Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Smik_4.6365.437ON44644624050.0
YDR370C5.437ON44244117570.0
Skud_4.6395.437ON44244217130.0
Suva_2.5425.437ON44244216060.0
NDAI0B056905.437ON4233948701e-113
NCAS0F034005.437ON4153908591e-111
KAFR0E038205.437ON3963758381e-108
Kpol_1016.45.437ON4133757262e-91
TDEL0B021805.437ON4183807099e-89
ZYRO0F10098g5.437ON3733756807e-85
SAKL0G02596g5.437ON4003676026e-73
TPHA0J026005.437ON4413866049e-73
CAGL0A02860g5.437ON4023455949e-72
KNAG0C048905.437ON4053845913e-71
KLTH0F15994g5.437ON3903735329e-63
Kwal_55.214155.437ON3893965311e-62
TBLA0A028005.437ON4533835124e-59
AER404C5.437ON3863774378e-49
KLLA0E02245g5.437ON4033203267e-33
NCAS0E002403.570ON380154860.049
KAFR0J001603.570ON38098810.20
Kwal_47.192763.570ON386142800.23
SAKL0F00726g3.570ON383120800.24
NDAI0I032603.570ON377123770.57
KLLA0E12893g3.570ON38468741.2
YGL246C (RAI1)3.570ON38745732.0
Skud_4.3248.189ON9361672.3
AFR307C3.489ON65083722.5
Kpol_380.83.570ON379164712.9
Smik_7.153.570ON38745713.0
AFR262CsingletonON775167713.3
Suva_7.153.570ON38945704.2
Suva_17.1singletonON48561705.0
NDAI0G029203.165ON48696687.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Smik_4.636
         (446 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Smik_4.636 Chr4 complement(1137846..1139186) [1341 bp, 446 aa] {...   931   0.0  
YDR370C Chr4 complement(1217782..1219110) [1329 bp, 442 aa] {ON}...   681   0.0  
Skud_4.639 Chr4 complement(1140646..1141974) [1329 bp, 442 aa] {...   664   0.0  
Suva_2.542 Chr2 complement(968396..969724) [1329 bp, 442 aa] {ON...   623   0.0  
NDAI0B05690 Chr2 (1387153..1388424) [1272 bp, 423 aa] {ON} Anc_5...   339   e-113
NCAS0F03400 Chr6 complement(686480..687727) [1248 bp, 415 aa] {O...   335   e-111
KAFR0E03820 Chr5 (758469..759659) [1191 bp, 396 aa] {ON} Anc_5.4...   327   e-108
Kpol_1016.4 s1016 (8493..9362,9366..9737) [1242 bp, 413 aa] {ON}...   284   2e-91
TDEL0B02180 Chr2 (388145..389401) [1257 bp, 418 aa] {ON} Anc_5.4...   277   9e-89
ZYRO0F10098g Chr6 complement(818672..819793) [1122 bp, 373 aa] {...   266   7e-85
SAKL0G02596g Chr7 complement(214675..215877) [1203 bp, 400 aa] {...   236   6e-73
TPHA0J02600 Chr10 complement(577310..578635) [1326 bp, 441 aa] {...   237   9e-73
CAGL0A02860g Chr1 complement(300736..301944) [1209 bp, 402 aa] {...   233   9e-72
KNAG0C04890 Chr3 (945616..946833) [1218 bp, 405 aa] {ON} Anc_5.4...   232   3e-71
KLTH0F15994g Chr6 (1298649..1299821) [1173 bp, 390 aa] {ON} weak...   209   9e-63
Kwal_55.21415 s55 (826461..827630) [1170 bp, 389 aa] {ON} YDR370...   209   1e-62
TBLA0A02800 Chr1 (675150..676511) [1362 bp, 453 aa] {ON} Anc_5.4...   201   4e-59
AER404C Chr5 complement(1412412..1413572) [1161 bp, 386 aa] {ON}...   172   8e-49
KLLA0E02245g Chr5 complement(210001..211212) [1212 bp, 403 aa] {...   130   7e-33
NCAS0E00240 Chr5 complement(34922..36064) [1143 bp, 380 aa] {ON}...    38   0.049
KAFR0J00160 Chr10 complement(26405..27547) [1143 bp, 380 aa] {ON...    36   0.20 
Kwal_47.19276 s47 (1168248..1169408) [1161 bp, 386 aa] {ON} YGL2...    35   0.23 
SAKL0F00726g Chr6 complement(63291..64442) [1152 bp, 383 aa] {ON...    35   0.24 
NDAI0I03260 Chr9 (765221..766354) [1134 bp, 377 aa] {ON} Anc_3.570     34   0.57 
KLLA0E12893g Chr5 complement(1140409..1141563) [1155 bp, 384 aa]...    33   1.2  
YGL246C Chr7 complement(37617..38780) [1164 bp, 387 aa] {ON}  RA...    33   2.0  
Skud_4.324 Chr4 complement(563741..564019) [279 bp, 93 aa] {ON} ...    30   2.3  
AFR307C Chr6 complement(997169..999121) [1953 bp, 650 aa] {ON} S...    32   2.5  
Kpol_380.8 s380 (14034..15173) [1140 bp, 379 aa] {ON} (14034..15...    32   2.9  
Smik_7.15 Chr7 complement(32394..33557) [1164 bp, 387 aa] {ON} Y...    32   3.0  
AFR262C Chr6 complement(904657..906984) [2328 bp, 775 aa] {ON} S...    32   3.3  
Suva_7.15 Chr7 complement(32131..33300) [1170 bp, 389 aa] {ON} Y...    32   4.2  
Suva_17.1 Chr17 complement(1..1455) [1455 bp, 485 aa] {ON}  YFR0...    32   5.0  
NDAI0G02920 Chr7 complement(676413..677873) [1461 bp, 486 aa] {O...    31   7.8  

>Smik_4.636 Chr4 complement(1137846..1139186) [1341 bp, 446 aa] {ON}
           YDR370C (REAL)
          Length = 446

 Score =  931 bits (2405), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 446/446 (100%), Positives = 446/446 (100%)

Query: 1   MPTEHDAVVRLTKELDGINLHSAPDIVREHQKKSFNWKTNSVSSLGNMSLQQSENHINGH 60
           MPTEHDAVVRLTKELDGINLHSAPDIVREHQKKSFNWKTNSVSSLGNMSLQQSENHINGH
Sbjct: 1   MPTEHDAVVRLTKELDGINLHSAPDIVREHQKKSFNWKTNSVSSLGNMSLQQSENHINGH 60

Query: 61  PKFTRVSYTSFSHSGMHKFPAKPPRDIFHESKEVALFTNGQAYTTVRKDILPNLKGDIAE 120
           PKFTRVSYTSFSHSGMHKFPAKPPRDIFHESKEVALFTNGQAYTTVRKDILPNLKGDIAE
Sbjct: 61  PKFTRVSYTSFSHSGMHKFPAKPPRDIFHESKEVALFTNGQAYTTVRKDILPNLKGDIAE 120

Query: 121 LCERSLLDARERKLPYLGHDLFANIGQFVPMTISELDSILPCISYIENWRLNNHGEDFKI 180
           LCERSLLDARERKLPYLGHDLFANIGQFVPMTISELDSILPCISYIENWRLNNHGEDFKI
Sbjct: 121 LCERSLLDARERKLPYLGHDLFANIGQFVPMTISELDSILPCISYIENWRLNNHGEDFKI 180

Query: 181 GRKFTVVTTRHHIVDMTMHLFDRRNKKRSLVATYMGAGLISFSRNQKNDSRMSKEGIYSS 240
           GRKFTVVTTRHHIVDMTMHLFDRRNKKRSLVATYMGAGLISFSRNQKNDSRMSKEGIYSS
Sbjct: 181 GRKFTVVTTRHHIVDMTMHLFDRRNKKRSLVATYMGAGLISFSRNQKNDSRMSKEGIYSS 240

Query: 241 DPNMKKICYSGFEFENWVTEGIKAADLNGSKLPVFSVVESKLSEEIGLLIRCEMDAFNPV 300
           DPNMKKICYSGFEFENWVTEGIKAADLNGSKLPVFSVVESKLSEEIGLLIRCEMDAFNPV
Sbjct: 241 DPNMKKICYSGFEFENWVTEGIKAADLNGSKLPVFSVVESKLSEEIGLLIRCEMDAFNPV 300

Query: 301 SGANTELKCFAPLSMHNSNHRRKLLKTWIQTGLSPNSDIMIGLRDSHSGQLLDIQWYSRD 360
           SGANTELKCFAPLSMHNSNHRRKLLKTWIQTGLSPNSDIMIGLRDSHSGQLLDIQWYSRD
Sbjct: 301 SGANTELKCFAPLSMHNSNHRRKLLKTWIQTGLSPNSDIMIGLRDSHSGQLLDIQWYSRD 360

Query: 361 SLCMKFNHSGLPSNKRELNYNAKVAVEWCNHCIKSICELLGANISDYSCKNPESFEISID 420
           SLCMKFNHSGLPSNKRELNYNAKVAVEWCNHCIKSICELLGANISDYSCKNPESFEISID
Sbjct: 361 SLCMKFNHSGLPSNKRELNYNAKVAVEWCNHCIKSICELLGANISDYSCKNPESFEISID 420

Query: 421 SNNTIAITKLKNIPKHVELFGTSIHV 446
           SNNTIAITKLKNIPKHVELFGTSIHV
Sbjct: 421 SNNTIAITKLKNIPKHVELFGTSIHV 446

>YDR370C Chr4 complement(1217782..1219110) [1329 bp, 442 aa] {ON}
           Putative protein of unknown function
          Length = 442

 Score =  681 bits (1757), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 325/441 (73%), Positives = 372/441 (84%)

Query: 1   MPTEHDAVVRLTKELDGINLHSAPDIVREHQKKSFNWKTNSVSSLGNMSLQQSENHINGH 60
           M TE DAV+ L K+L+GINL + P++ R HQ K    KT S SS      QQ +N+    
Sbjct: 1   MSTEQDAVLGLAKDLEGINLLTVPNLERGHQSKLCKEKTTSDSSSSRKPSQQRDNYRKRR 60

