Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Smik_4.6345.434ON31231216510.0
YDR368W (YPR1)5.434ON31231215570.0
Skud_4.6375.434ON31231215410.0
Suva_2.5405.434ON31231215400.0
NDAI0C016005.434ON31331211371e-157
CAGL0A02816g5.434ON31030911281e-155
Smik_15.2985.434ON31231211231e-155
Skud_15.2835.434ON31231211221e-154
YOR120W (GCY1)5.434ON31231211201e-154
TBLA0A02825singletonON31131211201e-154
Suva_8.1735.434ON31231211191e-154
SAKL0G02530g5.434ON31231211151e-153
CAGL0I01100g5.434ON31030911071e-152
KAFR0E03850singletonON31131310871e-149
KNAG0C049105.434ON31331210761e-147
NCAS0H020605.434ON32230610721e-147
TDEL0E019105.434ON31131210461e-143
TBLA0A065105.434ON31231210441e-143
NCAS0F033805.434ON31331310261e-140
Kwal_47.18084na 1ON30930910251e-140
KLLA0B14707gsingletonON31030610251e-140
Kpol_1062.295.434ON31130910241e-140
ZYRO0F10032g5.434ON31030910221e-139
KLTH0E15532gsingletonON30930210211e-139
NDAI0B056705.434ON31830810211e-139
TPHA0G00210singletonON31131210091e-137
KLTH0E00220gsingletonON3063059961e-135
KLTH0A00528gsingletonON3063059961e-135
KLTH0F16060g5.434ON3093089901e-134
TPHA0E017605.434ON3103099681e-131
TBLA0A02835singletonON3113129551e-129
KLTH0A03476gna 1ON3083039481e-128
TDEL0D00230singletonON3123059481e-128
KAFR0E038405.434ON3103129201e-124
KLLA0D10109gsingletonON3093029011e-121
Kwal_55.214265.434ON3083089001e-121
AER401W5.434ON3133108501e-113
NDAI0A070003.108ON3203055367e-66
NCAS0I024203.108ON3202985323e-65
Kwal_56.226113.108ON3213185071e-61
KAFR0G013503.108ON3243145072e-61
KLTH0C10010g3.108ON3213185044e-61
ZYRO0B06138g3.108ON3283155002e-60
SAKL0C10626gsingletonON3223124872e-58
KNAG0K020703.108ON3232994862e-58
KLLA0F02728g3.108ON3303124863e-58
YBR149W (ARA1)3.108ON3443154812e-57
Smik_2.2883.108ON3442934733e-56
Smik_2.289singletonON3443154725e-56
Skud_2.2763.108ON3443154656e-55
TDEL0D051603.108ON3253144628e-55
Suva_4.3983.108ON3443234586e-54
SAKL0C09922g3.108ON3223084513e-53
Ecym_55085.409ON3263254524e-53
ACL107C5.409ON3543074352e-50
KLLA0E21627g5.409ON3293084262e-49
NCAS0A066605.409ON3263264262e-49
KLTH0F16610g5.409ON3293314123e-47
KNAG0B03780singletonON3263274113e-47
CAGL0I01122g5.409ON3263264105e-47
KLTH0F01892gna 2ON3022974085e-47
ZYRO0A06336g5.409ON3273334071e-46
TPHA0E018605.409ON3263104062e-46
NDAI0D016005.409ON3273284053e-46
TDEL0E021505.409ON3293124036e-46
Kwal_55.215365.409ON3293113974e-45
KLLA0F03256g7.468ON2852793944e-45
KNAG0D013707.468ON2822763919e-45
YHR104W (GRE3)5.409ON3273083941e-44
KAFR0C05320singletonON3273063931e-44
Skud_8.1655.409ON3273103932e-44
SAKL0G01914g5.409ON3293113932e-44
Ecym_7160na 3ON2712823882e-44
SAKL0F14278g7.468ON2862823866e-44
TBLA0A00630singletonON3283103897e-44
Kwal_33.13276na 2ON3022893851e-43
KLTH0G02420gna 4ON2892963832e-43
Smik_8.1825.409ON3273103862e-43
Kwal_47.18893na 4ON2892963832e-43
CAGL0C04543g7.468ON2872783798e-43
Kpol_1013.827.468ON2852893789e-43
Suva_15.3005.409ON3273103783e-42
TBLA0F01720singletonON3263113732e-41
