Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Smik_4.6355.435ON86386342230.0
YDR369C (XRS2)5.435ON85487122550.0
Suva_2.5415.435ON86988520110.0
Skud_4.6385.435ON84382620040.0
NDAI0B056805.435ON8567376085e-66
TDEL0E019005.435ON7627056036e-66
ZYRO0F10054g5.435ON6607495493e-59
Kpol_1016.55.435ON8126994441e-44
KNAG0C049005.435ON7697234172e-41
NCAS0F033905.435ON8614283951e-38
KAFR0E038305.435ON8452183897e-38
CAGL0A02838g5.435ON8284073264e-30
TBLA0A028205.435ON9252052925e-26
KLTH0F16038g5.435ON7922152746e-24
SAKL0G02552g5.435ON8342132702e-23
Kwal_55.214225.435ON7824422657e-23
Ecym_47615.435ON7987332576e-22
TPHA0J025905.435ON7751142325e-19
AER402C5.435ON8691451987e-15
KLLA0E02201g5.435ON8352021987e-15
KLTH0B03058g5.218ON77183743.4
Ecym_63351.282ON972173718.9
NCAS0A126702.559ON128166719.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Smik_4.635
         (863 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Smik_4.635 Chr4 complement(1135040..1137631) [2592 bp, 863 aa] {...  1631   0.0  
YDR369C Chr4 complement(1215016..1217580) [2565 bp, 854 aa] {ON}...   873   0.0  
Suva_2.541 Chr2 complement(965557..968166) [2610 bp, 869 aa] {ON...   779   0.0  
Skud_4.638 Chr4 complement(1137885..1140416) [2532 bp, 843 aa] {...   776   0.0  
NDAI0B05680 Chr2 complement(1384354..1386924) [2571 bp, 856 aa] ...   238   5e-66
TDEL0E01900 Chr5 (359266..361554) [2289 bp, 762 aa] {ON} Anc_5.4...   236   6e-66
ZYRO0F10054g Chr6 complement(814872..816854) [1983 bp, 660 aa] {...   216   3e-59
Kpol_1016.5 s1016 (10036..12474) [2439 bp, 812 aa] {ON} (10036.....   175   1e-44
KNAG0C04900 Chr3 (946975..949284) [2310 bp, 769 aa] {ON} Anc_5.4...   165   2e-41
NCAS0F03390 Chr6 complement(683109..685694) [2586 bp, 861 aa] {O...   156   1e-38
KAFR0E03830 Chr5 (759871..762408) [2538 bp, 845 aa] {ON} Anc_5.4...   154   7e-38
CAGL0A02838g Chr1 complement(297872..300358) [2487 bp, 828 aa] {...   130   4e-30
TBLA0A02820 Chr1 (678796..681573) [2778 bp, 925 aa] {ON} Anc_5.4...   117   5e-26
KLTH0F16038g Chr6 (1302028..1304406) [2379 bp, 792 aa] {ON} weak...   110   6e-24
SAKL0G02552g Chr7 complement(209978..212482) [2505 bp, 834 aa] {...   108   2e-23
Kwal_55.21422 s55 (830578..832926) [2349 bp, 782 aa] {ON} YDR369...   106   7e-23
Ecym_4761 Chr4 (1479649..1482045) [2397 bp, 798 aa] {ON} similar...   103   6e-22
TPHA0J02590 Chr10 complement(574619..576946) [2328 bp, 775 aa] {...    94   5e-19
AER402C Chr5 complement(1407938..1410547) [2610 bp, 869 aa] {ON}...    81   7e-15
KLLA0E02201g Chr5 complement(205466..207973) [2508 bp, 835 aa] {...    81   7e-15
KLTH0B03058g Chr2 complement(238392..240707) [2316 bp, 771 aa] {...    33   3.4  
Ecym_6335 Chr6 (642156..645074) [2919 bp, 972 aa] {ON} similar t...    32   8.9  
NCAS0A12670 Chr1 (2496486..2500331) [3846 bp, 1281 aa] {ON} Anc_...    32   9.4  

>Smik_4.635 Chr4 complement(1135040..1137631) [2592 bp, 863 aa] {ON}
           YDR369C (REAL)
          Length = 863

 Score = 1631 bits (4223), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 814/863 (94%), Positives = 814/863 (94%)

Query: 1   MWVVRYQNILEDGTISVISCCLQASKSYSIGRSSKNPLIIKHDKSISRQHITLKWQSNSG 60
           MWVVRYQNILEDGTISVISCCLQASKSYSIGRSSKNPLIIKHDKSISRQHITLKWQSNSG
Sbjct: 1   MWVVRYQNILEDGTISVISCCLQASKSYSIGRSSKNPLIIKHDKSISRQHITLKWQSNSG 60

Query: 61  SDSNHNSLCLINQGKLTSINNKFMKVGETFIIEALGVSNSTFIELGATPIRIEVEWKNQV 120
           SDSNHNSLCLINQGKLTSINNKFMKVGETFIIEALGVSNSTFIELGATPIRIEVEWKNQV
Sbjct: 61  SDSNHNSLCLINQGKLTSINNKFMKVGETFIIEALGVSNSTFIELGATPIRIEVEWKNQV 120

Query: 121 WNIPSHLAQFRTALSQFGISTETSINEVPTNIMISDYPSSDDNVIRELCALAENIPLKKS 180
           WNIPSHLAQFRTALSQFGISTETSINEVPTNIMISDYPSSDDNVIRELCALAENIPLKKS
Sbjct: 121 WNIPSHLAQFRTALSQFGISTETSINEVPTNIMISDYPSSDDNVIRELCALAENIPLKKS 180

Query: 181 QLLVKLCNTLLSASITDLTFDERWNDIVKSPEYDVFDANPDLLFSKFMKLSDITILTTIS 240
           QLLVKLCNTLLSASITDLTFDERWNDIVKSPEYDVFDANPDLLFSKFMKLSDITILTTIS
Sbjct: 181 QLLVKLCNTLLSASITDLTFDERWNDIVKSPEYDVFDANPDLLFSKFMKLSDITILTTIS 240

Query: 241 NEPYLPSILRRFNIKLFDFVDINSLYKHVDSLKPSTKYLILTSMNKKENGQILCTTKCLL 300
           NEPYLPSILRRFNIKLFDFVDINSLYKHVDSLKPSTKYLILTSMNKKENGQILCTTKCLL
Sbjct: 241 NEPYLPSILRRFNIKLFDFVDINSLYKHVDSLKPSTKYLILTSMNKKENGQILCTTKCLL 300

Query: 301 TSLIKDTLASVINTKSVSFEAPNNETPVRDPEKLSSASKIHHTIETEASPVIXXXXXXXX 360
           TSLIKDTLASVINTKSVSFEAPNNETPVRDPEKLSSASKIHHTIETEASPVI        
Sbjct: 301 TSLIKDTLASVINTKSVSFEAPNNETPVRDPEKLSSASKIHHTIETEASPVILKKRRLNR 360

Query: 361 XXVLPLDSLNFFAGGLNVKASSESKDITDVKESRCGLDSKSVISSPIIGRAEEKHSLISQ 420
             VLPLDSLNFFAGGLNVKASSESKDITDVKESRCGLDSKSVISSPIIGRAEEKHSLISQ
Sbjct: 361 RRVLPLDSLNFFAGGLNVKASSESKDITDVKESRCGLDSKSVISSPIIGRAEEKHSLISQ 420

Query: 421 DTQKVAGDIEKENGHNSTGAIIVSSPESDAVRTSKRFLDISPQQSSTNMTRRDSQKKSAD 480
           DTQKVAGDIEKENGHNSTGAIIVSSPESDAVRTSKRFLDISPQQSSTNMTRRDSQKKSAD
Sbjct: 421 DTQKVAGDIEKENGHNSTGAIIVSSPESDAVRTSKRFLDISPQQSSTNMTRRDSQKKSAD 480

Query: 481 FVNFETAATSSMEEDKATKAYSITGHPTHSVTQTSEGSHELFNYSQKLSFPLKADLESPV 540
           FVNFETAATSSMEEDKATKAYSITGHPTHSVTQTSEGSHELFNYSQKLSFPLKADLESPV
Sbjct: 481 FVNFETAATSSMEEDKATKAYSITGHPTHSVTQTSEGSHELFNYSQKLSFPLKADLESPV 540

Query: 541 KEVSFREKSSAPHSFVQAIQQTKKREVKRVKSTIVELEDDELSEEAINQLERLAIVEANN 600
           KEVSFREKSSAPHSFVQAIQQTKKREVKRVKSTIVELEDDELSEEAINQLERLAIVEANN
Sbjct: 541 KEVSFREKSSAPHSFVQAIQQTKKREVKRVKSTIVELEDDELSEEAINQLERLAIVEANN 600

Query: 601 DLLRKLPDYRLNTVSSSTEKGGNGVIRQEWQRRKNFKTFVKAWPKFKAQKEGSKNDTQKS 660
           DLLRKLPDYRLNTVSSSTEKGGNGVIRQEWQRRKNFKTFVKAWPKFKAQKEGSKNDTQKS
Sbjct: 601 DLLRKLPDYRLNTVSSSTEKGGNGVIRQEWQRRKNFKTFVKAWPKFKAQKEGSKNDTQKS 660

Query: 661 DFIRGAAFLITRNYVPLKKYSKKNKVTKWDKEESDDMHALTEMEKIGSNAYISDTTNSTT 720
           DFIRGAAFLITRNYVPLKKYSKKNKVTKWDKEESDDMHALTEMEKIGSNAYISDTTNSTT
Sbjct: 661 DFIRGAAFLITRNYVPLKKYSKKNKVTKWDKEESDDMHALTEMEKIGSNAYISDTTNSTT 720

Query: 721 IHKRPQTQRIFIXXXXXXXXXXXXXXXXRGSDAAPNAQPGTIKLFITDDNGNDNKSDRVY 780
           IHKRPQTQRIFI                RGSDAAPNAQPGTIKLFITDDNGNDNKSDRVY
Sbjct: 721 IHKRPQTQRIFISEDSSDNGEEDSFSFSRGSDAAPNAQPGTIKLFITDDNGNDNKSDRVY 780

Query: 781 DKGSSFKLVTESGTDLQQNMSEQSFKTNGRGMGAISKSRGSSRASDIYHXXXXXXXXXXX 840
           DKGSSFKLVTESGTDLQQNMSEQSFKTNGRGMGAISKSRGSSRASDIYH           
Sbjct: 781 DKGSSFKLVTESGTDLQQNMSEQSFKTNGRGMGAISKSRGSSRASDIYHNNNNNNNNNNN 840

Query: 841 XXXXXXXXXXXXGPKFKFKRRKE 863
                       GPKFKFKRRKE
Sbjct: 841 NAADDDDDDDDDGPKFKFKRRKE 863

>YDR369C Chr4 complement(1215016..1217580) [2565 bp, 854 aa] {ON}
           XRS2Protein required for DNA repair; component of the
           Mre11 complex, which is involved in double strand
           breaks, meiotic recombination, telomere maintenance, and
           checkpoint signaling
          Length = 854

 Score =  873 bits (2255), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 472/871 (54%), Positives = 593/871 (68%), Gaps = 27/871 (3%)

Query: 1   MWVVRYQNILEDGTISVISCCLQASKSYSIGRSSKNPLIIKHDKSISRQHITLKWQSNSG 60
           MWVVRYQN LEDG+IS ISCCLQA K+YSIGRSSKNPLIIK+DKSISRQHIT KW+ N+ 
Sbjct: 1   MWVVRYQNTLEDGSISFISCCLQAFKTYSIGRSSKNPLIIKNDKSISRQHITFKWEINNS 60

Query: 61  SDSNHNSLCLINQGKLTSINNKFMKVGETFIIEALGVSNSTFIELGATPIRIEVEWKNQV 120
           SD  H+SLCL+N+GKLTS+N KFMKVGETF I A  V  ST IELG TPIRIE EW N+V
Sbjct: 61  SDLKHSSLCLVNKGKLTSLNKKFMKVGETFTINASDVLKSTIIELGTTPIRIEFEWINEV 120

Query: 121 WNIPSHLAQFRTALSQFGISTETSINEVPTNIMISDYPSSDDNVIRELCALAENIPLKKS 180
           WNIP HL QFRT LS++GISTE SIN++P N+MISDYP S+DN IREL AL   IP+KKS
Sbjct: 121 WNIPPHLTQFRTMLSEYGISTEISINDIPANLMISDYPKSEDNSIRELYALVSTIPMKKS 180