Query: 61  PKFTRVSYTSFSHSGMHKFPAKPPRDIFHESKEVALFTNGQAYTTVRKDILPNLKGDIAE 120
           PK   + YTSF H+GMH F  KPPRDIFHESKEVALFTNG+AYT +RKD++PNLK  IAE
Sbjct: 61  PKLICIPYTSFLHTGMHNFLTKPPRDIFHESKEVALFTNGRAYTILRKDLIPNLKESIAE 120

Query: 121 LCERSLLDARERKLPYLGHDLFANIGQFVPMTISELDSILPCISYIENWRLNNHGEDFKI 180
           L E SLL+A++RK+PYLGHDLFANI +FVPMTISELDS+ PC SYIENW L+N G+DFKI
Sbjct: 121 LYESSLLEAKKRKVPYLGHDLFANIDEFVPMTISELDSVSPCFSYIENWILDNPGKDFKI 180

Query: 181 GRKFTVVTTRHHIVDMTMHLFDRRNKKRSLVATYMGAGLISFSRNQKNDSRMSKEGIYSS 240
           G+KFTVVTTRHHIVD+TMHLF+RRN++ SL+ TYMGAGL+SF RN K DS+MSKEGIYS+
Sbjct: 181 GKKFTVVTTRHHIVDLTMHLFNRRNRQTSLIVTYMGAGLLSFCRNVKKDSQMSKEGIYSN 240

Query: 241 DPNMKKICYSGFEFENWVTEGIKAADLNGSKLPVFSVVESKLSEEIGLLIRCEMDAFNPV 300
           DPNMKKICYSGFEFENWVTE  K ADL GSK P+FS+VESKLSEEIGLLIRCEMDAFNPV
Sbjct: 241 DPNMKKICYSGFEFENWVTENSKVADLTGSKCPIFSLVESKLSEEIGLLIRCEMDAFNPV 300

Query: 301 SGANTELKCFAPLSMHNSNHRRKLLKTWIQTGLSPNSDIMIGLRDSHSGQLLDIQWYSRD 360
           S  NTELKCFAPLSMHNSNHRRKLLKTW+QTGL PNSDIMIGLRDSHSGQLLDIQWYSRD
Sbjct: 301 SETNTELKCFAPLSMHNSNHRRKLLKTWVQTGLLPNSDIMIGLRDSHSGQLLDIQWYSRD 360

Query: 361 SLCMKFNHSGLPSNKRELNYNAKVAVEWCNHCIKSICELLGANISDYSCKNPESFEISID 420
            LC KFNH GLP+NK+ELNYNA++AVEWC++CI++IC+L+ ANISDYS   PESFEI ID
Sbjct: 361 LLCKKFNHPGLPTNKKELNYNAQIAVEWCHYCIEAICKLVEANISDYSSTKPESFEIGID 420

Query: 421 SNNTIAITKLKNIPKHVELFG 441
           +NN I ITKLK  P++VELFG
Sbjct: 421 TNNAIVITKLKTTPRNVELFG 441

>Skud_4.639 Chr4 complement(1140646..1141974) [1329 bp, 442 aa] {ON}
           YDR370C (REAL)
          Length = 442

 Score =  664 bits (1713), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 317/442 (71%), Positives = 369/442 (83%)

Query: 1   MPTEHDAVVRLTKELDGINLHSAPDIVREHQKKSFNWKTNSVSSLGNMSLQQSENHINGH 60
           M TE D + RLTK L+  NL+  PD+V+ HQK+S   ++ S++S       Q +++ N  
Sbjct: 1   MSTEDDPIARLTKNLESTNLNIVPDLVKGHQKRSSEGRSISITSSVKPPSPQKDDYWNRC 60

Query: 61  PKFTRVSYTSFSHSGMHKFPAKPPRDIFHESKEVALFTNGQAYTTVRKDILPNLKGDIAE 120
            +F  V YTSF H+ +H    KPP DIF +SKEVALFTN QAYTT RKD++P+L+  I E
Sbjct: 61  SRFKCVPYTSFVHTSIHDLSRKPPGDIFQDSKEVALFTNYQAYTTARKDLIPSLRDGITE 120

Query: 121 LCERSLLDARERKLPYLGHDLFANIGQFVPMTISELDSILPCISYIENWRLNNHGEDFKI 180
           L E SLL+AR RK+PYLGHDLFANI QFVPMTISELDSI PCISY+ENW+L+NHG++FKI
Sbjct: 121 LYESSLLEARRRKVPYLGHDLFANIDQFVPMTISELDSISPCISYVENWKLSNHGKNFKI 180

Query: 181 GRKFTVVTTRHHIVDMTMHLFDRRNKKRSLVATYMGAGLISFSRNQKNDSRMSKEGIYSS 240
           G+KFT+V+ RHHIVD+TMH FDRRNK++SL+ TYMGAGLISFSRN KND +MSKEGIYSS
Sbjct: 181 GKKFTIVSARHHIVDLTMHRFDRRNKRKSLIVTYMGAGLISFSRNPKNDFQMSKEGIYSS 240

Query: 241 DPNMKKICYSGFEFENWVTEGIKAADLNGSKLPVFSVVESKLSEEIGLLIRCEMDAFNPV 300
           DPNMKKICYSGFEFE+WVTE IKA DLNG K P+FSVVESKLSE+IGLL+RCE+DAFNPV
Sbjct: 241 DPNMKKICYSGFEFEHWVTEDIKATDLNGPKHPIFSVVESKLSEDIGLLMRCEIDAFNPV 300

Query: 301 SGANTELKCFAPLSMHNSNHRRKLLKTWIQTGLSPNSDIMIGLRDSHSGQLLDIQWYSRD 360
           S  NTELKCF PLSMHNSNHR+KLLKTWIQTGL PNSDI+IGLRDSHSGQLLDIQWYSRD
Sbjct: 301 SRTNTELKCFGPLSMHNSNHRKKLLKTWIQTGLLPNSDIVIGLRDSHSGQLLDIQWYSRD 360

Query: 361 SLCMKFNHSGLPSNKRELNYNAKVAVEWCNHCIKSICELLGANISDYSCKNPESFEISID 420
           SL  KFNH GLP +K+ELN+NAKVAVEWCNHCIKSICEL+ ANIS Y+   PESFE+SID
Sbjct: 361 SLYKKFNHPGLPPSKKELNFNAKVAVEWCNHCIKSICELVEANISHYNSTRPESFEVSID 420

Query: 421 SNNTIAITKLKNIPKHVELFGT 442
           +N TIAITKL  +PK+VELF T
Sbjct: 421 ANGTIAITKLNTVPKNVELFVT 442

>Suva_2.542 Chr2 complement(968396..969724) [1329 bp, 442 aa] {ON}
           YDR370C (REAL)
          Length = 442

 Score =  623 bits (1606), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 298/442 (67%), Positives = 352/442 (79%)

Query: 1   MPTEHDAVVRLTKELDGINLHSAPDIVREHQKKSFNWKTNSVSSLGNMSLQQSENHINGH 60
           M  E D VV+L K+L+GINL   P+ V EH+KKS   K   +SSL   S QQ  +++   
Sbjct: 1   MSPEQDGVVKLAKDLEGINLRDVPNPVNEHRKKSSKRKIIPISSLKRPSSQQKNDYLEEI 60

Query: 61  PKFTRVSYTSFSHSGMHKFPAKPPRDIFHESKEVALFTNGQAYTTVRKDILPNLKGDIAE 120
            +FTRV Y+SF H+ +  FP KPP DIF+ESKEVALFT+ Q Y   RKD++PNLK DI+ 
Sbjct: 61  SEFTRVPYSSFLHTSIRNFPTKPPPDIFYESKEVALFTDNQLYVAARKDVIPNLKEDISH 120

Query: 121 LCERSLLDARERKLPYLGHDLFANIGQFVPMTISELDSILPCISYIENWRLNNHGEDFKI 180
           L E  LL+AR+ K  YLG DLFANI + VPMTISELD+I PCISYIE+WRLNN G+ FKI
Sbjct: 121 LYESPLLEARKLKTLYLGLDLFANIDELVPMTISELDTIAPCISYIEDWRLNNSGKPFKI 180

Query: 181 GRKFTVVTTRHHIVDMTMHLFDRRNKKRSLVATYMGAGLISFSRNQKNDSRMSKEGIYSS 240
           G+KFTVVTTRHHIVD+TMH FDRRNK++S++ATYMG G IS SRN K D + SKEGIYS 
Sbjct: 181 GKKFTVVTTRHHIVDLTMHPFDRRNKQKSIIATYMGNGFISLSRNPKYDHKASKEGIYSG 240

Query: 241 DPNMKKICYSGFEFENWVTEGIKAADLNGSKLPVFSVVESKLSEEIGLLIRCEMDAFNPV 300
           DPN+KKIC+SGFEFEN +TE  K +  + SK PVFS+VE KLSE+IGLL+RCEMDAFNPV
Sbjct: 241 DPNIKKICHSGFEFENCLTENTKNSGSSASKCPVFSIVEGKLSEDIGLLMRCEMDAFNPV 300

Query: 301 SGANTELKCFAPLSMHNSNHRRKLLKTWIQTGLSPNSDIMIGLRDSHSGQLLDIQWYSRD 360
           S  NTELKCF PLSM NS+HR+KLLKTWIQTGL PNSDIM+GLRDS+SGQLLDIQWYSRD
Sbjct: 301 SKTNTELKCFGPLSMQNSSHRKKLLKTWIQTGLLPNSDIMVGLRDSYSGQLLDIQWYSRD 360

Query: 361 SLCMKFNHSGLPSNKRELNYNAKVAVEWCNHCIKSICELLGANISDYSCKNPESFEISID 420
           +L  KFNH GLP NK+E+NYNAKVAVEWC HCIKSIC+L+ ANIS Y+C  PE FEI+ID
Sbjct: 361 TLFRKFNHPGLPLNKKEMNYNAKVAVEWCKHCIKSICDLVEANISRYNCNKPEPFEINID 420

Query: 421 SNNTIAITKLKNIPKHVELFGT 442
           +N TI ITKL  IP++VE+F T
Sbjct: 421 ANGTIIITKLSTIPRNVEIFKT 442

>NDAI0B05690 Chr2 (1387153..1388424) [1272 bp, 423 aa] {ON}
           Anc_5.437 YDR370C
          Length = 423

 Score =  339 bits (870), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 178/394 (45%), Positives = 256/394 (64%), Gaps = 21/394 (5%)