SAKL0F02574gna 4ON2892893675e-41
ZYRO0G17600g7.468ON2832793665e-41
Kwal_47.182197.468ON2932773668e-41
YJR096W7.468ON2822893658e-41
KLLA0F05775g7.285ON3093133669e-41
KAFR0G009207.468ON2862943632e-40
KLTH0G05786g7.468ON2862773622e-40
NCAS0H005607.468ON2842883613e-40
Suva_12.1847.468ON2822893596e-40
Smik_10.3847.468ON2822813589e-40
ZYRO0E09614gna 5ON3083093555e-39
Skud_10.3187.468ON2822903525e-39
TDEL0C033207.468ON2832833526e-39
CAGL0J09394g7.285ON3113133538e-39
Kwal_47.19278na 5ON3143103539e-39
ABL209Cna 3ON3102753502e-38
KLTH0G00638gna 5ON3133063442e-37
NCAS0A137407.285ON3092913432e-37
Kpol_1020.137.285ON3133233381e-36
Skud_4.1317.285ON3123133362e-36
Smik_4.1137.285ON3123153354e-36
KNAG0C041107.285ON3113163276e-35
NDAI0A023007.285ON3133193267e-35
SAKL0F00704gna 5ON3153043251e-34
YDL124W7.285ON3123123241e-34
KAFR0B012007.285ON3153213137e-33
SAKL0F09746g7.285ON3122913111e-32
ZYRO0C09196g7.285ON3123073092e-32
TBLA0F019807.285ON3023133065e-32
TDEL0D02790singletonON3293143069e-32
Kpol_381.8singletonON3092782995e-31
Ecym_32647.285ON3113102551e-24
Kwal_33.13274singletonON108961781e-15
Suva_12.272singletonON2652091262e-07
Suva_4.1227.285ON2061951048e-05
TDEL0A08000singletonON3192181013e-04
Kwal_33.13275singletonOFF6735860.003
Suva_9.17singletonON308207910.006
KLTH0E01474gsingletonON313182870.020
Kpol_400.9singletonON341306850.038
NCAS0C02450singletonON343273840.045
NDAI0C01480singletonON343290830.056
Suva_5.2077.378ON767194820.11
Ecym_22962.604ON340181810.11
NCAS0C019908.565ON343291790.21
Kpol_1050.555.105ON452160780.29
KAFR0C04240singletonON34371770.37
KLLA0B09658g3.462ON34276760.51
NDAI0J00730singletonON343297750.58
TBLA0G01120singletonON343112750.64
NCAS0A129502.604ON32381740.79
KLTH0E16852gsingletonON37593731.1
YNL331C (AAD14)na 6ON37693731.1
KLLA0E24421gna 7ON36848731.1
Smik_14.1na 6ON37693731.3
YDL243C (AAD4)singletonON32993721.3
TPHA0J014705.680ON87197731.3
TBLA0B10110singletonON345142721.4
YER091C (MET6)7.378ON767193731.4
Suva_14.10na 6ON37693712.1
YCR107W (AAD3)singletonON363102702.6
YFL056C (AAD6)singletonON21293692.8
TPHA0E023405.261ON167476703.0
KNAG0M023402.604ON309145693.2
NDAI0B009305.76ON940108703.2
Ecym_20263.25ON45199693.4
KAFR0D039801.75ON34997684.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Smik_4.634
         (312 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Smik_4.634 Chr4 (1133924..1134862) [939 bp, 312 aa] {ON} YDR368W...   640   0.0  
YDR368W Chr4 (1213904..1214842) [939 bp, 312 aa] {ON}  YPR1NADPH...   604   0.0  
Skud_4.637 Chr4 (1136769..1137707) [939 bp, 312 aa] {ON} YDR368W...   598   0.0  
Suva_2.540 Chr2 (964433..965371) [939 bp, 312 aa] {ON} YDR368W (...   597   0.0  
NDAI0C01600 Chr3 complement(342011..342952) [942 bp, 313 aa] {ON...   442   e-157
CAGL0A02816g Chr1 (296851..297783) [933 bp, 310 aa] {ON} highly ...   439   e-155
Smik_15.298 Chr15 (512239..513177) [939 bp, 312 aa] {ON} YOR120W...   437   e-155