Query: 181 QLLVKLCNTLLSASITDLTFDERWNDIVKSPEYDVFDANPDLLFSKFMKLSDITILTTIS 240
           + L++LCNTLL  S T+L FDE WND++ +PEY+VFD +P++L SKFM+L++I +LTTI 
Sbjct: 181 RFLMELCNTLLPTSKTNLKFDEMWNDMISNPEYNVFDFDPNILLSKFMRLNNIRVLTTIK 240

Query: 241 NEPYLPSILRRFNIKLFDFVDINSLYKHVDSLKPSTKYLILTSMNKKENGQILCTTKCLL 300
           +EP L S+LR FNI LF F +I+SLYK+VDSL+ ST+YLILT+ +KKENG+ILCT K +L
Sbjct: 241 SEPRLSSLLRTFNINLFAFDNIDSLYKYVDSLEASTEYLILTTTDKKENGKILCTIKTML 300

Query: 301 TSLIKDTLASVINTKSVSFEAPNNETPVRDPEKLSSASKIHHTIETEASPVIXXXXXXXX 360
           TS+I  TL++VIN K  S    +N    +  E +S+  K     E EASPV+        
Sbjct: 301 TSIIDGTLSAVINMKGASSRTLDNGKFDQISEGMSTILKTSRAPEVEASPVVSKKRKLNR 360

Query: 361 XXVLPLDSLNFFAGGLNVKASSESKDITDVKESRCGLDSKSVISSPIIGRAEEKHSLISQ 420
             VLPLDSL+FFAGGL+ K  SE++ +TD K   CG +SK+VISSP I  A+EKH+   Q
Sbjct: 361 RRVLPLDSLDFFAGGLSTKTLSENRSLTDAKRLNCGAESKTVISSPNIAEADEKHAPFLQ 420

Query: 421 DTQKVAGDIEKENGHNSTGAIIVSSPESDAVRTSKRFLDIS------PQQSSTNMTRRDS 474
           +  K   DI K++GH+S GAIIVSSP    V TS+  LD S      PQ S   +    S
Sbjct: 421 NALKPTEDIGKKSGHSSPGAIIVSSPNLGTVNTSEDSLDKSLQSHKLPQPSLPEVAGIGS 480

Query: 475 QKKSADFVNFETAATSSMEEDKATKAYSITGHPTHSVTQTSEGSHELFNYSQKLSFPLKA 534
           Q  S++  ++ETAA +SM++ + TK + +  H   ++ Q S+   +L NYS+++S PL+ 
Sbjct: 481 QTISSNSADYETAAVNSMDDAEVTKNFRVNHH--QNIEQPSKNIRKLSNYSREISSPLQE 538

Query: 535 DLESPVKEVSFREKSSAPHSFVQAIQQTKKREVKRVKSTIVELEDDELSEEAINQLERLA 594
           + +SPVKE+S +EKS  PH+FV+AIQ+TK REVKRVKSTIVEL+D+ELSEEAINQL+ LA
Sbjct: 539 NCKSPVKELSIKEKSGTPHAFVEAIQETKNREVKRVKSTIVELKDEELSEEAINQLKNLA 598

Query: 595 IVEANNDLLRKLPDYRLNTVSSSTEKGGNGVIRQEWQRRKNFKTFVKAWPKFKAQKEGSK 654
           IVE +N+LLRK  D   N  S +TEK  N ++  EW +RKNFKTFVK  PK KA KE  K
Sbjct: 599 IVEPSNNLLRKSFDSEGNKTSRTTEKWENSLMEPEWHKRKNFKTFVKVRPKSKAHKEEGK 658

Query: 655 NDTQKSDFIRGAAFLITRNYVPLKKYSKKNKVTKWDKEESDDMHALTEMEKIGSNAYISD 714
           N+TQ SDFIR AAFLITRNYVPLKKYSKK+  TKW  EE++DM ALTEME+ GSN ++SD
Sbjct: 659 NNTQSSDFIRNAAFLITRNYVPLKKYSKKDTTTKWGTEENEDMFALTEMERFGSNTFMSD 718

Query: 715 TTNSTTIHKRPQTQRIFIXXXXXXXXXXXXXXXXRGSDAAPNAQPGTIKLFIT---DDNG 771
             NS TI KR Q    F                 R S  A + QP   K+FIT   D   
Sbjct: 719 NINSNTIQKRSQALNRFTNEDSSNEGEEDSFSFSRCSGTAASVQPLKNKIFITDEDDLGD 778

Query: 772 NDNKSDRVYDKGSSFKLVTESGTDLQQNMSEQSFKTNGRGMGAISKSRGSSRASDIYHXX 831
            D+KSDR+  + ++  L      +L+ N+SE+  K +     A S+SRGS  AS+     
Sbjct: 779 IDDKSDRLNHRENNRNLFVVKEMNLRPNLSEECSKQSRHSRSATSRSRGSFGASN----- 833

Query: 832 XXXXXXXXXXXXXXXXXXXXXGPKFKFKRRK 862
                                GPKF FKRRK
Sbjct: 834 -----------NGDGDDDDDDGPKFTFKRRK 853

>Suva_2.541 Chr2 complement(965557..968166) [2610 bp, 869 aa] {ON}
           YDR369C (REAL)
          Length = 869

 Score =  779 bits (2011), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 451/885 (50%), Positives = 568/885 (64%), Gaps = 40/885 (4%)

Query: 1   MWVVRYQNILEDGTISVISCCLQASKSYSIGRSSKNPLIIKHDKSISRQHITLKWQSNSG 60
           MWV+RYQNILEDG+I+ ISCCLQASKSYSIGRSSKN L+IK+DKSISRQH+T KW+ N  
Sbjct: 1   MWVIRYQNILEDGSINSISCCLQASKSYSIGRSSKNELVIKNDKSISRQHVTFKWEINDS 60

Query: 61  SDSNHNSLCLINQGKLTSINNKFMKVGETFIIEALGVSNSTFIELGATPIRIEVEWKNQV 120
            +   N L L+NQGKLTSIN KFMKVGET  I    VSN T IELG TPIRI+ EW +++
Sbjct: 61  LNPKGNKLSLVNQGKLTSINKKFMKVGETSTISVTKVSNHTEIELGTTPIRIKFEWIDEI 120

Query: 121 WNIPSHLAQFRTALSQFGISTETSINEVPTNIMISDYPSSDDNVIRELCALAENIPLKKS 180
           WNIPS+LAQF+T LSQFGI+T+TSI++   +I+ISD+PS++D+ +REL AL   IPLKKS
Sbjct: 121 WNIPSNLAQFQTILSQFGIATKTSIDDDSASILISDFPSNNDDGMRELYALVHTIPLKKS 180

Query: 181 QLLVKLCNTLLSASITDLTFDERWNDIVKSPEYDVFDANPDLLFSKFMKLSDITILTTIS 240
           QLLV LCN+LLS+S+ +L FDE WN++V  P + VFD +P +LFSKFM+L ++  LTTI 
Sbjct: 181 QLLVDLCNSLLSSSVMNLKFDETWNNMVNKPLFKVFDYDPSVLFSKFMRLDNVITLTTIG 240

Query: 241 NEPYLPSILRRFNIKLFDFVDINSLYKHVDSLKPSTKYLILTSMNKKENGQILCTTKCLL 300
           NE  LP+ILRR N++LF F  +N LYKHVD LKPS KYLILT  NK+ENGQ LCT + L+
Sbjct: 241 NESGLPNILRRLNVRLFHFDCLNDLYKHVDLLKPSEKYLILTFTNKRENGQKLCTLQNLI 300

Query: 301 TSLIKDTLASVINTKSVSFEAPNNETPVRDPEKLSSASKIHHTIETEASPVIXXXXXXXX 360
           TS+I DTL SVINTK+V FE   N TP +  E  ++ SK  HT ETEA+P +        
Sbjct: 301 TSIIDDTLPSVINTKAVPFEVQENNTPEKVFEGHTAISKTVHTPETEATPAVLKKRRLNR 360

Query: 361 XXVLPLDSLNFFAGGLNVKASSESKDITDVKESRCGLDSKSVISSPIIGRAEEKHSLISQ 420
             V PLDSLNFFAGGL+   SS+ K   D KE    L+SK+ +SSPII   + K S   Q
Sbjct: 361 RRVQPLDSLNFFAGGLSADPSSKHKGFADAKEPIFNLNSKTTVSSPIIEEIDRKPSSSVQ 420

Query: 421 DTQKVAGDIEKENGHNSTGAIIVSSPE-SDAVRTSKRFLDISPQQSSTNMTRRDSQKKSA 479
           +TQ+++ D  KENG+  TGA++V SPE   +VR  +        Q S  +TR DSQ  SA
Sbjct: 421 NTQRISRDTWKENGYIGTGAVVVGSPEIGGSVRHDEEEPVNESLQPSPTVTRPDSQNISA 480

Query: 480 DFVNFETAATSSMEEDKATKAYSITGHPTHSVTQT-----SEGSHELFN----------- 523
             V   T     ME  K  ++Y I+   T +  QT     ++  ++  N           
Sbjct: 481 YPVT--TTPEKHMEGRKIVESYKISDDSTQNENQTQNENQTQNENQTQNEMKIKLQTLKD 538

Query: 524 ------YSQKLSFPLKADLESPVKEVSFREKSSAPHSFVQAIQQTKKREVKRVKSTIVEL 577
                  SQK     +A   SP++E+S +E+S+ PHSFV+AIQQTK REVKRVKSTIVEL
Sbjct: 539 NRKFSVLSQKTPSHQQAGHNSPLRELSLKEQSNTPHSFVEAIQQTKNREVKRVKSTIVEL 598

Query: 578 EDDELSEEAINQLERLAIVEANNDLLRKLPDYRLNTVSSSTEKGGNGVIRQEWQRRKNFK 637
           EDDELSEEAINQL  LAIVE +N+LLR       N   SS  +   G IRQEW +RKNFK
Sbjct: 599 EDDELSEEAINQLNNLAIVEPSNELLRDPRSVGSNRTRSSARRSEKGAIRQEWPKRKNFK 658

Query: 638 TFVKAWPKFKAQKEGSKNDTQKSDFIRGAAFLITRNYVPLKKYSKKNKVTKWDKEESDDM 697
           TF K WP  K  KEG K + Q SDFIR AAFLITRNYVPLKKYSKK++ + WDKE +DD+
Sbjct: 659 TFAKVWPNSKTPKEGDKGNNQNSDFIRSAAFLITRNYVPLKKYSKKDRASNWDKENNDDV 718

Query: 698 HALTEMEKIGSNAYISDTTNSTTIHKRPQTQRIFIXXXXXXXXXXXXXXXXRGSDAAPNA 757
            ALTEME + S+ +I D T+++ I +R   Q   +                R SD A   
Sbjct: 719 LALTEMENLESDTHIPDNTDASVIQERSYAQDSVMKENNSDDMKERSFSFSRRSDTASTY 778

Query: 758 QPGTIKLFITDDNGNDNKSDRVYDKGSSFKLVTESGTDLQQNMSEQSFKTNGRGMGAISK 817
           QP   KLF+ +D+ ND+++D V D    F+LVT + ++LQ + +E+S K N  G  A S+
Sbjct: 779 QPVKNKLFVAEDDDNDDENDIVNDSEDGFELVTITKSNLQPDAAEESSKRNRSGGNAASR 838

Query: 818 SRGSSRASDIYHXXXXXXXXXXXXXXXXXXXXXXXGPKFKFKRRK 862
             GS R                             GPKFKFKR+K
Sbjct: 839 PLGSYRND---------------NVNDSDDDDDDEGPKFKFKRKK 868

>Skud_4.638 Chr4 complement(1137885..1140416) [2532 bp, 843 aa] {ON}
           YDR369C (REAL)
          Length = 843

 Score =  776 bits (2004), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 433/826 (52%), Positives = 545/826 (65%), Gaps = 10/826 (1%)

Query: 1   MWVVRYQNILEDGTISVISCCLQASKSYSIGRSSKNPLIIKHDKSISRQHITLKWQSNSG 60
           MWV+RYQN +EDG IS ISCCLQASKSYSIGRSSKN LIIK+DKSISRQHIT KW+ N G
Sbjct: 1   MWVIRYQNTVEDGHISHISCCLQASKSYSIGRSSKNSLIIKNDKSISRQHITFKWEINGG 60

Query: 61  SDSNHNSLCLINQGKLTSINNKFMKVGETFIIEALGVSNSTFIELGATPIRIEVEWKNQV 120
            +   + L LINQGKLTSIN KF+KVGE FII A  VSN T IELG +P  IEV W +++
Sbjct: 61  LNLKASHLSLINQGKLTSINKKFLKVGEKFIIYAPEVSNLTTIELGTSPFHIEVAWVSEI 120