Query: 61  PKFTRVSYTSFSHSGMHKFPAKPPRDIFHESKEVALFTNGQAYTTVRKDILPNLKGDIAE 120
           P  T + +  F H  +  +P K P   F  SK+VAL+ N Q Y++   +++P L+  IA+
Sbjct: 34  PPITTIPFKQFKHCSISTYP-KTPSSFFETSKDVALYHNKQLYSSDDTNLIPQLEPAIAK 92

Query: 121 LCERS--LLDARERKLPYLGHDLFANIGQFVPMTISELDSILPCISYIENWRLNNHGEDF 178
           L   S  L +AR+ KLPYLG DL+     F+PM   ELDSI PC  YIE+W L N   D+
Sbjct: 93  LANPSCSLNEARDLKLPYLGSDLYDGYESFIPMDPDELDSIEPCFKYIESWELQNK-HDY 151

Query: 179 KIGRKFTVVTTRHHIVDMTMHLFDRRNKKRSLV-ATYMGA--GLISFSR--NQKNDSRMS 233
           ++G KFT+V+ RHHIV+MTM +F++R     ++  TY G   G++ FSR  N+K+D    
Sbjct: 152 QLGNKFTIVSARHHIVEMTMCIFNKRKMDDFILNVTYKGGSNGMLLFSRDVNKKDDG--- 208

Query: 234 KEGIYSSDPNMKKICYSGFEFENWVT--EGIKAAD-----LNGSKLPVFSVVESKLSEEI 286
             GIYS D  ++KI YSGF  E+ +T  +    AD     L G    VF+++E+KL+++I
Sbjct: 209 --GIYSKDGVVRKISYSGFALEDLLTTNKNDHNADNSDVTLVGGDKAVFAIIENKLNDDI 266

Query: 287 GLLIRCEMDAFNPVSGANTELKCFAPLSMHNSNHRRKLLKTWIQTGLSPNSDIMIGLRDS 346
            LL+RCEMD++NPV+   TE+KCFA L M+N NHRRKLLK W+QTG+ PNSDI+IG+RD 
Sbjct: 267 SLLLRCEMDSYNPVNKCFTEMKCFARLKMNNHNHRRKLLKAWVQTGVIPNSDILIGIRDP 326

Query: 347 HSGQLLDIQWYSRDSLCMKFNHSGLPSNKRELNYNAKVAVEWCNHCIKSICELLGANISD 406
             G+L DI+W+SR +L  + N+  LP  K +LNYNA++AV+W  HCIKSIC+L+  +I  
Sbjct: 327 MFGELNDIEWFSRMNLYRQINNRNLPEAKLDLNYNAEIAVQWSQHCIKSICKLVDESIDK 386

Query: 407 YSCKNPESFEISIDSNNTIAITKLKNIPKHVELF 440
                 +SF+I I+++  I I KLK++P +V ++
Sbjct: 387 TRLNTSQSFQIRINASRAIQIKKLKSVPNNVTMY 420

>NCAS0F03400 Chr6 complement(686480..687727) [1248 bp, 415 aa] {ON}
           Anc_5.437 YDR370C
          Length = 415

 Score =  335 bits (859), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 172/390 (44%), Positives = 243/390 (62%), Gaps = 18/390 (4%)

Query: 64  TRVSYTSFSHSGMHKFPAKPPRDIFHESKEVALFTNGQAYTTVRKDILPNLKGDIAELCE 123
           TRV +  FSHS +  FP    +  +  S +VAL+ N + Y   + DI+P+LK DIA+L +
Sbjct: 24  TRVPFGEFSHSSISLFPT-CTQPFYESSNQVALYHNHKLYPASQYDIIPHLKNDIAQLPK 82

Query: 124 RSLLDARERKLPYLGHDLFANIGQFVPMTISELDSILPCISYIENWRLNNHGEDFKIGRK 183
           +S  +AR  K  YLG DL+     FVPM+  +LDS+ PC+S+I++W        +K GRK
Sbjct: 83  KSASEARTLKRSYLGSDLYDGFETFVPMSAKDLDSLEPCMSFIKDWE-RKASTKYKPGRK 141

Query: 184 FTVVTTRHHIVDMTMHLFD---------RRNKKRSLVATYMG--AGLISFSRNQKNDSRM 232
           F +V+TRHHIV+MTM LF          ++ +   L   Y G   G + F+++  N    
Sbjct: 142 FNIVSTRHHIVEMTMKLFTGKTNNYNNTKKVQDYVLNVVYTGDETGRLLFTKDWSNTGNS 201

Query: 233 SKEGIYSSDPNMKKICYSGFEFENWVTEGIKAADLNGSKL-----PVFSVVESKLSEEIG 287
             EGIYS +  +K+ICYSGF  E+ +TE     +  G KL      VF+VVE+KL ++I 
Sbjct: 202 MNEGIYSKNIILKRICYSGFALEDLMTETTSELEKEGEKLTGGEKAVFAVVENKLDDDIC 261

Query: 288 LLIRCEMDAFNPVSGANTELKCFAPLSMHNSNHRRKLLKTWIQTGLSPNSDIMIGLRDSH 347
           +L+RCE+DAFN      TELKCF+PL M N +HRRKLLK W+QTG+ P+SDI+IG+RDS 
Sbjct: 262 ILLRCELDAFNGAEKKFTELKCFSPLKMSNFSHRRKLLKAWVQTGVLPDSDILIGIRDSS 321

Query: 348 SGQLLDIQWYSRDSLCMKFNHSGLPSNKRELNYNAKVAVEWCNHCIKSICELLGANISDY 407
            G+L D++WYSRD L  K N+  LP +K + N+NA+VA +W  HCI+SIC+L+  N+   
Sbjct: 322 FGELEDVEWYSRDRLRSKINNRNLPESKIDWNFNAQVATQWSQHCIRSICKLVDENLDQK 381

Query: 408 SCKNPESFEISIDSNNTIAITKLKNIPKHV 437
           +  NP+ F+I IDS   I I  L  +PK +
Sbjct: 382 AISNPQGFQIRIDSRRNIRIKCLSKVPKDI 411

>KAFR0E03820 Chr5 (758469..759659) [1191 bp, 396 aa] {ON} Anc_5.437
           YDR370C
          Length = 396

 Score =  327 bits (838), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 161/375 (42%), Positives = 250/375 (66%), Gaps = 18/375 (4%)

Query: 68  YTSFSHSGMHKFPAKPPRDIFHESKEVALFTNGQAY--TTVRKDILPNLKGDIAELCER- 124
           +  F H  +  FP  P  + F  S+EVA + +G+ Y      +DILP L  DI+++ +  
Sbjct: 32  FKRFQHRSIAYFPNHPA-NFFQISREVATYHDGRIYEPNETSQDILPLLNKDISKIAQGV 90

Query: 125 SLLDARERKLPYLGHDLFANIGQFVPMTISELDSILPCISYIENWRLNNHGEDFKIGRKF 184
           S +DAR+ K+ Y+G DL+     F  M+  ELDS LPC +YI+ W  ++H + +   +K+
Sbjct: 91  SAIDARKYKVKYIGSDLYQGFENFESMSREELDSALPCFAYIKKWEAHHHCK-YTENKKY 149

Query: 185 TVVTTRHHIVDMTMHLFDRRNKKRSLVATYMGAGLISFSRNQKNDSRMSKEGIYSSDPNM 244
           T+V+ RHHIV++ M +FD  +K+  + +TY+G GL++FS++  +   M+ EGI++ + N+
Sbjct: 150 TIVSARHHIVNLIMSIFDT-SKETIVNSTYLGNGLLTFSQDTSDPMTMN-EGIFTKNKNL 207

Query: 245 KKICYSGFEFENWVTEGIKAADLNGSKLPVFSVVESKLSEEIGLLIRCEMDAFNPVSGAN 304
           KKICYSGF  E+ +T+          K P+FS+ E++L + I LL+RCEMDA+N ++   
Sbjct: 208 KKICYSGFALEDLLTKS--------QKEPLFSITENQLDDNITLLLRCEMDAYNQLTQNY 259

Query: 305 TELKCFAPLSMHNSNHRRKLLKTWIQTGLSPNSDIMIGLRDSHSGQLLDIQWYSRDSLCM 364
           TELKC+APL M +  HR+KLLKTWIQTG+ P+SD+M G+R  ++G+LLDI+WYSRD L  
Sbjct: 260 TELKCYAPLKMASPQHRKKLLKTWIQTGVLPSSDLMFGIRSPYNGELLDIEWYSRDGLYR 319

Query: 365 KFNHSGLPSNKRELNYNAKVAVEWCNHCIKSICELLGANISDYSCKNPESFEISIDSNNT 424
           +FN+  LP NK+ LN+NA +AVEW +HCIK+ICEL+  N+   +   P++F+I +D+   
Sbjct: 320 RFNNRNLPENKKSLNFNANIAVEWSHHCIKTICELISDNLQGDA---PQAFQIKVDTFRN 376

Query: 425 IAITKLKNIPKHVEL 439
           I+I  L  IP++ ++
Sbjct: 377 ISIRNLSKIPQNAQI 391

>Kpol_1016.4 s1016 (8493..9362,9366..9737) [1242 bp, 413 aa] {ON}
           (8493..9362,9366..9737) [1242 nt, 414 aa]
          Length = 413

 Score =  284 bits (726), Expect = 2e-91,   Method: Compositional matrix adjust.
 Identities = 159/375 (42%), Positives = 232/375 (61%), Gaps = 12/375 (3%)

Query: 66  VSYTSFSHSGMHKFPAKPPRDIFHESKEVALFTNGQAYTTVRKDILPNLKGDIAELCERS 125
           + +  F HS    FP K  +D+F ESK VA F   Q +  V    LP LK DIA +  +S
Sbjct: 41  IPFHRFVHSNARSFPQKT-KDLFLESKTVAFFQKDQLFINVEDAALPLLKKDIANISGKS 99

Query: 126 LLDARERKLPYLGHDLFANIGQFVPMTISELDSILPCISYIENWRLNNHGEDFKIGRKFT 185
           +L++++ KLPYLG DL+A+  ++ P+    LDS  PC  +I +W   + GE +     +T
Sbjct: 100 VLNSKKYKLPYLGSDLYASTDKYGPLPEDVLDSPKPCFDFIRHWENEHRGEHYGAHADYT 159

