgi targeting and function; tetramer formation
           required for function
          Length = 345

 Score =  669 bits (1727), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 331/347 (95%), Positives = 340/347 (97%), Gaps = 3/347 (0%)

Query: 1   MSTLQRRRVNRADSGDTSSMQPSANNINAKGDKIASVAVD-DDDNGTNKKIAYDPEESKL 59
           MSTLQRRRVNRADSGDTSS+  SANN   KGDKIA++AVD DDDNGTNKKIAYDPEESKL
Sbjct: 1   MSTLQRRRVNRADSGDTSSIHSSANN--TKGDKIANIAVDGDDDNGTNKKIAYDPEESKL 58

Query: 60  RDNINIPTLTLMEEVLLMGLRDREGYLSFWNDSISYALRGCIIIELALRGKIRILDDSAR 119
           RDNINIPTLTLMEEVLLMGLRDREGYLSFWNDSISYALRGCIIIELALRGKIRILDDSAR
Sbjct: 59  RDNINIPTLTLMEEVLLMGLRDREGYLSFWNDSISYALRGCIIIELALRGKIRILDDSAR 118

Query: 120 KRFDLSERLIEVIDGSKTGEVLLDETLQLMKNDEPLTISNWIDLLSGETWNLLKINYQLK 179
           KRFDLSERLIEVID SKTGEVLLDETLQLMKNDEPL+ISNWIDLLSGETWNLLKINYQLK
Sbjct: 119 KRFDLSERLIEVIDSSKTGEVLLDETLQLMKNDEPLSISNWIDLLSGETWNLLKINYQLK 178

Query: 180 QVRERLAKGLVDKGVLRTEMKNFFLFDMATHPIADASCKEAIKRRVLSVLVSRNMELSYN 239
           QVRERLAKGLVDKGVLRTEMKNFFLFDMATHPIADASCKEAIKRRVLSVLVSRNMELSYN
Sbjct: 179 QVRERLAKGLVDKGVLRTEMKNFFLFDMATHPIADASCKEAIKRRVLSVLVSRNMELSYN 238

Query: 240 EYFPETTSFKIIRTLALICGSYGANVLENVLTTLEYEKRDKAISRAEEIMAQFSQFPFDL 299
           EYFPETTSFKIIRTLALICGSYGANVLENVLTTLEYEKRDKAISRAEEIMAQFSQ+PFDL
Sbjct: 239 EYFPETTSFKIIRTLALICGSYGANVLENVLTTLEYEKRDKAISRAEEIMAQFSQYPFDL 298

Query: 300 EKETELGISVNLNKEVKEEMESNPGHNLQLEVIAGVFEVFSRMDMLL 346
           EKETELG+SVNLNKEVKEE+E+NPGH+LQLEVIAGVFEVFSRMDMLL
Sbjct: 299 EKETELGVSVNLNKEVKEEIENNPGHDLQLEVIAGVFEVFSRMDMLL 345

>Skud_4.641 Chr4 complement(1144004..1145044) [1041 bp, 346 aa] {ON}
           YDR372C (REAL)
          Length = 346

 Score =  669 bits (1727), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 324/346 (93%), Positives = 339/346 (97%)

Query: 1   MSTLQRRRVNRADSGDTSSMQPSANNINAKGDKIASVAVDDDDNGTNKKIAYDPEESKLR 60
           MSTLQRRRVNRADSGDTSSMQ  +NN N+KGDKIA++ +DDDD+G NKKIAYDPEESKLR
Sbjct: 1   MSTLQRRRVNRADSGDTSSMQSMSNNDNSKGDKIANIGIDDDDSGANKKIAYDPEESKLR 60

Query: 61  DNINIPTLTLMEEVLLMGLRDREGYLSFWNDSISYALRGCIIIELALRGKIRILDDSARK 120
           DNI IPTLTLMEEVLLMGLRDREGYLSFWNDSISYALRGCI+IELALRGKIRILDDSARK
Sbjct: 61  DNIKIPTLTLMEEVLLMGLRDREGYLSFWNDSISYALRGCILIELALRGKIRILDDSARK 120

Query: 121 RFDLSERLIEVIDGSKTGEVLLDETLQLMKNDEPLTISNWIDLLSGETWNLLKINYQLKQ 180
           RFDLSERL+EV+DGSKTGEVLLDETLQLMKNDEPLTISNWIDLLSGETWNLLKINYQLKQ
Sbjct: 121 RFDLSERLVEVVDGSKTGEVLLDETLQLMKNDEPLTISNWIDLLSGETWNLLKINYQLKQ 180

Query: 181 VRERLAKGLVDKGVLRTEMKNFFLFDMATHPIADASCKEAIKRRVLSVLVSRNMELSYNE 240
           VRERLAKGLVDKGVLRTEMKNFFLFDMATHPIADASCKEAIKRRVLSVLVSRNMELSYNE
Sbjct: 181 VRERLAKGLVDKGVLRTEMKNFFLFDMATHPIADASCKEAIKRRVLSVLVSRNMELSYNE 240

Query: 241 YFPETTSFKIIRTLALICGSYGANVLENVLTTLEYEKRDKAISRAEEIMAQFSQFPFDLE 300
           YFPETTSFKIIRTLALICGSYGANVLENVLTTLEYEKRDKAI+RAEEIMAQFSQ+PFDLE
Sbjct: 241 YFPETTSFKIIRTLALICGSYGANVLENVLTTLEYEKRDKAINRAEEIMAQFSQYPFDLE 300

Query: 301 KETELGISVNLNKEVKEEMESNPGHNLQLEVIAGVFEVFSRMDMLL 346
           KETELG+SVNLNKEVKEE+E+N GH+LQLEVIAGVFEVFSRMDMLL
Sbjct: 301 KETELGVSVNLNKEVKEEIENNTGHDLQLEVIAGVFEVFSRMDMLL 346

>Suva_2.544 Chr2 complement(971735..972775) [1041 bp, 346 aa] {ON}
           YDR372C (REAL)
          Length = 346

 Score =  661 bits (1705), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 321/346 (92%), Positives = 336/346 (97%)

Query: 1   MSTLQRRRVNRADSGDTSSMQPSANNINAKGDKIASVAVDDDDNGTNKKIAYDPEESKLR 60
           MSTLQRRRVNRADSGDTSSMQ ++NN N+ GDK ++  VD DDNG NKKIAYDPEESKLR
Sbjct: 1   MSTLQRRRVNRADSGDTSSMQSTSNNHNSSGDKTSNGPVDGDDNGINKKIAYDPEESKLR 60

Query: 61  DNINIPTLTLMEEVLLMGLRDREGYLSFWNDSISYALRGCIIIELALRGKIRILDDSARK 120
           DNI IPTLTLMEEVLLMGLRDREGYLSFWNDSISYALRGCI+IELALRGKIRILDDSARK
Sbjct: 61  DNIKIPTLTLMEEVLLMGLRDREGYLSFWNDSISYALRGCILIELALRGKIRILDDSARK 120

Query: 121 RFDLSERLIEVIDGSKTGEVLLDETLQLMKNDEPLTISNWIDLLSGETWNLLKINYQLKQ 180
           RFDLSERL+EVIDGSKTGEVLLDETLQLMKNDEPLTISNWIDLLSGETWNLLKINYQLKQ
Sbjct: 121 RFDLSERLVEVIDGSKTGEVLLDETLQLMKNDEPLTISNWIDLLSGETWNLLKINYQLKQ 180

Query: 181 VRERLAKGLVDKGVLRTEMKNFFLFDMATHPIADASCKEAIKRRVLSVLVSRNMELSYNE 240
           VRERLAKGLVDKGVLRTEMKNFFLFDMATHPIADASCKEAIKRRVLSVLVSRNMELSYNE
Sbjct: 181 VRERLAKGLVDKGVLRTEMKNFFLFDMATHPIADASCKEAIKRRVLSVLVSRNMELSYNE 240

Query: 241 YFPETTSFKIIRTLALICGSYGANVLENVLTTLEYEKRDKAISRAEEIMAQFSQFPFDLE 300
           YFPETTSFKIIRTLALICGSYGANVLENVLTTLEYEKRDKAISRAEEIM+ FSQ+PFDLE
Sbjct: 241 YFPETTSFKIIRTLALICGSYGANVLENVLTTLEYEKRDKAISRAEEIMSHFSQYPFDLE 300