Skud_15.283 Chr15 (507542..508480) [939 bp, 312 aa] {ON} YOR120W...   436   e-154
YOR120W Chr15 (551114..552052) [939 bp, 312 aa] {ON}  GCY1Putati...   436   e-154
TBLA0A02825 Chr1 complement(681691..682626) [936 bp, 311 aa] {ON}     436   e-154
Suva_8.173 Chr8 (308911..309849) [939 bp, 312 aa] {ON} YOR120W (...   435   e-154
SAKL0G02530g Chr7 (208952..209890) [939 bp, 312 aa] {ON} similar...   434   e-153
CAGL0I01100g Chr9 complement(91693..92625) [933 bp, 310 aa] {ON}...   431   e-152
KAFR0E03850 Chr5 complement(764595..765530) [936 bp, 311 aa] {ON}     423   e-149
KNAG0C04910 Chr3 complement(949367..950308) [942 bp, 313 aa] {ON...   419   e-147
NCAS0H02060 Chr8 (400615..401583) [969 bp, 322 aa] {ON} Anc_5.434     417   e-147
TDEL0E01910 Chr5 complement(361621..362556) [936 bp, 311 aa] {ON...   407   e-143
TBLA0A06510 Chr1 complement(1597737..1598675) [939 bp, 312 aa] {...   406   e-143
NCAS0F03380 Chr6 (682072..683013) [942 bp, 313 aa] {ON} Anc_5.434     399   e-140
Kwal_47.18084 s47 complement(677816..678745) [930 bp, 309 aa] {O...   399   e-140
KLLA0B14707g Chr2 complement(1291951..1292883) [933 bp, 310 aa] ...   399   e-140
Kpol_1062.29 s1062 complement(63895..64830) [936 bp, 311 aa] {ON...   399   e-140
ZYRO0F10032g Chr6 (813814..814746) [933 bp, 310 aa] {ON} uniprot...   398   e-139
KLTH0E15532g Chr5 complement(1380466..1381395) [930 bp, 309 aa] ...   397   e-139
NDAI0B05670 Chr2 (1383187..1384143) [957 bp, 318 aa] {ON} Anc_5....   397   e-139
TPHA0G00210 Chr7 (31978..32913) [936 bp, 311 aa] {ON}                 393   e-137
KLTH0E00220g Chr5 complement(12415..13335) [921 bp, 306 aa] {ON}...   388   e-135
KLTH0A00528g Chr1 complement(46253..47173) [921 bp, 306 aa] {ON}...   388   e-135
KLTH0F16060g Chr6 complement(1304479..1305408) [930 bp, 309 aa] ...   385   e-134
TPHA0E01760 Chr5 complement(354862..355794) [933 bp, 310 aa] {ON...   377   e-131
TBLA0A02835 Chr1 complement(683118..684053) [936 bp, 311 aa] {ON}     372   e-129
KLTH0A03476g Chr1 complement(298735..299661) [927 bp, 308 aa] {O...   369   e-128
TDEL0D00230 Chr4 (37458..38396) [939 bp, 312 aa] {ON}  possible ...   369   e-128
KAFR0E03840 Chr5 complement(763027..763959) [933 bp, 310 aa] {ON...   358   e-124
KLLA0D10109g Chr4 (854495..855424) [930 bp, 309 aa] {ON} similar...   351   e-121
Kwal_55.21426 s55 complement(832981..833907) [927 bp, 308 aa] {O...   351   e-121
AER401W Chr5 (1406905..1407846) [942 bp, 313 aa] {ON} Syntenic h...   332   e-113
NDAI0A07000 Chr1 complement(1596632..1597594) [963 bp, 320 aa] {...   211   7e-66
NCAS0I02420 Chr9 complement(454156..455118) [963 bp, 320 aa] {ON...   209   3e-65
Kwal_56.22611 s56 complement(202750..203715) [966 bp, 321 aa] {O...   199   1e-61
KAFR0G01350 Chr7 (304389..305363) [975 bp, 324 aa] {ON} Anc_3.10...   199   2e-61
KLTH0C10010g Chr3 (829145..830110) [966 bp, 321 aa] {ON} similar...   198   4e-61
ZYRO0B06138g Chr2 complement(491830..492816) [987 bp, 328 aa] {O...   197   2e-60