Query: 186 VVTTRHHIVDMTMHLF-DRRNKKRSLVATYMGAGLISFSRNQK-NDSRMSKEGIYSSDPN 243
           +++ RHHI ++ M LF D +N    L+ TY+  G+I  S++   + S  +  G+ SS+P 
Sbjct: 160 ILSPRHHITEIVMSLFEDEKNCSVYLLCTYLKNGIILLSKDDASSSSNSNTTGLNSSNPM 219

Query: 244 MKKICYSGFEFENWVTEGIKAADLNGSKLPVFSVVESKLSEEIGLLIRCEMDAFNPVSGA 303
            +KICYSGF FE+ V E     D+  +  P+FSVVESKL+E I LL+R E+D +N V+  
Sbjct: 220 TRKICYSGFAFEDLVLE-----DIAENARPIFSVVESKLTESINLLLRNELDGYNNVTNM 274

Query: 304 NTELKCFAPLSMHNSNHRRKLLKTWIQTGLSPNSDIMIGLRDSHSGQLLDIQWYSRDSLC 363
            TELKCFAPL    S   +++LKTW+QTGL P SDI+IG+RD+ SG L D+ WY+R  LC
Sbjct: 275 FTELKCFAPLKCMFS--AKEVLKTWVQTGLIPESDIVIGIRDTQSGLLEDLVWYNRKDLC 332

Query: 364 MKFNHSGLPSNKRELNYNAKVAVEWCNHCIKSICELLGANISDYSCKNPESFEISIDSNN 423
             FN+  LP      N+NA +AVEW    ++SI  L+ ++I+D    +P SF++ ID++ 
Sbjct: 333 RTFNNPSLPPAPSHFNFNANIAVEWLKFTMESIVSLVSSSIAD--SNHPCSFKLKIDNHK 390

Query: 424 TIAITKLKNIPKHVE 438
           TI+I KL  IP+ V+
Sbjct: 391 TISIQKLSRIPQTVQ 405

>TDEL0B02180 Chr2 (388145..389401) [1257 bp, 418 aa] {ON} Anc_5.437
           YDR370C
          Length = 418

 Score =  277 bits (709), Expect = 9e-89,   Method: Compositional matrix adjust.
 Identities = 150/380 (39%), Positives = 228/380 (60%), Gaps = 22/380 (5%)

Query: 66  VSYTSFSHSGMHKFPAKPPRDIFHESKEVALFTNGQAYT--TVRKDILPNLKGDIAELCE 123
           + ++ F HS +  FP     D F   +EVA + NG  +   + +K + P L+   A + E
Sbjct: 50  IPFSKFEHSDLDYFPDDTA-DFFEGCEEVATYQNGYLFMKDSSKKPLYPCLQMFAALIAE 108

Query: 124 RSLLDARERKLPYLGHDLFANIGQFVPMTISELDSILPCISYIENWRLNNHGEDFKIGRK 183
                  + KLPY+G DL+    ++ P+  SELDS + C  YI+ W      + F  G K
Sbjct: 109 NR---GPKNKLPYIGCDLYQGHERYKPLPSSELDSSIACFEYIKKWERRKISKSFNSG-K 164

Query: 184 FTVVTTRHHIVDMTMHLFDRRNKKRSLVATYMGAGLISFSRNQKNDSRMSKEGIYSSDPN 243
            T+++ RHH+VD+ M LF   + + S++ T +G G + FS ++  + R    G+ S +  
Sbjct: 165 VTIISPRHHVVDLVMALF--HDDEVSIICTNIGKGKLIFSGDRSKEER---NGLNSKNSM 219

Query: 244 MKKICYSGFEFENWVTEGIKAADLNGSKLPVFSVVESKLSEEIGLLIRCEMDAFNPVSGA 303
            +KICYSGF  E+ +T        +    P +S+VE K++E + LL+RCEMDA+NP+   
Sbjct: 220 TRKICYSGFALEDKLT-----TSHDERMGPFYSIVEGKINERLSLLLRCEMDAYNPIFNR 274

Query: 304 NTELKCFAPLSMHNSNHRRKLLKTWIQTGLSPNSDIMIGLRDSHSGQLLDIQWYSRDSLC 363
            TELKCF  L++ ++ HRRKLLKTW+Q GL P+SD++IG RD+  GQL D+ WYSR SL 
Sbjct: 275 YTELKCFTKLNVQDTAHRRKLLKTWVQIGLIPDSDLIIGTRDTQVGQLEDLTWYSRGSLY 334

Query: 364 MKFNHSGLPSNKRELNYNAKVAVEWCNHCIKSICELLGANISDYSCKNP----ESFEISI 419
            KFN+  +  N + LN+NA +AVEWC HCI+SIC+L+  N S  S  +P    ESF++ +
Sbjct: 335 KKFNNPSIARNNKYLNFNANIAVEWCFHCIESICDLVMKN-SLSSPDDPYPKYESFKVIV 393

Query: 420 DSNNTIAITKLKNIPKHVEL 439
           D ++ I + KL  +P+HV++
Sbjct: 394 DKSHNIIVKKLTKVPRHVQI 413

>ZYRO0F10098g Chr6 complement(818672..819793) [1122 bp, 373 aa] {ON}
           similar to uniprot|Q06349 Saccharomyces cerevisiae
           YDR370C Hypothetical ORF
          Length = 373

 Score =  266 bits (680), Expect = 7e-85,   Method: Compositional matrix adjust.
 Identities = 140/375 (37%), Positives = 226/375 (60%), Gaps = 21/375 (5%)

Query: 66  VSYTSFSHSGMHKFPAKPPRDIFHESKEVALFTNGQAYTTVRKDILPNLKGDIAELC-ER 124
           V +  F HS   +FP++P R++F + KE + +  GQ + ++   I   LK    +L  +R
Sbjct: 16  VPFNQFQHSSAFRFPSEP-RNLFTKYKEASYYYGGQLHDSISDSI--GLKSPGNKLSHDR 72

Query: 125 SLLDARERKLPYLGHDLFANIGQFVPMTISELDSILPCISYIENWRLNNHGEDFKIGRKF 184
           S  + R+    +LG DL+     F+P++   LDS   C  +I  W  +NH   +     F
Sbjct: 73  SCSNKRD----FLGSDLYQGWEDFLPLSPEILDSSRGCYQWINKWENDNHTS-YSQRSPF 127

Query: 185 TVVTTRHHIVDMTMHLFDRRNKKRSLVATYMGAGLISFSRNQKNDSRMSKEGIYSSDPNM 244
            V++ RH++V++TM LF  +  K S++ T++G G I  S  Q  + + S +    +    
Sbjct: 128 VVISPRHYLVELTMQLF--QQSKYSILCTHLGDGKIVLS--QVENDKKSHQHTSRNTTMT 183

Query: 245 KKICYSGFEFENWVTEGIKAADLNGSKLPVFSVVESKLSEEIGLLIRCEMDAFNPVSGAN 304
           KKI +SG+  E+ +T G +  D      P F+++E++L   I L++RCE+D++N ++   
Sbjct: 184 KKILHSGYALEDLLTRGPRVEDD-----PFFAIIEAELDANISLVLRCELDSYNELTETF 238

Query: 305 TELKCFAPLSMHNSNHRRKLLKTWIQTGLSPNSDIMIGLRDSHSGQLLDIQWYSRDSLCM 364
           TELKC+APL+MHN+ HR KLLKTWIQ  +SP  D++IG+R++H G L D+Q+++   L  
Sbjct: 239 TELKCYAPLNMHNAYHREKLLKTWIQLAISPRCDLLIGVRNTHMGLLQDLQYFTNKELYR 298

Query: 365 KFNHSGLPSNKRELNYNAKVAVEWCNHCIKSICELLGANISDYSCKNPESFEISIDSNNT 424
           K N   LP + +  NYNA +AV+WC HCI+SIC+L+G N+   S   P+ F+++ID ++ 
Sbjct: 299 KINDRNLPKSPKRFNYNADLAVQWCQHCIRSICKLVGENVDRSS---PQCFKLTIDESHK 355

Query: 425 IAITKLKNIPKHVEL 439
           I + KLK++P HVEL
Sbjct: 356 IQLEKLKHVPAHVEL 370

>SAKL0G02596g Chr7 complement(214675..215877) [1203 bp, 400 aa] {ON}
           weakly similar to uniprot|Q06349 Saccharomyces
           cerevisiae YDR370C Hypothetical ORF
          Length = 400

 Score =  236 bits (602), Expect = 6e-73,   Method: Compositional matrix adjust.
 Identities = 134/367 (36%), Positives = 211/367 (57%), Gaps = 15/367 (4%)

Query: 71  FSHSGMHKFPAKPPRDIFHESKEVALFT---NGQAYTTVRKDILPNLKGDIAELCERSLL 127
           F HS +  FP+ P +  F ES+E+  FT   +   Y    K  L  LK DI E       
Sbjct: 30  FVHSNVSHFPSVPCK-FFQESREIGTFTRMVSSGKYLFDDKLGLRPLKDDICEYIHNPAK 88

Query: 128 DARERKLPYLGHDLFANIGQFVPMTISELDSILPCISYIENWRLNNHGEDFKIGRKFTVV 187
           +A + K  YLG+DL      ++P++  EL+++   +++I NW   N G+ +    KFT+V
Sbjct: 89  NASKIKTQYLGYDLLNGFEDYIPLSEDELNNMDGILNFIGNWEEKN-GKKYGSENKFTIV 147

Query: 188 TTRHHIVDMTMHLFDRRNKKRSLVATYMGAGLISFSRNQKNDSRMSKEGIYSSDPNMKKI 247
           + RHH++D+ M  F    ++ +L+ T++   LI  S   K        GI S D  ++K+
Sbjct: 148 SNRHHLIDLIMCPFSL--EEANLIVTHLDGLLIISSDKSKPKV---DSGIRSKDTRVRKL 202

Query: 248 CYSGFEFENWVTEGIKAADLNGSKLPVFSVVESKLSEEIGLLIRCEMDAFNPVSGANTEL 307
           CY+GFE EN VT+G    D  G     +S+VE+KL+E + LL++ EMD++NP +    EL
Sbjct: 203 CYTGFELENLVTKG--KVDSPGMHTCFYSIVENKLTEGVSLLLQAEMDSYNPKTDNYVEL 260