Query: 301 KETELGISVNLNKEVKEEMESNPGHNLQLEVIAGVFEVFSRMDMLL 346
           K+T+LG+SVNLNKEVKEE+E+NPGH+LQLEVIAGVFEVFSRMDMLL
Sbjct: 301 KDTDLGVSVNLNKEVKEEIENNPGHDLQLEVIAGVFEVFSRMDMLL 346

>TDEL0D02590 Chr4 (497351..498343) [993 bp, 330 aa] {ON} Anc_5.442
           YDR372C
          Length = 330

 Score =  556 bits (1433), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 269/346 (77%), Positives = 304/346 (87%), Gaps = 16/346 (4%)

Query: 1   MSTLQRRRVNRADSGDTSSMQPSANNINAKGDKIASVAVDDDDNGTNKKIAYDPEESKLR 60
           MS LQRRRVNR DSGD SS+Q S  N                +  T+K++AYDPEE+K+ 
Sbjct: 1   MSNLQRRRVNRVDSGDESSLQASEFN----------------ETTTSKRVAYDPEEAKIT 44

Query: 61  DNINIPTLTLMEEVLLMGLRDREGYLSFWNDSISYALRGCIIIELALRGKIRILDDSARK 120
           +N+  P LTLMEEVLL+GLRD+EGYLSFWND+ISYALRGCIIIELALRGKIRI+DDSARK
Sbjct: 45  ENVKNPKLTLMEEVLLLGLRDKEGYLSFWNDNISYALRGCIIIELALRGKIRIIDDSARK 104

Query: 121 RFDLSERLIEVIDGSKTGEVLLDETLQLMKNDEPLTISNWIDLLSGETWNLLKINYQLKQ 180
           RFD+SERLIEV+D SKTGEVLLDETLQLMK DEPLTI+NWIDLLSGETWNLLKINYQLKQ
Sbjct: 105 RFDVSERLIEVVDASKTGEVLLDETLQLMKYDEPLTIANWIDLLSGETWNLLKINYQLKQ 164

Query: 181 VRERLAKGLVDKGVLRTEMKNFFLFDMATHPIADASCKEAIKRRVLSVLVSRNMELSYNE 240
           VRERLAKGLVDKGVLRTEMKNFFLFDMATHP+ D SCKEA+KRRVLSVLVSRNMELSYNE
Sbjct: 165 VRERLAKGLVDKGVLRTEMKNFFLFDMATHPVTDTSCKEALKRRVLSVLVSRNMELSYNE 224

Query: 241 YFPETTSFKIIRTLALICGSYGANVLENVLTTLEYEKRDKAISRAEEIMAQFSQFPFDLE 300
           YFP+TTSFK+IRT+ALICGSY ANVLENVLT+L+YEKRD+A+SRA+EI+ Q++Q+PFDL+
Sbjct: 225 YFPDTTSFKLIRTIALICGSYRANVLENVLTSLDYEKRDRALSRADEILEQYTQYPFDLD 284

Query: 301 KETELGISVNLNKEVKEEMESNPGHNLQLEVIAGVFEVFSRMDMLL 346
           K TE G+S+NLNKEVKEE+  N    LQLEV+AGVFEVFSRMDMLL
Sbjct: 285 KATESGLSINLNKEVKEELSQNKDCPLQLEVVAGVFEVFSRMDMLL 330

>KAFR0D05060 Chr4 complement(994966..995946) [981 bp, 326 aa] {ON}
           Anc_5.442 YDR372C
          Length = 326

 Score =  548 bits (1413), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 270/349 (77%), Positives = 297/349 (85%), Gaps = 26/349 (7%)

Query: 1   MSTLQRRRVNRADSGDTSSMQPSANNINAKGDKIASVAVDDDDN---GTNKKIAYDPEES 57
           MSTLQRRR NR+DS                         DD +N     ++K+AYDPEE+
Sbjct: 1   MSTLQRRRKNRSDSN-----------------------ADDSENVSESQDRKVAYDPEEA 37

Query: 58  KLRDNINIPTLTLMEEVLLMGLRDREGYLSFWNDSISYALRGCIIIELALRGKIRILDDS 117
           KLRDN++IP LTLMEEVLLMGLRDREGYLSFWND+ISYALRGCI+IELALR KIRILDDS
Sbjct: 38  KLRDNVSIPKLTLMEEVLLMGLRDREGYLSFWNDNISYALRGCILIELALRNKIRILDDS 97

Query: 118 ARKRFDLSERLIEVIDGSKTGEVLLDETLQLMKNDEPLTISNWIDLLSGETWNLLKINYQ 177
           ARKRFD+SERL+EVIDGSKTGEVLLDE LQLMKNDEPLTI+NWIDLLSGETWNLLKINYQ
Sbjct: 98  ARKRFDVSERLVEVIDGSKTGEVLLDEALQLMKNDEPLTIANWIDLLSGETWNLLKINYQ 157

Query: 178 LKQVRERLAKGLVDKGVLRTEMKNFFLFDMATHPIADASCKEAIKRRVLSVLVSRNMELS 237
           LKQVRERLAKGLVDKGVLRTEMKNFFLFDMATHP+ D SCKEAIKRR+LS LVSRNMEL+
Sbjct: 158 LKQVRERLAKGLVDKGVLRTEMKNFFLFDMATHPVTDTSCKEAIKRRILSALVSRNMELN 217

Query: 238 YNEYFPETTSFKIIRTLALICGSYGANVLENVLTTLEYEKRDKAISRAEEIMAQFSQFPF 297
           YN YF ETTSFK IR +AL+C SYGANVLENVL++L+YEKRD+AISRAEEI+AQF+Q+PF
Sbjct: 218 YNSYFAETTSFKYIRIVALVCCSYGANVLENVLSSLDYEKRDRAISRAEEILAQFAQYPF 277

Query: 298 DLEKETELGISVNLNKEVKEEMESNPGHNLQLEVIAGVFEVFSRMDMLL 346
           DL K TELGISVNLNKEV+ E+  NP   LQLEVIAGV EVFSRMDMLL
Sbjct: 278 DLSKNTELGISVNLNKEVENEVNENPQFTLQLEVIAGVIEVFSRMDMLL 326

>CAGL0A02926g Chr1 complement(304789..305775) [987 bp, 328 aa] {ON}
           highly similar to uniprot|Q06385 Saccharomyces
           cerevisiae YDR372c
          Length = 328

 Score =  545 bits (1405), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 266/346 (76%), Positives = 309/346 (89%), Gaps = 18/346 (5%)

Query: 1   MSTLQRRRVNRADSGDTSSMQPSANNINAKGDKIASVAVDDDDNGTNKKIAYDPEESKLR 60
           MSTLQRRRVN++++        ++N I  +          +DD  ++ KIAYDPEESKL+
Sbjct: 1   MSTLQRRRVNKSEN--------ASNGIEDR----------EDDGTSSGKIAYDPEESKLQ 42

Query: 61  DNINIPTLTLMEEVLLMGLRDREGYLSFWNDSISYALRGCIIIELALRGKIRILDDSARK 120
           ++   PTLTLMEEVLLMGLRDREGYLSFWNDSISYALRGCI+IELALR KIRILD  AR 
Sbjct: 43  NDSKQPTLTLMEEVLLMGLRDREGYLSFWNDSISYALRGCILIELALRNKIRILDAPARM 102

Query: 121 RFDLSERLIEVIDGSKTGEVLLDETLQLMKNDEPLTISNWIDLLSGETWNLLKINYQLKQ 180
           RFD+SERLIEVID SKTGEVLLDETLQLM NDEPL+I+NWIDLLSGETWNLLKINYQLKQ
Sbjct: 103 RFDISERLIEVIDSSKTGEVLLDETLQLMVNDEPLSIANWIDLLSGETWNLLKINYQLKQ 162

Query: 181 VRERLAKGLVDKGVLRTEMKNFFLFDMATHPIADASCKEAIKRRVLSVLVSRNMELSYNE 240
           VRERLAKGLVDKGVLRTEMKNFFLFDMATHP++D+SCKEAIKRR+LSVLVSRNME+SYN 
Sbjct: 163 VRERLAKGLVDKGVLRTEMKNFFLFDMATHPVSDSSCKEAIKRRILSVLVSRNMEISYNS 222

Query: 241 YFPETTSFKIIRTLALICGSYGANVLENVLTTLEYEKRDKAISRAEEIMAQFSQFPFDLE 300
           YFPE+T+FK+IRT++LI G+YGANVLENV+++LEY+KRDKAI+RAEEI+AQFSQ+PFDL+
Sbjct: 223 YFPESTNFKLIRTVSLIAGAYGANVLENVISSLEYDKRDKAITRAEEILAQFSQYPFDLQ 282