SAKL0C10626g Chr3 (962421..963389) [969 bp, 322 aa] {ON} similar...   192   2e-58
KNAG0K02070 Chr11 complement(419556..420527) [972 bp, 323 aa] {O...   191   2e-58
KLLA0F02728g Chr6 (249240..250232) [993 bp, 330 aa] {ON} similar...   191   3e-58
YBR149W Chr2 (539987..541021) [1035 bp, 344 aa] {ON}  ARA1NADP+ ...   189   2e-57
Smik_2.288 Chr2 (524564..525598) [1035 bp, 344 aa] {ON} YBR149W ...   186   3e-56
Smik_2.289 Chr2 (526189..527223) [1035 bp, 344 aa] {ON} YBR149W ...   186   5e-56
Skud_2.276 Chr2 (507436..508470) [1035 bp, 344 aa] {ON} YBR149W ...   183   6e-55
TDEL0D05160 Chr4 complement(935981..936958) [978 bp, 325 aa] {ON...   182   8e-55
Suva_4.398 Chr4 (709192..710226) [1035 bp, 344 aa] {ON} YBR149W ...   181   6e-54
SAKL0C09922g Chr3 (897779..898747) [969 bp, 322 aa] {ON} similar...   178   3e-53
Ecym_5508 Chr5 (1035144..1036124) [981 bp, 326 aa] {ON} similar ...   178   4e-53
ACL107C Chr3 complement(152564..153628) [1065 bp, 354 aa] {ON} S...   172   2e-50
KLLA0E21627g Chr5 complement(1929294..1930283) [990 bp, 329 aa] ...   168   2e-49
NCAS0A06660 Chr1 (1316398..1317378) [981 bp, 326 aa] {ON}             168   2e-49
KLTH0F16610g Chr6 complement(1346319..1347308) [990 bp, 329 aa] ...   163   3e-47
KNAG0B03780 Chr2 (725307..726287) [981 bp, 326 aa] {ON}               162   3e-47
CAGL0I01122g Chr9 (93934..94914) [981 bp, 326 aa] {ON} highly si...   162   5e-47
KLTH0F01892g Chr6 (149177..150085) [909 bp, 302 aa] {ON} similar...   161   5e-47
ZYRO0A06336g Chr1 complement(505818..506801) [984 bp, 327 aa] {O...   161   1e-46
TPHA0E01860 Chr5 complement(373074..374054) [981 bp, 326 aa] {ON...   160   2e-46
NDAI0D01600 Chr4 (382637..383620) [984 bp, 327 aa] {ON}               160   3e-46
TDEL0E02150 Chr5 complement(403001..403990) [990 bp, 329 aa] {ON...   159   6e-46
Kwal_55.21536 s55 complement(877191..878180) [990 bp, 329 aa] {O...   157   4e-45
KLLA0F03256g Chr6 (306731..307588) [858 bp, 285 aa] {ON} highly ...   156   4e-45
KNAG0D01370 Chr4 complement(230193..231041) [849 bp, 282 aa] {ON...   155   9e-45
YHR104W Chr8 (323409..324392) [984 bp, 327 aa] {ON}  GRE3Aldose ...   156   1e-44
KAFR0C05320 Chr3 complement(1065934..1066917) [984 bp, 327 aa] {...   155   1e-44
Skud_8.165 Chr8 (297201..298184) [984 bp, 327 aa] {ON} YHR104W (...   155   2e-44
SAKL0G01914g Chr7 (162612..163601) [990 bp, 329 aa] {ON} highly ...   155   2e-44
Ecym_7160 Chr7 (334780..335595) [816 bp, 271 aa] {ON} similar to...   154   2e-44
SAKL0F14278g Chr6 (1143922..1144782) [861 bp, 286 aa] {ON} highl...   153   6e-44
TBLA0A00630 Chr1 complement(126399..127385) [987 bp, 328 aa] {ON}     154   7e-44
Kwal_33.13276 s33 (153537..154445) [909 bp, 302 aa] {ON} YDL124W...   152   1e-43
KLTH0G02420g Chr7 complement(188767..189636) [870 bp, 289 aa] {O...   152   2e-43
Smik_8.182 Chr8 (299804..300787) [984 bp, 327 aa] {ON} YHR104W (...   153   2e-43
Kwal_47.18893 s47 (1017098..1017967) [870 bp, 289 aa] {ON} YJR09...   152   2e-43
