Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Smik_4.6375.441ON51151126200.0
YDR371W (CTS2)5.441ON51151121670.0
Skud_4.6405.441ON51148221590.0
Suva_2.5435.441ON51151121180.0
NCAS0F034205.441ON52551312081e-161
ZYRO0F10186g5.441ON51949811901e-159
TDEL0D026005.441ON52350211471e-152
TBLA0A027905.441ON54752311311e-149
Kpol_1062.255.441ON53351811251e-149
NDAI0B057105.441ON56347710961e-144
SAKL0G02684g5.441ON53950710881e-143
CAGL0A02904g5.441ON50149510571e-139
TPHA0E017205.441ON53745810431e-136
KNAG0C048705.441ON4584489951e-130
KAFR0E038105.441ON4904539671e-125
KLTH0F15906g5.441ON5154959471e-122
Kwal_55.214025.441ON5164609401e-121
KLLA0E02333g5.441ON4804859091e-117
ACL166W5.441ON4905048881e-113
Ecym_45125.441ON5274968681e-110
Smik_8.452.500ON39590820.19
TBLA0A102305.301ON106370723.7
KLTH0G15070g6.80ON60087723.7
ZYRO0G16478g5.291ON401118704.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Smik_4.637
         (511 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Smik_4.637 Chr4 (1139498..1141033) [1536 bp, 511 aa] {ON} YDR371...  1013   0.0  
YDR371W Chr4 (1219413..1220948) [1536 bp, 511 aa] {ON}  CTS2Puta...   839   0.0  
Skud_4.640 Chr4 (1142282..1143817) [1536 bp, 511 aa] {ON} YDR371...   836   0.0  
Suva_2.543 Chr2 (970024..971559) [1536 bp, 511 aa] {ON} YDR371W ...   820   0.0  
NCAS0F03420 Chr6 (689091..690668) [1578 bp, 525 aa] {ON} Anc_5.4...   469   e-161
ZYRO0F10186g Chr6 (823029..824588) [1560 bp, 519 aa] {ON} simila...   462   e-159
TDEL0D02600 Chr4 complement(498470..500041) [1572 bp, 523 aa] {O...   446   e-152
TBLA0A02790 Chr1 complement(672252..673895) [1644 bp, 547 aa] {O...   440   e-149
Kpol_1062.25 s1062 complement(56775..58376) [1602 bp, 533 aa] {O...   437   e-149
NDAI0B05710 Chr2 (1389267..1390958) [1692 bp, 563 aa] {ON} Anc_5...   426   e-144
SAKL0G02684g Chr7 (220460..222079) [1620 bp, 539 aa] {ON} simila...   423   e-143
CAGL0A02904g Chr1 (302938..304443) [1506 bp, 501 aa] {ON} simila...   411   e-139
TPHA0E01720 Chr5 complement(348101..349714) [1614 bp, 537 aa] {O...   406   e-136
KNAG0C04870 Chr3 complement(943386..944762) [1377 bp, 458 aa] {O...   387   e-130
KAFR0E03810 Chr5 complement(756701..758173) [1473 bp, 490 aa] {O...   377   e-125
KLTH0F15906g Chr6 complement(1293832..1295379) [1548 bp, 515 aa]...   369   e-122
Kwal_55.21402 s55 complement(821930..823480) [1551 bp, 516 aa] {...   366   e-121
KLLA0E02333g Chr5 (215594..217036) [1443 bp, 480 aa] {ON} simila...   354   e-117
ACL166W Chr3 (64828..66300) [1473 bp, 490 aa] {ON} Syntenic homo...   346   e-113
Ecym_4512 Chr4 (1022092..1023675) [1584 bp, 527 aa] {ON} similar...   338   e-110
Smik_8.45 Chr8 (78091..79278) [1188 bp, 395 aa] {ON} YHL004W (REAL)    36   0.19 
TBLA0A10230 Chr1 complement(2524337..2527528) [3192 bp, 1063 aa]...    32   3.7  
KLTH0G15070g Chr7 (1319937..1321739) [1803 bp, 600 aa] {ON} simi...    32   3.7  
ZYRO0G16478g Chr7 complement(1349497..1350702) [1206 bp, 401 aa]...    32   4.4  

>Smik_4.637 Chr4 (1139498..1141033) [1536 bp, 511 aa] {ON} YDR371W
           (REAL)
          Length = 511

 Score = 1013 bits (2620), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 493/511 (96%), Positives = 493/511 (96%)

Query: 1   MVSLSLYHGSKXXXXXXXXXXXXXXXXXXEMCLYKKIFKNQRSNKIRDSFNNGGHKVPNM 60
           MVSLSLYHGSK                  EMCLYKKIFKNQRSNKIRDSFNNGGHKVPNM
Sbjct: 1   MVSLSLYHGSKTSLISHLLILLIIVTIVIEMCLYKKIFKNQRSNKIRDSFNNGGHKVPNM 60

Query: 61  DQTQGPNVDGEGFVSGVYYSNWSPYKPRFHFPHDINLTQVSHVYYAFFRINPRTGGIEST 120
           DQTQGPNVDGEGFVSGVYYSNWSPYKPRFHFPHDINLTQVSHVYYAFFRINPRTGGIEST
Sbjct: 61  DQTQGPNVDGEGFVSGVYYSNWSPYKPRFHFPHDINLTQVSHVYYAFFRINPRTGGIEST 120

Query: 121 DNWSDLEMNLYKPLAIKSSELIDGNSSNDIQKILPLGCIGELFYLKHSCSGKKFKVIMSI 180
           DNWSDLEMNLYKPLAIKSSELIDGNSSNDIQKILPLGCIGELFYLKHSCSGKKFKVIMSI
Sbjct: 121 DNWSDLEMNLYKPLAIKSSELIDGNSSNDIQKILPLGCIGELFYLKHSCSGKKFKVIMSI 180

Query: 181 GGWSDSENFKVIIKNENLLQAFVDSSVETMFKLGFDGIDLDWEFPENNKSEPQGYLKLVR 240
           GGWSDSENFKVIIKNENLLQAFVDSSVETMFKLGFDGIDLDWEFPENNKSEPQGYLKLVR
Sbjct: 181 GGWSDSENFKVIIKNENLLQAFVDSSVETMFKLGFDGIDLDWEFPENNKSEPQGYLKLVR 240

Query: 241 MLRSKLNSLESQIFGEGVEDHFQLSIAAPAFKDKLYYLPIPEIDQYIDYWNMMTYDYYGS 300
           MLRSKLNSLESQIFGEGVEDHFQLSIAAPAFKDKLYYLPIPEIDQYIDYWNMMTYDYYGS
Sbjct: 241 MLRSKLNSLESQIFGEGVEDHFQLSIAAPAFKDKLYYLPIPEIDQYIDYWNMMTYDYYGS 300

Query: 301 WSETTGYHSNLFSETELSGNFAIHYMIDKFGINSRKLVLGMAAYGRSFHIKGSGFQPFTQ 360
           WSETTGYHSNLFSETELSGNFAIHYMIDKFGINSRKLVLGMAAYGRSFHIKGSGFQPFTQ
Sbjct: 301 WSETTGYHSNLFSETELSGNFAIHYMIDKFGINSRKLVLGMAAYGRSFHIKGSGFQPFTQ 360

Query: 361 NTILINQSFKGVGKLTKEVNKADGKEGIWPYKNLPKKGTIERYDPKYVSAYCFDEKNSIF 420
           NTILINQSFKGVGKLTKEVNKADGKEGIWPYKNLPKKGTIERYDPKYVSAYCFDEKNSIF
Sbjct: 361 NTILINQSFKGVGKLTKEVNKADGKEGIWPYKNLPKKGTIERYDPKYVSAYCFDEKNSIF 420

Query: 421 ISYDNTKSVKTKAEYVLHNKLGGGFWWESCGETYANESRSLIHAFNEGLRSNVSTKPSMF 480
           ISYDNTKSVKTKAEYVLHNKLGGGFWWESCGETYANESRSLIHAFNEGLRSNVSTKPSMF
Sbjct: 421 ISYDNTKSVKTKAEYVLHNKLGGGFWWESCGETYANESRSLIHAFNEGLRSNVSTKPSMF 480

Query: 481 ENERVVNFYLNKYGNNGFLTPYLKHMDSFKQ 511
           ENERVVNFYLNKYGNNGFLTPYLKHMDSFKQ
Sbjct: 481 ENERVVNFYLNKYGNNGFLTPYLKHMDSFKQ 511

>YDR371W Chr4 (1219413..1220948) [1536 bp, 511 aa] {ON}
           CTS2Putative chitinase, functionally complements A.
           gossypii cts2 mutant sporulation defect
          Length = 511

 Score =  839 bits (2167), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 401/511 (78%), Positives = 447/511 (87%)

Query: 1   MVSLSLYHGSKXXXXXXXXXXXXXXXXXXEMCLYKKIFKNQRSNKIRDSFNNGGHKVPNM 60
           MV  S  H SK                  EMCLY KIFKNQRS+ IRD+FNNGGH+VP+ 
Sbjct: 1   MVGHSAQHRSKSSLVSHLLILLIFITIIIEMCLYNKIFKNQRSDDIRDNFNNGGHRVPSN 60

Query: 61  DQTQGPNVDGEGFVSGVYYSNWSPYKPRFHFPHDINLTQVSHVYYAFFRINPRTGGIEST 120
            Q  G ++  E F+SGVYYSNWSPYKPRFHFPHDINL QVSH+YYAFF+IN RTGGIE+T
Sbjct: 61  VQNHGTHIRDEAFISGVYYSNWSPYKPRFHFPHDINLKQVSHIYYAFFKINSRTGGIENT 120

Query: 121 DNWSDLEMNLYKPLAIKSSELIDGNSSNDIQKILPLGCIGELFYLKHSCSGKKFKVIMSI 180
           D+WSDLEMNLYK LAIK+SELI  +S+N +Q ILPLGCIGELFYLK++CS KKFKVIMSI
Sbjct: 121 DSWSDLEMNLYKSLAIKNSELIKESSNNSVQNILPLGCIGELFYLKNTCSDKKFKVIMSI 180

Query: 181 GGWSDSENFKVIIKNENLLQAFVDSSVETMFKLGFDGIDLDWEFPENNKSEPQGYLKLVR 240
           GGWSDSENFK+IIK++ LLQ FVDSSVETMF+LGFDGIDLDWEFP NN+SEP+GYLKLVR
Sbjct: 181 GGWSDSENFKIIIKDDKLLQNFVDSSVETMFRLGFDGIDLDWEFPGNNESEPRGYLKLVR 240

Query: 241 MLRSKLNSLESQIFGEGVEDHFQLSIAAPAFKDKLYYLPIPEIDQYIDYWNMMTYDYYGS 300
           MLR KLNSLESQIFG+  EDHFQLSIAAPAFKDKL+YLPI EIDQY+DYWNMMTYDYYGS
Sbjct: 241 MLRLKLNSLESQIFGKRTEDHFQLSIAAPAFKDKLFYLPITEIDQYVDYWNMMTYDYYGS 300