Query: 301 KETELGISVNLNKEVKEEMESNPGHNLQLEVIAGVFEVFSRMDMLL 346
           KE++ GISVNLNKE++EE+ESNPG +L+LEVIAGVFEVFSRMDMLL
Sbjct: 283 KESKDGISVNLNKELQEELESNPGSDLKLEVIAGVFEVFSRMDMLL 328

>KNAG0B04200 Chr2 (799881..800915) [1035 bp, 344 aa] {ON} Anc_5.442
           YDR372C
          Length = 344

 Score =  540 bits (1392), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 259/348 (74%), Positives = 304/348 (87%), Gaps = 6/348 (1%)

Query: 1   MSTLQRRRVNRADS--GDTSSMQPSANNINAKGDKIASVAVDDDDNGTNKKIAYDPEESK 58
           MSTLQRRRVNR+DS  G+T S   +A   +A  D        ++ +G  +K+AYDPEE+K
Sbjct: 1   MSTLQRRRVNRSDSNEGETVSGGKTAAAPSASND----AEEYEETSGPTRKVAYDPEEAK 56

Query: 59  LRDNINIPTLTLMEEVLLMGLRDREGYLSFWNDSISYALRGCIIIELALRGKIRILDDSA 118
           LRDN  +P LTLMEEVLLMGLRDREGYLSFWND+ISYALRGCI+IELALR KIRILDDSA
Sbjct: 57  LRDNYTVPKLTLMEEVLLMGLRDREGYLSFWNDNISYALRGCIMIELALRKKIRILDDSA 116

Query: 119 RKRFDLSERLIEVIDGSKTGEVLLDETLQLMKNDEPLTISNWIDLLSGETWNLLKINYQL 178
           RKRFD+SERL+EV+DGSKTGEVLLDETLQLMKNDEPLTI+NWIDLLSGETWNL+KINYQL
Sbjct: 117 RKRFDISERLVEVVDGSKTGEVLLDETLQLMKNDEPLTIANWIDLLSGETWNLMKINYQL 176

Query: 179 KQVRERLAKGLVDKGVLRTEMKNFFLFDMATHPIADASCKEAIKRRVLSVLVSRNMELSY 238
           KQVRERLAKGLVDKGVLRTEMKNFFLFDMATHP+ D+SCKEAIKRR+LS +VSRNMELS+
Sbjct: 177 KQVRERLAKGLVDKGVLRTEMKNFFLFDMATHPVTDSSCKEAIKRRILSTVVSRNMELSF 236

Query: 239 NEYFPETTSFKIIRTLALICGSYGANVLENVLTTLEYEKRDKAISRAEEIMAQFSQFPFD 298
           N YFPE+TSFK IRT+AL+C +YGA+VLENVL++L+YE+RD+A+SRAEE++ +F Q+PFD
Sbjct: 237 NSYFPESTSFKYIRTVALVCSTYGASVLENVLSSLDYEQRDRAVSRAEELLEKFGQYPFD 296

Query: 299 LEKETELGISVNLNKEVKEEMESNPGHNLQLEVIAGVFEVFSRMDMLL 346
           LEK+ + GIS NLNKE + E++ +P   L LEV+AGV EVFSRMDMLL
Sbjct: 297 LEKQGDSGISCNLNKEAQREVDESPNSALYLEVVAGVIEVFSRMDMLL 344

>SAKL0G02706g Chr7 complement(222134..223132) [999 bp, 332 aa] {ON}
           highly similar to uniprot|Q06385 Saccharomyces
           cerevisiae YDR372C VPS74
          Length = 332

 Score =  533 bits (1374), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 260/346 (75%), Positives = 299/346 (86%), Gaps = 14/346 (4%)

Query: 1   MSTLQRRRVNRADSGDTSSMQPSANNINAKGDKIASVAVDDDDNGTNKKIAYDPEESKLR 60
           MS LQRRRVNR +S D +    ++++ N             D+N  ++K+AYDPEE+KL+
Sbjct: 1   MSGLQRRRVNRTNS-DYAEQPITSSDSN-------------DENAKDRKVAYDPEEAKLK 46

Query: 61  DNINIPTLTLMEEVLLMGLRDREGYLSFWNDSISYALRGCIIIELALRGKIRILDDSARK 120
           +N  +P LTLMEEVLLMGL+D+EGYLSFWND+ISYALRGCI+IELALR KIR+LDD ARK
Sbjct: 47  ENTTVPKLTLMEEVLLMGLKDKEGYLSFWNDNISYALRGCILIELALRDKIRVLDDPARK 106

Query: 121 RFDLSERLIEVIDGSKTGEVLLDETLQLMKNDEPLTISNWIDLLSGETWNLLKINYQLKQ 180
           RFD+S+RLIEVIDGSKTGEVLLDE L L+KNDEPL I+NWIDLLSGETWNLLKINYQLKQ
Sbjct: 107 RFDVSDRLIEVIDGSKTGEVLLDEALNLIKNDEPLPIANWIDLLSGETWNLLKINYQLKQ 166

Query: 181 VRERLAKGLVDKGVLRTEMKNFFLFDMATHPIADASCKEAIKRRVLSVLVSRNMELSYNE 240
           VRERLAKGLVDKGVLRTEMKNFFLFDMATHPI D SCKEAIKRRVLSVLVSRNMEL+YNE
Sbjct: 167 VRERLAKGLVDKGVLRTEMKNFFLFDMATHPITDTSCKEAIKRRVLSVLVSRNMELNYNE 226

Query: 241 YFPETTSFKIIRTLALICGSYGANVLENVLTTLEYEKRDKAISRAEEIMAQFSQFPFDLE 300
           YF E  +FKIIRTL+LICG+YGANVLENVL +L+Y+KRD+A SRA+EI+AQFS+FPF L+
Sbjct: 227 YFSENITFKIIRTLSLICGAYGANVLENVLASLDYDKRDRAFSRADEILAQFSEFPFALD 286

Query: 301 KETELGISVNLNKEVKEEMESNPGHNLQLEVIAGVFEVFSRMDMLL 346
           K TE GISVNLNKEV+ E+  NPG +LQLEV+AGVFEVFSRMD LL
Sbjct: 287 KATESGISVNLNKEVQAEIAQNPGKDLQLEVVAGVFEVFSRMDTLL 332

>NCAS0F03430 Chr6 complement(690870..691868) [999 bp, 332 aa] {ON}
           Anc_5.442 YDR372C
          Length = 332

 Score =  528 bits (1361), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 260/348 (74%), Positives = 304/348 (87%), Gaps = 18/348 (5%)

Query: 1   MSTLQRRRVNRADS-GDTSSMQPSANNINAKGDKIASVAVDDDDNGTNKKIAYDPEESKL 59
           MSTLQRRRVN+ DS  +T S+ P     N + D        D+DN    K+AYDPEE+++
Sbjct: 1   MSTLQRRRVNKDDSDNETGSVTP-----NVERDS-------DNDN----KVAYDPEEARM 44

Query: 60  RD-NINIPTLTLMEEVLLMGLRDREGYLSFWNDSISYALRGCIIIELALRGKIRILDDSA 118
           R+    +P LTLMEEVLLMGLRD+EGYLSFWND+ISYALRGCI+IELALRGKI+ILDDSA
Sbjct: 45  RNVGGQVPVLTLMEEVLLMGLRDKEGYLSFWNDNISYALRGCILIELALRGKIQILDDSA 104

Query: 119 RKRFDLSERLIEVIDGSKTGEVLLDETLQLMKNDEPLTISNWIDLLSGETWNLLKINYQL 178
           RKRF+LSERL++VIDG+KTGEVLLDETLQLMKNDEPL+I++WIDLLSGETWN++KINYQL
Sbjct: 105 RKRFELSERLVQVIDGTKTGEVLLDETLQLMKNDEPLSIASWIDLLSGETWNIMKINYQL 164

Query: 179 KQVRERLAKGLVDKGVLRTEMKNFFLFDMATHPIADASCKEAIKRRVLSVLVSRNMELSY 238
           KQVRERLAKGLVDKGVLRTEMKNFFLFDMATHP+ D+SCKEAIKRRVLS+LVSRNMELSY
Sbjct: 165 KQVRERLAKGLVDKGVLRTEMKNFFLFDMATHPVTDSSCKEAIKRRVLSILVSRNMELSY 224