Query: 121 WNIPSHLAQFRTALSQFGISTETSINEVPTNIMISDYPSSDDNVIRELCALAENIPLKKS 180
           WNIPSHL +FRT LSQFGISTE+SI++ P N+MISD+PSSDDN +REL AL   IPLKK 
Sbjct: 121 WNIPSHLTEFRTTLSQFGISTESSIDDGPINLMISDFPSSDDNGMRELYALVNAIPLKKL 180

Query: 181 QLLVKLCNTLLSASITDLTFDERWNDIVKSPEYDVFDANPDLLFSKFMKLSDITILTTIS 240
           +LLV +C TLL AS+ +L FDE W D++ SPE++VF+ +  +L SKFMKL+ I +LTT S
Sbjct: 181 RLLVDVCKTLLPASVRNLKFDEMWKDVLNSPEFNVFNFDASVLSSKFMKLNRIIVLTTTS 240

Query: 241 NEPYLPSILRRFNIKLFDFVDINSLYKHVDSLKPSTKYLILTSMNKKENGQILCTTKCLL 300
           NE  L + LR  N+KL +F ++ SLY+HVD LKPS KYLILTS NK ENGQI CT   L+
Sbjct: 241 NERRLSATLRGLNVKLLNFDNMKSLYEHVDGLKPSIKYLILTSTNKTENGQIQCTINGLI 300

Query: 301 TSLIKDTLASVINTKSVSFEAPNNETPVRDPEKLSSASKIHHTIETEASPVIXXXXXXXX 360
           TS+I+D L ++ NTKSV  E  N +   R  E  S++SK  HT E E  P I        
Sbjct: 301 TSVIEDALPAITNTKSVPCEIQNKKFE-RVSEVQSTSSKTLHTPEIEVGPAILKKRRLNR 359

Query: 361 XXVLPLDSLNFFAGGLNVKASSESKDITDVKESRCGLDSKSVISSPIIGRAEEKHSLISQ 420
             V PLDSL+FFAGGL+ K+SSE +D  D ++   GL  K+VISSP IGR +E  SL  +
Sbjct: 360 RRVQPLDSLSFFAGGLSSKSSSEHQDFADAEKLSPGLGLKTVISSPNIGRMDETSSLAVR 419

Query: 421 DTQKVAGDIEKENGHNSTGAIIVSSPESDAVRTSKRFLDISPQQSSTNMTRRDSQKKSAD 480
           + QKV  + EKENG  STGAI++SSPE  A   S+   D  P+ S   +TR   Q  S  
Sbjct: 420 NIQKVDENNEKENGQKSTGAIVISSPELYAEHISEDSEDKPPRLSPLTVTRPGLQ--SNP 477

Query: 481 FVNFETAATSSMEEDKATKAYSITGHPTHSVTQTSEGSHELFNYSQKLSFPLKADLESPV 540
            ++  T A   ME+ +  + Y      T  + QT E +HE    SQ+ +   + D +SPV
Sbjct: 478 LISRTTPA-HYMEDKRIAENYENGKSSTRDIIQTLEENHEPPEQSQEKNSYSQVDRKSPV 536

Query: 541 KEVSFREKSSAPHSFVQAIQQTKKREVKRVKSTIVELEDDELSEEAINQLERLAIVEANN 600
           KE+  + KS+ P SFV+AIQ+TK REV+R KSTIV+LEDDELSEE INQL+ LAIVE N 
Sbjct: 537 KELLQKRKSNTPLSFVEAIQETKNREVERFKSTIVQLEDDELSEEGINQLKNLAIVEPNE 596

Query: 601 DLLRKLPDYRLNTVSSSTEKGGNGVIRQEWQRRKNFKTFVKAWPKFKAQKEGSKNDTQKS 660
           DLLRK      N+V +  +K  +G++RQEW  RKNFKTF+K WPKFK Q EG+K DTQ S
Sbjct: 597 DLLRKPQILGTNSVRTRAQKNESGIMRQEWHERKNFKTFIKVWPKFKMQNEGNKGDTQNS 656

Query: 661 DFIRGAAFLITRNYVPLKKYSKKNKVTKWDKEESDDMHALTEMEKIGSNAYISDTTNSTT 720
           DFIR AAFLITRNYVPL+KYSK NK T+ + +E++DM  L EME + SN  +S  T+S  
Sbjct: 657 DFIRSAAFLITRNYVPLRKYSKNNKATECNGKENEDMLGLIEMENLVSNTGVSGNTSSAV 716

Query: 721 IHKRPQTQRIFIXXXXXXXXXXXXXXXXRGSDAAPNAQPGTIKLFITDDNGNDNKSDRVY 780
           I + P+TQ  FI                R SD    AQP   KLF+T+D   D+K++ V 
Sbjct: 717 IQQGPRTQNTFINEDISDEGNQQSFSFSRHSDI---AQPAKNKLFVTED---DDKNNMVN 770

Query: 781 DKGSSFKLVTESGTDLQQNMSEQSFKTNGRGMGAISKSRGSSRASD 826
           D  +  +L+T     L+ +  ++  K N R     +    S  A D
Sbjct: 771 DSENGCELITLKKIGLRPSNFDEPSKGNRRSRSTAAGLHESCEAFD 816

>NDAI0B05680 Chr2 complement(1384354..1386924) [2571 bp, 856 aa]
           {ON} Anc_5.435 YDR369C
          Length = 856

 Score =  238 bits (608), Expect = 5e-66,   Method: Compositional matrix adjust.
 Identities = 218/737 (29%), Positives = 349/737 (47%), Gaps = 119/737 (16%)

Query: 1   MWVVRYQNILEDGTISVISCCLQASKSYSIGRSSKNPLIIKHDKSISRQHITLKWQSNSG 60
           MW++RYQ  LEDG I  +S CL+ S +YSIGRSSKNPL IK+DKSISRQHIT+KW+  SG
Sbjct: 1   MWILRYQYGLEDGGIKKVSICLERSIAYSIGRSSKNPLSIKNDKSISRQHITIKWEP-SG 59

Query: 61  SDSNHNSLCLINQGKLTSINNKFMKVGETFIIEALGVSNSTFIELGATPIRIEVEWKNQV 120
                  L L+NQGKLTS+  +++ + E+ I   +  +    + LG  P+ +++ W+   
Sbjct: 60  ------QLHLVNQGKLTSVKERYLAIDESLIFNVVD-TKELDVHLGTNPVIVQIRWQPMN 112

Query: 121 WNIPSHLAQFRTALSQFGISTETSINEVPTNIMISDYPSSDDNVIRELCALAENIPLKKS 180
             IP+   QFR  L+++GI   + I +  ++I       +D  V   L ALA  IP+ KS
Sbjct: 113 LYIPNMYEQFRGLLTKYGIEVTSDILQEDSHITAVVMTPNDYYV--PLLALALGIPVFKS 170

Query: 181 QLLVKLCNTLLSASITDLTFDERWNDIVKSPEYDVFDANPDLLFSKFMK--LSDITILTT 238
           Q L ++ N L   +I   TFD    D+ K    +     P    S   K    D   + T
Sbjct: 171 QYLTEVSNMLRPDNI---TFD---TDVQKINSMESLKLVPSFSLSNNSKNFFQDYFFIIT 224

Query: 239 IS----NEPYLPSILRRFNIKLFDFVDINSLYKHVDSLKPSTKYLILTS------MNKKE 288
           ++    +E    S + R +++L    +   + K    L+ S   ++ TS      +  ++
Sbjct: 225 LNKSSVSEHADKSFILRKSLQLIGGEE--EIIKDPTELQNSVTKILSTSGKNIVIVTDED 282

Query: 289 NG-QILCTTKC-----LLTSLIKDTL----ASVINTKSVSFEAP---NNE---TPVRDP- 331
           NG +++   +C     +  S +K+      +++  T  VS +AP    NE     +++P 
Sbjct: 283 NGKRMIMNFECRNVKDIFDSFVKNDPKLLKSNLTETGVVSPKAPEIFENEKLMVEIQEPP 342

Query: 332 ------EKLSSASKIHHTIETEASPVIXXXXXXXXXXVLPLDSLNFFAGGLNVKASSESK 385
                 E+ +S+  + HT     +  I          V PL+SL+FF GG       E+ 
Sbjct: 343 IEAAITEESTSSKNLKHTPPEPVTTHIVKKRRLARKRVKPLESLDFFVGGSTTGTPFETS 402

Query: 386 DITDVKESRCGLDSKSVISSPIIGRAEEKHSLISQDTQKVAGDIEKENGHN--STGAIIV 443
             T  +E    ++ K    +PI+   + + S +++   + A DI    G +   T A+  
Sbjct: 403 STTLQQEI---IEPKVPDVAPILNE-QIQQSQVNKSINEPAKDIYSIGGSDRKETAALTY 458

Query: 444 SS-------PESDAVRTSKRFLDISPQQSSTNMTRRDSQKKSADFVNFETAATSSMEEDK 496
           ++       P         + +DISP  +S    +R +  + +  +   T   +  +++K
Sbjct: 459 ATIDKHMQEPTQQIDDIPSQHIDISPHGNSNEQEKRSNSSEKSPMI---TQQVNDEKDEK 515

Query: 497 ATKAYSITGHPTHSVTQTSEGSHELFNYSQKLSFPLKADLESPVKEVSFREKSSAPHSFV 556
            + A +                                 L+   +E S R   + P S V
Sbjct: 516 ISNAKA---------------------------------LKIGKREDSKRYSETTPKSMV 542

Query: 557 QAIQQTKKREVKRVKSTIVELEDDELSEEAINQLERLAIVEANNDLLRKLPDYRLNTVSS 616
           + IQ  K REV R++S+I  ++ +EL+E+AIN+   LAIVE+N  L+R+  +      + 
Sbjct: 543 ETIQDIKNREVTRLQSSIAHVDAEELTEDAINEFSNLAIVESNASLIRRTEN------ND 596

Query: 617 STEKGGNGVIRQE--------WQRRKNFKTFVKAWPKFKAQKEGSKN---DTQKSDFIRG 665
           +T K  N V+R +         + R+NFK FVK +PK+   K  S N   D   SDFIR 
Sbjct: 597 NTNKSTNSVVRHDSPDNIMNVLEGRRNFKRFVKVYPKYIQNKNDSNNERGDNGASDFIRN 656

Query: 666 AAFLITRNYVPLKKYSK 682
            AFLITRNYVPLK+YSK
Sbjct: 657 NAFLITRNYVPLKQYSK 673

>TDEL0E01900 Chr5 (359266..361554) [2289 bp, 762 aa] {ON} Anc_5.435
           YDR369C
          Length = 762

 Score =  236 bits (603), Expect = 6e-66,   Method: Compositional matrix adjust.
 Identities = 209/705 (29%), Positives = 323/705 (45%), Gaps = 89/705 (12%)

Query: 1   MWVVRYQNILEDGTISVISCCLQASKSYSIGRSSKNPLIIKHDKSISRQHITLKWQSNSG 60
           MW+++Y   LEDGTI  +S CL   +++SIGRSSKNPL IK+DKSISR HI++ W     
Sbjct: 1   MWILKYTYELEDGTIRRVSSCLVKQQTFSIGRSSKNPLNIKNDKSISRNHISVVW----- 55

Query: 61  SDSNHNSLCLINQGKLTSINNKFMKVGETFIIEA-LGVSNSTFIELGATPIRIEVEWKNQ 119
            DS    + LINQG+LT+   K++KVGE+   E  L +     IELG  PI++EV W++ 
Sbjct: 56  -DSEVKLIRLINQGRLTAAGGKYLKVGESMDFEEKLHIREPIIIELGTKPIKVEVVWQDV 114

Query: 120 VWNIPSHLAQFRTALSQFGISTET-SINEVPTNIMISDYPSSDDNVIRELCALAENIPLK 178
           V+++PS L+QF   L   GI  +  +++   T I+++D         + L  L     ++
Sbjct: 115 VFDLPSQLSQFIDTLDHVGIGVKADTVDNRSTTIIVTD---KIKFAYKCLFGLINGAVIR 171

Query: 179 KSQLLVKLCNTLLSASITDLTFDERWNDIVKSPEYDVFDAN--PDLLFSKFMKLSDITIL 236
            SQ LV++ N +LS   T  TF+E W+ ++++  Y ++  N  P  +  K  K     I 
Sbjct: 172 NSQFLVEVTN-ILSKPTT--TFEESWDSLIQNESYMLYPNNLGPHEVILKGYKF--YLIA 226