Query: 301 WSETTGYHSNLFSETELSGNFAIHYMIDKFGINSRKLVLGMAAYGRSFHIKGSGFQPFTQ 360
           WSETTGYHSNLFSETEL+GNFA+HYMID+FG+NSRKLVLGMAAYGRSFHIK + F+PF Q
Sbjct: 301 WSETTGYHSNLFSETELNGNFAMHYMIDRFGVNSRKLVLGMAAYGRSFHIKDNKFEPFNQ 360

Query: 361 NTILINQSFKGVGKLTKEVNKADGKEGIWPYKNLPKKGTIERYDPKYVSAYCFDEKNSIF 420
           NT+LIN+ FKGVGK TKE++KADGKEGIWPYKNLPK GTIE+YDPKYVSAYCFDEKNSIF
Sbjct: 361 NTVLINKIFKGVGKPTKEIDKADGKEGIWPYKNLPKIGTIEQYDPKYVSAYCFDEKNSIF 420

Query: 421 ISYDNTKSVKTKAEYVLHNKLGGGFWWESCGETYANESRSLIHAFNEGLRSNVSTKPSMF 480
           ISYDNTKSVKTKAEYV HN LGGGFWWESCGE YANESRSLI+AFNEGL  NVS+KPS+F
Sbjct: 421 ISYDNTKSVKTKAEYVTHNNLGGGFWWESCGEAYANESRSLINAFNEGLHFNVSSKPSIF 480

Query: 481 ENERVVNFYLNKYGNNGFLTPYLKHMDSFKQ 511
           ++ RV  +YLNKYG+ GFL+PYLKH+DS KQ
Sbjct: 481 QDVRVKKYYLNKYGDGGFLSPYLKHLDSRKQ 511

>Skud_4.640 Chr4 (1142282..1143817) [1536 bp, 511 aa] {ON} YDR371W
           (REAL)
          Length = 511

 Score =  836 bits (2159), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 391/482 (81%), Positives = 443/482 (91%)

Query: 30  EMCLYKKIFKNQRSNKIRDSFNNGGHKVPNMDQTQGPNVDGEGFVSGVYYSNWSPYKPRF 89
           EMCLY KIFK+QRS+ IRD+F NGG +VP+M Q Q P+  G+G+VSGVYYSNWSPY PRF
Sbjct: 30  EMCLYNKIFKSQRSDDIRDNFRNGGDQVPSMVQNQKPHDGGKGYVSGVYYSNWSPYTPRF 89

Query: 90  HFPHDINLTQVSHVYYAFFRINPRTGGIESTDNWSDLEMNLYKPLAIKSSELIDGNSSND 149
           HFPHDINL QVSHVYYAFFRIN +TGGIESTD+WSDLEMNLYKPLAIKSS+L++ N ++ 
Sbjct: 90  HFPHDINLMQVSHVYYAFFRINSKTGGIESTDSWSDLEMNLYKPLAIKSSQLVENNLNDS 149

Query: 150 IQKILPLGCIGELFYLKHSCSGKKFKVIMSIGGWSDSENFKVIIKNENLLQAFVDSSVET 209
           +Q ILPLGC+GELFYLK++CS KKFKVIMSIGGWSDSENFK I+ ++ LLQ FVDSSVET
Sbjct: 150 VQNILPLGCVGELFYLKNACSEKKFKVIMSIGGWSDSENFKTIVGDDKLLQNFVDSSVET 209

Query: 210 MFKLGFDGIDLDWEFPENNKSEPQGYLKLVRMLRSKLNSLESQIFGEGVEDHFQLSIAAP 269
           MFKLGFDGID+DWEFPENNK EPQGYLKLV+MLR KLN+LESQIFGE +EDHFQ+SIAAP
Sbjct: 210 MFKLGFDGIDIDWEFPENNKIEPQGYLKLVKMLRLKLNNLESQIFGESIEDHFQISIAAP 269

Query: 270 AFKDKLYYLPIPEIDQYIDYWNMMTYDYYGSWSETTGYHSNLFSETELSGNFAIHYMIDK 329
           AFKDKL++LPI EIDQYIDYWNMMTYDYYGSWSETTGYHSNLFSETELSGNFA+HYMID+
Sbjct: 270 AFKDKLFFLPISEIDQYIDYWNMMTYDYYGSWSETTGYHSNLFSETELSGNFAMHYMIDE 329

Query: 330 FGINSRKLVLGMAAYGRSFHIKGSGFQPFTQNTILINQSFKGVGKLTKEVNKADGKEGIW 389
           F ++S KLVLGMAAYGRSFHIK S FQPFTQNT+LINQ FKGVGK  KE++KADGKEGIW
Sbjct: 330 FSVDSSKLVLGMAAYGRSFHIKDSKFQPFTQNTVLINQHFKGVGKPGKEIDKADGKEGIW 389

Query: 390 PYKNLPKKGTIERYDPKYVSAYCFDEKNSIFISYDNTKSVKTKAEYVLHNKLGGGFWWES 449
           PYK+LPKKGTIE+YDPKYVSAYCFDEKNSIFISYDNTKS KTKAEYV+HNKLGGGFWWES
Sbjct: 390 PYKSLPKKGTIEQYDPKYVSAYCFDEKNSIFISYDNTKSAKTKAEYVMHNKLGGGFWWES 449

Query: 450 CGETYANESRSLIHAFNEGLRSNVSTKPSMFENERVVNFYLNKYGNNGFLTPYLKHMDSF 509
           CGE + N+SRSLI+AFNEG+R NVS+KPSMF++ RV+ FYLNKYG++GFL+PYLKH++S 
Sbjct: 450 CGEAHTNKSRSLINAFNEGIRFNVSSKPSMFQDMRVIKFYLNKYGDDGFLSPYLKHLESS 509

Query: 510 KQ 511
           KQ
Sbjct: 510 KQ 511

>Suva_2.543 Chr2 (970024..971559) [1536 bp, 511 aa] {ON} YDR371W
           (REAL)
          Length = 511

 Score =  820 bits (2118), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 390/511 (76%), Positives = 441/511 (86%), Gaps = 1/511 (0%)

Query: 1   MVSLSLYHGSKXXXXXXXXXXXXXXXXXXEMCLYKKIFKNQRSNKIRDSFNNGGHKVPNM 60
           MV  S +H S                   EMCLY K+FKNQRS  IRD+F NG H+VPNM
Sbjct: 1   MVEHSQHHRSNTSIISHLLILLIAITIIIEMCLYNKLFKNQRSEDIRDNFQNGRHQVPNM 60

Query: 61  DQTQGPNVDGEGFVSGVYYSNWSPYKPRFHFPHDINLTQVSHVYYAFFRINPRTGGIEST 120
            Q Q P+ D +G+VSGVYYSNWSPYKPRFHFPHDINL QVSHVYYAFFRI+P+TG I ST
Sbjct: 61  VQNQKPSGDDDGYVSGVYYSNWSPYKPRFHFPHDINLEQVSHVYYAFFRIDPKTGCIGST 120

Query: 121 DNWSDLEMNLYKPLAIKSSELIDGN-SSNDIQKILPLGCIGELFYLKHSCSGKKFKVIMS 179
           D+WSDLEM+LYKPLAIK+S+L+D N   N++Q ILPLGCIGELFYLK++CSG+KFK IMS
Sbjct: 121 DSWSDLEMDLYKPLAIKASQLVDDNLDDNNMQSILPLGCIGELFYLKNACSGRKFKSIMS 180

Query: 180 IGGWSDSENFKVIIKNENLLQAFVDSSVETMFKLGFDGIDLDWEFPENNKSEPQGYLKLV 239
           IGGWSDSENFK I+KNE LLQ FVDSSVETMFKLGFDGID+DWEFPENNK EPQGYLKLV
Sbjct: 181 IGGWSDSENFKTIVKNEKLLQNFVDSSVETMFKLGFDGIDIDWEFPENNKVEPQGYLKLV 240

Query: 240 RMLRSKLNSLESQIFGEGVEDHFQLSIAAPAFKDKLYYLPIPEIDQYIDYWNMMTYDYYG 299
           RMLR KLNSLESQIFG   +DHF+LSIAAPAFKDKLY+LPI EIDQYID+WNMMTYDYYG
Sbjct: 241 RMLRLKLNSLESQIFGGSTKDHFELSIAAPAFKDKLYFLPIAEIDQYIDHWNMMTYDYYG 300

Query: 300 SWSETTGYHSNLFSETELSGNFAIHYMIDKFGINSRKLVLGMAAYGRSFHIKGSGFQPFT 359
           SWSETTGYHSNLFSETELSGNFAIHYMI +FG+N RKLVLGMAAYGRSFHIK   F+PFT
Sbjct: 301 SWSETTGYHSNLFSETELSGNFAIHYMIGEFGVNPRKLVLGMAAYGRSFHIKDDKFRPFT 360

Query: 360 QNTILINQSFKGVGKLTKEVNKADGKEGIWPYKNLPKKGTIERYDPKYVSAYCFDEKNSI 419
           +NT+LINQ FKGVGK  KE++KADGKEGIWPYKNLPKKGT E+YDPKYVSAYCFDEKNSI
Sbjct: 361 KNTVLINQQFKGVGKPGKEIDKADGKEGIWPYKNLPKKGTTEQYDPKYVSAYCFDEKNSI 420

Query: 420 FISYDNTKSVKTKAEYVLHNKLGGGFWWESCGETYANESRSLIHAFNEGLRSNVSTKPSM 479
           FI YDNT+S+KTKA+YV+H +LGGGFWWESCGE YA++SRSLI+AFNE L  NVS+KPSM
Sbjct: 421 FIGYDNTESIKTKADYVMHTELGGGFWWESCGEDYADKSRSLINAFNEALHFNVSSKPSM 480

Query: 480 FENERVVNFYLNKYGNNGFLTPYLKHMDSFK 510
           F+++RV+ +YL+KYG+ GFL PYLKH++S K
Sbjct: 481 FQDKRVMKYYLSKYGDGGFLAPYLKHLESLK 511

>NCAS0F03420 Chr6 (689091..690668) [1578 bp, 525 aa] {ON} Anc_5.441
           YDR371W
          Length = 525

 Score =  469 bits (1208), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 250/513 (48%), Positives = 336/513 (65%), Gaps = 54/513 (10%)

Query: 30  EMCLYKKIFKNQRSNK-IRDSFNNGGHKVPN-------MDQTQGPNVDGE-GFVSGVYYS 80
           +MCL+K  FK + +   I+  F NG   +PN       M+QT   N +GE G++SG+YYS
Sbjct: 27  QMCLHKLYFKQKATQDLIQSHFRNG--TIPNRQEIDYLMNQT---NSNGEKGYLSGLYYS 81