CAGL0C04543g Chr3 (434137..435000) [864 bp, 287 aa] {ON} highly ...   150   8e-43
Kpol_1013.82 s1013 complement(200564..201421) [858 bp, 285 aa] {...   150   9e-43
Suva_15.300 Chr15 (525715..526698) [984 bp, 327 aa] {ON} YHR104W...   150   3e-42
TBLA0F01720 Chr6 complement(430289..431269) [981 bp, 326 aa] {ON}     148   2e-41
SAKL0F02574g Chr6 complement(220827..221696) [870 bp, 289 aa] {O...   145   5e-41
ZYRO0G17600g Chr7 (1455426..1456277) [852 bp, 283 aa] {ON} highl...   145   5e-41
Kwal_47.18219 s47 (737925..738806) [882 bp, 293 aa] {ON} YJR096W...   145   8e-41
YJR096W Chr10 (611195..612043) [849 bp, 282 aa] {ON} Putative xy...   145   8e-41
KLLA0F05775g Chr6 (560270..561199) [930 bp, 309 aa] {ON} highly ...   145   9e-41
KAFR0G00920 Chr7 complement(215664..216524) [861 bp, 286 aa] {ON...   144   2e-40
KLTH0G05786g Chr7 complement(460135..460995) [861 bp, 286 aa] {O...   144   2e-40
NCAS0H00560 Chr8 complement(96020..96874) [855 bp, 284 aa] {ON} ...   143   3e-40
Suva_12.184 Chr12 (289608..290456) [849 bp, 282 aa] {ON} YJR096W...   142   6e-40
Smik_10.384 Chr10 (600097..600945) [849 bp, 282 aa] {ON} YJR096W...   142   9e-40
ZYRO0E09614g Chr5 complement(765913..766839) [927 bp, 308 aa] {O...   141   5e-39
Skud_10.318 Chr10 (568560..569408) [849 bp, 282 aa] {ON} YJR096W...   140   5e-39
TDEL0C03320 Chr3 (591171..592022) [852 bp, 283 aa] {ON} Anc_7.46...   140   6e-39
CAGL0J09394g Chr10 (925839..926774) [936 bp, 311 aa] {ON} simila...   140   8e-39
Kwal_47.19278 s47 complement(1169418..1170362) [945 bp, 314 aa] ...   140   9e-39
ABL209C Chr2 complement(11410..12342) [933 bp, 310 aa] {ON} Synt...   139   2e-38
KLTH0G00638g Chr7 (43280..44221) [942 bp, 313 aa] {ON} similar t...   137   2e-37
NCAS0A13740 Chr1 complement(2699208..2700137) [930 bp, 309 aa] {...   136   2e-37
Kpol_1020.13 s1020 (27790..28731) [942 bp, 313 aa] {ON} (27790.....   134   1e-36
Skud_4.131 Chr4 (235946..236884) [939 bp, 312 aa] {ON} YDL124W (...   134   2e-36
Smik_4.113 Chr4 (216885..217823) [939 bp, 312 aa] {ON} YDL124W (...   133   4e-36
KNAG0C04110 Chr3 (806389..807324) [936 bp, 311 aa] {ON} Anc_7.28...   130   6e-35
NDAI0A02300 Chr1 (516594..517535) [942 bp, 313 aa] {ON} Anc_7.285     130   7e-35
SAKL0F00704g Chr6 (60941..61888) [948 bp, 315 aa] {ON} similar t...   129   1e-34
YDL124W Chr4 (240259..241197) [939 bp, 312 aa] {ON} NADPH-depend...   129   1e-34
KAFR0B01200 Chr2 (224411..225358) [948 bp, 315 aa] {ON} Anc_7.28...   125   7e-33
SAKL0F09746g Chr6 complement(746292..747230) [939 bp, 312 aa] {O...   124   1e-32
ZYRO0C09196g Chr3 complement(698826..699764) [939 bp, 312 aa] {O...   123   2e-32
TBLA0F01980 Chr6 (493378..494286) [909 bp, 302 aa] {ON} Anc_7.28...   122   5e-32
TDEL0D02790 Chr4 complement(533517..534506) [990 bp, 329 aa] {ON}     122   9e-32
Kpol_381.8 s381 complement(20844..21359,21366..21695,21698..2178...   119   5e-31