Query: 237 TTISNEPYLPSILRRFNIKLFDFVDINSLYKHVDSLKPSTKYLILTSMNKKENGQI---- 292
           + +    Y+   L R N +L    +   L   +D LK       L  +  +E  +I    
Sbjct: 227 SDVITMAYVQEALERGNGELIVVENTEQL---LDRLKQENSTDDLIVLKAEETTKIPGDK 283

Query: 293 --LCTTKCLLTSLIKDTLASVINTKSVSFEAPNN----ETPVRDPEKLSSASKI---HHT 343
             L T   L+ ++  +T+ +++         P +      P     ++SS+  +    HT
Sbjct: 284 IKLHTLVDLVNAVSHNTVKTLLGGVPPMEAGPGDVIGSHQPTLTKTEVSSSQSLSNKEHT 343

Query: 344 IETEASPVIX-XXXXXXXXXVLPLDSLNFFAGGLNVKASSESKDITDVKESRCGLDSKSV 402
            E   +P             V PLDSL FFAGG +       ++I+    +    D+   
Sbjct: 344 PEHTVTPAEKPPVKRRRYNRVKPLDSLMFFAGG-DYSTEEPEQEISTQPVNPAASDTAKT 402

Query: 403 ISSPIIGRAEEKHSLISQDTQKVAGDIEKENGHNSTGAIIVSSP----ESDAVRTSKRFL 458
             +  I   E   S  S    K   +I  +   NS   + + SP     +  + T+ + +
Sbjct: 403 SITTQINVPENDASQESSAFDKFQPNIVLK---NSAKPLTIDSPGDAHNTHEINTANQHV 459

Query: 459 DISPQQSSTNMTRRDSQKKSADFVNFETAATSSMEEDKATKAYSITGHPTHSVTQTSEGS 518
               QQ   N    + Q + A+    ET    +  +       S   +P +S + T EG 
Sbjct: 460 KDIAQQIEMNHPESEQQSEQANLNMVETTPRPTARKKTLQDFKSTVNNPDNSASST-EG- 517

Query: 519 HELFNYSQKLSFPLKADLESPVKEVSFREKSSAPHSFVQAIQQTKKREVKRVKSTIVELE 578
                                                V  I+  K REVKR+KST+V+++
Sbjct: 518 ------------------------------------LVDLIKDAKSREVKRLKSTLVQVD 541

Query: 579 DDELSEEAINQLERLAIVEANNDLLRKLPDYRLNTVSSSTEKGGNGVIRQEWQRRKNFKT 638
            DEL+E+AINQL  LAIV+ N+ L+R     R    S+ T +         W  RKNFK 
Sbjct: 542 TDELTEDAINQLGDLAIVQPNDSLIR-----RQKIDSAETSRNDQ---HPPWDGRKNFKN 593

Query: 639 FVKAWPKFKAQKEGSKNDTQKSDFIRGAAFLITRNYVPLKKYSKK 683
           FVK   K+K Q+ G       SDFIR + +L+TR YVP K Y+K+
Sbjct: 594 FVKVQAKYKEQRMGENYREGSSDFIRNSGYLLTRQYVPSKIYTKE 638

>ZYRO0F10054g Chr6 complement(814872..816854) [1983 bp, 660 aa] {ON}
           weakly similar to uniprot|P33301 Saccharomyces
           cerevisiae YDR369C XRS2 classified as an early
           recombination function required for DNA repair but
           dispensable for mitotic recombination (xrs2 is hyper-Rec
           during vegatative growth) required for double strand
           breaks meiotic recombination and spore viability DNA
           repair protein
          Length = 660

 Score =  216 bits (549), Expect = 3e-59,   Method: Compositional matrix adjust.
 Identities = 220/749 (29%), Positives = 343/749 (45%), Gaps = 157/749 (20%)

Query: 1   MWVVRYQNILEDGTISVISCCLQASKSYSIGRSSKNPLIIKHDKSISRQHITLKWQSNSG 60
           MW++RYQ  LEDG +  +SCCL+  ++Y+IGRSSKN L IK+DKSISRQH+++ W     
Sbjct: 1   MWILRYQYDLEDGNLKHVSCCLRLGETYNIGRSSKNLLNIKNDKSISRQHVSICW----- 55

Query: 61  SDSNHNSLCLINQGKLTSINNKFMKVGETFIIEALGVSNST-FIELGATPIRIEVEWKNQ 119
            D     L LINQGK+T+++ K++K+GE+    + G S  T  +ELG  P++++++W + 
Sbjct: 56  -DGKDRQLKLINQGKMTAVSEKYLKMGESI---SFGKSMGTVLVELGTKPLKMQLQWMDS 111

Query: 120 VWNIPSHLAQFRTALSQFGI---STETSINEVPTNIMISDYPSSDDNVIRELCALAENIP 176
           +W +P       +AL + GI   S+E S      N+++ D      N  R L  L + IP
Sbjct: 112 IWMVPQGSRSDHSALEELGIEVLSSELSR----ANLIVID---EQQNYSRWLYGLVKRIP 164

Query: 177 LKKSQLLVKLCNTLLSASITDLTFDERWNDIVK--SPEYDVFDANPDLL----FSKFMKL 230
           L   + L  + +  +S   T+  FD  W  I+   S  Y  ++    +L    F    K 
Sbjct: 165 LMNLEFL-NVVSQKVSGHETE--FDSIWTKIMNDGSLRYKSWEVQAQVLQNLEFLTVGKD 221

Query: 231 SDITILTTISNEPYLPSI----LRRFNIKLFDFVDINSLYKHVDSLKPSTKYLILTSMNK 286
            D ++    +   Y   +    LR    +  D  ++  L  H   L P+ +   L  + K
Sbjct: 222 EDTSLAIEAAGGKYSAVLSVEELREAVKRKGDLSNVVILKSH---LTPAEE---LAPLGK 275

Query: 287 KENGQILCTTKCLLTSLIKDTLASVINTKSVSFEA---PNNETPVRDPEKLSSASKIHHT 343
                   T + ++ +++KD + S+ N   V  E    P  E P+  P            
Sbjct: 276 ------TFTVQDVVEAILKDEVNSLKN--GVIGEVAKRPEAEVPMEKP------------ 315

Query: 344 IETEASPVIXXXXXXXXXXVLPLDSLNFFAGGLNVKASSESKDITDVKESRCGLDSKSVI 403
                   +          V PLD L+FFAGG ++K S          ES   L+S+   
Sbjct: 316 --------VTKKRRLNRPRVKPLDILSFFAGGDSMKESQ--------GESTMKLNSQ--- 356

Query: 404 SSPIIGRAEEKHSLISQDTQKVAGDIEKENGHNSTGAIIVSSPESDAVRTSKRFLDIS-- 461
                   EE+    S+D +K+    E+     S  +  V  PE       K F + S  
Sbjct: 357 --------EEE----SKDPRKLEDPKEE-----SKESKEVLQPE-----VPKEFNEYSKE 394

Query: 462 -PQQSSTNMTRRDSQKKSADFVNFETAATSSMEEDKATKAYSITGHPTHSVTQTSEGS-H 519
            P Q S   ++ D  +K             S+EE         T  PT  VT+    S  
Sbjct: 395 EPGQKSYEESKADENEK-------------SLEE---------TVEPTLQVTEPPPTSAA 432

Query: 520 ELFNYSQKLSFPLKADLESPVKEVSFREKSSAPHSFVQAIQQTKKREVKRVKSTIVELED 579
           E  N ++    P  +D          + +S + +  +Q IQ TK  EVKR+ STI+++ D
Sbjct: 433 EKPNNARPHRKPTLSDYR--------KGESPSQNDMIQMIQDTKNHEVKRLNSTIIQVGD 484

Query: 580 DELSEEAINQLERLAIVEANNDLLRKLPDYRLNTVSSSTEKGGNGVIRQEWQRRKNFKTF 639
           +EL+E+AINQL  L +V+ N++L+R+    R  TV S             W  RKNFK F
Sbjct: 485 EELTEDAINQLGNLVLVDRNDNLMRRRD--RSPTVDSHNPN---------WNNRKNFKNF 533

Query: 640 VKAWPKFKAQKEGSKNDTQKSDFIRGAAFLITRNYVPLKKY-----SKKNKVTKWD-KEE 693
           VK WPK+  Q   S+  +  SD IR  AFL+TR YVP + Y     SK+ +   +D  E 
Sbjct: 534 VKVWPKYGGQDSTSREGS--SDTIRNRAFLLTRQYVPTRTYTSGDSSKQAQEDLYDFPEP 591

Query: 694 SDDMHALTEMEKIG-SNAYISDTTNSTTI 721
             +  ++ ++E  G +N ++ D  +S  +
Sbjct: 592 QPEAQSVPQVEAPGPNNLFVMDEDDSQDV 620

>Kpol_1016.5 s1016 (10036..12474) [2439 bp, 812 aa] {ON}
           (10036..12474) [2439 nt, 813 aa]
          Length = 812

 Score =  175 bits (444), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 184/699 (26%), Positives = 326/699 (46%), Gaps = 72/699 (10%)

Query: 1   MWVVRYQNILEDGTISVISCCLQASKSYSIGRSSKNPLIIKHDKSISRQHITLKWQSNSG 60
           MWV+RYQ  L+DG++  ISCC++  ++Y +GRSSKN L +++DKSISRQ I+++W     
Sbjct: 1   MWVLRYQYSLDDGSVEKISCCIRNEETYYLGRSSKNQLSVRNDKSISRQQISIQW----- 55

Query: 61  SDSNHNSLCLINQGKLTSINNKFMKVGETFIIEALGVSNSTFIELGATPIRIEVEWKNQV 120
            D + + + + N GK+T +  +++  GET   ++   ++   +++G TPI + + W+ + 
Sbjct: 56  -DRDKDCIMVKNLGKVTMVEERYLSDGETLSFQS--KNDLVTMKIGTTPIVVNLSWEVKR 112

Query: 121 WNIPSHLAQFRTALSQFGISTETSINEVPTNIMI-SDYPSSDDNVIRELCALAENIPLKK 179
            N           L  +G    T  N    +++I +D  +  D  ++    + + I +  
Sbjct: 113 CNYMKTDMDMVHLLQSYGFQPTTIENSHSLDMIIQNDVTTISDKYLKCYSMIHDTILINS 172

Query: 180 SQLLVKLCNTLLSASITDLTFDERWNDIVKSPEYDVFDANPDLL-FSKFMKLSDITILTT 238
             L   L N ++        FD  W  +  S E ++ +   ++   +K +K   + +L  
Sbjct: 173 KTLRDILTNNIIMTK----KFDSYWVKL-NSHESNIQNHTINVTKLAKSLKGMHMFLLDP 227

Query: 239 IS-NEPYLPSILRRFNIKLFDFVDINSLYKHVDSLKPSTKYLILTSMNKKENGQIL--CT 295
            S N  Y    L         F++IN L  ++++     ++L+L+S  K EN   L    
Sbjct: 228 ESYNCEYFEKFLEEIGCIPRKFLNINDLETYLETQFKGGEFLLLSSA-KLENQSRLERFI 286

Query: 296 TKCLLTSLIKDTLASVINTKSVSF---EAPNNETPVRDP---EKLSSASKIHHTIET-EA 348
           +  L + L K     +   +S++    E+ N   PV      E+ + A  I   +E  E 
Sbjct: 287 SIPLESFLDKLLFLDLDFGQSINRSKEESKNVIEPVLKEVGVEQTTEAVPISKNVEIYEP 346

Query: 349 SPVIXXXXXXXXXXVLPLDSLNFFAGGLNVKASSESKDITDVKESRCGLDSKSVISSPII 408
            P            V PLDSLNFFAGG           +T +  S+  L    V  +  I
Sbjct: 347 QP---KKRRLNRSRVKPLDSLNFFAGG-----------VTSIGASQLPL---PVEEANNI 389

Query: 409 GRAEEKHSLISQDTQKVAGDIEKENGHNSTGAIIVSS-----PESDAVRTSKRFLDISPQ 463
            R ++K  + SQ   ++  +IE E   +  G ++ ++     P+SD     ++ + ++  
Sbjct: 390 TRKKDKEVIKSQGKGEI--NIETEMDESGNGELLSTASEFKKPKSDVQHKLEKRMQVAID 447