Query: 81  NWSPYKPRFHFPHDINLTQVSHVYYAFFRINPRTGGIESTDNWSDLEMNLYKPLAIKSSE 140
           +WSPYKPRFHFPHDI+LT+VSH+YYAFF ++P+TG +  +D WSDL+M+LYKPL++K   
Sbjct: 82  SWSPYKPRFHFPHDIDLTRVSHIYYAFFLVDPKTGKLNPSDEWSDLQMDLYKPLSVKLHN 141

Query: 141 LIDGNSSNDIQ----KILPLGCIGELFYLKHSC---SGKKFKVIMSIGGWSDSENFKVII 193
           L   ++   +Q    + LPLGCIGELFYLKHS     G   K+I+SIGGWS+ + F  ++
Sbjct: 142 LNLADNEKPVQLRDKRKLPLGCIGELFYLKHSGIIPGGSSTKMILSIGGWSNRDRFPGLV 201

Query: 194 KNENLLQAFVDSSVETMFKLGFDGIDLDWEFPENNKSEPQGYLKLVRMLRSKLNSLESQI 253
           ++    + F+DS+VETMF+ GFDGIDLDWEFP+++  EP  YL+++  LR K++ LE +I
Sbjct: 202 RDTRKFENFIDSAVETMFRYGFDGIDLDWEFPKDDGLEPNKYLEMISKLRRKMDDLELEI 261

Query: 254 FGEGVEDH--FQLSIAAPAFKDKLYYLPIPEIDQYIDYWNMMTYDYYGSWSETTGYHSNL 311
           FGE  +DH  FQLS+A PAF  KL  LPI ++DQY+DYWNMMTYDYYGSWSE TGYH NL
Sbjct: 262 FGE-TKDHPKFQLSVATPAFIYKLSILPIIQMDQYVDYWNMMTYDYYGSWSEATGYHCNL 320

Query: 312 FS-----------------ETELSGNFAIHYMIDKFGINSRKLVLGMAAYGRSF-HIKGS 353
           F+                    L+ N AI +MI    + S K+VLGMAAYGR F H+K  
Sbjct: 321 FNGDGSEFRAGYKHEHTAHNNGLNANEAIDFMIKSCNVPSSKVVLGMAAYGREFKHVKSR 380

Query: 354 GFQPFTQNTILINQSFKGVGKLTKEVNKADGKEGIWPYKNLPKKGTIERYDPKYVSAYCF 413
                     LINQ FKGVGK          + G+W Y  LP KGT+E YDP Y +A+C+
Sbjct: 381 -----QGVDTLINQKFKGVGK-----GGLGDEPGMWLYNQLPLKGTVEMYDPNYGAAFCY 430

Query: 414 DEKNSIFISYDNTKSVKTKAEYVLHNKLGGGFWWESCGETYANESRSLIHAFNEGLRS-- 471
           D+K+  FI YDN  SVK KA+YV   +LGGGFWWESCG+ + N+ RSL++ F+  +    
Sbjct: 431 DKKSETFIGYDNVDSVKLKAQYVQTRELGGGFWWESCGDDHINKRRSLLYNFSNEVTEIR 490

Query: 472 NVSTKPSMFENERVVNFYLNKYGNNGFLTPYLK 504
             S +  +F  +  + +YLN+YG +GFL+  L+
Sbjct: 491 KFSDQDLIFRRKECIAYYLNRYGTDGFLSGILQ 523

>ZYRO0F10186g Chr6 (823029..824588) [1560 bp, 519 aa] {ON} similar
           to uniprot|Q06350 Saccharomyces cerevisiae YDR371W CTS2
           Sporulation-specific chitinase
          Length = 519

 Score =  462 bits (1190), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 230/498 (46%), Positives = 325/498 (65%), Gaps = 35/498 (7%)

Query: 30  EMCLYKKIFKNQRSNKIRDSFNNGGHKVPNMDQTQGPNVDGEGFVSGVYYSNWSPYKPRF 89
           EMC Y+KIFK+   + + D  +  G       +     +  EG+ SG+YYS+WSPY PR 
Sbjct: 25  EMCFYRKIFKSSAEHDVLDHVHEVGDGSLQQFKDHHTVIGDEGYTSGLYYSDWSPYPPRK 84

Query: 90  HFPHDINLTQVSHVYYAFFRINPRTGGIESTDNWSDLEMNLYKPLAIKSSEL-IDGNSSN 148
           HFPHDI+ ++VSH+YYAFF I+  TG ++S+D WSD +M+LYKPLA+K ++L +  +  +
Sbjct: 85  HFPHDIDFSKVSHIYYAFFLIDGHTGELKSSDEWSDFQMDLYKPLAVKLNQLQLKNDDVH 144

Query: 149 DIQKILPLGCIGELFYLKHSC-----SGKKFKVIMSIGGWSDSENFKVIIKNENLLQAFV 203
               +LP GC+GELFYL+H+       G+ FKV+M++GGWS+ + +  ++++   ++ F+
Sbjct: 145 ASMGVLPKGCVGELFYLRHTGILDRDKGRHFKVMMAVGGWSNRDQWPKMVRDPRRVENFI 204

Query: 204 DSSVETMFKLGFDGIDLDWEFPENNKSEPQGYLKLVRMLRSKLNSLESQIF-GEGVEDHF 262
           +S VETMFK GFDGIDLDWEFP+N+  EP+ YL+L R +R K + LE  IF GE     F
Sbjct: 205 NSCVETMFKYGFDGIDLDWEFPQNDGFEPRMYLELARKMRLKFDELEEVIFAGEPNHPKF 264

Query: 263 QLSIAAPAFKDKLYYLPIPEIDQYIDYWNMMTYDYYGSWSETTGYHSNLF---------- 312
           QLS+A PAFKDKL  LPI E+D+YID WNMMTYDY+G WS  TGYH NL+          
Sbjct: 265 QLSMATPAFKDKLNVLPIKELDRYIDVWNMMTYDYHGEWSPVTGYHCNLYDGPVKVHSQY 324

Query: 313 -----SETE-LSGNFAIHYMIDKFGINSRKLVLGMAAYGRSF-HIKGSGFQPFTQNTILI 365
                S+ E L  N AI  MI++FG++SRK+ LGMAAYGR F H+K S     + +   I
Sbjct: 325 KHDSSSDDEGLDANSAISDMINRFGVDSRKITLGMAAYGRGFTHVKAS-----SNDKRFI 379

Query: 366 NQSFKGVGKLTKEVNKADGKEGIWPYKNLPKKGTIERYDPKYVSAYCFDEKNSIFISYDN 425
           ++SF GVG        ++G+ G+W Y  LP KG+ E YDP+YVS +CFD K   F+ YDN
Sbjct: 380 DKSFHGVG------GASEGEPGMWLYNQLPIKGSKEEYDPEYVSGFCFDHKTKTFVGYDN 433

Query: 426 TKSVKTKAEYVLHNKLGGGFWWESCGETYANESRSLIHAFNEGLRSNVSTKPSMFENERV 485
            +SVK KA+YV    L GGFWWESCG+ + +  RSL++AF   +++    + S++     
Sbjct: 434 VESVKVKADYVKEMGLRGGFWWESCGDNHIDPQRSLLNAFTGRIKTIAKNENSVYHKPEA 493

Query: 486 VNFYLNKYGNNGFLTPYL 503
           + +YL K+G + FL+P++
Sbjct: 494 LRYYLEKFGQDEFLSPFI 511

>TDEL0D02600 Chr4 complement(498470..500041) [1572 bp, 523 aa] {ON}
           Anc_5.441 YDR371W
          Length = 523

 Score =  446 bits (1147), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 226/502 (45%), Positives = 319/502 (63%), Gaps = 41/502 (8%)

Query: 30  EMCLYKKIFKNQRSNKIRDSFNNGGHKVPNMDQTQGPNVDGEGFVSGVYYSNWSPYKPRF 89
           EMC YKKIF      K+ D   +   +   +  T    V+   ++SG+YYSNWSPY PR 
Sbjct: 23  EMCFYKKIFHRSAQRKVVDYVQSQPQQAQLV--TNPGTVEPGQYLSGLYYSNWSPYSPRM 80

Query: 90  HFPHDINLTQVSHVYYAFFRINPRTGGIESTDNWSDLEMNLYKPLAIKSSELIDGNSSND 149
           HFPHDI+L++VSH+YYAFF ++  TG ++  D WSD+ M+LYKP+AIK ++L +    ND
Sbjct: 81  HFPHDIDLSRVSHIYYAFFLVDGATGALKLGDEWSDVGMDLYKPMAIKLNKL-NPEVKND 139

Query: 150 IQK---ILPLGCIGELFYLKHS-----CSGKKFKVIMSIGGWSDSENFKVIIKNENLLQA 201
           +++   ILP GC+GELFY++++      + + FKVIM +GGWS+ E F  +++N   +  
Sbjct: 140 LERQRRILPNGCLGELFYMRNANLFPNRNIRDFKVIMCVGGWSNREEFPKMVRNPKRVDK 199

Query: 202 FVDSSVETMFKLGFDGIDLDWEFPENNKSEPQGYLKLVRMLRSKLNSLESQIFGEGV-ED 260
           F+DS +ETMFK GFDGIDLDWEFPE++  EPQ YL+L + L+ ++N LE  IFG  +   
Sbjct: 200 FIDSCIETMFKYGFDGIDLDWEFPEDDGFEPQMYLQLAKRLKERMNELEDAIFGPNMNHP 259

Query: 261 HFQLSIAAPAFKDKLYYLPIPEIDQYIDYWNMMTYDYYGSWSETTGYHSNL-------FS 313
            FQLS+A PAF +KL  LPI E+D+YID WNMMTYDY+G WSE TGYH NL       F 
Sbjct: 260 KFQLSMATPAFSEKLDILPITEMDKYIDIWNMMTYDYHGEWSEKTGYHCNLYNGSTKSFD 319

Query: 314 ETE------------LSGNFAIHYMIDKFGINSRKLVLGMAAYGRSFHIKGSGFQPFTQN 361
           ET             L  + AI +M++  G+NS K+ LGMAAYGR F    +     + +
Sbjct: 320 ETHQKHIYSTESVEGLDAHSAIEHMLNVAGVNSHKICLGMAAYGRGF----TNVVAQSTD 375

Query: 362 TILINQSFKGVGKLTKEVNKADGKEGIWPYKNLPKKGTIERYDPKYVSAYCFDEKNSIFI 421
              I++ F GVG        +DG+ G+W Y  LP +GT E +DP YVS +C+   +  F+
Sbjct: 376 KRFIDKPFHGVG------GASDGEPGMWLYNQLPIQGTHELFDPDYVSGFCYSSTSKTFV 429

Query: 422 SYDNTKSVKTKAEYVLHNKLGGGFWWESCGETYANESRSLIHAFNEGLRSNVSTKPSMFE 481
            YD+ +SV+ KA+YV    L GGFWWESCG+ +AN+SRSL++AF   ++        M+ 
Sbjct: 430 GYDSVESVRFKAQYVREKNLAGGFWWESCGDDHANQSRSLLNAFTNEIKFVSKFDDLMYR 489