Query: 239 NEYFPETTSFKIIRTLALICGSYGANVLENVLTTLEYEKRDKAISRAEEIMAQFSQFPFD 298
           N YFPETT FKIIRT+ALICG+YGANVLEN+L +L++E  D AI+RA+E++AQFS+FPFD
Sbjct: 225 NNYFPETTRFKIIRTIALICGAYGANVLENLLGSLDFEMSDNAIARADELIAQFSKFPFD 284

Query: 299 LEKETELGISVNLNKEVKEEMESNPGHNLQLEVIAGVFEVFSRMDMLL 346
           LE  T LGISVNLN+EV++E+   PG++LQLEVIAGV EVFSRMD LL
Sbjct: 285 LETPTALGISVNLNREVQQELADTPGYDLQLEVIAGVIEVFSRMDTLL 332

>KLTH0F15884g Chr6 (1292767..1293756) [990 bp, 329 aa] {ON} highly
           similar to uniprot|Q06385 Saccharomyces cerevisiae
           YDR372C VPS74
          Length = 329

 Score =  524 bits (1350), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 253/346 (73%), Positives = 296/346 (85%), Gaps = 17/346 (4%)

Query: 1   MSTLQRRRVNRADSGDTSSMQPSANNINAKGDKIASVAVDDDDNGTNKKIAYDPEESKLR 60
           MS LQRRRVN+++S   SS  P                V+D+ +G  K++AYDPEE+KLR
Sbjct: 1   MSGLQRRRVNKSES--ISSQDP---------------VVNDETDGEGKRVAYDPEEAKLR 43

Query: 61  DNINIPTLTLMEEVLLMGLRDREGYLSFWNDSISYALRGCIIIELALRGKIRILDDSARK 120
           D+   P L LMEEVLLMGL+D+EGYLSFWND+ISYALRGCI+IELALRGKI++L+D ARK
Sbjct: 44  DDTTTPKLNLMEEVLLMGLKDKEGYLSFWNDNISYALRGCILIELALRGKIQVLNDPARK 103

Query: 121 RFDLSERLIEVIDGSKTGEVLLDETLQLMKNDEPLTISNWIDLLSGETWNLLKINYQLKQ 180
           RFD+SERL+EVI+ +KTGEVLLDE L LMKNDEPLTI+NWIDLLSGETWN +KI+YQLKQ
Sbjct: 104 RFDVSERLVEVINATKTGEVLLDEALNLMKNDEPLTIANWIDLLSGETWNFMKISYQLKQ 163

Query: 181 VRERLAKGLVDKGVLRTEMKNFFLFDMATHPIADASCKEAIKRRVLSVLVSRNMELSYNE 240
           VRERLAKGLVDKGVLRTEMKNFFLFDM THPI D SCKEAIKRR+LSVLVSRNM+L+YNE
Sbjct: 164 VRERLAKGLVDKGVLRTEMKNFFLFDMPTHPITDTSCKEAIKRRILSVLVSRNMQLNYNE 223

Query: 241 YFPETTSFKIIRTLALICGSYGANVLENVLTTLEYEKRDKAISRAEEIMAQFSQFPFDLE 300
           YFP +  FK+IRTL+LICG+YGANVLENVL++L+YEKRD+A SRA+EI+AQFSQFPF L+
Sbjct: 224 YFPSSVRFKLIRTLSLICGAYGANVLENVLSSLDYEKRDRAFSRADEILAQFSQFPFALD 283

Query: 301 KETELGISVNLNKEVKEEMESNPGHNLQLEVIAGVFEVFSRMDMLL 346
           K+TE GISVNLNKEV+EE+ SN   +LQLE +AGVFEVFSRMD LL
Sbjct: 284 KQTETGISVNLNKEVQEEVVSNQDASLQLECVAGVFEVFSRMDTLL 329

>ZYRO0F10208g Chr6 complement(824737..825735) [999 bp, 332 aa] {ON}
           highly similar to uniprot|Q06385 Saccharomyces
           cerevisiae YDR372C VPS74
          Length = 332

 Score =  523 bits (1348), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 254/346 (73%), Positives = 295/346 (85%), Gaps = 14/346 (4%)

Query: 1   MSTLQRRRVNRADSGDTSSMQPSANNINAKGDKIASVAVDDDDNGTNKKIAYDPEESKLR 60
           MS LQRRRVNR DS         +NN   +G       ++  ++ ++KK+AYDPEE KL 
Sbjct: 1   MSGLQRRRVNRVDSS-------GSNNEPTRG-------LEAQEDSSSKKVAYDPEEVKLT 46

Query: 61  DNINIPTLTLMEEVLLMGLRDREGYLSFWNDSISYALRGCIIIELALRGKIRILDDSARK 120
           DN+ +P LTLMEEVLL+GLRD+EGYLSFWND+ISYALRGCI+IELALRGKIR++DDSARK
Sbjct: 47  DNVEVPKLTLMEEVLLLGLRDKEGYLSFWNDNISYALRGCIVIELALRGKIRVVDDSARK 106

Query: 121 RFDLSERLIEVIDGSKTGEVLLDETLQLMKNDEPLTISNWIDLLSGETWNLLKINYQLKQ 180
           RFD+SERLIEV D SKTGEVLLDE LQLMK DEPL+I+NWIDLLSGETWN LKINYQLKQ
Sbjct: 107 RFDVSERLIEVTDSSKTGEVLLDEALQLMKCDEPLSITNWIDLLSGETWNPLKINYQLKQ 166

Query: 181 VRERLAKGLVDKGVLRTEMKNFFLFDMATHPIADASCKEAIKRRVLSVLVSRNMELSYNE 240
           VRERLAKGLVDKGVLRTEMKNFFLFDMATHP+ D SCKEAIKRR+LSVLV RN+EL+YN+
Sbjct: 167 VRERLAKGLVDKGVLRTEMKNFFLFDMATHPVTDTSCKEAIKRRILSVLVPRNLELNYND 226

Query: 241 YFPETTSFKIIRTLALICGSYGANVLENVLTTLEYEKRDKAISRAEEIMAQFSQFPFDLE 300
           YF E  SFK+IRT+ALICG+Y ANVLENVLT+L YEKRD AI RA+EI+ QFS++PFDL+
Sbjct: 227 YFSERVSFKLIRTIALICGAYRANVLENVLTSLGYEKRDNAIGRADEILKQFSEYPFDLD 286

Query: 301 KETELGISVNLNKEVKEEMESNPGHNLQLEVIAGVFEVFSRMDMLL 346
            +TE GIS+NLNKEV +E++ +P   LQLEV+AGVFEVFSRMDMLL
Sbjct: 287 TQTESGISINLNKEVGQELQQHPESTLQLEVLAGVFEVFSRMDMLL 332

>Kwal_55.21399 s55 (820851..821840) [990 bp, 329 aa] {ON} YDR372C
           (VPS74) -  [contig 130] FULL
          Length = 329

 Score =  517 bits (1331), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 247/346 (71%), Positives = 297/346 (85%), Gaps = 17/346 (4%)

Query: 1   MSTLQRRRVNRADSGDTSSMQPSANNINAKGDKIASVAVDDDDNGTNKKIAYDPEESKLR 60
           MS LQRRRVN+++S   S  +P                + ++  G +K++AYDPEE+ L+
Sbjct: 1   MSGLQRRRVNKSESNYDS--EP---------------VISEEAEGESKRVAYDPEEAMLK 43

Query: 61  DNINIPTLTLMEEVLLMGLRDREGYLSFWNDSISYALRGCIIIELALRGKIRILDDSARK 120
           DN  IP L LMEEVLLMGL+D+EGYLSFWND+ISYALRGCI+IELALRGKI++++DSARK
Sbjct: 44  DNATIPKLNLMEEVLLMGLKDKEGYLSFWNDNISYALRGCILIELALRGKIQVVNDSARK 103

Query: 121 RFDLSERLIEVIDGSKTGEVLLDETLQLMKNDEPLTISNWIDLLSGETWNLLKINYQLKQ 180
           RFD+SERL+EVI+ +KTGEVLLDE L LMKNDEPLTI+NWIDLLSGETWN +KI+YQLKQ
Sbjct: 104 RFDVSERLVEVINATKTGEVLLDEALNLMKNDEPLTIANWIDLLSGETWNFMKISYQLKQ 163

Query: 181 VRERLAKGLVDKGVLRTEMKNFFLFDMATHPIADASCKEAIKRRVLSVLVSRNMELSYNE 240
           VRERLAKGLVDKGVLRTEMKNFFLFDM THPI D SCKEAIKRR+LSVLVSRNM+L+YNE
Sbjct: 164 VRERLAKGLVDKGVLRTEMKNFFLFDMPTHPITDTSCKEAIKRRILSVLVSRNMQLNYNE 223