Query: 464 QSSTNMTRRDSQKKSADFVNFETAATSSMEEDKATKAYSITGHPTHSVTQTSEGSHELFN 523
           +S   + +     K  + ++ +   ++ ++    T +  I    T    +++  + E   
Sbjct: 448 RSPEKIKK----PKLEENISIQQLLSNKVKSTSDTSSVLI---ETQIAKESNTKAIEYGK 500

Query: 524 YSQKLSFPLKADLESPVKEVSFREKSSAPHSFVQAIQQTKKREVKRVKSTIVELEDDELS 583
             QK     K   +  ++  S           V AIQ  K+RE  RVK++IVE++++EL+
Sbjct: 501 VRQKTLTDYKHTSDERIERPSV--------DLVHAIQDIKERETLRVKTSIVEIKENELT 552

Query: 584 EEAINQLERLAIVEANNDLLRKLPDYRLNTVSSSTEKGGNGVIRQEWQRRKNFKTFVKAW 643
           EEAIN+   L +V+ N  L +   D  L+    +     N     +W  +KNFK FVK  
Sbjct: 553 EEAINKFSDLTVVDINTRLFK---DKSLDINKPANSNQNN----MDWSGKKNFKKFVKMV 605

Query: 644 PKFKAQKEGSKNDTQKSDFIRGAAFLITRNYVPLKKYSK 682
           PK+K  +   ++    S FIR +A LITRN+VP+K+YSK
Sbjct: 606 PKYKRSQGNGQHADSCSTFIRNSAMLITRNFVPMKQYSK 644

>KNAG0C04900 Chr3 (946975..949284) [2310 bp, 769 aa] {ON} Anc_5.435
           YDR369C
          Length = 769

 Score =  165 bits (417), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 184/723 (25%), Positives = 315/723 (43%), Gaps = 114/723 (15%)

Query: 1   MWVVRYQNILEDGTISVISCCLQASKSYSIGRSSK-NPLIIKHDKSISRQHITLKWQSNS 59
           MW++RY    ED     +SCCLQ S++YSIGRSSK N L+IK+DKSISRQHI+ +W S  
Sbjct: 1   MWILRYSYESEDHGTVYVSCCLQRSRNYSIGRSSKTNALVIKNDKSISRQHISFQWVS-- 58

Query: 60  GSDSNHNSLCLINQGKLTSINNKFMKVGETFIIEALGVSNSTFIELGATPIRIEVEWKNQ 119
                H+ + ++N GKLT IN+ F+K  ET  I ++  S  T I++G+ P+ + + W++ 
Sbjct: 59  -----HDYVDIVNDGKLTYINDAFLKPKETTRI-SISASKETNIKVGSAPVIVNLVWEDV 112

Query: 120 VWNIPSHLAQFRTALSQFGISTETSINEVPTNIMISDYPSSDDNVIRELCALAENIPLKK 179
             ++ + ++    +L   GI    S + V  NI         ++ ++ LC   + I    
Sbjct: 113 FIDM-TPISDTGQSLKLIGIYPAGSTHGV--NI---------EDAMKTLCIKIKEIKWPH 160

Query: 180 SQL-LVKLCNTLLSASITDL-------------TFDERWNDIVKSPEYDVFDANPDLLFS 225
             + L++  N L  A + DL             +FDE WN  V S +Y  +   P+    
Sbjct: 161 QLIALIRGANRLYKADLVDLMAQQLVDSNENISSFDEIWNRTVDSGQYKEY---PNFKVD 217

Query: 226 KFMKLSDITILTTISNEPYLP---SILRRFNIKLFDFVDINSLYKHVDSLKPSTKYLILT 282
           +     D TI+   +N+  +    S +      L  FV+  S  K+  + +     L+L 
Sbjct: 218 R-NSFRDFTIIYFDNNDSDISGVRSCVEFCGGTLLSFVNNESFEKYASTNETLHNVLLLR 276

Query: 283 SMNKKENGQI--------LCTTKCLLTSLIKDTLASVINTKSVSFEAPN-NETPVRDPEK 333
           S   + +  +        +C+T     ++ ++ ++++++ +       +  +  +R P++
Sbjct: 277 SERFQVSHPVYEILNKIDICSTGSFFKAVTENNVSTLVHRELFLRRYTDITQKEMRRPKE 336

Query: 334 LSSASKIHHTIETEASPVIXXXXXXXXXXVLPLDSLNFFAGGLNVKASSESKDITDVKES 393
                     +E  A P+           V PL+ L FFAGG     + +S D       
Sbjct: 337 ---------PVEDTAVPL--KKRRLNRRKVQPLNPLEFFAGGDTATTTKQSSD------- 378

Query: 394 RCGLDS-KSVISSPIIGRAEEKHSLIS------QDTQKVAGDIEKENGHNSTGAIIVSSP 446
             GL + K+V  + +  +      ++S      QDT    G I      N+  A +    
Sbjct: 379 -DGLAATKAVDETEVSDKMHGSGDVLSNSTNNNQDTVATQGKISPILEMNALSAEVPKGD 437

Query: 447 ESDAVRTSKRFL---DISPQQSSTNMTRRDSQKKSADFVNFETAATSSMEEDKATKAYSI 503
           ES  V    R     D  P     N   ++ +         E    SS+ E   T    +
Sbjct: 438 ESSHVVEPDRTYEKDDCLPDNLEVNGMMKEPEPV------IEKTRQSSINESLRTPKEPV 491

Query: 504 TGHPTHSVTQTSEGSHELFNYSQKLSFPLKADLESPVKEVS-FREKSSAPH---SFVQAI 559
                                S++ S  +  +  +P ++    R + + P    S V+ I
Sbjct: 492 AEMEDELEEVDEVDEPTHLKASREASKIVGPESLAPSRDTEVLRPRPAKPRNSSSLVETI 551

Query: 560 QQTKKREVKRVKSTIVELEDDELSEEAINQLERLAIVEANNDLLRKLPDYRLNTVSSSTE 619
           Q  K  E +R++ T+  ++  EL++EAI     +AIVE   +++RK P      V+ S+ 
Sbjct: 552 QSVKDNETRRLQCTLTPVDPSELTDEAIADFSNMAIVEPTVNIVRKKP----AMVTESS- 606

Query: 620 KGGNGVIRQEWQRRKNFKTFVKAWPKFKAQKEGSKNDTQKSDFIRGAAFLITRNYVPLKK 679
                 IR +   R NFK F+K WPK +          + +D +R  A+LITR+YVP+K 
Sbjct: 607 ------IRSD---RPNFKKFMKVWPKAR----------KGNDSLRNNAYLITRDYVPMKA 647

Query: 680 YSK 682
           Y++
Sbjct: 648 YNR 650

>NCAS0F03390 Chr6 complement(683109..685694) [2586 bp, 861 aa] {ON}
           Anc_5.435 YDR369C
          Length = 861

 Score =  156 bits (395), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 129/428 (30%), Positives = 202/428 (47%), Gaps = 71/428 (16%)

Query: 1   MWVVRYQNILEDGTISVISCCLQASKSYSIGRSSKNPLIIKHDKSISRQHITLKWQSNSG 60
           MWV+RYQ  LEDG+   IS C+Q S  Y+IGRS+KN L IK+DKSISRQH++LKW+    
Sbjct: 1   MWVLRYQYDLEDGSTQKISRCIQKSVCYTIGRSNKNHLSIKNDKSISRQHLSLKWE---- 56

Query: 61  SDSNHNSLCLINQGKLTSINNKFMKVGETFIIEALGVSNSTFIELGATPIRIEVEWKNQV 120
              + N + +INQGKLT I  +++ VG++      G  NS  I+LG  P+ + +E+ +  
Sbjct: 57  ---DRNDIHIINQGKLTYIGEQYLDVGQSL---TFGNVNSLSIKLGTKPVMVHLEFYSSN 110

Query: 121 WNIPSHLAQFRTALSQFGISTETSI---NEVPTNIMISDYPSSDDNVIRELCALAENIPL 177
           W IP+ L QF   L  FG++  T I    +   ++++ +   S    +  L    ++IP+
Sbjct: 111 WLIPNGLTQFHETLKDFGVNVATQIPVDQKTQIDLIVDEINGSG---LIPLWGFMKDIPV 167

Query: 178 KKSQLLVKLCNTLLSASITDLTFDERWNDIVKSPEYDVFDANPDLLFSKFMKLSD----- 232
           KK Q     C  L S    D  FD  W+ + ++           L  S ++ L D     
Sbjct: 168 KKPQFFSTACEILSS---NDNDFDNSWHRLQETSNT--------LFCSHYISLKDRSRLF 216

Query: 233 --ITILTTISNE------PYLPSILRRFNIKLFDFVDINSLYKHVDSLKPST-KYLILTS 283
               IL    NE        L + L      + DF D+N+   ++++LKP+T +++ L  
Sbjct: 217 ENYVILILFDNETNKDAVKTLKTALNLGGAIVNDFSDLNASKDYINNLKPTTNQHICLVK 276

Query: 284 MN--KKENGQI----LCTTKCLLTSLIKDTLASVINTKSVSFEAPNNETPVRDPE----- 332
               K  N Q+        + ++T++  D +  +I T     +  N +  +  PE     
Sbjct: 277 FGSFKSPNDQLPDLEYFKLEDIITAIRDDKIMKLITTIPEREQVMNQDVSLI-PEITYPS 335

Query: 333 -KLSSASKIHHTIET---------------EASPV--IXXXXXXXXXXVLPLDSLNFFAG 374
            + ++    HHT+++               EA+ V  I          V PLDSL FFAG
Sbjct: 336 DRKTNIQPSHHTVDSIHNDKKNVLSNRDPGEATLVNPIVKKRRLNRQRVKPLDSLAFFAG 395

Query: 375 GLNVKASS 382
           G + K  S
Sbjct: 396 GASPKIGS 403

 Score =  124 bits (312), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 72/148 (48%), Positives = 96/148 (64%), Gaps = 9/148 (6%)

Query: 552 PHSFVQAIQQTKKREVKRVKSTIVELEDDELSEEAINQLERLAIVEANNDLLRKLPDYRL 611
           P SFVQAIQ+TK REV R+KST+VE++ DEL+E AINQL  L IVE N  L+RK    + 
Sbjct: 538 PKSFVQAIQETKNREVTRLKSTMVEIDTDELTEGAINQLGSLVIVEPNQSLIRK----KA 593

Query: 612 NTVSSSTEKGGNG-VIRQEWQRRKNFKTFVKAWPKFKAQKEGSKNDTQKSDFIRGAAFLI 670
           +     T  G +     +EW RRKNFK FVK +PK+   K+ +++DT  +D IR  AFLI
Sbjct: 594 SRCECRTPTGEDSDKTAREWSRRKNFKKFVKIYPKY--MKKDTESDT--TDLIRNNAFLI 649

Query: 671 TRNYVPLKKYSKKNKVTKWDKEESDDMH 698
           TRNYVP+KK++ +      D E+  + H
Sbjct: 650 TRNYVPMKKFTGQYNNVPNDDEDMYEHH 677

>KAFR0E03830 Chr5 (759871..762408) [2538 bp, 845 aa] {ON} Anc_5.435
           YDR369C
          Length = 845

 Score =  154 bits (389), Expect = 7e-38,   Method: Compositional matrix adjust.
 Identities = 87/218 (39%), Positives = 131/218 (60%), Gaps = 9/218 (4%)

Query: 1   MWVVRYQNILEDGTISVISCCLQASKSYSIGRSSKNPLIIKHDKSISRQHITLKWQSNSG 60
           MW++RY+N LEDGT+  +SCCLQ  K YSIGRSSKNPL IK+DKSISRQHIT++W  N  
Sbjct: 1   MWILRYENELEDGTLRKVSCCLQKWKMYSIGRSSKNPLTIKNDKSISRQHITIRWDCN-- 58

Query: 61  SDSNHNSLCLINQGKLTSINNKFMKVGETFIIEALGVSNSTFIELGATPIRIEVEWKNQV 120
           ++     L ++NQGKLT+I+  +MK  E+   +    S +  ++LG  P+ + + W    
Sbjct: 59  NEGTGTVLSVVNQGKLTAIDENYMKSDESKAFDDETYS-TVVVKLGTKPVVVRISWTPIF 117

Query: 121 WNIPSHLAQFRTALSQFGISTET-SINEVPTNIMISDYPSSDDNVIRELCALAENIPLKK 179
           W++     QF  +++  GI T+  S N    +++I+D  S+   ++  L  L +N  L K
Sbjct: 118 WDLSKDFLQFEKSINSMGICTQMQSSNVRDISLVINDEKSNWSRIMFAL--LKQNCTLVK 175