Query: 482 NERVVNFYLNKYGNNGFLTPYL 503
              V+ +Y+NK+GN+ FL+P++
Sbjct: 490 QTPVLRYYVNKFGNDAFLSPFI 511

>TBLA0A02790 Chr1 complement(672252..673895) [1644 bp, 547 aa] {ON}
           Anc_5.441 YDR371W
          Length = 547

 Score =  440 bits (1131), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 227/523 (43%), Positives = 327/523 (62%), Gaps = 52/523 (9%)

Query: 30  EMCLYKKIFKNQRSNKIRDSF---------NNGGHKVPNMDQTQGPNVDGEGFVSGVYYS 80
           EMC Y K+F  ++  ++ +           NN  +++ +   T     + +G+ SGVYYS
Sbjct: 25  EMCFYDKLFNKKKEQQVLNQLQPPTKIEPLNNVDNEIKDNKNTNLTVANPQGYTSGVYYS 84

Query: 81  NWSPYKPRFHFPHDINLTQVSHVYYAFFRINPRTGGIESTDNWSDLEMNLYKPLAIKSSE 140
           NWSPY PR HFPHDI+ +++SHVYY+FF +N   G +E  D WSD+EM+LYKPL+IK  +
Sbjct: 85  NWSPYSPRKHFPHDIDFSRISHVYYSFFLVNGDNGKVELGDKWSDIEMDLYKPLSIKLGK 144

Query: 141 LI-------DGNSSNDIQKILPLGCIGELFYLKHSC--------SGKKFKVIMSIGGWSD 185
           L        +  + + I+  LP GCIGE FYL++S         + K FK+IM+IGGWS+
Sbjct: 145 LKNKVDVYEEPQTQSTIKTNLPKGCIGEFFYLRNSKLLPTINTENSKNFKMIMTIGGWSN 204

Query: 186 SENFKVIIKNENLLQAFVDSSVETMFKLGFDGIDLDWEFPENNKSEPQGYLKLVRMLRSK 245
            ++F  + K+   +  FV S++E MF+ GFDGIDLDWEFP+NN  EP  YLK+++ LR  
Sbjct: 205 RDSFPKMAKSPQKIHNFVTSAIEMMFEYGFDGIDLDWEFPKNNTQEPAVYLKIMQQLRQG 264

Query: 246 LNSLESQIFGEG---VED--HFQLSIAAPAFKDKLYYLPIPEIDQYIDYWNMMTYDYYGS 300
           +N LE +I+      VE+  HFQLS+A+PAF++KL  LPI E+++ +DYWNMMTYDY G 
Sbjct: 265 MNELEEEIYKNSAVPVEERKHFQLSVASPAFEEKLSVLPIKEMNKVLDYWNMMTYDYNGE 324

Query: 301 WSETTGYHSNLFS-------ETELSGNFAIHYMIDKFGINSRKLVLGMAAYGRSF----- 348
           WSE TGYHSNL+        E  L+ + AI YMI+  G+   KLVLG+A YGR +     
Sbjct: 325 WSEKTGYHSNLYDGSKVKHDEEVLNADSAIKYMIETQGVEPNKLVLGLAGYGRGYTNVNV 384

Query: 349 -HIKGSG----FQPFTQNTILINQSFKGVGKLTKEVNKADGKEGIWPYKNLPKKGTIERY 403
            HI+G G     +  T + + I+  +KGVG       +++G+ G+W Y  LP KG+IE++
Sbjct: 385 NHIQGFGKNNKERELTGDEVFIDLEYKGVG------GESEGEPGMWMYNQLPIKGSIEQF 438

Query: 404 DPKYVSAYCFDEKNSIFISYDNTKSVKTKAEYVLHNKLGGGFWWESCGETYANESRSLIH 463
           DPK+VSAYC+D K +  ++YDN +S+  K +YV    L GGF WESCG+ + N  RSLI 
Sbjct: 439 DPKFVSAYCYDLKTNTLVTYDNVESMNVKGQYVKDKGLAGGFMWESCGDVHDNPKRSLIT 498

Query: 464 AFNEGLRSNVSTKPSMFENERVVNFYLNKYGNNGFLTPYLKHM 506
           AF   L      + S+F++E+   FYL ++GN G+L+  +  +
Sbjct: 499 AFTNELGKIKKQESSIFQDEKTFEFYLEEFGNEGYLSEAIAKL 541

>Kpol_1062.25 s1062 complement(56775..58376) [1602 bp, 533 aa] {ON}
           complement(56775..58376) [1602 nt, 534 aa]
          Length = 533

 Score =  437 bits (1125), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 233/518 (44%), Positives = 326/518 (62%), Gaps = 62/518 (11%)

Query: 30  EMCLYKKIFKN-QRSNKIRDSFNNG----GHKVPNMDQTQGPNVDGEGFVSGVYYSNWSP 84
           E  LY+K  K+  +   I DS N      G   PN       N D  G+  GVYYSNWSP
Sbjct: 24  ESFLYQKFLKHGSKEESIEDSINESQIVYGKSFPN-------NPDS-GYDVGVYYSNWSP 75

Query: 85  YKPRFHFPHDINLTQVSHVYYAFFRINPRTGGIESTDNWSDLEMNLYKPLAIKSSEL-ID 143
           Y PR H PHD++ ++++HVYYAFF ++ +TG + ++DNWSD EM+ YKPLA+K  +L +D
Sbjct: 76  YTPRLHLPHDMDFSRLTHVYYAFFVVDSKTGALTTSDNWSDFEMDCYKPLAMKLKKLQLD 135

Query: 144 GNSSNDIQKILPLGCIGELFYLKHSC-----SGKKFKVIMSIGGWSDSENFKVIIKNENL 198
              +   +  LP+GCIGELFYL+HS      + +KFK+IMS+GGWS+ E F  +I++   
Sbjct: 136 HFFNPKFKNGLPMGCIGELFYLRHSQLFDSNNSRKFKLIMSVGGWSNREAFPRMIRDSKK 195

Query: 199 LQAFVDSSVETMFKLGFDGIDLDWEFPENNKSEPQGYLKLVRMLRSKLNSLESQIFG-EG 257
           L AFV+S +E MF  GFDGI+LDWEFP+++K EP+ YL+LV+ L+ K N LE +IF   G
Sbjct: 196 LDAFVNSCIENMFNYGFDGIELDWEFPKDDKLEPKMYLELVKKLKWKQNELEQKIFNNSG 255

Query: 258 VEDH-----FQLSIAAPAFKDKLYYLPIPEIDQYIDYWNMMTYDYYGSWSETTGYHSNLF 312
             +H     F LSIAAPAFK+KL  L + E+D Y+D WNMMTYDY+G WSE TGYHSNL+
Sbjct: 256 NGNHSKRPKFHLSIAAPAFKEKLDILLMREMDHYVDVWNMMTYDYHGEWSEKTGYHSNLY 315

Query: 313 SETE---------------------------LSGNFAIHYMIDKFGINSRKLVLGMAAYG 345
           S  E                           L+G++AI+Y+I K+ IN +K+ LGMAAYG
Sbjct: 316 SPQETRNEDDDDDDRDEDNEDDDDDEDDESNLNGDYAINYVIKKYHINPKKINLGMAAYG 375

Query: 346 RSFHIKGSGFQPFTQNTILINQSFKGVGKLTKEVNKADGKEGIWPYKNLPKKGTIERYDP 405
           R F    +     +Q+T  IN+ ++GVG        ++G+ G+W Y  LP K ++E +DP
Sbjct: 376 RGF----TKVNASSQDTRFINKPYRGVG------GASEGEPGMWLYNQLPIKNSLEEFDP 425

Query: 406 KYVSAYCFDEKNSIFISYDNTKSVKTKAEYVLHNKLGGGFWWESCGETYANESRSLIHAF 465
            YVSA+C+D+K+  F+ YDN  S+K KA+YV  + L GGFWWESCG+ + N  +SL++AF
Sbjct: 426 DYVSAFCYDKKSKTFVGYDNRDSMKVKAQYVKEHNLKGGFWWESCGDDHKNPEKSLLNAF 485

Query: 466 NEGLRSNVSTKPSMFENERVVNFYLNKYGNNGFLTPYL 503
            + + S      +MF N  V+ +YL   G+ GFL+ ++
Sbjct: 486 TDEIGSVTEKNETMFTNIEVLKYYLKTKGDTGFLSTFI 523

>NDAI0B05710 Chr2 (1389267..1390958) [1692 bp, 563 aa] {ON}
           Anc_5.441 YDR371W
          Length = 563

 Score =  426 bits (1096), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 223/477 (46%), Positives = 303/477 (63%), Gaps = 59/477 (12%)

Query: 73  FVSGVYYSNWSPYKPRFHFPHDINLTQVSHVYYAFFRINPRTGGIESTDNWSDLEMNLYK 132
           FVSGVYYS+WSPYKPR+HFPHDI+LT+++HVYY+FF +N  TG +  +D WSDL+M+LYK
Sbjct: 93  FVSGVYYSSWSPYKPRYHFPHDIDLTKITHVYYSFFLVNGATGDVTCSDEWSDLKMDLYK 152

Query: 133 PLAIK-------SSELIDGNSSN------DIQKILPLGCIGELFYLKHSCSGKKFKVIMS 179
           PL++K          L D N +        ++K LPLGC+GELFYLK     + FK+IMS
Sbjct: 153 PLSLKLNTLHQNDKVLHDKNKTRLNETIEKMKKQLPLGCVGELFYLK---KFQNFKLIMS 209

Query: 180 IGGWSDSENFKVIIKNENLLQAFVDSSVETMFKLGFDGIDLDWEFPENNKSEPQGYLKLV 239
           IGGWS+ E+F  +++++N L  F++SSVE MFK GFDGIDLDWEFPE++  EP  YL++V
Sbjct: 210 IGGWSNREHFPSMVRDDNKLNQFIESSVEQMFKYGFDGIDLDWEFPEDDGFEPGKYLEIV 269

Query: 240 RMLRSKLNSLESQIFGEGV-----EDH------FQLSIAAPAFKDKLYYLPIPEIDQYID 288
           + LR +++ LE  IF +        DH      F+LS+A PAF +KL  LPI E+++YID
Sbjct: 270 QRLRKRMDKLEHDIFQKSKISPHDYDHDYHHPKFELSVATPAFIEKLNILPIKEMNKYID 329

Query: 289 YWNMMTYDYYGSWSETTGYHSNLF------------------SETELSGNFAIHYMIDKF 330
           YWNMMTYDYYG WSE TGYH NL+                  S   L+ N AI+YM+   
Sbjct: 330 YWNMMTYDYYGDWSEETGYHCNLYEGGNNGTINAQYKHEHTSSNKGLNANDAINYMLYNN 389