Ecym_3264 Chr3 complement(503010..503945) [936 bp, 311 aa] {ON} ...   102   1e-24
Kwal_33.13274 s33 (151643..151969) [327 bp, 108 aa] {ON} YJR096W...    73   1e-15
Suva_12.272 Chr12 complement(441543..442262,442266..442340) [795...    53   2e-07
Suva_4.122 Chr4 (228898..228945,228942..229163,229167..229517) [...    45   8e-05
TDEL0A08000 Chr1 (1399350..1400309) [960 bp, 319 aa] {ON}              44   3e-04
Kwal_33.13275 s33 (152348..152551) [204 bp, 67 aa] {OFF} [contig...    38   0.003
Suva_9.17 Chr9 (18179..19105) [927 bp, 308 aa] {ON} YNL331C (REAL)     40   0.006
KLTH0E01474g Chr5 complement(143734..144675) [942 bp, 313 aa] {O...    38   0.020
Kpol_400.9 s400 complement(19154..20179) [1026 bp, 341 aa] {ON} ...    37   0.038
NCAS0C02450 Chr3 complement(455582..456613) [1032 bp, 343 aa] {O...    37   0.045
NDAI0C01480 Chr3 (312131..313162) [1032 bp, 343 aa] {ON}               37   0.056
Suva_5.207 Chr5 complement(314580..316883) [2304 bp, 767 aa] {ON...    36   0.11 
Ecym_2296 Chr2 complement(574287..575309) [1023 bp, 340 aa] {ON}...    36   0.11 
NCAS0C01990 Chr3 (365857..366888) [1032 bp, 343 aa] {ON} Anc_8.565     35   0.21 
Kpol_1050.55 s1050 complement(123375..124733) [1359 bp, 452 aa] ...    35   0.29 
KAFR0C04240 Chr3 (842806..843837) [1032 bp, 343 aa] {ON}               34   0.37 
KLLA0B09658g Chr2 complement(837873..838901) [1029 bp, 342 aa] {...    34   0.51 
NDAI0J00730 Chr10 complement(155561..156592) [1032 bp, 343 aa] {...    33   0.58 
TBLA0G01120 Chr7 complement(285827..286858) [1032 bp, 343 aa] {O...    33   0.64 
NCAS0A12950 Chr1 complement(2551851..2552822) [972 bp, 323 aa] {...    33   0.79 
KLTH0E16852g Chr5 complement(1496072..1497199) [1128 bp, 375 aa]...    33   1.1  
YNL331C Chr14 complement(16118..17248) [1131 bp, 376 aa] {ON}  A...    33   1.1  
KLLA0E24421g Chr5 (2171139..2172245) [1107 bp, 368 aa] {ON} simi...    33   1.1  
Smik_14.1 Chr14 complement(607..1737) [1131 bp, 376 aa] {ON} YNL...    33   1.3  
YDL243C Chr4 complement(17577..18566) [990 bp, 329 aa] {ON}  AAD...    32   1.3  
TPHA0J01470 Chr10 complement(340233..342580,342945..343212) [261...    33   1.3  
TBLA0B10110 Chr2 complement(2432572..2433609) [1038 bp, 345 aa] ...    32   1.4  
YER091C Chr5 complement(339864..342167) [2304 bp, 767 aa] {ON}  ...    33   1.4  
Suva_14.10 Chr14 complement(10349..11479) [1131 bp, 376 aa] {ON}...    32   2.1  
YCR107W Chr3 (313890..314981) [1092 bp, 363 aa] {ON}  AAD3Putati...    32   2.6  
YFL056C Chr6 complement(14793..15431) [639 bp, 212 aa] {ON}  AAD...    31   2.8  
TPHA0E02340 Chr5 (494049..499073) [5025 bp, 1674 aa] {ON} Anc_5....    32   3.0  
KNAG0M02340 Chr13 complement(431237..432166) [930 bp, 309 aa] {O...    31   3.2  
NDAI0B00930 Chr2 (215394..218216) [2823 bp, 940 aa] {ON} Anc_5.7...    32   3.2  
Ecym_2026 Chr2 (42179..43534) [1356 bp, 451 aa] {ON} similar to ...    31   3.4  
KAFR0D03980 Chr4 (783660..784709) [1050 bp, 349 aa] {ON} Anc_1.7...    31   4.2  