Query: 308 KCFAPLSMHNSNHRRKLLKTWIQTGLSPNSDIMIGLRDSHSGQLLDIQWYSRDSLCMKFN 367
           KC     + NSNHRRKLL+ WIQTGL P +D+++G RD +  QL  ++ Y+RD +  KF+
Sbjct: 261 KCSVNFQLKNSNHRRKLLRMWIQTGLVPRTDLLVGFRDPYYNQLDALKPYTRDEIYKKFS 320

Query: 368 HSGLPSNKRELNYNAKVAVEWCNHCIKSICELLGANISDYSCKNPESFEISIDSNNTIAI 427
              L  N++  N+N+ VAV+W +H I  I EL+  N++D      +SF++++  +  +++
Sbjct: 321 TRNLNENRKYYNFNSTVAVQWSHHVIAKITELVDKNLTDEPL---QSFKLTLTRDLQLSL 377

Query: 428 TKLKNIP 434
           TKL N P
Sbjct: 378 TKLANTP 384

>TPHA0J02600 Chr10 complement(577310..578635) [1326 bp, 441 aa] {ON}
           Anc_5.437 YDR370C
          Length = 441

 Score =  237 bits (604), Expect = 9e-73,   Method: Compositional matrix adjust.
 Identities = 136/386 (35%), Positives = 217/386 (56%), Gaps = 22/386 (5%)

Query: 65  RVSYTSFSHSGMHKFPAKPPRDIFHESKEVALF--------TNGQAYTTVRKDILPNLKG 116
           R+ +  FS+S  H   ++P  +IF E+K VAL+        TN +A   + +   P L  
Sbjct: 62  RIPFKHFSYSNAHIGKSQP--NIFQEAKGVALYYDKRITKITNNEA-ELINESNPPFLTK 118

Query: 117 DIAELCERSLLDARERKLPYLGHDLFANIGQFVPMTISELDSILPCISYIENWRLNNHGE 176
           DI+ L E SLLD+++ KLPY+G++L+  I +F PM  + LDS +PC  Y+   +++   E
Sbjct: 119 DISNLSEISLLDSKKFKLPYMGYNLYDEIEKFGPMDSTLLDSTVPCFEYLRTLKISE--E 176

Query: 177 DFKIGRKFTVVTTRHHIVDMTMHLFDRRNKK---RSLVATYMGAGLISFSRNQKNDSRMS 233
           D      +T +T RHH+ ++ M +++ R  +   +S + T +   LI  S +   ++  S
Sbjct: 177 DKLYNTPYTFMTPRHHLTELMMTVYESRESELTGKSWLFTRIKDDLIVISEDLAKENNPS 236

Query: 234 KEGIYSSDPNMKKICYSGFEFENWVTEGIKAADLNGSKLPVFSVVESKLSEEIGLLIRCE 293
            +     +   KK+  SGF FE  V E  +         P F + E++L+ +   +IR E
Sbjct: 237 PQNHKLQNSFSKKVINSGFTFEELVIENFQEC-----HKPYFYISENRLTPKSTFIIRSE 291

Query: 294 MDAFNPVSGANTELKCFAPLSMHNSNHRRKLLKTWIQTGLSPNSDIMIGLRDSHSGQLLD 353
           MD++N  +   TELKCF  L +  + HR+KLLKTW QTGLSPN DI+IG+RD+ SG L D
Sbjct: 292 MDSYNNKTETFTELKCFNKLHLGVAQHRKKLLKTWFQTGLSPNCDIVIGIRDTSSGILED 351

Query: 354 IQWYSRDSLCMKFNHSGLPSNKRELNYNAKVAVEWCNHCIKSICELLGANISDYSCKNPE 413
           + WYSR+++  K     LP  K   ++   + ++W NHCI +I      + SD +  NP 
Sbjct: 352 LLWYSRENMYQKLQDPSLPKFKNSFDFKPHIGIQWLNHCIHAIESAFTKDTSD-TASNPM 410

Query: 414 SFEISIDSNNTIAITKLKNIPKHVEL 439
           ++++ ID + +I I KL  +PK+VE+
Sbjct: 411 TYKVIIDKHKSIIIKKLSIVPKNVEI 436

>CAGL0A02860g Chr1 complement(300736..301944) [1209 bp, 402 aa] {ON}
           similar to uniprot|Q06349 Saccharomyces cerevisiae
           YDR370c
          Length = 402

 Score =  233 bits (594), Expect = 9e-72,   Method: Compositional matrix adjust.
 Identities = 120/345 (34%), Positives = 199/345 (57%), Gaps = 7/345 (2%)

Query: 88  FHESKEVALFTNGQAYTTVRKDILPNLKGDIAELCERSLLDARERKLPYLGHDLFANIGQ 147
           +  +K + +F + + Y   R D+ P LK  IA + + +  +  +   P+LG  L+ N  +
Sbjct: 63  YDSAKTLGIFHDHKLYEMNRMDLFPQLKDPIAHIAKSTPAEKTQLVRPFLGISLYENHDK 122

Query: 148 FVPMTISELDSILPCISYIENWRLNNHGEDFKIGRKFTVVTTRHHIVDMTMHLFDRRNKK 207
           + PMT  ELD+   C +Y++ +  N+HG+ +   R F +VT RHH++D+ +  F R+   
Sbjct: 123 YSPMTAKELDTTEACSTYLDQYE-NSHGQKYGEDRDFVIVTARHHMIDLAILPFSRQFTN 181

Query: 208 RSLVATYMGAGLISFSRNQKNDSRMSKEGIYSSDPNMKKICYSGFEFENWVTEGIKAADL 267
            +L+  Y    L+  S++   D+   K G+ + +P +KKIC+SGF  E+ +TE     + 
Sbjct: 182 VNLLCAYTPGNLLEISQDPA-DNTNDKVGVNTDNPILKKICFSGFALEDILTESANDEER 240

Query: 268 NGSKLPVFSVVESKLSEEIGLLIRCEMDAFNPVSGANTELKCFAPLSMHNSNHRRKLLKT 327
           N    P F +VE++++    LL+RCE+DA+NP++   TELKC+A  +  N NHRRKLLK+
Sbjct: 241 N----PTFLIVENEIAN-TRLLMRCEIDAYNPITSHYTELKCYAKYNFGNPNHRRKLLKS 295

Query: 328 WIQTGLSPNSDIMIGLRDSHSGQLLDIQWYSRDSLCMKFNHSGLPSNKRELNYNAKVAVE 387
           WIQTG+ P +DI+IG+RD+ SG L D++ Y+R+ L  K     LP    ELNY+  ++V 
Sbjct: 296 WIQTGVIPTTDIVIGVRDTESGCLQDVRCYNRNLLYNKLISKSLPRCDSELNYDPAISVV 355

Query: 388 WCNHCIKSICELLGANISDYSCKNPESFEISIDSNNTIAITKLKN 432
           W    I ++   + + +  +    P+ F I +D+N  I I   +N
Sbjct: 356 WYRSLINTLTTTIASLLDKFGRDEPQLFSIKVDNNCNIRIEHRQN 400

>KNAG0C04890 Chr3 (945616..946833) [1218 bp, 405 aa] {ON} Anc_5.437
           YDR370C
          Length = 405

 Score =  232 bits (591), Expect = 3e-71,   Method: Compositional matrix adjust.
 Identities = 142/384 (36%), Positives = 204/384 (53%), Gaps = 19/384 (4%)

Query: 65  RVSYTSFSHSGMHKFPAKPPRDIFHESKEVALFTNGQAY----TTVRKDILPNLKGDIAE 120
           RV +  F H    K+ +KP   IF +SKEVA +T G+ Y     T    ILP LK DIA 
Sbjct: 27  RVRFKEFHHHDPGKYVSKPAH-IFQKSKEVACYTGGKLYINDGNTTNLTILPLLKEDIAA 85

Query: 121 LCE-RSLLDARERKLPYLGHDLFANIGQFV-PMTISELDSILPCISYIENWRLNNHGEDF 178
           L + ++   +   K  YLG  L+A    +V  M+   LDS  PC+ YI  W   + GE  
Sbjct: 86  LAQSKNTQKSGSFKSKYLGLSLYAGFEDYVFTMSPDMLDSAKPCLDYINEWNRGSKGEK- 144

Query: 179 KIGRKF--TVVTTRHHIVDMTMHLFDRRNKKRSLVATYMGAGLISFSRNQKNDSRMSKEG 236
           K G  +   +V  RHH+V++TM LF   +    LV T +    I  S+      R   EG
Sbjct: 145 KFGESYRHIIVGPRHHLVELTMALF-ANDSDYKLVCTVLRGKFIVLSQFDDGSQRNRNEG 203

Query: 237 IYSSDPNMKKICYSGFEFENWVTEGIKAADLNGSKLPV-FSVVESKLSEEIGLLIRCEMD 295
           I  SD   + +CYSGF          K   LN   +P  F    + +         CEMD
Sbjct: 204 ITLSDRRTRMLCYSGFVI-------CKIWSLNRGIIPSQFFYYGTPIRRGHLATFTCEMD 256

Query: 296 AFNPVSGANTELKCFAPLSMHNSNHRRKLLKTWIQTGLSPNSDIMIGLRDSHSGQLLDIQ 355
           A+N +    TELKC+ PL+M +S H+ KLL+TW+QT +SP++D++IG R+++ G L DI 
Sbjct: 257 AYNQIENHYTELKCYGPLNMKSSYHKSKLLRTWVQTEVSPDTDVVIGCRNAYDGTLQDIT 316

Query: 356 WYSRDSLCMKFNHSGLPSNKRELNYNAKVAVEWCNHCIKSICELLGANISDYSCKNPESF 415
             SR+SL  KFN+   P      NYNA+VAVEW  + +K+I  L+  N++  S   P++F
Sbjct: 317 QLSRESLYRKFNNKHQPRAHTNFNYNAQVAVEWSQYAMKAIIRLIEGNLNQKSVLEPQAF 376

Query: 416 EISIDSNNTIAITKLKNIPKHVEL 439
            +++   + I I KLK +PK+ E+
Sbjct: 377 VVTVYRGHDIGIRKLKGVPKYAEI 400

>KLTH0F15994g Chr6 (1298649..1299821) [1173 bp, 390 aa] {ON} weakly
           similar to uniprot|Q06349 Saccharomyces cerevisiae
           YDR370C Hypothetical ORF
          Length = 390