Query: 331 GINSRKLVLGMAAYGRSFHIKGSGFQPFTQNTILINQSFKGVGKLTKEVNKADGKEGIWP 390
            ++SRKLVLG+AAYGR F    +  +    + + IN+ F GVG        + G+ G+W 
Sbjct: 390 NVSSRKLVLGLAAYGRGF----TKVKVNKNDELFINKKFDGVG------GASAGEPGMWL 439

Query: 391 YKNLPKKGTIERYDPKYVSAYCFDEKNSIFISYDNTKSVKTKAEYVLHNKLGGGFWWESC 450
           Y  LP K + E +DP YVSA+C+D K   F+ YDN  ++K KA+YV    L GGFWWESC
Sbjct: 440 YNQLPIKNSKEMFDPNYVSAFCYDPKTKTFVGYDNVDTMKVKAKYVQDRHLAGGFWWESC 499

Query: 451 GETYANESRSLIHAFNEGLRSNVSTKPS----MFENERVVNFYLNKYGNNGFLTPYL 503
           G+ + +  RSL++AF   L      K      ++E    + +YLN +GN+GFL+P+ 
Sbjct: 500 GDDHKHPERSLLNAFTNQLEVKHLMKYEDSHLIYEQPDTIKYYLNYFGNDGFLSPFF 556

>SAKL0G02684g Chr7 (220460..222079) [1620 bp, 539 aa] {ON} similar
           to uniprot|Q06350 Saccharomyces cerevisiae YDR371W CTS2
           Sporulation-specific chitinase
          Length = 539

 Score =  423 bits (1088), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 213/507 (42%), Positives = 323/507 (63%), Gaps = 43/507 (8%)

Query: 30  EMCLYKKIFKNQRSNKIRDSFN--NGGHKVPNMDQTQGP-NVDGEGFVSGVYYSNWSPYK 86
           EM ++    K + + K +  ++  N      N+ +  GP + D + ++SGVYY+NWSPY 
Sbjct: 43  EMSVFFGTLKGRATQKFKQIYSDMNSNDNNQNLQEEVGPASNDSQSYISGVYYTNWSPYA 102

Query: 87  PRFHFPHDINLTQVSHVYYAFFRINPRTGGIESTDNWSDLEMNLYKPLAIK-SSELIDGN 145
           PR HFPHD+N  ++++V+Y+FF ++P++G ++S+D WSD +M+LYK    +  + L+  +
Sbjct: 103 PRNHFPHDMNFHRITNVFYSFFVVDPKSGTVKSSDEWSDFQMDLYKKFYPQFKAALLSSS 162

Query: 146 SSNDIQ----KILPLGCIGELFYLKHSC---------SGKKFKVIMSIGGWSDSENFKVI 192
           SS+  Q    ++LP+GCIGELFYLK+S            + FKV MS+GGWS+ + F +I
Sbjct: 163 SSSTFQSHKKEMLPMGCIGELFYLKYSSILPSLHGDGVHRNFKVSMSVGGWSNRDAFPII 222

Query: 193 IKNENLLQAFVDSSVETMFKLGFDGIDLDWEFPENNKSEPQGYLKLVRMLRSKLNSLESQ 252
           ++++N    F+ + VETMF+ GFDG+D+DWEFP+N+  EP+ YL ++R LR  L+ LE  
Sbjct: 223 VRDKNKFDTFIRTCVETMFQYGFDGLDIDWEFPQNDGLEPKMYLTMIRRLREALDDLERD 282

Query: 253 IF-GEGVEDHFQLSIAAPAFKDKLYYLPIPEIDQYIDYWNMMTYDYYGSWSETTGYHSNL 311
           IF  E   +HF L++A PAFK+KL  LP+ ++D Y+D+WN+M YDY+G WSE TGYHSNL
Sbjct: 283 IFQDEHHSEHFFLTVAVPAFKEKLQVLPLRDMDAYVDFWNLMAYDYHGEWSELTGYHSNL 342

Query: 312 FSE--------------TELSGNFAIHYMIDKFGINSRKLVLGMAAYGRSFHIKGSGFQP 357
           +SE               +L+ + A+ Y++  FGINSRK+VLGMAAYGR F    +  + 
Sbjct: 343 YSEDSNHVHRRHFRDEENQLNADSAVKYLLKNFGINSRKVVLGMAAYGRGF----TRVKT 398

Query: 358 FTQNTILINQSFKGVGKLTKEVNKADGKEGIWPYKNLPKKGTIERYDPKYVSAYCFDEKN 417
              +   I + + GVG        ++G+ G+W Y  LP  GT+E +DP+ VSAY FD K+
Sbjct: 399 TANSGSYIGKPYNGVG------GASEGEPGMWLYNQLPLPGTLENFDPRSVSAYSFDPKS 452

Query: 418 SIFISYDNTKSVKTKAEYVLHNKLGGGFWWESCGETYANESRSLIHAFNEGLRSNVSTKP 477
             F+ YDN  S++ KA+YV ++ L GGFWWESCG+ + +E +SL++AF   L S    +P
Sbjct: 453 KTFVGYDNVDSMRCKAQYVKNHNLAGGFWWESCGDNHKDEQKSLLNAFTNDLGSLAKQQP 512

Query: 478 SMFENERVVNFYLNKYGNNGFLTPYLK 504
           S++ +  V+ +YL  Y   GFL+   K
Sbjct: 513 SIYTSAHVIRYYLKNYP-QGFLSRVFK 538

>CAGL0A02904g Chr1 (302938..304443) [1506 bp, 501 aa] {ON} similar
           to uniprot|Q06350 Saccharomyces cerevisiae YDR371w
          Length = 501

 Score =  411 bits (1057), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 208/495 (42%), Positives = 306/495 (61%), Gaps = 38/495 (7%)

Query: 30  EMCLYKKIFKNQRSNKIRDSFNNGGHKVPNMDQTQGPNVDGEGFVSGVYYSNWSPYKPRF 89
           +M L+ KIF+  +     D +     ++P  D      +    +++G+YYSNWSPY+PR 
Sbjct: 23  QMSLHYKIFQKLKRRSQSDDY-----RMPESDV-----LSNTSYIAGLYYSNWSPYEPRL 72

Query: 90  HFPHDINLTQVSHVYYAFFRINPRTGGIESTDNWSDLEMNLYKPLAIKSSELIDGNSSND 149
           HFPHDI+  +VSH+YYAF  I+P TG + S+D WSD ++NL K       +   G+    
Sbjct: 73  HFPHDIDFEKVSHIYYAFLLIDPETGNLTSSDEWSDTQLNLAKQCREYMFKRFTGDELKA 132

Query: 150 IQKI-LPLGCIGELFYLKHSCSGKK---FKVIMSIGGWSDSENFKVIIKNENLLQAFVDS 205
           +  I  P GCIGEL YL++  S  K    K+IMS+GGWS+ E+F +++++E   + F++S
Sbjct: 133 VTNIRAPPGCIGELNYLRYIYSKIKKRNVKLIMSVGGWSNRESFPIMVRDELKFKNFINS 192

Query: 206 SVETMFKLGFDGIDLDWEFPENNKSEPQGYLKLVRMLRSKLNSLESQIFGEGVEDHFQLS 265
            +ETM   GFDGIDLDWEFPE++  EP  YL++ R L+ +L  LE+ I G+     FQLS
Sbjct: 193 CIETMVYYGFDGIDLDWEFPEDDSYEPDAYLRMARELKLQLQKLEANILGDHSNKTFQLS 252

Query: 266 IAAPAFKDKLYYLPIPEIDQYIDYWNMMTYDYYGSWSETTGYHSNLFSE----------- 314
           +A PAFKDKL  LPI ++D+YID WN+MTYDYYG WSE TG H+NL++E           
Sbjct: 253 MATPAFKDKLSILPIHKLDKYIDLWNLMTYDYYGEWSERTGLHANLYNEKGKLLHLHRHD 312

Query: 315 --TELSGNFAIHYMIDKFGINSRKLVLGMAAYGRSF-HIKGSGFQPFTQNTILINQSFKG 371
               LSG+ AI+YM+++  I+ RK++LGMAAYGR F ++      P     +     F G
Sbjct: 313 EDAGLSGDAAINYMVNRCKIDPRKVILGMAAYGRGFTNVDMKSTNPHNPYGL----KFSG 368

Query: 372 VGKLTKEVNKADGKEGIWPYKNLPKKGTIERYDPKYVSAYCFDEKNSIFISYDNTKSVKT 431
           VG        ++G+ G+W Y  LP  G+ E+YD ++V AYC+D++    + YDN  SV  
Sbjct: 369 VG------GASEGEPGMWLYNQLPIPGSNEKYDYRHVGAYCYDDRTHTLVGYDNPTSVIE 422

Query: 432 KAEYVLHNKLGGGFWWESCGETYANESRSLIHAFNEGLRSNVSTKPSMFENERVVNFYLN 491
           KA Y++ N LGG FWWESCG+T+ N  RSL++ +   +R+  + K +++   ++ ++YL 
Sbjct: 423 KANYIMSNSLGGAFWWESCGDTHKNPKRSLLNTYIRVIRNVKNNKETIYSTTKLHDYYLE 482

Query: 492 KYGNNGFLTPYLKHM 506
            Y  NGFLT ++K +
Sbjct: 483 NYDTNGFLTGFIKDI 497

>TPHA0E01720 Chr5 complement(348101..349714) [1614 bp, 537 aa] {ON}
           Anc_5.441 YDR371W
          Length = 537

 Score =  406 bits (1043), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 204/458 (44%), Positives = 292/458 (63%), Gaps = 41/458 (8%)

Query: 76  GVYYSNWSPYKPRFHFPHDINLTQVSHVYYAFFRINPRTGGIESTDNWSDLEMNLYKPLA 135
           GVYYSNWSPY PR  FPHDI+ ++VSHVYY+F  ++   G I+S+D WSD ++++YKPL 
Sbjct: 81  GVYYSNWSPYSPRLFFPHDIDTSRVSHVYYSFLLVDGDEGTIKSSDTWSDFQIDMYKPLY 140

Query: 136 IKSSELIDGNSSNDI---QKILPLGCIGELFYLK------HSCSGKKFKVIMSIGGWSDS 186
           +   ++ +   S  I   +++LP+GCIGE FYL+      H      FKV MS+GGWS+ 
Sbjct: 141 LSLGQVDNDFDSVPISMKKELLPMGCIGEFFYLRNTRIPIHGPKSTDFKVFMSVGGWSNR 200

Query: 187 ENFKVIIKNENLLQAFVDSSVETMFKLGFDGIDLDWEFPENNKSEPQGYLKLVRMLRSKL 246
           E F  ++++   +  F++S ++TMF  GFDGIDLDWEFPE++  EP  YL +++ L+ K+
Sbjct: 201 EAFPKMVRDPQKVDKFINSCIDTMFMYGFDGIDLDWEFPEDDGFEPMMYLDIIKRLKMKM 260