Query: 180 SQLLVKLCNTLLSASITDLTFDERWNDIVKS-PEYDVF 216
             LL ++CN LL+   T+  FDE W  + +S   Y V+
Sbjct: 176 PVLLSEVCNVLLADCQTN--FDEIWAQLFESFSNYTVY 211

 Score =  102 bits (254), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 57/142 (40%), Positives = 82/142 (57%), Gaps = 22/142 (15%)

Query: 542 EVSFREKSSAPHSFVQAIQQTKKREVKRVKSTIVELEDDELSEEAINQLERLAIVEANND 601
           +VS  ++S +P +F++A+Q TK REVKR+++ IV++   ELSEEAIN+L  L IVE+N +
Sbjct: 569 DVSLTKRSKSPAAFIEAVQSTKTREVKRIRTKIVDVSPSELSEEAINKLSNLTIVESNPN 628

Query: 602 LLRKLPDYRLNTVSSSTEKGGNGVIRQEWQRRKNFKTFVKAWPKFKAQKEGSKNDTQKSD 661
           L+R+                 N  +   W+ R+NFK F K WP+    ++G        D
Sbjct: 629 LIRE------------RRADKNDSVNDMWKGRRNFKKFNKVWPQ---HRDG-------YD 666

Query: 662 FIRGAAFLITRNYVPLKKYSKK 683
            +R  AFLI RNYV LK Y  K
Sbjct: 667 SLRNNAFLIIRNYVELKPYDGK 688

>CAGL0A02838g Chr1 complement(297872..300358) [2487 bp, 828 aa] {ON}
           similar to uniprot|P33301 Saccharomyces cerevisiae
           YDR369c XRS2
          Length = 828

 Score =  130 bits (326), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 120/407 (29%), Positives = 197/407 (48%), Gaps = 71/407 (17%)

Query: 1   MWVVRYQNILEDGTISVISCCLQASKSYSIGRSSKNPLIIKHDKSISRQHITLKWQSNSG 60
           MWV+RY  + E G +  +SCC++ +  Y+IGRSSKN L+IK+DKSISRQH++LKW S+  
Sbjct: 1   MWVLRYSYVEETGEVKKVSCCIRQNVQYTIGRSSKNNLVIKNDKSISRQHVSLKWSSSK- 59

Query: 61  SDSNHNSLCLINQGKLTSINNKFMKVGETFIIEALGVSNSTFIE--LGATPIRIEVEWKN 118
                N + L N GKLT  + K++   E     A    + T IE  LG  P++I +   +
Sbjct: 60  -----NCIELTNTGKLTKSSEKYLGSNELITYSA----DETQIEMLLGVAPVKIILSRID 110

Query: 119 QVWNIPSHLAQFRTALSQFGISTETSINEVPTN----IMISDYPSSDDNVIRELCALAEN 174
           ++++IP+ L+QFR  L   GI  + S++    N    I + D+        REL A   +
Sbjct: 111 ELFDIPNSLSQFRETLETLGI--QISVDNANVNSTSLITVGDFG------YRELFAACND 162

Query: 175 IPLKKSQLLVKLCNTLLSASITDLTFDERWNDIVKSPEYDVFDANPDL--LFSKFMKLSD 232
           I +  S LL ++CN L++       FD  W  +  S     +  N DL  L S+F  +  
Sbjct: 163 INIYSSGLLTEICNKLVNDHDN---FDAEWRSMQSS-----YHRNLDLEGLLSQFGGIRG 214

Query: 233 ITILTTISNEPYLPSILRRFNIKLFDFVDI-NSLYKHVDSLKPSTKYLILTSMNKKENGQ 291
                    + ++ S L+ F +KL   V+I +S++K+ D L+      +++S    E   
Sbjct: 215 KFFFLLYKIDWFIISYLKPFLLKLS--VEIHDSIHKNDDLLR------LISSKQADEIPI 266

Query: 292 ILCTTKCLLTSLIKDTL------------ASVINTKSVSFEAPNNETPVRD--------- 330
           ++   K  +  L +DTL            +  +   ++ +++   + P+ D         
Sbjct: 267 VISNEK--IKYLPEDTLQIHSDDIYKFIESGDLYRNAIRYQSMERK-PIYDLEDETTNAI 323

Query: 331 -PEKLSSASKIHHTIETEASPVIXXXXXXXXXXVLPLDSLNFFAGGL 376
            P+K S A+    +  T+ S             V PL+SL+FFAGG+
Sbjct: 324 IPQKRSLANT---SQPTDTSLESTKKKRVRRHKVEPLNSLSFFAGGI 367

 Score = 88.6 bits (218), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 52/132 (39%), Positives = 77/132 (58%), Gaps = 19/132 (14%)

Query: 555 FVQAIQQTKKREVKRVKSTIVELEDDELSEEAINQLERLAIVEANNDLLRKLPDYRLNTV 614
            V+ +Q TK+ EVKR+ STIV++ED EL+EEAIN+L  L +VE   DL+R   D      
Sbjct: 553 IVKLVQTTKESEVKRLSSTIVKIEDSELTEEAINKLNDLVLVEPVADLIRTKSDI----- 607

Query: 615 SSSTEKGGNGVIRQEWQRRKNFKTFVKAWPKFKAQKEGSKNDTQKSDFIRGAAFLITRNY 674
                   N   +Q+W+ RKNFK FVK  PK+K+++   ++    S  IRG+  ++TR +
Sbjct: 608 ------SANNTTQQQWKNRKNFKKFVKICPKYKSEQSSIES---MSRHIRGSGEILTREF 658

Query: 675 -----VPLKKYS 681
                VP+  Y+
Sbjct: 659 LQTKNVPVDYYN 670

>TBLA0A02820 Chr1 (678796..681573) [2778 bp, 925 aa] {ON} Anc_5.435
           YDR369C
          Length = 925

 Score =  117 bits (292), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 75/205 (36%), Positives = 115/205 (56%), Gaps = 11/205 (5%)

Query: 1   MWVVRYQNILEDGTISVISCCLQASKSYSIGRSSKNPLIIKHDKSISRQHITLKWQSNSG 60
           MW++ Y     D T++ +SCCL+ +++YSIGRS K+PL +K+DKSISRQH+T  W  N  
Sbjct: 1   MWIISYSYKSADDTLTNVSCCLKQNETYSIGRSKKSPLFVKNDKSISRQHVTFHWTGNLN 60

Query: 61  SDSNHNSLCLINQGKLTSINNKFMKVGETFIIEALGVSNSTFIELGATPIRIEVEWKNQV 120
           +      L L+NQGKLT +N++ +   ET +  A  + +   +ELGATP+ +   W N V
Sbjct: 61  N-----QLSLLNQGKLTRVNSRILNPAETLLFNA-DIEHPAEVELGATPVVVCGAWTNHV 114

Query: 121 WNIPSHLAQFRTALSQFG--ISTETSINEVPTNIM-ISDYPSSDDNVIREL-CALAENIP 176
           +NIP    QF + L  +G  I+     NE  T ++ I   P +++ +   L  +L     
Sbjct: 115 YNIPIEFQQFESQLKDYGFNINFGPQKNEAITYVIDIEPRPMNNNFISGTLYYSLVNKSI 174

Query: 177 LKKSQLLVKLCNTLLSASITDLTFD 201
           + KS  L  L N LL+ ++T    D
Sbjct: 175 ILKSSFLTSLLN-LLNPNVTTFNID 198

 Score = 99.8 bits (247), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 77/244 (31%), Positives = 113/244 (46%), Gaps = 42/244 (17%)

Query: 450 AVRTSKRFLDI------SPQQSSTNMTRRDSQKKSADFVNFETAATSSMEEDKATKAYSI 503
           A  TSK+ + I       P   S +M   D     A+  +  +AAT    E K    Y +
Sbjct: 520 AASTSKKDVKILAARSKKPLNDSIDMDMSDQ----AELTDIHSAATDQQYEKKTLSNYIL 575

Query: 504 TGHPTHSVTQTSEGSHELFNYSQKLSFPLKADLESPVKEVSFREKSSAPHSFVQAIQQTK 563
              P                 S K S   +    SPVK      +S  P++F+ A+Q  K
Sbjct: 576 NNKPDDQAN------------SLKRSKEQEKGTVSPVK------RSPTPNNFISALQDAK 617

Query: 564 KREVKRVKSTIVELEDDELSEEAINQLERLAIVEANNDLLRKLPDYRLNTVSSSTEKGGN 623
            RE  R+ S  V++ D+EL+EEAIN+   LA+VE N D+           V S  +K   
Sbjct: 618 NRETDRLGSKFVKIYDEELTEEAINKFSNLAVVETNVDI-----------VISEGKKNNE 666

Query: 624 GV--IRQEWQRRKNFKTFVKAWPKFKAQKEGSKNDTQKSDFIRGAAFLITRNYVPLKKYS 681
            +  I  +W+ RKNFK FVK  PK++ +   S  D   + FIR +AFL+ R YVP++++ 
Sbjct: 667 SITDIDPKWKGRKNFKNFVKQLPKYRMKTMPS-GDNGVASFIRNSAFLLAREYVPMQEFK 725

Query: 682 KKNK 685
             N+
Sbjct: 726 MNNQ 729

>KLTH0F16038g Chr6 (1302028..1304406) [2379 bp, 792 aa] {ON} weakly
           similar to uniprot|P33301 Saccharomyces cerevisiae
           YDR369C XRS2 classified as an early recombination
           function required for DNA repair but dispensable for
           mitotic recombination (xrs2 is hyper-Rec during
           vegatative growth) required for double strand breaks
           meiotic recombination and spore viability DNA repair
           protein
          Length = 792

 Score =  110 bits (274), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 69/215 (32%), Positives = 106/215 (49%), Gaps = 29/215 (13%)

Query: 1   MWVVRYQNILEDGTISVISCCLQASKSYSIGRSSKNPLIIKHDKSISRQHITLKWQSNSG 60
           MW++RYQ I E G+   +SCCL+    Y +GRS K+PL IK DKSISR+H+ L+ + NS 
Sbjct: 1   MWILRYQYIDETGSEIRVSCCLKKGTQYVVGRSVKSPLQIKGDKSISRKHVQLEVRQNS- 59

Query: 61  SDSNHNSLCLINQGKLTSINNKFMKVGETFIIEALGVSNSTFIELGATPIRIEVEWKNQV 120
                  L ++N GKLT I    +K+ +       G   S  +E+GA P++  V ++  +
Sbjct: 60  ------KLEVLNAGKLTKIGGDNVKMDQML---EFGADQSVALEMGAGPVKGTVTYEPAI 110

Query: 121 WNIPSHLA---QFRTALSQFGISTETSINEVPTNIMISDYPSSDDNVIRELCALAENIPL 177
           W IP  LA     +  LS + I    S+    +  +I ++  S  N    L AL + IP+
Sbjct: 111 WKIPHDLAITESLKNHLSLYDIQVTNSLTSKTSVQIIKEHQKSHGNC---LFALVKKIPI 167

Query: 178 KKSQLLVKLCNTLLSASI-----TDLTFDERWNDI 207
                   +C   +   +     T + FD +W  I
Sbjct: 168 --------MCEGFIGDFVSQFADTQIDFDAKWEQI 194

 Score = 84.3 bits (207), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 51/129 (39%), Positives = 73/129 (56%), Gaps = 12/129 (9%)

Query: 552 PHSFVQAIQQTKKREVKRVKSTIVELEDDELSEEAINQLERLAIVEANNDLLRKLPDYRL 611
           P S +QA Q+ K+ EV R+K  + ++  +EL+EEAIN+L+ LA VE   DL+R+  +   
Sbjct: 525 PRSLIQAFQEAKQHEVHRLKKNMADVGSEELTEEAINKLDNLASVE-KVDLMRRPSEVPE 583

Query: 612 NTVSSSTEKGGNGVIRQEWQRRKNFKTFVKAWPKFKAQKEGSKNDTQKSDFIRGAAFLIT 671
           N+           +   +W RRKNFK FVK WP   + +    N T   D +R  A+LIT
Sbjct: 584 NS-------NQRILTNPQWARRKNFKKFVKLWPSHSS-RSSPDNIT---DAVRNKAYLIT 632

Query: 672 RNYVPLKKY 680
           R+YV L  Y
Sbjct: 633 RDYVSLCPY 641

>SAKL0G02552g Chr7 complement(209978..212482) [2505 bp, 834 aa] {ON}
           weakly similar to uniprot|P33301 Saccharomyces
           cerevisiae YDR369C XRS2 classified as an early
           recombination function required for DNA repair but
           dispensable for mitotic recombination (xrs2 is hyper-Rec
           during vegatative growth) required for double strand
           breaks meiotic recombination and spore viability DNA
           repair protein
          Length = 834