>Smik_4.634 Chr4 (1133924..1134862) [939 bp, 312 aa] {ON} YDR368W
           (REAL)
          Length = 312

 Score =  640 bits (1651), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 312/312 (100%), Positives = 312/312 (100%)

Query: 1   MPATLKNSSASLKLNTGASIPVLGFGTWRSVENNGYHSVIAALKAGYRHIDAAAIYLNEE 60
           MPATLKNSSASLKLNTGASIPVLGFGTWRSVENNGYHSVIAALKAGYRHIDAAAIYLNEE
Sbjct: 1   MPATLKNSSASLKLNTGASIPVLGFGTWRSVENNGYHSVIAALKAGYRHIDAAAIYLNEE 60

Query: 61  EVGRAIKDSGVPREDIFITTKLWGTEQRDPEAALNESLKRLGLDYVDLYLMHWPVPLKTE 120
           EVGRAIKDSGVPREDIFITTKLWGTEQRDPEAALNESLKRLGLDYVDLYLMHWPVPLKTE
Sbjct: 61  EVGRAIKDSGVPREDIFITTKLWGTEQRDPEAALNESLKRLGLDYVDLYLMHWPVPLKTE 120

Query: 121 TITDGNVLCIPTLDDGTVDVDTREWNFIKTWDLMQELPKTGKTKAVGVSNFSINNIKALL 180
           TITDGNVLCIPTLDDGTVDVDTREWNFIKTWDLMQELPKTGKTKAVGVSNFSINNIKALL
Sbjct: 121 TITDGNVLCIPTLDDGTVDVDTREWNFIKTWDLMQELPKTGKTKAVGVSNFSINNIKALL 180