 Score =  209 bits (532), Expect = 9e-63,   Method: Compositional matrix adjust.
 Identities = 122/373 (32%), Positives = 200/373 (53%), Gaps = 24/373 (6%)

Query: 66  VSYTSFSHSGMHKFPAKPPRDIFHESKEVALFT---NGQAYTTVRKDILPNLKGDIAELC 122
           VS   F  + +  FPA+P    F E KE+   T   +   +   RK   P+LK D+    
Sbjct: 19  VSCRGFERASISHFPAEP-LHFFDEVKEIGTMTHWIDSDKFELGRKQSAPHLKKDLGLF- 76

Query: 123 ERSLLDARERKLPYLGHDLFANIGQFVPMTISELDSILPCISYIENWRLNNHGEDFKIGR 182
             ++     +   Y+GHDL  +   F P+T ++L+ +     ++  W   +HG+ +  G 
Sbjct: 77  --TITKKLAKTNSYVGHDLLEHYDDFQPLTPNQLEDMSGVFEFLNKWE-GDHGKPYSSGS 133

Query: 183 KFTVVTTRHHIVDMTMHLFDRRNKKRSLVATYMGAGLISFSRNQKNDSRMSKEGIYSSDP 242
            FT+V +RH+++D+ M  F   ++       Y+   L  F   Q    +   +GIYSS+ 
Sbjct: 134 DFTIVCSRHNLIDLIMAPFS--DEDVHFNVKYINGYLHIFPDKQ---FQKKDDGIYSSES 188

Query: 243 NMKKICYSGFEFENWVTEGIKAADLNGSKLPVFSVVESKLSEEIGLLIRCEMDAFNPVSG 302
           N+++ICY+GFE E+ VTE    A     K   +S+V+ K+S+ I LL + EMD FNP   
Sbjct: 189 NIRRICYTGFELEDLVTETQPGA----PKSAFYSLVQGKISKNIKLLFKAEMDCFNPAKR 244

Query: 303 ANTELKCFAPLSMHNSNHRRKLLKTWIQTGLSPNSDIMIGLRDSHSGQLLDIQWYSRDSL 362
           + TE+KC   L + ++ HRRKLL+ W+QT L P++D++IGLRD +  QL   + Y+R  L
Sbjct: 245 SYTEIKCTTGLKVKSAFHRRKLLRMWVQTSLVPSTDLLIGLRDPYYHQLSSFECYTRQEL 304

Query: 363 CMKFNHSGLPSNKRELNYNAKVAVEWCNHCIKSICELLGANISDYSCKNPE---SFEISI 419
             KFN+  L   K++ NYNA ++V+W  H +K +C+     I+ Y  K P    SF++++
Sbjct: 305 YQKFNNRNLSLLKKKYNYNANISVQWFRHLVKRLCQ----TITPYVEKTPTEAVSFKLTL 360

Query: 420 DSNNTIAITKLKN 432
                + + K++ 
Sbjct: 361 TKQLELRLRKIET 373

>Kwal_55.21415 s55 (826461..827630) [1170 bp, 389 aa] {ON} YDR370C -
           Hypothetical ORF [contig 130] FULL
          Length = 389

 Score =  209 bits (531), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 126/396 (31%), Positives = 215/396 (54%), Gaps = 25/396 (6%)

Query: 42  VSSLGNMSLQQSENHINGHPKFTRVSYTSFSHSGMHKFPAKPPRDIFHESKEVALFT--- 98
           + +L ++SLQ     ++ + K       +F H+ +++FP K     F E +EVA  T   
Sbjct: 2   LPNLQDLSLQDRTEEVHANCK-------NFQHAQINQFP-KNVLPFFDEVQEVATITHLL 53

Query: 99  NGQAYTTVRKDILPNLKGDIAELCERSLLDARERKLPYLGHDLFANIGQFVPMTISELDS 158
           +   +    K  +P L  D+ E  E   L  + +   Y+GHDL  +  ++VP+T  +L+ 
Sbjct: 54  DTDEFLLDDKLGMPELVQDLCEFTESGKLANKGK---YIGHDLLDHFDEYVPITPKQLED 110

Query: 159 ILPCISYIENWRLNNHGEDFKIGRKFTVVTTRHHIVDMTMHLFDRRNKKRSLVATYMGAG 218
           +    +++E W+   HG  F     FT+V +RH+++D+ M  F   +    +  +     
Sbjct: 111 MAGVQAFLERWK-QLHGRSFCDNADFTIVCSRHNLIDLIMMPFSDEDVHLKIQFSNGYLN 169

Query: 219 LISFSRNQKNDSRMSKEGIYSSDPNMKKICYSGFEFENWVTEGIKAADLNGSKLPVFSVV 278
           L   ++ QK D     +GI+S D  +KKICY+GFE EN +T   K  D+  S    +S+V
Sbjct: 170 LSPDAQYQKTD-----QGIHSGDTKIKKICYTGFELENLITATSKP-DVRSS---FYSLV 220

Query: 279 ESKLSEEIGLLIRCEMDAFNPVSGANTELKCFAPLSMHNSNHRRKLLKTWIQTGLSPNSD 338
           E KL + I LL++ EMD FN  + + TE+KC + L + ++ HRRKLL+ W+QT L P+++
Sbjct: 221 EGKLGDGIKLLLKAEMDCFNSSTRSYTEIKCSSGLKVKSTYHRRKLLRMWVQTSLVPSTN 280

Query: 339 IMIGLRDSHSGQLLDIQWYSRDSLCMKFNHSGLPSNKRELNYNAKVAVEWCNHCIKSICE 398
           +++G+RD +  QL   + Y+R  L  KFN+  L   ++  NYNA ++V+W  H I+ +C+
Sbjct: 281 LLVGIRDPYYHQLTSFECYTRSQLYRKFNNQRLTVMRKNYNYNATISVQWFRHVIQQLCQ 340

Query: 399 LLGANISDYSCKNPESFEISIDSNNTIAITKLKNIP 434
           ++   I   S K   +F +++  N TI + K+   P
Sbjct: 341 MIKPFIEKGS-KEEVNFRLTLRKNLTIKLRKMPETP 375

>TBLA0A02800 Chr1 (675150..676511) [1362 bp, 453 aa] {ON} Anc_5.437
           YDR370C
          Length = 453

 Score =  201 bits (512), Expect = 4e-59,   Method: Compositional matrix adjust.
 Identities = 130/383 (33%), Positives = 204/383 (53%), Gaps = 37/383 (9%)

Query: 86  DIFHESKEVALFTNGQAYTTVRKDI-----LPNLKGDIAELCERSLLDARERKLPYLGHD 140
           D++  SKEVA +  G         I     +P LK DI ++  +SLLD+++ K  Y+G D
Sbjct: 58  DLYRTSKEVATYHLGNLNINTDPTIEHTKGVPCLKDDICQIAGKSLLDSKKYKAKYIGAD 117

Query: 141 LFANIGQFVPMTISELDSILPCISYIENWRLNNHGEDFKIG--RKFTVVTTRHHIVDMTM 198
           LF +  ++  M    L   + C  YI+ +   +  E  K G  ++F ++T+RHHI D+ +
Sbjct: 118 LFKDYEKYHAMEKEPLHDPISCFKYIQYYDKKHANEKKKYGMDKEFVIITSRHHINDLVL 177

Query: 199 HLFDR-RNKKRSLVATYMGAGLISFSRN---QKNDSRMSKEGIYSSDPNMKKICYSGFEF 254
             F +  + + S++ TY+G   I  S++   +  D R +K+  Y+S   M+KI  SGF F
Sbjct: 178 APFKKISDPEVSVLLTYLGDNRILLSQDYAHEPPDWRENKQ-FYNS---MRKIVNSGFAF 233

Query: 255 ENWVTEGIKAADLNGS------KLP-----VFSVVESKLSEEIGLLIRCEMDAFNPVSGA 303
           E+ V +   ++ L  S      K P      FSVVE+ +S ++ +L+R EMD +NP++ +
Sbjct: 234 EDLVIKDYTSSKLTPSLEEQQKKDPSITNNYFSVVENDISPKLTILLRSEMDGYNPLTNS 293

Query: 304 NTELKCFAPLSMHNSNHRRKLLKTWIQTGLSPNSDIMIGLRDSHSGQLLDIQWYSRDSLC 363
            TELKCF  L+M +  HR+KLLKTW+Q G  PNSD+++G RD+ +G L DI W+SRD L 
Sbjct: 294 YTELKCFTRLNMGSPFHRQKLLKTWVQIGQLPNSDLLVGSRDTQTGLLNDITWFSRDDLV 353

Query: 364 MKFNHSGLPSNKRELNYNAKVAVEWCNHCIKSICELLGANISDYSCKNPES-------FE 416
            K +    P  +   N     A  W  H + +I  L      DY  K P++       F 
Sbjct: 354 TKCDSYYSPRLRFHQNTTPTNASAWYYHVLSAITSL----TRDYLKKTPKAPSSVPVPFR 409

Query: 417 ISIDSNNTIAITKLKNIPKHVEL 439
           + ++ N TI +  LK +P  V +
Sbjct: 410 LIVEKNRTITLLPLKKVPASVPI 432

>AER404C Chr5 complement(1412412..1413572) [1161 bp, 386 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR370C
          Length = 386

 Score =  172 bits (437), Expect = 8e-49,   Method: Compositional matrix adjust.
 Identities = 123/377 (32%), Positives = 189/377 (50%), Gaps = 31/377 (8%)

Query: 76  MHKFPAKPPRD--------IFHESKEVAL-FTNGQAYTTVRKDILPNLKGDIAELCERSL 126
           M KFP  P           IF ES+EV   F  G  Y    K  LP L     E+CE   
Sbjct: 27  MKKFPHGPITRRGKERSIRIFSESREVGTAFRQGLVYDLDDKKNLPLLND---EICEYIS 83

Query: 127 LDARERKLPYLGHDLFANIGQFVPMTISELDSILPCISYIENWRLNNHGEDFKIGRKFTV 186
             ++ + + Y+G DL      F P+T  EL  +   + +I  W  +N   ++    KFT+
Sbjct: 84  HRSKSKLIGYVGSDLSVESETFHPVTSEELHCLHGLLKFIAKWEADNEV-NYASRSKFTI 142