Query: 241 YFPETTSFKIIRTLALICGSYGANVLENVLTTLEYEKRDKAISRAEEIMAQFSQFPFDLE 300
           YFP + SFK++RTL+LICG+YGANVLENVL +L+YEKRD+A SRA+EI+AQFSQFPF L+
Sbjct: 224 YFPASVSFKLLRTLSLICGAYGANVLENVLCSLDYEKRDRAFSRADEILAQFSQFPFALD 283

Query: 301 KETELGISVNLNKEVKEEMESNPGHNLQLEVIAGVFEVFSRMDMLL 346
           K+TE GISVN+NKE++EE+++N    L+LEV+AGVFEVFSRMD LL
Sbjct: 284 KQTETGISVNINKEMQEEIDANSDALLRLEVVAGVFEVFSRMDTLL 329

>NDAI0B05720 Chr2 complement(1391179..1392276) [1098 bp, 365 aa]
           {ON} Anc_5.442 YDR372C
          Length = 365

 Score =  516 bits (1330), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 266/367 (72%), Positives = 304/367 (82%), Gaps = 23/367 (6%)

Query: 1   MSTLQRRRVNRADSGDTSSMQP--SANNINAK--GDKIASVAVDDDDNGTNKKIAYDPEE 56
           MSTLQRRR  R   G    M    S NN +++  G   ++  V + +   + KIAYDPEE
Sbjct: 1   MSTLQRRR--RPQDGSNKGMVDVDSDNNDSSRILGSNNSNNNVSNSNTFGSSKIAYDPEE 58

Query: 57  SKLRDNIN-----------------IPTLTLMEEVLLMGLRDREGYLSFWNDSISYALRG 99
           +KL +N N                  PTLTLMEEVLLMGLRD+EGYLSFWND+ISYALRG
Sbjct: 59  AKLLNNNNINNNNSGSNSRGGNNAVTPTLTLMEEVLLMGLRDKEGYLSFWNDNISYALRG 118

Query: 100 CIIIELALRGKIRILDDSARKRFDLSERLIEVIDGSKTGEVLLDETLQLMKNDEPLTISN 159
           CI+IELALRGKIRILDDSARKRFDLSERLIEV DGSKTGEVLLDETLQLMKNDEPLTI+N
Sbjct: 119 CILIELALRGKIRILDDSARKRFDLSERLIEVKDGSKTGEVLLDETLQLMKNDEPLTIAN 178

Query: 160 WIDLLSGETWNLLKINYQLKQVRERLAKGLVDKGVLRTEMKNFFLFDMATHPIADASCKE 219
           WIDLLSGETWN++KINYQLKQVRERLAKGLVDKGVLRTEMKNFFLFDMATHP+ D+SCKE
Sbjct: 179 WIDLLSGETWNIMKINYQLKQVRERLAKGLVDKGVLRTEMKNFFLFDMATHPVTDSSCKE 238

Query: 220 AIKRRVLSVLVSRNMELSYNEYFPETTSFKIIRTLALICGSYGANVLENVLTTLEYEKRD 279
           AIKRRVLSVLVSRNME +YNEYFP+ T FKIIRT+ALICG+YGANVLENVL++L+YEK D
Sbjct: 239 AIKRRVLSVLVSRNMEFNYNEYFPQNTFFKIIRTIALICGAYGANVLENVLSSLDYEKSD 298

Query: 280 KAISRAEEIMAQFSQFPFDLEKETELGISVNLNKEVKEEMESNPGHNLQLEVIAGVFEVF 339
            AI+RA+E++AQFS+FPFDLEK T   +SVNLN+ V++E++ NPG++LQLEVIAGV EVF
Sbjct: 299 NAIARADELIAQFSKFPFDLEKTTNTNVSVNLNRLVQQELDENPGYDLQLEVIAGVIEVF 358

Query: 340 SRMDMLL 346
           SRMD LL
Sbjct: 359 SRMDTLL 365

>Kpol_1016.2 s1016 (4946..5932) [987 bp, 328 aa] {ON} (4946..5932)
           [987 nt, 329 aa]
          Length = 328

 Score =  514 bits (1325), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 243/346 (70%), Positives = 296/346 (85%), Gaps = 18/346 (5%)

Query: 1   MSTLQRRRVNRADSGDTSSMQPSANNINAKGDKIASVAVDDDDNGTNKKIAYDPEESKLR 60
           MS+LQRRR+NR +S DT+    S+N              DD++   + KIAYDPEE+KL+
Sbjct: 1   MSSLQRRRLNRINS-DTAE---SSN--------------DDEERSKSTKIAYDPEEAKLK 42

Query: 61  DNINIPTLTLMEEVLLMGLRDREGYLSFWNDSISYALRGCIIIELALRGKIRILDDSARK 120
           D++ +PTLTLMEEV+L+GL D++GYLSFWND+ISY LRGCIIIELALR KIRILDD ARK
Sbjct: 43  DDVTVPTLTLMEEVVLLGLGDKDGYLSFWNDNISYTLRGCIIIELALRNKIRILDDPARK 102

Query: 121 RFDLSERLIEVIDGSKTGEVLLDETLQLMKNDEPLTISNWIDLLSGETWNLLKINYQLKQ 180
           RFDLSERL+EV+DGSKTGEVLLDE LQLMKNDEPL+I+NWIDLLSGETWN  KINYQLKQ
Sbjct: 103 RFDLSERLVEVVDGSKTGEVLLDEALQLMKNDEPLSIANWIDLLSGETWNFFKINYQLKQ 162

Query: 181 VRERLAKGLVDKGVLRTEMKNFFLFDMATHPIADASCKEAIKRRVLSVLVSRNMELSYNE 240
           VRER++KGLVDKGVLRTEMKNFFLFDMATHP+ D SCKEAIKRR+LS LVSR MEL+YNE
Sbjct: 163 VRERISKGLVDKGVLRTEMKNFFLFDMATHPVTDTSCKEAIKRRILSALVSRTMELNYNE 222

Query: 241 YFPETTSFKIIRTLALICGSYGANVLENVLTTLEYEKRDKAISRAEEIMAQFSQFPFDLE 300
           YFPETT +K+IRT+ALIC SY ANVLENVL++LEYEKRD AI+R+E I+++F+Q+PF L+
Sbjct: 223 YFPETTQYKVIRTIALICSSYAANVLENVLSSLEYEKRDNAIARSESILSEFAQYPFKLD 282

Query: 301 KETELGISVNLNKEVKEEMESNPGHNLQLEVIAGVFEVFSRMDMLL 346
           K +++ +S+NL+K V++E+  NPG  LQLE +AGVF+VFS+MDM+L
Sbjct: 283 KASDIKVSINLSKLVEDEIAQNPGSALQLEAVAGVFDVFSKMDMIL 328

>TBLA0A06480 Chr1 (1593225..1594229) [1005 bp, 334 aa] {ON}
           Anc_5.442 YDR372C
          Length = 334

 Score =  514 bits (1323), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 242/352 (68%), Positives = 293/352 (83%), Gaps = 24/352 (6%)

Query: 1   MSTLQRRRVNRADSGDTSSMQPSANNINAKGDKIASVAVDDDDN------GTNKKIAYDP 54
           MSTLQRRR                    A+ D + S   D +DN        ++++AYDP
Sbjct: 1   MSTLQRRRKQ------------------ARSDSVGSSGTDSNDNEPTNRQAESRRVAYDP 42

Query: 55  EESKLRDNINIPTLTLMEEVLLMGLRDREGYLSFWNDSISYALRGCIIIELALRGKIRIL 114
           EE K+R+N+++P LTLMEEV+L+GLRD+EGYLSFWND+ISYALRGCIIIELALRGKIRIL
Sbjct: 43  EEDKIRNNMSVPQLTLMEEVVLLGLRDKEGYLSFWNDNISYALRGCIIIELALRGKIRIL 102

Query: 115 DDSARKRFDLSERLIEVIDGSKTGEVLLDETLQLMKNDEPLTISNWIDLLSGETWNLLKI 174
           DD ARKRF+LSERL+EV+D SKTGEVLLDE LQ+M+NDEPL ISNW+DLLSGETWN+ KI
Sbjct: 103 DDPARKRFELSERLVEVVDSSKTGEVLLDEALQIMRNDEPLAISNWVDLLSGETWNVFKI 162