Query: 247 NSLESQIFGEGVE-----DHFQLSIAAPAFKDKLYYLPIPEIDQYIDYWNMMTYDYYGSW 301
             LE+ I+ + +       HF+LSIAAPAF +KL  LP+ ++D+++D WNMMTYDY G W
Sbjct: 261 LELEATIYKDAISHNTSYPHFELSIAAPAFDEKLRILPVQQMDKFVDKWNMMTYDYSGEW 320

Query: 302 SETTGYHSNLFSETELSGNF----------------AIHYMIDKFGINSRKLVLGMAAYG 345
           S+ TGYHSNLFS  ++SG+                 A+ YM D   I+SRK++LGMAAYG
Sbjct: 321 SDVTGYHSNLFSPPDVSGSVMKRSQSNSNETLCGDNAVKYMKDNLKISSRKIILGMAAYG 380

Query: 346 RSFHIKGSGFQPFTQNTILINQSFKGVGKLTKEVNKADGKEGIWPYKNLPKKGTIERYDP 405
           R F    SG      N  L  + F GV   + +      + G+W Y  LP KG+ E +D 
Sbjct: 381 RGF----SGVSKSKTNGKLTGKKFNGVSGSSPD------EPGVWLYNKLPIKGSKEEFDK 430

Query: 406 KYVSAYCFDEKNSIFISYDNTKSVKTKAEYVLHNKLGGGFWWESCGETYANESRSLIHAF 465
           + VSAYC+D K+ IF++YDN++S+  K++YV  N LGGGF WE+CGE   N   SLI++F
Sbjct: 431 ESVSAYCYDPKSKIFVAYDNSQSMVIKSKYVRDNNLGGGFLWEACGEKLNNPKLSLINSF 490

Query: 466 NEGLRSNVSTKPSMFENERVVNFYLNKYGNNGFLTPYL 503
              + +N+  + SMF N +V+ +YL KYG  GFL+ Y+
Sbjct: 491 TFDM-NNIDKQKSMFSNRKVLEYYLMKYGKQGFLSGYI 527

>KNAG0C04870 Chr3 complement(943386..944762) [1377 bp, 458 aa] {ON}
           Anc_5.441 YDR371W
          Length = 458

 Score =  387 bits (995), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 197/448 (43%), Positives = 276/448 (61%), Gaps = 36/448 (8%)

Query: 63  TQGPNVDGEGFVSGVYYSNWSPYKPRFHFPHDINLTQVSHVYYAFFRINPRTGGIESTDN 122
            Q P    + +VSGVYYS+WSPY+PR HFP +I+ ++++H+YY+FF ++  +  ++  D+
Sbjct: 41  AQCPQNVNQKYVSGVYYSDWSPYEPRMHFPKNIDTSKITHIYYSFFLVDADSSALKLGDS 100

Query: 123 WSDLEMNLYKPLAIKSSELIDGNSSNDIQKILPLGCIGELFYLKHSCSGKKFKVIMSIGG 182
           WSD+EM + K   +K                   GCIG L  L+    G  FK IM++GG
Sbjct: 101 WSDIEMPMGKNTVLK-------------------GCIGALNSLRDEKPG--FKNIMAVGG 139

Query: 183 WSDSENFKVIIKNENLLQAFVDSSVETMFKLGFDGIDLDWEFPENNKSEPQGYLKLVRML 242
           WS+ + F + ++ ++ ++    S VETMF+ GFDGIDLDWE+P+++  EP+ YL+L+R +
Sbjct: 140 WSNKDAFPLALRKKHGVEKLAQSCVETMFQYGFDGIDLDWEYPKDDGKEPRIYLELMRKI 199

Query: 243 RSKLNSLESQIFGEGVEDHFQLSIAAPAFKDKLYYLPIPEIDQYIDYWNMMTYDYYGSWS 302
           R  +N LE  I+G+  +  F LS+A PAF DKL   PI E+DQYIDYWNMMTYDYYG WS
Sbjct: 200 RQHMNELEIAIWGDK-KRRFHLSVATPAFYDKLETFPIKEMDQYIDYWNMMTYDYYGEWS 258

Query: 303 ETTGYHSNL------FSETELSGNFAIHYMIDKFGINSRKLVLGMAAYGRSFHIKGSGFQ 356
             TG+HSNL      FSE  L  + AI YM +K GINSRK+VLGMA YGR F     G  
Sbjct: 259 SGTGFHSNLYDGTNKFSEHSLCADGAIRYMTNKIGINSRKVVLGMALYGRGFTNVKEGDP 318

Query: 357 PFTQNTILINQSFKGVGKLTKEVNKADGKEGIWPYKNLPKKGTIERYDPKYVSAYCFDEK 416
             T    LIN+ FKGVG       +++G+ G+W Y  LP +GT E +D +Y SAYCFD K
Sbjct: 319 KKTSG--LINRKFKGVG------GESEGEPGMWLYNQLPIRGTQEVFDEQYGSAYCFDPK 370

Query: 417 NSIFISYDNTKSVKTKAEYVLHNKLGGGFWWESCGETYANESRSLIHAFNEGLRSNVSTK 476
               + YDN  S + KA+YV  + L GGFWWESCG  + N  +SL+H FNE +      +
Sbjct: 371 TKTLVGYDNVDSTRQKAQYVRFHNLAGGFWWESCGNKWDNVQQSLVHVFNEDIERLDRNE 430

Query: 477 PSMFENERVVNFYLNKYGNNGFLTPYLK 504
            +++++ ++   YL  +  +GFL    K
Sbjct: 431 TNLYQDPKLREHYLQIFAKSGFLAATFK 458

>KAFR0E03810 Chr5 complement(756701..758173) [1473 bp, 490 aa] {ON}
           Anc_5.441 YDR371W
          Length = 490

 Score =  377 bits (967), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 194/453 (42%), Positives = 281/453 (62%), Gaps = 49/453 (10%)

Query: 73  FVSGVYYSNWSPYKPRFHFPHDINLTQVSHVYYAFFRINPRTGGIESTDNWSDLEMNLYK 132
           F  G+YYSNWS Y+PR HFPH+IN   +SHVYYAFF ++ + G + S D W+D +    +
Sbjct: 58  FSCGLYYSNWSAYEPRLHFPHEINFDHISHVYYAFFLVDGKNGKLVSGDKWADFQ----R 113

Query: 133 PLAIKSSELIDGNSSNDIQKILPLGCIGELFYLKHSCSGKKFKVIMSIGGWSDSENFKVI 192
           P+ +K+++L+ GN             +GELF LK      + K IM IGGWS+ E + + 
Sbjct: 114 PI-LKNNKLVKGN-------------VGELFDLKMK---NRVKCIMCIGGWSNREAWHIF 156

Query: 193 IKNENLLQAFVDSSVETMFKLGFDGIDLDWEFPENNKSEPQGYLKLVRMLRSKLNSLESQ 252
             + + +++F + +V+ MF+ GFDGIDLDWE+PE++  EPQ YL+++R ++  +N LES+
Sbjct: 157 STDPSKIESFTEQAVKMMFEYGFDGIDLDWEYPEDDGIEPQLYLEIMRRIKHHMNKLESE 216

Query: 253 IFGE--GVEDHFQLSIAAPAFKDKLYYLPIPEIDQYIDYWNMMTYDYYGSWSETTGYHSN 310
           IF +      +F+LS+A PAFKDKL   P+ E+D  IDYWNMMTYDYYG WSE TGYHSN
Sbjct: 217 IFKDTSATTSYFELSVATPAFKDKLEIFPLKEMDTVIDYWNMMTYDYYGEWSERTGYHSN 276

Query: 311 LF-----------------SETE-LSGNFAIHYMIDKFGINSRKLVLGMAAYGRSFHIKG 352
           L+                 SE E L+G++A+ YMI++ GI   K++LGMAAYGR F    
Sbjct: 277 LYDGSKGSTTIESVLRHGMSEVEGLNGDYAVKYMINQ-GIKKDKIILGMAAYGRGFTNVD 335

Query: 353 SGFQPFTQNTILINQSFKGVGKLTKEVNKADGKEGIWPYKNLPKKGTIERYDPKYVSAYC 412
                  ++   I ++F GVG        ++G+ G+W Y  LP  GT+E++DP+YVS YC
Sbjct: 336 VPTPRPNESPRYIGRTFDGVG------GASEGEPGMWRYDQLPIPGTVEQFDPRYVSGYC 389

Query: 413 FDEKNSIFISYDNTKSVKTKAEYVLHNKLGGGFWWESCGETYANESRSLIHAFNEGL-RS 471
           F+     F+ YD   SV+ K +Y+    +GGGFWWESCG+T+ N  RSL++A+ + L R 
Sbjct: 390 FEPTTGTFVGYDTIDSVRVKTQYIKMKDIGGGFWWESCGDTHKNPERSLVNAYVKELGRD 449

Query: 472 NVSTKPSMFENERVVNFYLNKYGNNGFLTPYLK 504
           N+    S+++N   V+ Y   +   GFL+ YLK
Sbjct: 450 NIKKPESIYKNLHCVSHYKQSFHGKGFLSKYLK 482

>KLTH0F15906g Chr6 complement(1293832..1295379) [1548 bp, 515 aa]
           {ON} similar to uniprot|Q06350 Saccharomyces cerevisiae
           YDR371W CTS2 Sporulation-specific chitinase
          Length = 515

 Score =  369 bits (947), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 210/495 (42%), Positives = 301/495 (60%), Gaps = 50/495 (10%)

Query: 41  QRSNKIR---DSFNNGGHKVPNM----DQTQGPNVDGE-GFVSGVYYSNWSPYKPRFHFP 92
           Q S K+R   + FNN G     +    D   G + D E GFV+G+YYSNWSPY  R HFP
Sbjct: 31  QTSTKMRAFQEHFNNLGRSGAMLSTSNDAGTGLSADNESGFVTGMYYSNWSPYAARKHFP 90

Query: 93  HDINLTQVSHVYYAFFRINPRTGGIESTDNWSDLEMNLYKPLAIKSSELIDGNSS--NDI 150
           HDI+  +++HVYYAF  +N  TG  + +D WSD++M+LYK + I S + +D  +      
Sbjct: 91  HDIDFRKLTHVYYAFLVVNSETGECQLSDEWSDVQMDLYKQM-ISSFKKLDLRAQFPTGS 149

Query: 151 QKILPLGCIGELFYLKHS---------CSGKKFKVIMSIGGWSDSENFKVIIKNENLLQA 201
           +  LPLGCIGELF+LK+S              FK IMS+GGWS+ E F  ++++   L+ 
Sbjct: 150 KDKLPLGCIGELFFLKYSNFLTRNGGSAGVNNFKTIMSVGGWSNREAFTSLVESPAKLEV 209