 Score =  108 bits (270), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 72/213 (33%), Positives = 112/213 (52%), Gaps = 20/213 (9%)

Query: 1   MWVVRYQNILEDGTISVISCCLQASKSYSIGRSSKNPLIIKHDKSISRQHITLKWQSNSG 60
           MW++RY+   EDG    ISCCL+    Y IGRS+K+PL IK+DKSISR+HI LK      
Sbjct: 1   MWILRYRYDTEDGNWCSISCCLKQGLIYDIGRSTKSPLHIKNDKSISRKHIQLKV----- 55

Query: 61  SDSNHNSLCLINQGKLTSINNKFMKVGETFIIEALGVSNSTFIELGATPIRIEVEWKNQV 120
             +  N L L+N GKLT++N + + V ++      G      +ELG  PI   +EW++QV
Sbjct: 56  --NKENELNLLNTGKLTTLNAEVLMVDQSLNFHPKG---QLRLELGIKPIIATIEWQDQV 110

Query: 121 WNIPSHL---AQF-RTALSQFGISTETSINEVPTNIMISDYPSSDDNVIRELCALAENIP 176
           W +   L   + F R   + +GIS  T+++   TN+ I     + D     L +L + I 
Sbjct: 111 WKVSHDLLYNSMFKRQEFNSYGISVTTTMS-TRTNLQI--IKQNQDTYSNCLFSLVKGID 167

Query: 177 LKKSQLLVKLCNTLLSASITDLTFDERWNDIVK 209
           + +   L    + L    +T   +D  W ++++
Sbjct: 168 IVRESFLSDFQSHLY---MTPTDYDGIWKNLLQ 197

 Score = 94.4 bits (233), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 67/176 (38%), Positives = 100/176 (56%), Gaps = 24/176 (13%)

Query: 554 SFVQAIQQTKKREVKRVKSTIVELEDDELSEEAINQLERLAIVEANNDLLRKLPDYRLNT 613
           + V+AIQ TK REV R+K+T+++++ +EL+E AIN L  LAIVE   DL+RK  + R + 
Sbjct: 574 ALVEAIQDTKSREVSRLKNTLIQIDKNELTENAINSLSNLAIVEK-KDLIRKNSE-RGHC 631

Query: 614 VSSSTEKGGNGVIRQEWQRRKNFKTFVKAWPKFKAQKEGSKNDTQKSDFIRGAAFLITRN 673
           +SS T           W+ RKNFK F+K  P+ ++Q+E    D+   + ++ +AFLITR 
Sbjct: 632 ISSDT---------CLWEGRKNFKKFIKVQPR-RSQRETF--DSDGKNIVKNSAFLITRE 679

Query: 674 YVPLKKYSKKNKVTKWDKEESDDM----HALTEMEKIGSNAYISDTTNSTTIHKRP 725
           YVPLKK+         +KE+ DD     H+  E         I +T+N T   + P
Sbjct: 680 YVPLKKFDPN------EKEQIDDTFFLNHSANEGPIPAQPRRIDETSNFTDDEEGP 729

>Kwal_55.21422 s55 (830578..832926) [2349 bp, 782 aa] {ON} YDR369C
           (XRS2) - DNA repair protein [contig 130] FULL
          Length = 782

 Score =  106 bits (265), Expect = 7e-23,   Method: Compositional matrix adjust.
 Identities = 116/442 (26%), Positives = 182/442 (41%), Gaps = 92/442 (20%)

Query: 1   MWVVRYQNILEDGTISVISCCLQASKSYSIGRSSKNPLIIKHDKSISRQHITLKWQSNSG 60
           MW++RYQ +  +G    +SCCL+    YSIGRS+KNPL IK DKSISR H+ L+   +  
Sbjct: 1   MWILRYQYVAGNGMDVHVSCCLKQGLQYSIGRSTKNPLQIKSDKSISRNHVELEVDQSC- 59

Query: 61  SDSNHNSLCLINQGKLTSINNKFMKVGETFIIEALGVSNSTFIELGATPIRIEVEWKNQV 120
                 ++ L   GKLT ++ K +K G+     A         E+GA+PI+  V  +   
Sbjct: 60  ------NVVLRVVGKLTKVSGKSVKAGQHLQFTA---DEEVLFEMGASPIKATVVKQQSF 110

Query: 121 WNIPSHLA---QFRTALSQFGISTETSINEVPTNIMISDYPSSDDNVIRELCALAENIPL 177
           W IP  L+        L+ F I    S++   +  +I D   S  N    L +L +NIP+
Sbjct: 111 WKIPHDLSLSQSLSRHLADFDIQVTNSLSSTTSIQIIKDSSKSFSNC---LFSLIKNIPI 167

Query: 178 KKSQLLVKLCNTLLSASITDL--TFDERWNDIV----KSPEYDVFDANPDLLFSKFMKLS 231
            +   +           I D+   FD RW+ +V    + P Y   +  P           
Sbjct: 168 LREHFIGDFV-----TQINDVHADFDSRWDRMVVENAQFPNYKC-ECRP----------- 210

Query: 232 DITILTTISNEPYLPSILRRFNI----------KLFDFVDINSLYKHVDSLKPSTKYLIL 281
                TTI    +L +  R F I           L+   DI++L   +     S   ++L
Sbjct: 211 ----FTTIH---FLVTNRRAFAIFKHIIDAGSGTLWLCDDISNLDHFIKHKITSDNVILL 263

Query: 282 TSMNKKENGQILCTTKCLLTSL---------------------IKDTLASVINTKSVSFE 320
             +N   NG+   ++    + L                     + D + +V++    +FE
Sbjct: 264 VHLN---NGKSSISSTEQSSDLDVQEAKLLKNKAQNLGFRIHDVNDIVGAVLDH---NFE 317

Query: 321 APNNETPVRD-PEKLSSASKIHHT-----IETEASPVIXXXXXXXXXXVLPLDSLNFFAG 374
                 PVR+ P K  +   +        I++  +P            V+PLDSL FF G
Sbjct: 318 KLLERVPVRNLPSKAPTGFPLEEATNKSVIKSADTPKPSNKRKRTNRQVVPLDSLAFFGG 377

Query: 375 GLNVKASSESKDITDVKESRCG 396
           G    A+   ++ T+V ES  G
Sbjct: 378 G---SAAESKQNPTEVPESERG 396

 Score = 93.6 bits (231), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 57/150 (38%), Positives = 83/150 (55%), Gaps = 17/150 (11%)

Query: 552 PHSFVQAIQQTKKREVKRVKSTIVELEDDELSEEAINQLERLAIVEANNDLLRKLPDYRL 611
           P SF QA+++TK  EV R++  IV +  +EL+EEAIN+L++LA+VE   DL+R   +Y +
Sbjct: 520 PVSFAQAVKETKSHEVDRLEKDIVNVTSEELTEEAINKLDKLALVET-KDLMRADREYAV 578

Query: 612 NTVSSSTEKGGNGVIRQEWQRRKNFKTFVKAWPKFKAQKEGSKNDTQKSDFIRGAAFLIT 671
              S  +E         +W  RKNFK FVK WP     +    +    ++ +R  A LIT
Sbjct: 579 CGQSGGSE---------QWAGRKNFKKFVKLWPS----RSSRNSPDSATNALRNRAHLIT 625

Query: 672 RNYVPLKKYSKKNKVTKWD---KEESDDMH 698
           R YVPL+ Y  +N   + D   K   DD+ 
Sbjct: 626 REYVPLRPYEGQNANNQDDSFLKNSQDDLQ 655

>Ecym_4761 Chr4 (1479649..1482045) [2397 bp, 798 aa] {ON} similar to
           Ashbya gossypii AER402C
          Length = 798

 Score =  103 bits (257), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 175/733 (23%), Positives = 307/733 (41%), Gaps = 145/733 (19%)

Query: 1   MWVVR--YQNILEDGTISVISCCLQASKSYSIGRSSKNPLIIKHDKSISRQHITLKWQSN 58
           MW+ +  YQN  +  T++ IS  ++  K+Y +GR+SK+ L+I  ++ +SR H+ LK    
Sbjct: 1   MWIFKCQYQNQKDPDTLNAISSVIKPDKNYIVGRASKSSLVID-ERGVSRTHLQLK---- 55

Query: 59  SGSDSNHNSLCLINQGKLTSINNKFMKVGETFIIEALGVSNSTFIELGATPIRIEVEWKN 118
               +N N + +   G    I +K ++ G     E     +   +E+G+  I  ++ W  
Sbjct: 56  ----ANRNIIEITLLGAQLKIGHKTIEKG--ISCEFHPKQSPLRLEVGSHSIECKLLWTQ 109

Query: 119 QVWNIPSHLAQFRTALSQ----------FGISTETSINEVPTNIMISDYPSSDDNVIREL 168
             + +PS L     AL++          F +S ETS   V +     DY        + L
Sbjct: 110 WEFKVPSDLEINYIALTKMFVQLGIKIVFSLSKETSHQIVRSRQGQKDYD-------KYL 162

Query: 169 CALAENIPLKKSQLLVKLCNTLLSASITDLTFDERWNDIVKS------------------ 210
            AL + +PL +   L  + + L S +   L F+ +  ++ +                   
Sbjct: 163 FALVKGLPLVEVGFLKGISSLLNSDT---LKFESKVKELEREFSIFPEFNPIPNPLKGLY 219

Query: 211 ---PEYDVFDANPDLLFSKFMKLSDITILTTISNEPYLPSILRRFNIKLFDFVDINSLYK 267
              PE D FD     +    +++   T+   I+ E ++       + K+      N++  
Sbjct: 220 FIVPEKDEFD-----ILKYTIEVGGGTVYNCITFEDFVKVTSTIPSSKVILIKCSNNISP 274

Query: 268 HVDSLKPSTKYLILT---SMNKKENGQILCTTKCLLTSLIKDTLASVINTKSVSFEAPNN 324
            +D+ KP+   ++L    S+  K++     T   L  +  +  + S I+ K +     N+
Sbjct: 275 AIDTQKPTDHNILLEKAHSIGFKQHDTRELTIAVLNNNFEETLIDSSISDKRLISCNSND 334

Query: 325 E-----TPVRDPEKLSSASKIHHTIETEASPVIXXXXXXXXXXVLPLDSLNFFAGGLNVK 379
           +     T + D  K++ ++     + TE  P            V PLDSL+FFAGG    
Sbjct: 335 KLKTTSTSLEDGLKVNVSATSGLNLNTEGPPA----KKRRINSVKPLDSLSFFAGG---- 386

Query: 380 ASSESKDITDVKESRCGLDSKSVISSPIIGR-AEEKHSLISQDTQKVAGDIEKENGHNST 438
                                S+  S  + R + EK ++   +  K+A          ++
Sbjct: 387 ---------------------SIERSTRVERNSSEKQTVQPAEHNKIA---------ETS 416

Query: 439 GAIIVSSPESDAVRTSKRFLDISPQQSSTNMTRRDSQKKSADFVNFETAATSSMEEDKAT 498
            A I   P    +   K   D+ P+  +        +K+S        A   S+ + +A 
Sbjct: 417 IASIELLPTKSGI---KEITDVVPETENEPEPMVSPKKRSP-------AKNESLADMRAG 466

Query: 499 KAYSITGHPTHSVTQTSEGSHE------LFNYSQKLSFPLKADLESPVKEVSFREKSSAP 552
             + ++   T  V +++E SH+      +F+   ++S   K  L +  K+ +   +S + 
Sbjct: 467 DNH-VSIKTTLEVEKSAEPSHKKLKVEGIFDEKVEMSNEQKYHLNAESKDSTLSTQSHS- 524

Query: 553 HSFVQAIQQTKKREVKRVKSTIVELEDDELSEEAINQLERLAIVEANNDLLRKLPDYRLN 612
            S V AI++ K+REV R+K+TIVE+  DEL+EEAI +L  LA+VE+  D+LRK     + 
Sbjct: 525 -SIVNAIKEIKEREVSRIKTTIVEIGPDELTEEAICKLSTLAVVES-VDMLRKTQSRHMK 582

Query: 613 TVSSSTEKGGNGVIRQEWQRRKNFKTFVKAWPKFKAQKEGSKNDTQKSDFIRGAAFLITR 672
           T ++           +    R+NFK FVK WP +        N     D + GA     R
Sbjct: 583 TETN-----------KRHHVRRNFKRFVKVWPAY-------LNKAICQDPM-GAQRYSNR 623