Query: 175 NYQLKQVRERLAKGLVDKGVLRTEMKNFFLFDMATHPIADASCKEAIKRRVLSVLVSRNM 234
           NYQLKQVRER++KGLVDKGVLRTEMKNFFLFDMATHP+ D+SCKEAIKRR+LS+LV+R  
Sbjct: 163 NYQLKQVRERISKGLVDKGVLRTEMKNFFLFDMATHPVTDSSCKEAIKRRILSILVNRTA 222

Query: 235 ELSYNEYFPETTSFKIIRTLALICGSYGANVLENVLTTLEYEKRDKAISRAEEIMAQFSQ 294
           E +YN+YFPETTSFK IRT++LIC +YGANVLENVL +LEY+KRD  ++RAEE++ QFSQ
Sbjct: 223 EFTYNDYFPETTSFKYIRTISLICSAYGANVLENVLNSLEYQKRDNGLNRAEELLEQFSQ 282

Query: 295 FPFDLEKETELGISVNLNKEVKEEMESNPGHNLQLEVIAGVFEVFSRMDMLL 346
           +PFDLEK+TE G S+NLN  VKEE+E++P + L LEV+AGVFEVFS+MD+LL
Sbjct: 283 YPFDLEKQTEFGTSINLNALVKEEIEADPKNALFLEVVAGVFEVFSKMDLLL 334

>Ecym_4513 Chr4 complement(1023828..1024829) [1002 bp, 333 aa] {ON}
           similar to Ashbya gossypii ACL165C
          Length = 333

 Score =  511 bits (1316), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 246/344 (71%), Positives = 292/344 (84%), Gaps = 12/344 (3%)

Query: 3   TLQRRRVNRADSGDTSSMQPSANNINAKGDKIASVAVDDDDNGTNKKIAYDPEESKLRDN 62
           +LQRRRVN+A+ G TS       +             D+DD G++K +AYDPE+ KLR+N
Sbjct: 2   SLQRRRVNKAEVGGTSVELTQRKH-----------GEDEDDKGSHK-VAYDPEDQKLREN 49

Query: 63  INIPTLTLMEEVLLMGLRDREGYLSFWNDSISYALRGCIIIELALRGKIRILDDSARKRF 122
              PTLTLMEEVLLMGL+D+EGYLSFWNDSISY+LRGCI+IELALRGKIR+++D+ARKRF
Sbjct: 50  TKEPTLTLMEEVLLMGLKDKEGYLSFWNDSISYSLRGCILIELALRGKIRVVEDAARKRF 109

Query: 123 DLSERLIEVIDGSKTGEVLLDETLQLMKNDEPLTISNWIDLLSGETWNLLKINYQLKQVR 182
           DLSERL+EVI+ SKTGE LLDETL LMK++EPL+I NWIDLLSGETWNLLKI+YQLKQVR
Sbjct: 110 DLSERLVEVIETSKTGEALLDETLSLMKSNEPLSIVNWIDLLSGETWNLLKISYQLKQVR 169

Query: 183 ERLAKGLVDKGVLRTEMKNFFLFDMATHPIADASCKEAIKRRVLSVLVSRNMELSYNEYF 242
           ERLAKGLVDKGVLRTEMKNFFLFDMATHP+AD+SCKE+IKRR+LSVLV RN+ L Y EYF
Sbjct: 170 ERLAKGLVDKGVLRTEMKNFFLFDMATHPVADSSCKESIKRRMLSVLVPRNVSLDYTEYF 229

Query: 243 PETTSFKIIRTLALICGSYGANVLENVLTTLEYEKRDKAISRAEEIMAQFSQFPFDLEKE 302
           PE+ +FK +RT+ALICG+YGANVLENVL++L+YEKR++  SRAEEI+ QFSQ+PF L+K+
Sbjct: 230 PESVAFKYLRTIALICGAYGANVLENVLSSLDYEKRERGFSRAEEILTQFSQYPFALDKD 289

Query: 303 TELGISVNLNKEVKEEMESNPGHNLQLEVIAGVFEVFSRMDMLL 346
            E GISVNL  +VKEE+  NPG  LQLEV+AGVFEVFSRMD  L
Sbjct: 290 VETGISVNLYNQVKEEIGKNPGTGLQLEVVAGVFEVFSRMDNFL 333

>KLLA0E02355g Chr5 complement(217222..218196) [975 bp, 324 aa] {ON}
           highly similar to uniprot|Q06385 Saccharomyces
           cerevisiae YDR372C VPS74
          Length = 324

 Score =  507 bits (1305), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 244/344 (70%), Positives = 285/344 (82%), Gaps = 21/344 (6%)

Query: 3   TLQRRRVNRADSGDTSSMQPSANNINAKGDKIASVAVDDDDNGTNKKIAYDPEESKLRDN 62
           +LQRRRVN+   GDT+   P                    DN  + KI YD +E+KLRDN
Sbjct: 2   SLQRRRVNK---GDTTESIPQI------------------DNEHDHKIVYDEQEAKLRDN 40

Query: 63  INIPTLTLMEEVLLMGLRDREGYLSFWNDSISYALRGCIIIELALRGKIRILDDSARKRF 122
            ++P LTLMEEVLLMGL+D++GYLSFWND+ISYALRGCI+IELALRGKIR +DD ARKR+
Sbjct: 41  TSVPKLTLMEEVLLMGLKDKQGYLSFWNDNISYALRGCILIELALRGKIRCVDDPARKRY 100

Query: 123 DLSERLIEVIDGSKTGEVLLDETLQLMKNDEPLTISNWIDLLSGETWNLLKINYQLKQVR 182
           D+SERLIEVIDGSKTGEVLLDE+L LMKND P +I  WIDLLSGETWNLLKINYQLKQVR
Sbjct: 101 DVSERLIEVIDGSKTGEVLLDESLSLMKNDPPTSIVGWIDLLSGETWNLLKINYQLKQVR 160

Query: 183 ERLAKGLVDKGVLRTEMKNFFLFDMATHPIADASCKEAIKRRVLSVLVSRNMELSYNEYF 242
           ERLAKGLVDKGVLRTEMKNFFLFDMATHPI D +CKE+IKRR+LS+LVSRN EL+YN YF
Sbjct: 161 ERLAKGLVDKGVLRTEMKNFFLFDMATHPITDTTCKESIKRRILSILVSRNAELTYNTYF 220

Query: 243 PETTSFKIIRTLALICGSYGANVLENVLTTLEYEKRDKAISRAEEIMAQFSQFPFDLEKE 302
           P+  SFK IRTL+LICG+YGANVLENVL TL+YE RD   +RA+EI+AQFS+FPF L+K+
Sbjct: 221 PQDVSFKYIRTLSLICGAYGANVLENVLATLDYEVRDTGFARADEILAQFSEFPFPLDKQ 280

Query: 303 TELGISVNLNKEVKEEMESNPGHNLQLEVIAGVFEVFSRMDMLL 346
           T  G+SVNLNKE+ +E+ ++PG +LQLEV+AGVFEVFSRMD LL
Sbjct: 281 TSTGVSVNLNKEISQELNNHPGSDLQLEVVAGVFEVFSRMDTLL 324

>ACL165C Chr3 complement(66499..67494) [996 bp, 331 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR372C
          Length = 331

 Score =  485 bits (1249), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 235/344 (68%), Positives = 281/344 (81%), Gaps = 14/344 (4%)

Query: 3   TLQRRRVNRADSGDTSSMQPSANNINAKGDKIASVAVDDDDNGTNKKIAYDPEESKLRDN 62
           +LQRRRVN+           +A N    G   AS+   D++ G   K+AYDPEE KLR+N
Sbjct: 2   SLQRRRVNK-----------TAGNETVGG---ASLNRSDEEEGMTHKVAYDPEEQKLREN 47

Query: 63  INIPTLTLMEEVLLMGLRDREGYLSFWNDSISYALRGCIIIELALRGKIRILDDSARKRF 122
              PTLTLMEEVLLMGL+D+EGYLSF N++ISYALRGCI+IELALRG+I+++DD+ R+RF
Sbjct: 48  TREPTLTLMEEVLLMGLKDKEGYLSFLNENISYALRGCILIELALRGRIQVVDDAMRRRF 107