Query: 202 FVDSSVETMFKLGFDGIDLDWEFPENNKSEPQGYLKLVRMLRSKLNSLESQIFG-EGVED 260
           F+DS V  MF+ GFDGID+DWEFP+N+  EP+ YL++++ LR +L++LESQIFG +  + 
Sbjct: 210 FLDSCVSKMFEYGFDGIDIDWEFPKNDAKEPKVYLQMLKALRERLDTLESQIFGSKDHKH 269

Query: 261 HFQLSIAAPAFKDKLYYLPIPEIDQYIDYWNMMTYDYYGSWSETTGYHSNLFSETEL--- 317
           HF L+ A  A ++ L YLP+ E D+Y+DYWN+M YD+ G+WS  T Y SNL++  +    
Sbjct: 270 HFALTSAISADEECLKYLPLQEADRYVDYWNLMAYDFSGAWSAQTAYQSNLYTPAKTNKR 329

Query: 318 ------SGNFAIHYMIDKFGINSRKLVLGMAAYGRSFHIKGSGFQPFTQNTILINQSFKG 371
                 S + A+ ++ DK  + S+K+VLGM AYGR F           +   + ++S + 
Sbjct: 330 STNGRGSADKAVRFLTDKSKLASKKIVLGMPAYGRGF-----------KGVEVSHKSIEN 378

Query: 372 V-GKLTKEVN-KADGKEGIWPYKNLPKKGTIERYDPKYVSAYCF----DEKNSIFISYDN 425
           V GK  ++V+  ++G+EGI  YK LP KG +E +D   VSAYC     ++K +  I YDN
Sbjct: 379 VIGKPFQDVSGSSEGEEGISLYKQLPLKGGMEFFDHNAVSAYCVKLSHNKKQAELIVYDN 438

Query: 426 TKSVKTKAEYVLHNKLGGGFWWESCGETYANESRSLIHAFNEGLRSNVSTKPSMFENERV 485
             S+  KA YV  N LGGGFWWESCGE Y  + +SL+ AF + ++    T+P+++    V
Sbjct: 439 VDSMIQKAHYVEKNHLGGGFWWESCGEDY--KGKSLVGAFTKEIKCLNKTEPTIYSLPEV 496

Query: 486 VNFYLNKYGNNGFLT 500
           V  YL K    GFL 
Sbjct: 497 VQHYL-KLHPGGFLA 510

>Kwal_55.21402 s55 complement(821930..823480) [1551 bp, 516 aa] {ON}
           YDR371W (CTS2) - chitinase [contig 130] FULL
          Length = 516

 Score =  366 bits (940), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 200/460 (43%), Positives = 284/460 (61%), Gaps = 45/460 (9%)

Query: 71  EGFVSGVYYSNWSPYKPRFHFPHDINLTQVSHVYYAFFRINPRTGGIESTDNWSDLEMNL 130
            G  SG+YYSNWSPYK R HFPHDI+  +++ V+Y+F  +N  TG  + +D WSD++M+L
Sbjct: 69  RGLTSGIYYSNWSPYKARKHFPHDIDFRRLTEVFYSFLVVNGETGECQLSDEWSDVQMDL 128

Query: 131 YKPLAIKSSELID------GNSSNDIQKILPLGCIGELFYLKHSC---------SGKKFK 175
           YK +   + E +D       +S ND    LPLGCIGELFYLK++            K FK
Sbjct: 129 YKQM-FSAFEKVDLKRQFPQSSRND----LPLGCIGELFYLKYTDFLSKMGGPEDVKNFK 183

Query: 176 VIMSIGGWSDSENFKVIIKNENLLQAFVDSSVETMFKLGFDGIDLDWEFPENNKSEPQGY 235
            IMS+GGWS+ E F+ ++++   ++ F++S V+ MFK GFDGID+DWEFP+N+ +EP+ Y
Sbjct: 184 TIMSVGGWSNREAFESLVQSPAKMKVFINSCVDQMFKYGFDGIDIDWEFPKNDSTEPKAY 243

Query: 236 LKLVRMLRSKLNSLESQIFG-EGVEDHFQLSIAAPAFKDKLYYLPIPEIDQYIDYWNMMT 294
           L ++R LR KL+ LES IFG E    HF L+ A  A    L YLP+ EID+Y+D WN+M 
Sbjct: 244 LDMMRSLRKKLDDLESDIFGTEKHTQHFLLTSAISADPSCLEYLPLGEIDRYVDQWNLMA 303

Query: 295 YDYYGSWSETTGYHSNLFSETEL----------SGNFAIHYMIDKFGINSRKLVLGMAAY 344
           YD+ G+WS  T Y SNL+S + L          S + A+  +++K  + ++K+VLGM AY
Sbjct: 304 YDFSGAWSRHTAYQSNLYSRSSLGKRSENSEGGSADTAVRLLLNKHKLPAKKIVLGMPAY 363

Query: 345 GRSFHIKGSGFQPFTQNTILINQSFKGVGKLTKEVNKADGKEGIWPYKNLPKKGTIERYD 404
           GR F  KG      +++ + I QSF+ V  L+      +G+ GI  Y  LP KG  E +D
Sbjct: 364 GRGF--KGVSVPHHSEHNV-IGQSFQQVSGLS------EGESGISLYNQLPLKGGQEWFD 414

Query: 405 PKYVSAYCF----DEKNSIFISYDNTKSVKTKAEYVLHNKLGGGFWWESCGETYANESRS 460
              VSAY      +++ +  + YDN +S+K KA+YVL N LGGGFWWESCGE Y + SRS
Sbjct: 415 QDAVSAYSVKLASNKEMAELVVYDNVQSMKIKAQYVLKNNLGGGFWWESCGENYLDNSRS 474

Query: 461 LIHAFNEGLRSNVSTKPSMFENERVVNFYLNKYGNNGFLT 500
           L  AF + ++    T P+++   +V  +Y  KY  +GFL 
Sbjct: 475 LTRAFTQEIKYLNKTVPTIYALPQVGEYYHKKY-PDGFLA 513

>KLLA0E02333g Chr5 (215594..217036) [1443 bp, 480 aa] {ON} similar
           to uniprot|Q06350 Saccharomyces cerevisiae YDR371W CTS2
           Sporulation-specific chitinase
          Length = 480

 Score =  354 bits (909), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 194/485 (40%), Positives = 287/485 (59%), Gaps = 63/485 (12%)

Query: 30  EMCLYKKIFKNQRSNKIRDSFNNGGHKVPNMD-QTQGPNVDGEGFVSGVYYSNWSPYKPR 88
           EMC+   +F     +KI+   + G      +D  T+ P+   +GF    YYSNWSPY  R
Sbjct: 26  EMCIVPWLF----LDKIKKGGSAGRRPPTEIDPDTRVPSEGPDGFSVATYYSNWSPYNAR 81

Query: 89  FHFPHDINLTQVSHVYYAFFRINPRTGGIESTDNWSDLEMNLYKPLAIKSSELIDGNSSN 148
            H P DI  +Q++HVYYAFF ++ ++G ++S+D+WSD E+    PL++            
Sbjct: 82  NHKPADIPTSQLTHVYYAFFVVDAKSGAVKSSDSWSDFEL----PLSVGVK--------- 128

Query: 149 DIQKILPLGCIGELFYLKHSCSGKKFKVIMSIGGWSDSENFKVIIKNENLLQAFVDSSVE 208
                   GCI EL  +K   S  +FK I+ +GGWS+ E +K I K+E  ++ F++++V+
Sbjct: 129 --------GCIKELQKIKLE-SKHEFKTILCLGGWSNREAYKKIAKSEKKVKKFIETAVD 179

Query: 209 TMFKLGFDGIDLDWEFPENNKSEPQGYLKLVRMLRSKLNSLESQIFGEGVED----HFQL 264
            MF+ GFDGIDLDWEFPE + +EP  YL+++R +R  ++ LE QIFG   E+    HFQL
Sbjct: 180 CMFRYGFDGIDLDWEFPEEDSNEPIVYLEMMRGIREGMDQLERQIFGSPAEEKDHPHFQL 239

Query: 265 SIAAPAFKDKLYYLPIPEIDQYIDYWNMMTYDYYGSWSETTGYHSNLF------------ 312
           S+A PAF +KL  LPI E+ +Y+D WNMM YD++G WS+ TGYHSNL+            
Sbjct: 240 SVATPAFAEKLNILPISEMSKYVDIWNMMCYDFHGEWSDVTGYHSNLYLQGHSHRRSLSN 299

Query: 313 --SETELSGNFAIHYMIDKFGINSRKLVLGMAAYGRSFHIKGSGFQPFTQNTILINQSFK 370
             S + LS + A+  M D+  I+SR++ LGMAAYGR F          T +   + + + 
Sbjct: 300 RISNSSLSSDTAVKLMTDRHNISSRRIALGMAAYGRGFT------NVETNDDNYLGKKYH 353

Query: 371 GVGKLTKEVNKADGKEGIWPYKNLPKKGTIERYDPKYVSAYCFDEKNSIFISYDNTKSVK 430
           GVG        ++G+ GIW Y  LP  G+ E++D   VSAYCFD K+  F+ YDN +S+ 
Sbjct: 354 GVG------GGSEGEPGIWLYNQLPIDGSKEQFDSNAVSAYCFDPKSRTFVGYDNVQSMD 407

Query: 431 TKAEYVLHNKLGGGFWWESCGETYANESRSLIHAFNE--GLRSNVSTKPSMFENERVVNF 488
            K +Y+    L GGFWWESCG++  +  +SL++AF++  GL        S+F++++V  F
Sbjct: 408 IKGKYIKKKNLNGGFWWESCGDS-KDPRKSLVNAFSKEIGLSEGFV---SLFKSDKVKQF 463

Query: 489 YLNKY 493
           +L KY
Sbjct: 464 HLQKY 468

>ACL166W Chr3 (64828..66300) [1473 bp, 490 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YDR371W (CTS2)
          Length = 490

 Score =  346 bits (888), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 198/504 (39%), Positives = 291/504 (57%), Gaps = 67/504 (13%)

Query: 30  EMCLYKKIFKNQRSNKIRD---SFNNGGHKVPNMDQTQGPNVDGEGFVSGVYYSNWSPYK 86
           EM    K+ K + S +IR      +     VP+      P  DGE +  GVYYS+WSPYK
Sbjct: 23  EMTFLPKLIKEKLSRRIRPKPLEVHEETRPVPD-----APYPDGE-YTVGVYYSSWSPYK 76

Query: 87  PRFHFPHDINLTQVSHVYYAFFRINPRTGGIESTDNWSDLEMNLYKPLAIKSSELIDGNS 146
           PR H+P +I+  +V+HVYYAFF ++ +TG I S D WSD +M    P+ +  + +  G +
Sbjct: 77  PRLHYPRNIDFQRVTHVYYAFFVVDEKTGKIGSLDKWSDTKM----PMNL--TGMPRGLN 130