Query: 187 VTTRHHIVDMTMHLFDRRNKKRSLVAT-YMGAGLISFSRNQKNDSRMSKEGIYSSDPNMK 245
           V+ RHHI+D+ M  F   N++  LV T + G  +I+ + +Q+        GI S     +
Sbjct: 143 VSPRHHILDILMIPFG--NERCRLVFTAHRGLFVITLAPSQR------PTGINSPSSATR 194

Query: 246 KICYSGFEFENWVTEGIKAADLNGSKLPVFSVVESKLSEEIGLLIRCEMDAFNPVSGANT 305
           KICY+GFE E  +T     A     +   +S +E+KL  +I +L++CEMDA+NP     T
Sbjct: 195 KICYTGFELERLLT-----ATSGTERGSFYSFIEAKLEPDITILLQCEMDAYNPKRQKYT 249

Query: 306 ELKCFAPLSMHNSNHRRKLLKTWIQTGLSPNSDIMIGLRDSHSGQLLDIQWYSRDSLCMK 365
           E+K     ++ N  H  KLLK W QT L P++DI++G RD  +  L  +  YS D +  K
Sbjct: 250 EIKSSVDFNVRNVRHLSKLLKIWAQTALLPSTDILVGFRDPSTHVLKTVVPYSVDQIAEK 309

Query: 366 -FNHSGLPSNKRELNYNAKVAVEWCNHCIKSICELLGANISDYSCKNPESFEISIDSNNT 424
            +      S+    N+N +VA +W ++ I+ ICE L +++ D +  +P+SF + ID N  
Sbjct: 310 LYIRDRTRSHPSYFNFNPEVAKDWTHYAIREICERL-SSLVDATSSSPQSFLVEIDKNLQ 368

Query: 425 IAITKLKNIPKHVELFG 441
           + I     +  + EL G
Sbjct: 369 MKIR--PTVVDYSELLG 383

>KLLA0E02245g Chr5 complement(210001..211212) [1212 bp, 403 aa] {ON}
           weakly similar to uniprot|Q06349 Saccharomyces
           cerevisiae YDR370C Hypothetical ORF
          Length = 403

 Score =  130 bits (326), Expect = 7e-33,   Method: Compositional matrix adjust.
 Identities = 95/320 (29%), Positives = 165/320 (51%), Gaps = 19/320 (5%)

Query: 112 PNLKGDIAELCERSLLDARERKLPYLGHDLFANIGQFVPMTISELDSILPCISYIENWRL 171
           P L+ ++    + S  + +  K  ++G DL      +VP+  + L+S++      + +  
Sbjct: 90  PRLRPEVCTYIKDSKWENKAVKDSFIGIDLTKGYDDYVPLDRNVLNSLVILKEAYQRYEK 149

Query: 172 NNHGEDFKIGRKFTVVTTRHHIVDMTMHLFDRRNKKRSLVATYMGAGLISFSRNQKNDSR 231
             + E      K T V+ RHHI+D+ M  F   ++  SL+ T      I  S ++  D  
Sbjct: 150 TLNPE------KTTFVSLRHHIIDIIMCPF--LDEPLSLLMTVQPDKNILISVDKSKDK- 200

Query: 232 MSKEGIYSSDPNM-KKICYSGFEFENWVTEGIKAADLNGSKLPVFSVVESKLSEEIGLLI 290
               GI+ +  +  KKICY+GF  E+ + E      +   +L  +S+V   L++EI LLI
Sbjct: 201 --PNGIHETRNSFNKKICYTGFALEDLLIESPTEGHILEHEL-YYSIVHGSLNDEIDLLI 257

Query: 291 RCEMDAFNPVSGANTELKCFAPLSMHNSNHRRKLLKTWIQTGLSPNSDIMIGLRDSHSGQ 350
           + EMD+ N ++   TE+K      + N+ HRRKLL+ WIQT L P SD++IG R+S+S +
Sbjct: 258 QAEMDSINTLTDTYTEIKSSVHFKLGNTYHRRKLLRMWIQTNLLPKSDLLIGFRNSYSNE 317

Query: 351 LLDIQWYSRDSLCMKFNHSGLPSNKREL-NYNAKVAVEWCNHCIKSICELLGANISDYSC 409
           L  ++ Y    +  K N+S +     +   +N  VA +W  H    I ++L  N+   S 
Sbjct: 318 LEQLKAYKIQDIYHKINNSSIVGKPGKFYKFNPNVANDWFQH----IFQVLKQNLLLLSQ 373

Query: 410 KNPE-SFEISIDSNNTIAIT 428
           ++   +F++ ID+N T++I+
Sbjct: 374 ESTSTTFKVQIDTNLTLSIS 393

>NCAS0E00240 Chr5 complement(34922..36064) [1143 bp, 380 aa] {ON}
           Anc_3.570
          Length = 380

 Score = 37.7 bits (86), Expect = 0.049,   Method: Compositional matrix adjust.
 Identities = 42/154 (27%), Positives = 62/154 (40%), Gaps = 30/154 (19%)

Query: 241 DPNMKKICYSGFEFENWVTEGIKAADLNGSKLPVFSVVESKLSEEIGLLIRCEMDAFNPV 300
           D   KKIC +G E+   V  G+ +A L                  +G  I C  D F   
Sbjct: 186 DKRSKKICNNGDEYVTVVKTGVGSAKL-----------------VLGAEIDCVFD-FKED 227

Query: 301 SGAN----TELKCFAPLSMHNSNHR--RKLLKTWIQTGLSPNSDIMIGLRDSHSGQLLDI 354
              N     ELKC   +      H+  RK+ +TW+Q  L     I+ G RD +   L  I
Sbjct: 228 GKDNLKHYAELKCTTQVITAADAHKFERKIFRTWLQCFLVGIPRIIYGFRDENY-VLKTI 286

Query: 355 QWYSRDSLCMKFNHSGLPSNKRELNYNAKVAVEW 388
           + YS D + +      L +N  ++N     A++W
Sbjct: 287 EEYSTDEIPIL-----LKNNNTKMNSMCLDAIKW 315

>KAFR0J00160 Chr10 complement(26405..27547) [1143 bp, 380 aa] {ON}
           Anc_3.570 YGL246C
          Length = 380

 Score = 35.8 bits (81), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 28/98 (28%), Positives = 42/98 (42%), Gaps = 10/98 (10%)

Query: 306 ELKCFAPLSMHN--SNHRRKLLKTWIQTGLSPNSDIMIGLRDSHSGQLLDIQWYSRDSLC 363
           ELKC   LS +    N  +KL KTW+Q  L     I  G RD  S  L  I+ Y  + + 
Sbjct: 234 ELKCTRSLSSYQDIENFEKKLFKTWLQCFLIGIPRITYGFRD-RSYNLTSIEEYLTEDVP 292

Query: 364 MKFNHSGLPSNKRELNYNAKVAVEWCNHCIKSICELLG 401
             F + G+ +   +       A++W    I  + + L 
Sbjct: 293 KLFTNRGVKAQCMD-------AIQWYGEIIGWLYDTLA 323

>Kwal_47.19276 s47 (1168248..1169408) [1161 bp, 386 aa] {ON} YGL246C
           (RAI1) - Product of gene unknown [contig 344] FULL
          Length = 386

 Score = 35.4 bits (80), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 39/142 (27%), Positives = 53/142 (37%), Gaps = 22/142 (15%)

Query: 208 RSLVATYMGAGLISFSRNQKNDSRMSKEGIYSSDPNMKKICYSGFEFENWVTEGIKAADL 267
           RS  + Y    L + S+      R S E         KKIC +G +F   V  G+    L
Sbjct: 157 RSYYSGYKFESLATLSKPLPQTPRSSLE------KRSKKICNNGDQFVTVVRSGVGNCKL 210

Query: 268 NGSKLPVFSVVESKLSEEIGLLIRCEMDAFNPVSGANTELKCFAPLSM--HNSNHRRKLL 325
                         L  E+  +     D  N +     ELKC   +S      +  RKL 
Sbjct: 211 -------------VLGAEVDCVFDFAEDTSNNLKHY-AELKCTKGVSTFAEARSFERKLF 256

Query: 326 KTWIQTGLSPNSDIMIGLRDSH 347
           KTW+Q  L   + I+ G RD H
Sbjct: 257 KTWLQCFLVGINRIIYGFRDEH 278

>SAKL0F00726g Chr6 complement(63291..64442) [1152 bp, 383 aa] {ON}
           highly similar to uniprot|P53063 Saccharomyces
           cerevisiae YGL246C RAI1 Nuclear protein that binds to
           and stabilizes the exoribonuclease Rat1p required for
           pre-rRNA processing
          Length = 383

 Score = 35.4 bits (80), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 33/120 (27%), Positives = 53/120 (44%), Gaps = 22/120 (18%)

Query: 249 YSGFEFENWVTEGIKAADLNGSKLP------------VFSVVESKLSEE---IGLLIRCE 293
           YSG++FE+ VT      +++ + L               SVV + + +    +G  + C 
Sbjct: 160 YSGYKFESLVTLPKPLGEVSRTTLEKRPKKIVNNGEQYISVVRTGVGKSKLILGAEVDCV 219

Query: 294 MDAFNPVSGAN----TELKCFAPLSM--HNSNHRRKLLKTWIQTGLSPNSDIMIGLRDSH 347
            D F   SG N    TELKC   ++         RK+ KTW+Q  L   + ++ G RD +
Sbjct: 220 FD-FKEDSGDNLKHYTELKCTKGVTTIAEARAFERKIFKTWLQCFLVGVNRVIYGFRDDN 278

>NDAI0I03260 Chr9 (765221..766354) [1134 bp, 377 aa] {ON} Anc_3.570
          Length = 377

 Score = 34.3 bits (77), Expect = 0.57,   Method: Compositional matrix adjust.
 Identities = 33/123 (26%), Positives = 50/123 (40%), Gaps = 26/123 (21%)

Query: 248 CYSGFEFENWVT--------------EGIKAADLNGSKLPVFSVVESKLSEEIGLLIRCE 293
           CY+G++FE+  T              +  K    NG +    +VV++ +     L++  E
Sbjct: 153 CYTGYKFESLATLSQPLPLVSRTTLEKRPKKISSNGDE--YIAVVKTGVGSS-KLVLGAE 209