Query: 123 DLSERLIEVIDGSKTGEVLLDETLQLMKNDEPLTISNWIDLLSGETWNLLKINYQLKQVR 182
           D SERLIEV+DGSKTGE LLDE L LMK  EPLTI NW+DLLSGETWN LKINYQL+QVR
Sbjct: 108 DPSERLIEVVDGSKTGEALLDEALTLMKGSEPLTIVNWMDLLSGETWNFLKINYQLRQVR 167

Query: 183 ERLAKGLVDKGVLRTEMKNFFLFDMATHPIADASCKEAIKRRVLSVLVSRNMELSYNEYF 242
           ERLAKGLVDKGVLRTEMKNFFLFDM THP+AD SCKE+IKRR+LSVLV RN+EL Y E F
Sbjct: 168 ERLAKGLVDKGVLRTEMKNFFLFDMPTHPVADTSCKESIKRRILSVLVPRNVELQYTELF 227

Query: 243 PETTSFKIIRTLALICGSYGANVLENVLTTLEYEKRDKAISRAEEIMAQFSQFPFDLEKE 302
           PET +FK +RT+ALIC ++GANVLE VL+TL+YEKRD+  SRAEE++ QFSQ+PF L+K+
Sbjct: 228 PETVAFKYLRTIALICSAHGANVLEKVLSTLDYEKRDRGFSRAEELLVQFSQYPFALDKD 287

Query: 303 TELGISVNLNKEVKEEMESNPGHNLQLEVIAGVFEVFSRMDMLL 346
            E GISVNLN+ V+EE++ NPG  L LEV+AGV +V+SRMD LL
Sbjct: 288 IETGISVNLNRLVQEELDRNPGTALNLEVVAGVLKVYSRMDDLL 331

>TPHA0J02610 Chr10 complement(579213..580202) [990 bp, 329 aa] {ON}
           Anc_5.442 YDR372C
          Length = 329

 Score =  475 bits (1223), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 227/347 (65%), Positives = 283/347 (81%), Gaps = 19/347 (5%)

Query: 1   MSTLQRRRVNRADSGDTSSMQPSANNINAKGDKIASVAVDDDDNGTN-KKIAYDPEESKL 59
           MS +QRRR+NR  + D S                     D+D + +N  K+A+DPEE+K+
Sbjct: 1   MSGVQRRRINRISNEDESDHS------------------DNDQSRSNVSKVAFDPEEAKI 42

Query: 60  RDNINIPTLTLMEEVLLMGLRDREGYLSFWNDSISYALRGCIIIELALRGKIRILDDSAR 119
           +D++++P LTLMEEV+L+GL D EGYLSFWND+ISY LRGCI+IELALRGKIRI+DDSAR
Sbjct: 43  KDDVSVPKLTLMEEVVLLGLGDSEGYLSFWNDNISYVLRGCILIELALRGKIRIIDDSAR 102

Query: 120 KRFDLSERLIEVIDGSKTGEVLLDETLQLMKNDEPLTISNWIDLLSGETWNLLKINYQLK 179
           K FDLSERLIEVID SKTGEVLLDETLQLMKNDEP +I +WIDLLSGETWN  K+NYQLK
Sbjct: 103 KSFDLSERLIEVIDASKTGEVLLDETLQLMKNDEPQSIVSWIDLLSGETWNFFKVNYQLK 162

Query: 180 QVRERLAKGLVDKGVLRTEMKNFFLFDMATHPIADASCKEAIKRRVLSVLVSRNMELSYN 239
           QVRERL+KGLVDKGVLRTEMKNFFLFDMATHP+AD+SCKE++KRR++S LV R + L YN
Sbjct: 163 QVRERLSKGLVDKGVLRTEMKNFFLFDMATHPVADSSCKESLKRRIMSTLVDRTLSLQYN 222

Query: 240 EYFPETTSFKIIRTLALICGSYGANVLENVLTTLEYEKRDKAISRAEEIMAQFSQFPFDL 299
           EYFPE+T+FK+IRT++LI  +Y ANVLENVL TLEYEKRDKA+SRAE ++  F  +PF L
Sbjct: 223 EYFPESTTFKVIRTVSLIITAYSANVLENVLNTLEYEKRDKALSRAENLLNNFGNYPFKL 282

Query: 300 EKETELGISVNLNKEVKEEMESNPGHNLQLEVIAGVFEVFSRMDMLL 346
             E +  IS+NLN+ V++E+++NP   LQLEV+AGVF+VF++MD+++
Sbjct: 283 VNEPDNRISINLNQLVEDEIKANPKTALQLEVLAGVFDVFAKMDVII 329

>Kpol_1062.24 s1062 (55671..56501) [831 bp, 276 aa] {ON}
           (55671..56501) [831 nt, 277 aa]
          Length = 276

 Score =  357 bits (917), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 164/273 (60%), Positives = 217/273 (79%)

Query: 71  MEEVLLMGLRDREGYLSFWNDSISYALRGCIIIELALRGKIRILDDSARKRFDLSERLIE 130
           MEEV+L+G+RD+EGYLSFWN+++S+ LRGCI+IELA RG I+++DD +RKRFDLS+RLIE
Sbjct: 1   MEEVVLLGMRDKEGYLSFWNENLSFVLRGCILIELAFRGNIQVIDDPSRKRFDLSDRLIE 60

Query: 131 VIDGSKTGEVLLDETLQLMKNDEPLTISNWIDLLSGETWNLLKINYQLKQVRERLAKGLV 190
           V++  KTGE LLDETLQ+MK++E  +IS WIDLLSGETWN+ KIN QLKQVRER++KGLV
Sbjct: 61  VVNPKKTGEFLLDETLQMMKSEESQSISTWIDLLSGETWNIFKINLQLKQVRERISKGLV 120

Query: 191 DKGVLRTEMKNFFLFDMATHPIADASCKEAIKRRVLSVLVSRNMELSYNEYFPETTSFKI 250
           DKG+LRTEMKNFFLFDMATHP+ D  CKE IK+R+LSVL+ +   +  +EYFPET   + 
Sbjct: 121 DKGILRTEMKNFFLFDMATHPVEDLKCKEMIKKRILSVLLPQTAVILADEYFPETVQLRC 180

Query: 251 IRTLALICGSYGANVLENVLTTLEYEKRDKAISRAEEIMAQFSQFPFDLEKETELGISVN 310
           +RT+ALI  +Y  +VLENV + L+Y+K+D    R  EI+ Q S +PF+ + ++   I+ N
Sbjct: 181 LRTIALILSAYAGSVLENVASDLDYQKKDDLFVRTSEILDQSSVYPFEFDNKSSTNIATN 240

Query: 311 LNKEVKEEMESNPGHNLQLEVIAGVFEVFSRMD 343
           LN+ V+ E+  +   NL+LE IAGVFEVF +MD
Sbjct: 241 LNQLVENELSKDKNLNLKLETIAGVFEVFLKMD 273

>TBLA0A02780 Chr1 (670848..672011) [1164 bp, 387 aa] {ON} Anc_5.442
           YDR372C
          Length = 387

 Score =  338 bits (866), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 157/304 (51%), Positives = 219/304 (72%), Gaps = 1/304 (0%)

Query: 44  NGTNKKIAYDPEESKLRDNINIPTLTLMEEVLLMGLRDREGYLSFWNDSISYALRGCIII 103
           NG +    +DPEES   + I +P L LMEE++L+GL+D++GYLSFWND+ISY LRGCI+I
Sbjct: 84  NGKHHLTKFDPEESISNNEIILPPLNLMEEIVLLGLKDKQGYLSFWNDNISYVLRGCILI 143

Query: 104 ELALRGKIRILDDSARKRFDLSERLIEVI-DGSKTGEVLLDETLQLMKNDEPLTISNWID 162
           ELALR KI+++DD  R  +D+S R+IEV+   +KTG  LLDE L +M  + P +I NWID
Sbjct: 144 ELALRKKIKVIDDPVRNMYDVSARIIEVVMPITKTGNHLLDEALNMMAKERPESIMNWID 203

Query: 163 LLSGETWNLLKINYQLKQVRERLAKGLVDKGVLRTEMKNFFLFDMATHPIADASCKEAIK 222
           LLSGETWN+ K N QLK VRER++KGLVDKG+L+    NF  FDM+THP+ D   KE++K
Sbjct: 204 LLSGETWNVFKNNLQLKNVRERVSKGLVDKGILKNNTSNFLFFDMSTHPLVDIGSKESVK 263

Query: 223 RRVLSVLVSRNMELSYNEYFPETTSFKIIRTLALICGSYGANVLENVLTTLEYEKRDKAI 282
           +R+ S+LV ++  L YN YFPE  +FKIIR+L LIC +YGA+VL++ L T+ Y+  D A 
Sbjct: 264 QRIFSILVPKHSYLLYNNYFPENVTFKIIRSLCLICCAYGADVLDDTLLTMNYDDSDNAF 323