Query: 673 NYVPLKKYSKKNK 685
             VPLK Y   NK
Sbjct: 624 QCVPLKVYEPMNK 636

>TPHA0J02590 Chr10 complement(574619..576946) [2328 bp, 775 aa] {ON}
           Anc_5.435 YDR369C
          Length = 775

 Score = 94.0 bits (232), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 46/114 (40%), Positives = 73/114 (64%), Gaps = 4/114 (3%)

Query: 1   MWVVRYQNILEDGTISVISCCLQASKSYSIGRSSKNPLIIKHDKSISRQHITLKWQSNSG 60
           M ++RY+N+L DG ++V+SCCL     Y+IGRSSKN   IK+DKSISRQH++L W+    
Sbjct: 1   MIILRYKNVLADGPVNVVSCCLLCDVEYAIGRSSKNKFAIKNDKSISRQHVSLLWK--YS 58

Query: 61  SDSNHNSLCLINQGKLTSINNKFMKVGETFIIEALGVSNSTFIELGATPIRIEV 114
           SD  +  + + N GK+T I +K++   ET  ++   +     + +G +PI +E+
Sbjct: 59  SDDKNVIIQIKNFGKVTMIKDKYLSQDET--LQFTLIDKKLEVNIGTSPITLEI 110

 Score = 44.7 bits (104), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 41/141 (29%), Positives = 79/141 (56%), Gaps = 7/141 (4%)

Query: 550 SAPHSFVQAIQQTKKREVKRVKSTIVELEDDELSEEAINQLERLAIVEANNDLLRKLPDY 609
           S+    V+ IQ  K R V RV S IV ++++EL+EE +N+   + +V+ N+ L++K P+ 
Sbjct: 519 SSSTDLVRTIQNVKSRGVDRVNSKIVTVDENELNEEELNKFFDVVVVDVNDKLMKKHPNA 578

Query: 610 RLNTVSSSTEKGGNGVIRQEWQRRKNFKTFVKAWPKFKAQKEGSKNDTQKSDFIRGAAFL 669
           +    +++ +   N      ++ RK++K F K+ PK+++ K   ++ +  SD        
Sbjct: 579 QKVIDNANIDHNSN------FKNRKDYKLFKKSIPKWQS-KLNKQHHSMTSDNGENLVVS 631

Query: 670 ITRNYVPLKKYSKKNKVTKWD 690
             RN +PL+KY++  K+ + D
Sbjct: 632 KNRNKIPLRKYNENEKIHEAD 652

>AER402C Chr5 complement(1407938..1410547) [2610 bp, 869 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR369C
           (XRS2)
          Length = 869

 Score = 80.9 bits (198), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 54/145 (37%), Positives = 79/145 (54%), Gaps = 22/145 (15%)

Query: 537 ESPVKEVSFREKSSAP-HSFVQAIQQTKKREVKRVKSTIVELEDDELSEEAINQLERLAI 595
           E PV     R+  + P  + V AI+Q K+REV R+++TIVEL  +EL+E+AI QL+ LAI
Sbjct: 580 EKPVNSCKRRQAPAVPEQNIVDAIKQIKEREVNRIRTTIVELGPEELTEDAIRQLKSLAI 639

Query: 596 VEANNDLLRKLPDYRLNTVSSSTEKGGNGVIRQEWQRRKNFKTFVKAWPKFKAQKEGSKN 655
           V+   D+LR+   + ++TV SS               RKN+K F K WPK+  +K   + 
Sbjct: 640 VQP-VDMLRQ--QHTVDTVGSSPLTFA----------RKNYKNFKKVWPKYMNRKNSPET 686

Query: 656 DTQKSDFIRGAAFLITRNYVPLKKY 680
                   R A  +  R Y+PL+ Y
Sbjct: 687 --------RNATAISNRKYLPLELY 703

 Score = 63.5 bits (153), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 62/214 (28%), Positives = 101/214 (47%), Gaps = 23/214 (10%)

Query: 1   MWVVR--YQNILEDGTISVISCCLQASKSYSIGRSSKNPLIIKHDKSISRQHITLKWQSN 58
           MWV +  YQ   + G +  ISC L   + + +GR+SK+ L+I+ +K +SR H+ L+    
Sbjct: 1   MWVFKCNYQKSGQLGALQNISCALCPEREFIVGRASKSTLVIE-EKGVSRTHLRLEV--- 56

Query: 59  SGSDSNHNSLCLINQGKLTSINNKFMKVGETFIIEALGVSNSTFI-ELGATPIRIEVEWK 117
              D + N L L +Q K   +  +    G        G S S  I E+G+  ++  +EW 
Sbjct: 57  --IDDHVNILLLGSQLK---VGGEDASKGSVL---PFGPSQSPVILEVGSHSVQCILEWA 108

Query: 118 NQVWNIPSHLAQFRTALSQ----FGISTETSINEVPTNIMISDYPSSDDNVIRELCALAE 173
              + +P+ L Q   AL +     GI   TS ++  T+ +I  +   D +  + L AL +
Sbjct: 109 QWEFKVPNTLLQEDPALLEVIKGLGIRVVTSFSKATTHHIIRPH-EDDQDYEKYLFALVK 167

Query: 174 NIPLKKSQLLVKLCNTLLSASITDLTFDERWNDI 207
            IP+   + L K    LL   +TD  FD +   I
Sbjct: 168 GIPILHLEFL-KQFTALLRQPVTD--FDPQLRSI 198

>KLLA0E02201g Chr5 complement(205466..207973) [2508 bp, 835 aa] {ON}
           weakly similar to uniprot|P33301 Saccharomyces
           cerevisiae YDR369C XRS2 classified as an early
           recombination function required for DNA repair but
           dispensable for mitotic recombination (xrs2 is hyper-Rec
           during vegatative growth) required for double strand
           breaks meiotic recombination and spore viability DNA
           repair protein
          Length = 835

 Score = 80.9 bits (198), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 61/202 (30%), Positives = 97/202 (48%), Gaps = 22/202 (10%)

Query: 1   MWVVRYQNILEDGTISVISCC--LQASKSYSIGRSSKNPLIIKHDKSISRQHITLKWQSN 58
           MW+V +  I +D        C  LQ    YSIGRS+K    I+ DKSISR H+ +K+   
Sbjct: 1   MWIVSF--IFDDEAEKSHKVCKALQYGVEYSIGRSAKCTFRIQTDKSISRVHLLIKFD-- 56

Query: 59  SGSDSNHNSLCLINQGKLTSINNKFMKVGETFIIEALGVSNSTFIELGATPIRIEVEWKN 118
            GSD     L + N+GKLT  N + + + ET ++     + +T I +G  PI + V +  
Sbjct: 57  -GSD-----LIITNKGKLTKFNEEIIPLDETIVVH----NQNTVINIGGMPIDVNVRYFY 106

Query: 119 QVWNIPSHLA--QFRTALSQFGISTETSINEVPTNIMISDYPSSDDNVIRELCALAENIP 176
           + W IP  L   + ++ +S FG+    S ++  T  + SD  S        L AL + +P
Sbjct: 107 EEWKIPHRLELNETKSLVSDFGVKLSESFSKKTTTQICSDSSSYSGC----LFALLKGVP 162

Query: 177 LKKSQLLVKLCNTLLSASITDL 198
           +   + L ++   L   +  D 
Sbjct: 163 VVSIEFLNQMGKLLQQGNYLDF 184

 Score = 40.8 bits (94), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 41/147 (27%), Positives = 70/147 (47%), Gaps = 28/147 (19%)

Query: 555 FVQAIQQTKKREVKRVKSTIVELEDDELSEEAINQLE---RLAIVEANNDLLRKLPDYRL 611
            + AI +TK++EVKR++  I+E++  EL+E A+   +   ++  ++    +L  +P    
Sbjct: 594 IITAIAETKQKEVKRLQEGIIEVDQSELTESALIDFKDAAKINTIQIKPRVLASIPISNG 653

Query: 612 NTVSSSTEKGGNGVIRQEWQRRKNFKTFVKAWPKF-KAQKEGSKNDTQKSDFIRGAAFLI 670
           NT               +W  RKNFK F K WP + +   EG  +D   +         I
Sbjct: 654 NT---------------KWLGRKNFKKFKKNWPSYLRRTTEGLCSDNTSNQ--------I 690

Query: 671 TRNYVPLKKYSKKNKVTKWDKEESDDM 697
            R Y+ ++KY  + K  K   EE D++
Sbjct: 691 GREYITMRKYDSR-KAKKHIAEEMDEI 716

>KLTH0B03058g Chr2 complement(238392..240707) [2316 bp, 771 aa] {ON}
           highly similar to uniprot|P54861 Saccharomyces
           cerevisiae YLL001W DNM1 Dynamin-related GTPase required
           for mitochondrial fission and the maintenance of
           mitochondrial morphology assembles on the cytoplasmic
           face of mitochondrial tubules at sites at which division
           will occur also participates in endocytosis
          Length = 771

 Score = 33.1 bits (74), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 24/83 (28%), Positives = 38/83 (45%), Gaps = 7/83 (8%)

Query: 600 NDLLRKLPDY--RLNTVSSSTEK-----GGNGVIRQEWQRRKNFKTFVKAWPKFKAQKEG 652
           N +  KLPD   RLNT+   TE+     GG+G+I +E +     +   K   +F +  EG
Sbjct: 327 NHIRDKLPDIKARLNTLMGQTEQELATYGGSGIITKENRAGLVLQLMNKFAARFVSSIEG 386

Query: 653 SKNDTQKSDFIRGAAFLITRNYV 675
           + +D    +   GA      N +
Sbjct: 387 TSSDISTKELCGGARIYYIYNNI 409

>Ecym_6335 Chr6 (642156..645074) [2919 bp, 972 aa] {ON} similar to
           Ashbya gossypii AFR101C
          Length = 972

 Score = 32.0 bits (71), Expect = 8.9,   Method: Compositional matrix adjust.
 Identities = 38/173 (21%), Positives = 74/173 (42%), Gaps = 26/173 (15%)

Query: 176 PLKKSQLLVKLCNTLLSASITD---LTFDERWNDIVKSPEYDVFDANPDLLFSKFMKLS- 231
           P  +++L ++L  TL   S+ D   +     W   +    YD+  A+ D++   F+ ++ 
Sbjct: 300 PNLRTKLPLRLVRTLSPNSVEDTEPICISRDWEGRL---HYDIVIASKDIVLDAFLPIAL 356

Query: 232 DITILTTISNEPYLPSILRRFNIKLFDFVDINSLYKHVDSLKPSTKYLILTSMNKKENGQ 291
            +T L  +        IL R  + L + ++     K V  L+P+ K+LI        NG 
Sbjct: 357 RVTPLDKV--------ILHRTRVYLTETLEYYCRSKKVHRLEPTKKFLIAEHKAAPVNGL 408

Query: 292 ILCTTKCL---LTSLIKDTLASVINTKSVSFEAPNNETPVRDPEKLSSASKIH 341
              +       L +L++D    ++N K   ++       V  PE+L+   ++H
Sbjct: 409 TQASAGLRAKNLGNLLEDEHGDIVN-KEFDYQ-------VFIPERLNYQQRLH 453

>NCAS0A12670 Chr1 (2496486..2500331) [3846 bp, 1281 aa] {ON}
           Anc_2.559 YMR012W
          Length = 1281

 Score = 32.0 bits (71), Expect = 9.4,   Method: Compositional matrix adjust.
 Identities = 26/66 (39%), Positives = 35/66 (53%), Gaps = 8/66 (12%)

Query: 191 LSASITDLTFDERWNDIVKSPEYDVFDANPDLLFSKFMKLSDITILTTISNEPYLPSILR 250
           L A + +L F E++ND   + E D F  +P   FS F KL+  T+L  IS E YL     
Sbjct: 846 LIAFVLNLLFGEKYNDSPVAEEIDNF--HPIKSFS-FHKLTRTTLLEAISKESYL----- 897

Query: 251 RFNIKL 256
           RF  +L
Sbjct: 898 RFRYEL 903

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.312    0.128    0.355 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 87,809,101
Number of extensions: 3897208
Number of successful extensions: 13591
Number of sequences better than 10.0: 160
Number of HSP's gapped: 14051
Number of HSP's successfully gapped: 186
Length of query: 863
Length of database: 53,481,399
Length adjustment: 118
Effective length of query: 745
Effective length of database: 39,950,811
Effective search space: 29763354195
Effective search space used: 29763354195
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 70 (31.6 bits)