Query: 294 MDAFNPVSGAN-------TELKCFAPLSMHNSNHR--RKLLKTWIQTGLSPNSDIMIGLR 344
           +D        N        ELKC   +      HR  RKL KTW+Q  L     I+ G R
Sbjct: 210 IDCIFDFKEENKDNLRHYAELKCSTQIITAADAHRFERKLFKTWLQCFLVGIPRIIYGFR 269

Query: 345 DSH 347
           D +
Sbjct: 270 DEN 272

>KLLA0E12893g Chr5 complement(1140409..1141563) [1155 bp, 384 aa]
           {ON} similar to uniprot|P53063 Saccharomyces cerevisiae
           YGL246C RAI1 Nuclear protein that binds to and
           stabilizes the exoribonuclease Rat1p required for
           pre-rRNA processing
          Length = 384

 Score = 33.1 bits (74), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 33/68 (48%), Gaps = 7/68 (10%)

Query: 286 IGLLIRCEMDAFNPVSGAN----TELKCFAPLSMHNSNHR--RKLLKTWIQTGLSPNSDI 339
           IG  + C  D F   S  N     ELKC   ++  +  H+  RKL KTW+Q  L   + I
Sbjct: 214 IGAEVDCIFD-FKEDSDDNLKHYAELKCTTMVNTVSDAHKFERKLFKTWLQCFLVGINRI 272

Query: 340 MIGLRDSH 347
           + G RD +
Sbjct: 273 IYGFRDDN 280

>YGL246C Chr7 complement(37617..38780) [1164 bp, 387 aa] {ON}
           RAI1Nuclear protein with decapping endonuclease activity
           targeted toward mRNAs with unmethylated
           7-methylguanosine cap structures; binds to and
           stabilizes the exoribonuclease Rat1p; required for
           pre-rRNA processing; homologous to human DOM3Z
          Length = 387

 Score = 32.7 bits (73), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 16/45 (35%), Positives = 24/45 (53%), Gaps = 2/45 (4%)

Query: 305 TELKCFAPLSMHNSNHR--RKLLKTWIQTGLSPNSDIMIGLRDSH 347
            ELKC   ++  +  H+  RKL +TW+Q  L     I+ G +D H
Sbjct: 240 AELKCTQQVANISDTHKFERKLFRTWLQCFLVGIPRIIYGFKDDH 284

>Skud_4.324 Chr4 complement(563741..564019) [279 bp, 93 aa] {ON}
           YDR070C (REAL)
          Length = 93

 Score = 30.4 bits (67), Expect = 2.3,   Method: Composition-based stats.
 Identities = 20/61 (32%), Positives = 32/61 (52%), Gaps = 9/61 (14%)

Query: 82  KPPRDIFHESKEVALFTNGQAYTTVRKDILPNLKG--DIAELCERSLLDARERKLPYLGH 139
           + PR + ++S   A       ++   +  LP+LK   D AE  E+SL D+ ++KL  L H
Sbjct: 8   RTPRQLIYKSPRAA-------FSVAARASLPHLKDNQDAAEKKEQSLFDSNKKKLNSLEH 60

Query: 140 D 140
           D
Sbjct: 61  D 61

>AFR307C Chr6 complement(997169..999121) [1953 bp, 650 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGR128C
           (UTP8)
          Length = 650

 Score = 32.3 bits (72), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 24/83 (28%), Positives = 35/83 (42%), Gaps = 5/83 (6%)

Query: 209 SLVATYMGAGLISFSRNQKNDSRMSKEGIYSSDPNMKKICYSGFEFENWVTEGIKAADLN 268
           SL  +Y   GL+ +  +      M        D   KK CY  F+  N   E +   +LN
Sbjct: 167 SLDISYTNVGLVEYFTDSAGKDYM----FVLCDIQNKKTCYKLFQL-NHSAENLPITELN 221

Query: 269 GSKLPVFSVVESKLSEEIGLLIR 291
              L  F++ ESK+  + G L R
Sbjct: 222 SVILEDFALAESKMVYQFGKLYR 244

>Kpol_380.8 s380 (14034..15173) [1140 bp, 379 aa] {ON}
           (14034..15173) [1140 nt, 380 aa]
          Length = 379

 Score = 32.0 bits (71), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 43/164 (26%), Positives = 69/164 (42%), Gaps = 32/164 (19%)

Query: 248 CYSGFEFENWVT--------------EGIKAADLNGSKLPVFSVVESKLSEEIGLLIRCE 293
            YSG++FEN VT              +  K    NG +    SVV + +     L++  E
Sbjct: 156 VYSGYKFENLVTVSKPIPYTSRTTIEKRPKKIVSNGDEY--ISVVRTGVGN-CKLMLGAE 212

Query: 294 MDA-FNPVSGANTELKCFAPLSMHNS--------NHRRKLLKTWIQTGLSPNSDIMIGLR 344
           +DA F+        LK +  L   N+           +K+ KTWIQ  L     I+ G R
Sbjct: 213 VDAIFDFKEEDKDNLKHYVELKTTNAVLTPSDARKFEQKIFKTWIQCFLVGIPRIIYGFR 272

Query: 345 DSHSGQLLDIQWYSRDSLCMKFNHSGLPSNKRELNYNAKVAVEW 388
           D++   L  ++ +S D + +      L SN  +L  +   A++W
Sbjct: 273 DNNF-ILKSVEEFSTDEVPLL-----LKSNSPQLGNSCVDAIKW 310

>Smik_7.15 Chr7 complement(32394..33557) [1164 bp, 387 aa] {ON}
           YGL246C (REAL)
          Length = 387

 Score = 32.0 bits (71), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 16/45 (35%), Positives = 23/45 (51%), Gaps = 2/45 (4%)

Query: 305 TELKCFAPLSMHNSNHR--RKLLKTWIQTGLSPNSDIMIGLRDSH 347
            ELKC   +   +  H+  RKL +TW+Q  L     I+ G +D H
Sbjct: 240 AELKCTKQVMNASDTHKFERKLFRTWLQCFLVGIPRIIYGFKDDH 284

>AFR262C Chr6 complement(904657..906984) [2328 bp, 775 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGL246C
           (RAI1); Tandem gene duplication in this genome
          Length = 775

 Score = 32.0 bits (71), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 41/167 (24%), Positives = 64/167 (38%), Gaps = 26/167 (15%)

Query: 249 YSGFEFENWVTEGIKAADLNGSKL-----------PVFSVVESKLSEEIGLLIRCEMDA- 296
           YSG++FE         A+     L           P +  V      E  L++  E+D  
Sbjct: 568 YSGYKFERMALLDRPVAETPREVLESRGKQVVRNGPQYRTVMRTGVGEHKLVLGAEIDGI 627

Query: 297 --FNPVSGANTELKCFAPLSMHNSNHRRKLLKTWIQTGLSPNSDIMIGLRDSHSGQLLDI 354
             F   +G N +      +   N N   KL  +W+Q  L   + ++IG RD     L  +
Sbjct: 628 IDFREPTGDNLKHYVELKVCQKNRNFSEKLFSSWLQCFLVGINRVIIGFRDEKF-VLKSV 686

Query: 355 QWYSRDSLCMKFNHSGLPSNKRELNY-NAKV-AVEWCNHCIKSICEL 399
           +         +F+ S +P   +   Y N  V A+EW     K +CEL
Sbjct: 687 E---------EFSTSEIPHLLKGTEYSNVCVDAIEWYGALTKWLCEL 724

>Suva_7.15 Chr7 complement(32131..33300) [1170 bp, 389 aa] {ON}
           YGL246C (REAL)
          Length = 389

 Score = 31.6 bits (70), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 16/45 (35%), Positives = 23/45 (51%), Gaps = 2/45 (4%)

Query: 305 TELKCFAPLSMHNSNHR--RKLLKTWIQTGLSPNSDIMIGLRDSH 347
            ELKC   +   +  H+  RKL +TW+Q  L     I+ G +D H
Sbjct: 240 AELKCTQQVMNVSDTHKFERKLFRTWLQCFLVGIPRIIYGFKDDH 284

>Suva_17.1 Chr17 complement(1..1455) [1455 bp, 485 aa] {ON}  YFR054C
           (REAL)
          Length = 485

 Score = 31.6 bits (70), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 17/61 (27%), Positives = 34/61 (55%), Gaps = 3/61 (4%)

Query: 19  NLHSAPDIVREHQKKSFNWKTNSVSSLGNMSLQQSENHINGHPKFTRVSYTSFSHSGMHK 78
           + ++  D+  + +  +F WK NS  ++GNMS++ +        K   + ++SFS+SG  +
Sbjct: 87  DFNTVIDLKDDTKSNAFLWKGNSFQNMGNMSMRGTP---YASSKSQSLKFSSFSNSGFLQ 143

Query: 79  F 79
           F
Sbjct: 144 F 144

>NDAI0G02920 Chr7 complement(676413..677873) [1461 bp, 486 aa] {ON}
           Anc_3.165
          Length = 486

 Score = 30.8 bits (68), Expect = 7.8,   Method: Compositional matrix adjust.
 Identities = 29/96 (30%), Positives = 43/96 (44%), Gaps = 3/96 (3%)

Query: 17  GINLHSAPD-IVREHQKKSFNWKTNSVSSLGNMSLQQSENHINGHPKFTRVSYTSFSHSG 75
           GI L + P  ++ +   K      N+ SSL +  L    N+    PKF + + +S SH  
Sbjct: 122 GIPLETEPSKVIAKMSVKPAKLHHNNTSSLLDGHLGSKGNNEISMPKFLKRNDSSQSHDS 181

Query: 76  MHKFP--AKPPRDIFHESKEVALFTNGQAYTTVRKD 109
              F   +  P+DI H+  EV L  N +    V KD
Sbjct: 182 NFSFNDFSWRPKDIKHKKNEVILHVNEKINILVAKD 217

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.133    0.402 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 50,722,052
Number of extensions: 2278265
Number of successful extensions: 5799
Number of sequences better than 10.0: 39
Number of HSP's gapped: 5898
Number of HSP's successfully gapped: 39
Length of query: 446
Length of database: 53,481,399
Length adjustment: 113
Effective length of query: 333
Effective length of database: 40,524,141
Effective search space: 13494538953
Effective search space used: 13494538953
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 67 (30.4 bits)