Query: 283 SRAEEIMAQFSQFPFDLEKETELGISVNLNKEVKEEMESNPGHNLQLEVIAGVFEVFSRM 342
            +AE++    S FP +L++    G+ V++ K+++ E+  + G +L LEV+AGV +V  RM
Sbjct: 324 KKAEKLFETISDFPINLDQREGSGVPVDIIKDLQSELLQHSGESLYLEVVAGVLQVILRM 383

Query: 343 DMLL 346
           D LL
Sbjct: 384 DSLL 387

>NCAS0H02090 Chr8 complement(405561..406598) [1038 bp, 345 aa] {ON}
           Anc_5.442 YDR372C
          Length = 345

 Score =  234 bits (597), Expect = 3e-74,   Method: Compositional matrix adjust.
 Identities = 121/284 (42%), Positives = 187/284 (65%), Gaps = 9/284 (3%)

Query: 66  PTLTLMEEVLLMGLRDREGYLSFWNDSISYALRGCIIIELALRGKIRILDDSARKRFDLS 125
           P LTLM+E+ L+ L+D+EGY+S W+  +SY LR C+IIELALRGKI+ + +  +K+ DL+
Sbjct: 63  PELTLMDELFLLALKDKEGYVSDWDGKLSYVLRCCVIIELALRGKIQAVAEGKKKK-DLA 121

Query: 126 --ERLIEVIDGSKTGEVLLDETLQLMKNDEP-LTISNWIDLLSGETWNLLKINYQLKQVR 182
             E  IEVIDGS TG+ LLD+TL LMK ++   ++S+WI LLSGE+ N LK +YQL  VR
Sbjct: 122 PHECKIEVIDGSITGDPLLDQTLGLMKKEKKNYSVSHWIKLLSGESMNFLKASYQLLHVR 181

Query: 183 ERLAKGLVDKGVLRTEMKNFFLFDMATHPIADASCKEAIKRRVLSVLVSRNMELSYNEYF 242
           +R+ + LV+ G+L  + K      + THPI D  CK AI+ R+  +L +  ++L   +YF
Sbjct: 182 KRIERILVETGILSKQTKKLAAIGLDTHPIKDIKCKNAIRSRMQYILTANKVDLPSTKYF 241

Query: 243 PETTSFKIIRTLALICGSYGANVLENVLTTLEYEKRDKAISRAEEIMAQFSQFPFDLEKE 302
           P+T S++++RT+ L C +YGA++L+      E E       RA  +++ FS+FPF+L + 
Sbjct: 242 PDTVSYRVLRTIVLACAAYGADILDKGFFQTENETV-IGKGRARVLLSLFSKFPFELNQ- 299

Query: 303 TELGISVNLNKEVKEEMESNPGHNLQLEVIAGVFEVFSRMDMLL 346
               +  +LN++V +E+  +P    QLEV+AG  +V + +D +L
Sbjct: 300 ---AVQPDLNEKVSKELHEHPEEASQLEVVAGAIDVINTIDTVL 340

>KAFR0C05110 Chr3 (1013807..1016482) [2676 bp, 891 aa] {ON} Anc_7.39
           YOR353C
          Length = 891

 Score = 36.6 bits (83), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 26/74 (35%), Positives = 41/74 (55%), Gaps = 7/74 (9%)

Query: 109 GKIRILDDSARKRFDLSERLIEVIDGSKTGEVLLDETLQLMKNDEPLTISNWIDLLSG-E 167
           GK  + D  A K  DL++   + +D SK    +LDE LQL+ N++PL +  ++  +   +
Sbjct: 723 GKQVLTDSLASKIRDLTDTCCQAMDLSK----ILDERLQLLLNNDPLIVEKYLSTVEKLK 778

Query: 168 TWNLLKINYQLKQV 181
           TW   KIN  LK +
Sbjct: 779 TWE--KINAFLKSI 790

>ZYRO0F02794g Chr6 (237327..237848) [522 bp, 173 aa] {ON} similar to
           uniprot|Q6Q5C1 Saccharomyces cerevisiae YLR065C
           Hypothetical ORF
          Length = 173

 Score = 31.2 bits (69), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 23/76 (30%), Positives = 35/76 (46%), Gaps = 13/76 (17%)

Query: 64  NIPTLTLMEEVLLMGLRDREGYLSFWNDSISYALRGCIIIELALRGKIRILDDSARKRFD 123
            IP + L      +  RD   Y+ F            I++ L L G I +LD S R ++D
Sbjct: 24  TIPVVLLASTRQWISKRDIVNYIRF------------ILLHLPLLGCIYVLDSSGRPKYD 71

Query: 124 LSERLI-EVIDGSKTG 138
              +LI E +D S++G
Sbjct: 72  SKNKLIREGLDLSQSG 87

>KLTH0E09504g Chr5 complement(860113..861270) [1158 bp, 385 aa] {ON}
           similar to uniprot|P40208 Saccharomyces cerevisiae
           YMR135C GID8 Protein of unknown function involved in
           proteasome-dependent catabolite inactivation of
           fructose-1 6-bisphosphatase contains LisH and CTLH
           domains like Vid30p
          Length = 385

 Score = 30.8 bits (68), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 12/23 (52%), Positives = 17/23 (73%)

Query: 249 KIIRTLALICGSYGANVLENVLT 271
           +I+  + LIC ++GA VLENV T
Sbjct: 111 RILEAIELICSTFGAQVLENVKT 133

>TDEL0C04810 Chr3 (867670..871932) [4263 bp, 1420 aa] {ON} Anc_3.339
           YBR097W
          Length = 1420

 Score = 31.2 bits (69), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 17/55 (30%), Positives = 32/55 (58%), Gaps = 1/55 (1%)

Query: 194 VLRTEMKNFFLFDMA-THPIADASCKEAIKRRVLSVLVSRNMELSYNEYFPETTS 247
           VL   ++ FF FD+  TH +  +SCK+ + R V ++L S ++  S + ++ +  S
Sbjct: 725 VLYPIVRPFFEFDVEFTHDLMLSSCKQPVSRTVYNLLCSWSLRASKSLFWQQVPS 779

>Skud_5.48 Chr5 (71966..73519) [1554 bp, 517 aa] {ON} YEL042W (REAL)
          Length = 517

 Score = 30.4 bits (67), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 19/80 (23%), Positives = 34/80 (42%), Gaps = 14/80 (17%)

Query: 86  LSFWNDSISYALRGCIIIELALRGKIRILDDSARKR--------------FDLSERLIEV 131
           L F  D++    RGC  + +     +RI+ D+  K+              F ++E  + +
Sbjct: 150 LDFAVDNVPLKARGCTPVAVRATAGLRIIGDAKSKKILTAVTNHLEKDYPFPIAEGSVSI 209

Query: 132 IDGSKTGEVLLDETLQLMKN 151
           +DG + G      T  L+KN
Sbjct: 210 MDGDEEGVFAWITTNYLLKN 229

>NCAS0A02560 Chr1 (487074..489899) [2826 bp, 941 aa] {ON} Anc_4.267
           YDL073W
          Length = 941

 Score = 30.0 bits (66), Expect = 9.8,   Method: Compositional matrix adjust.
 Identities = 22/75 (29%), Positives = 34/75 (45%), Gaps = 1/75 (1%)

Query: 15  GDTSSMQPSANNINAKGDKIASVAVDDDDNGTNKKIAYDPEESKLRDNINIPTLTLMEEV 74
           G      P  N +N   D+ + +++ DD    NK +  + + +KL   INI  LTL E  
Sbjct: 858 GSKEVASPHDNGVNDLSDEFSHISIKDDVVRRNKLMELETKFNKLLKLINIWNLTLDEYY 917

Query: 75  LLMG-LRDREGYLSF 88
             M  + D   +L F
Sbjct: 918 EFMDVINDNSSFLDF 932

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.134    0.371 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 35,682,234
Number of extensions: 1574434
Number of successful extensions: 6255
Number of sequences better than 10.0: 60
Number of HSP's gapped: 6427
Number of HSP's successfully gapped: 60
Length of query: 346
Length of database: 53,481,399
Length adjustment: 110
Effective length of query: 236
Effective length of database: 40,868,139
Effective search space: 9644880804
Effective search space used: 9644880804
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 66 (30.0 bits)