Query: 147 SNDIQKILPLGCIGELFYLKHSCSGKKFKVIMSIGGWSDSENFKVIIKNENLLQAFVDSS 206
                     G IGEL YLK +  G  FK++M++GGWS+ E F  I+++E     F+DS+
Sbjct: 131 ----------GAIGELNYLK-TRPGTDFKLMMAVGGWSNREPFHKIVRDEEKFNNFIDSA 179

Query: 207 VETMFKLGFDGIDLDWEFPENNKSEPQGYLKLVRMLRSKLNSLESQIFGEG--VEDHFQL 264
           ++ MF+ GFDGIDLDWEFP+++  EPQ YL++   LR K++ LE  I+G G   E  F L
Sbjct: 180 IDAMFEYGFDGIDLDWEFPKDDGYEPQMYLEMCSRLRHKMDELEDNIWGPGGTTEPRFHL 239

Query: 265 SIAAPAFKDKLYYLPIPEIDQYIDYWNMMTYDYYGSWSETTGYHSNLFSET--------- 315
           S+AAPAF   L   P+ E+++Y+  WNMMTYDY+G+WSE TGYHSNL++ T         
Sbjct: 240 SMAAPAFPQTLGIFPVEEMNKYLSMWNMMTYDYHGAWSERTGYHSNLYNATNSPYKSHLD 299

Query: 316 -------------ELSGNFAIHYMIDKFGINSRKLVLGMAAYGRSF-HIKGSGFQPFTQN 361
                        EL+ + AI  M ++F ++ RK+ LGMAAYGR F +++G G Q     
Sbjct: 300 KRRYEDMGIDNFDELNAHDAILMMTEQFKVSPRKIALGMAAYGRGFTNVRGDGEQ----- 354

Query: 362 TILINQSFKGVGKLTKEVNKADGKEGIWPYKNLPKKGTIERYDPKYVSAYCFDEKNSIFI 421
             LI Q      K +     ++G+ G+W Y  LP     E++D  +VSAY +D      +
Sbjct: 355 --LIGQ------KYSGVGGGSEGEPGMWLYNQLPLAHGPEKFDNVWVSAYSYDPNTKTLV 406

Query: 422 SYDNTKSVKTKAEYVLHNKLGGGFWWESCGETYANESRSLIHAFNEGLRSNVSTKPSMFE 481
            YDN  S+K K EYV   KL G F WESCG+ + ++ R+L+ AF E ++   + K + ++
Sbjct: 407 VYDNVDSMKIKKEYVKDKKLAGAFLWESCGDNFKDKDRNLVEAFTENMKG--ARKATAYK 464

Query: 482 NERVVNFYLNKYGNNGFLTPYLKH 505
           + +++ +YL +    GFL P  +H
Sbjct: 465 DSKLIQYYL-RTRPEGFLVPMYRH 487

>Ecym_4512 Chr4 (1022092..1023675) [1584 bp, 527 aa] {ON} similar to
           Ashbya gossypii ACL166W
          Length = 527

 Score =  338 bits (868), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 190/496 (38%), Positives = 290/496 (58%), Gaps = 64/496 (12%)

Query: 30  EMCLYKKI----FKNQRSNKIRDSFNNGGHKVPNMDQTQGPNVDGEGFVSGVYYSNWSPY 85
           EM    K+    FK  RS+  R + +     V         N+    +  GVYY++WSPY
Sbjct: 23  EMTFIPKLMIEKFKKPRSDIERTALSTITRPVDR-------NLQHGKYAVGVYYTSWSPY 75

Query: 86  KPRFHFPHDINLTQVSHVYYAFFRINPRTGGIESTDNWSDLEMNLYKPLAIKSSELIDGN 145
           +PR HFPHDI+  +V++V YAFF ++P+TG ++ TD+WSDLEM  + P   +        
Sbjct: 76  EPRLHFPHDIDFKRVTNVNYAFFVVDPKTGKVQPTDSWSDLEMPSHAPGIPQGVT----- 130

Query: 146 SSNDIQKILPLGCIGELFYLKHSCSGKKFKVIMSIGGWSDSENFKVIIKNENLLQAFVDS 205
                      G IGEL YLK       F++ M++GGWS+ E F  I+++E  L+ FV+S
Sbjct: 131 -----------GMIGELNYLKLQ-RNTNFRLFMAVGGWSNREAFPKIVRSEEKLKNFVNS 178

Query: 206 SVETMFKLGFDGIDLDWEFPENNKSEPQGYLKLVRMLRSKLNSLESQIFGEGVEDH--FQ 263
           +++ MF+ GFDGIDLDWEFP+++  EP  YL++   LRSK++ LE +I+G    D+  F+
Sbjct: 179 TIDAMFEYGFDGIDLDWEFPKDDGYEPGMYLEMCSRLRSKMDKLEDEIWGANNTDYPKFE 238

Query: 264 LSIAAPAFKDKLYYLPIPEIDQYIDYWNMMTYDYYGSWSETTGYHSNLFSETE------- 316
           LS+A PAF   L  LPI E+++++  WNMMTYD++GSWS+ TGYHSNL+   +       
Sbjct: 239 LSVATPAFSQTLKILPIIEMNKFVSIWNMMTYDFHGSWSKRTGYHSNLYDGNKNNDELKK 298

Query: 317 -------------LSGNFAIHYMIDKFGINSRKLVLGMAAYGRSFHIKGSGFQPFTQNTI 363
                        L+ + AI  M++ F ++++K+ LGM AYGR F    +  Q    +  
Sbjct: 299 RRFEGMVIDDNEGLNADDAIKIMVENFKVHAKKVRLGMPAYGRGF----TNVQT-KDDDD 353

Query: 364 LINQSFKGVGKLTKEVNKADGKEGIWPYKNLPKKGTIERYDPKYVSAYCFDEKNSIFISY 423
           L+N+      K +     ++G+ GIW Y  LP   T E++D ++VSAYCFD+    F+ Y
Sbjct: 354 LLNK------KYSGVGGGSEGEPGIWLYNQLPLANTAEKFDDRWVSAYCFDKNLKTFVGY 407

Query: 424 DNTKSVKTKAEYVLHNKLGGGFWWESCGETYANESRSLIHAFNEGLRSNVSTKPSMFENE 483
           DN +S++ K++YV    L GGF+WESCG+T+ +  R+L+ AF++ L       P++F++ 
Sbjct: 408 DNIQSMEVKSDYVKQKHLSGGFFWESCGDTHNDPKRNLVRAFSQELSE--MRIPTIFKDP 465

Query: 484 RVVNFYLNKYGNNGFL 499
           R + +YL K+   GFL
Sbjct: 466 RAIAYYL-KHRQKGFL 480

>Smik_8.45 Chr8 (78091..79278) [1188 bp, 395 aa] {ON} YHL004W (REAL)
          Length = 395

 Score = 36.2 bits (82), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 27/90 (30%), Positives = 48/90 (53%), Gaps = 6/90 (6%)

Query: 161 ELFYLKHSCSGKKFKVIMSIGGWSDSENFKVIIKNENLLQAFVDSSVETMFKLGFDGIDL 220
            LF L++SC  K+F+   S    + S N +VI+  + LL   + + ++++ ++  D I  
Sbjct: 12  RLFSLRNSCLSKRFQSSSSGAADNSSNNDEVILLQQKLLYDEIRAELKSLSQIPEDEI-- 69

Query: 221 DWEFPENNKSEPQGYLKLV-RMLRSKLNSL 249
               PE  KS  +G L    ++L ++LNSL
Sbjct: 70  ---LPELKKSLGEGKLSAKEQLLETELNSL 96

>TBLA0A10230 Chr1 complement(2524337..2527528) [3192 bp, 1063 aa]
           {ON} Anc_5.301 YDR291W
          Length = 1063

 Score = 32.3 bits (72), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 22/70 (31%), Positives = 33/70 (47%), Gaps = 15/70 (21%)

Query: 32  CLYKKIFKNQ--RSNKIRDSFNNGGHKVPNMDQTQGPNVDGE------------GFVSGV 77
           C++K I +NQ     K+ D FNNGGH++ + D  +  N+D E             F+ GV
Sbjct: 80  CMFKYIDENQINLEKKVFD-FNNGGHQMKDNDIFELKNIDNEFQKPKSSQILIFEFIDGV 138

Query: 78  YYSNWSPYKP 87
              +W    P
Sbjct: 139 MKRSWKTETP 148

>KLTH0G15070g Chr7 (1319937..1321739) [1803 bp, 600 aa] {ON} similar
           to uniprot|P29029 Saccharomyces cerevisiae YLR286C CTS1
           Endochitinase required for cell separation after mitosis
           transcriptional activation during late G and early M
           cell cycle phases is mediated by transcription factor
           Ace2p
          Length = 600

 Score = 32.3 bits (72), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 28/87 (32%), Positives = 37/87 (42%), Gaps = 11/87 (12%)

Query: 168 SCSGKKFKVIMSIGGWSDSENFKVIIKNE----NLLQAFVDSSV-ETMFKLG-FDGIDLD 221
           +C G   KV++S+GG + S  F    + E     L   F   S  E  F     DG D D
Sbjct: 93  TCQGLGKKVLLSMGGATGSYGFSSDSQAEEFADTLWNTFAGGSADERPFDDAVVDGFDFD 152

Query: 222 WEFPENNKSEPQGYLKLVRMLRSKLNS 248
            E      S+P GY  L + LR   +S
Sbjct: 153 IE-----NSQPDGYAALAKKLRQHFDS 174

>ZYRO0G16478g Chr7 complement(1349497..1350702) [1206 bp, 401 aa]
           {ON} similar to uniprot|Q05648 Saccharomyces cerevisiae
           YDR282C Hypothetical ORF
          Length = 401

 Score = 31.6 bits (70), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 30/118 (25%), Positives = 49/118 (41%), Gaps = 19/118 (16%)

Query: 125 DLEMNLYKPLAIKSSELIDGNSSNDIQKIL---------PLGCI-GELFYLKHSCSGKKF 174
           DLE  L K L +KS   +    S D+ K +         P+  I  E+   +H C+G   
Sbjct: 79  DLESVLLKCLKVKSCTTVTTAESYDLSKCIALLHSQGFQPVSLIPDEIITFRHHCNGSTG 138

Query: 175 KVIM-----SIGGWSDSENFKVIIKNENLLQAFVDSSVETMFKLGFDGIDLDWEFPEN 227
            +++     SI  W     F     N+N+L+   D+    +    F+  D+D+   EN
Sbjct: 139 DIMILGQSGSIICW----GFDEATVNQNILKLVEDARTNPLNPDEFESEDMDYVELEN 192

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.136    0.417 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 59,312,458
Number of extensions: 2816413
Number of successful extensions: 7151
Number of sequences better than 10.0: 33
Number of HSP's gapped: 7240
Number of HSP's successfully gapped: 33
Length of query: 511
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 397
Effective length of database: 40,409,475
Effective search space: 16042561575
Effective search space used: 16042561575
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 68 (30.8 bits)