Query: 181 ESPSNKLVPAANQIEIHPLLPQNELIAFCKEKGIVVEAYSPFGSVNAPLLEEQAIIDMAK 240
           ESPSNKLVPAANQIEIHPLLPQNELIAFCKEKGIVVEAYSPFGSVNAPLLEEQAIIDMAK
Sbjct: 181 ESPSNKLVPAANQIEIHPLLPQNELIAFCKEKGIVVEAYSPFGSVNAPLLEEQAIIDMAK 240

Query: 241 KHGVAPAQLIISWSIQRGYVVLAKSVNPERIVSNFKIFTLPEDDFKIISNLSKVHGEKRV 300
           KHGVAPAQLIISWSIQRGYVVLAKSVNPERIVSNFKIFTLPEDDFKIISNLSKVHGEKRV
Sbjct: 241 KHGVAPAQLIISWSIQRGYVVLAKSVNPERIVSNFKIFTLPEDDFKIISNLSKVHGEKRV 300

Query: 301 VDMKWSSFPIFK 312
           VDMKWSSFPIFK
Sbjct: 301 VDMKWSSFPIFK 312

>YDR368W Chr4 (1213904..1214842) [939 bp, 312 aa] {ON}
           YPR1NADPH-dependent aldo-keto reductase, reduces
           multiple substrates including 2-methylbutyraldehyde and
           D,L-glyceraldehyde, expression is induced by osmotic and
           oxidative stress; functionally redundant with other
           aldo-keto reductases
          Length = 312

 Score =  604 bits (1557), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 289/312 (92%), Positives = 304/312 (97%)

Query: 1   MPATLKNSSASLKLNTGASIPVLGFGTWRSVENNGYHSVIAALKAGYRHIDAAAIYLNEE 60
           MPATLKNSSA+LKLNTGASIPVLGFGTWRSV+NNGYHSVIAALKAGYRHIDAAAIYLNEE
Sbjct: 1   MPATLKNSSATLKLNTGASIPVLGFGTWRSVDNNGYHSVIAALKAGYRHIDAAAIYLNEE 60

Query: 61  EVGRAIKDSGVPREDIFITTKLWGTEQRDPEAALNESLKRLGLDYVDLYLMHWPVPLKTE 120
           EVGRAIKDSGVPRE+IFITTKLWGTEQRDPEAALN+SLKRLGLDYVDLYLMHWPVPLKT+
Sbjct: 61  EVGRAIKDSGVPREEIFITTKLWGTEQRDPEAALNKSLKRLGLDYVDLYLMHWPVPLKTD 120

Query: 121 TITDGNVLCIPTLDDGTVDVDTREWNFIKTWDLMQELPKTGKTKAVGVSNFSINNIKALL 180
            +TDGNVLCIPTL+DGTVD+DT+EWNFIKTW+LMQELPKTGKTKAVGVSNFSINNIK LL
Sbjct: 121 RVTDGNVLCIPTLEDGTVDIDTKEWNFIKTWELMQELPKTGKTKAVGVSNFSINNIKELL 180

Query: 181 ESPSNKLVPAANQIEIHPLLPQNELIAFCKEKGIVVEAYSPFGSVNAPLLEEQAIIDMAK 240
           ESP+NK+VPA NQIEIHPLLPQ+ELIAFCKEKGIVVEAYSPFGS NAPLL+EQAIIDMAK
Sbjct: 181 ESPNNKVVPATNQIEIHPLLPQDELIAFCKEKGIVVEAYSPFGSANAPLLKEQAIIDMAK 240

Query: 241 KHGVAPAQLIISWSIQRGYVVLAKSVNPERIVSNFKIFTLPEDDFKIISNLSKVHGEKRV 300
           KHGV PAQLIISWSIQRGYVVLAKSVNPERIVSNFKIFTLPEDDFK ISNLSKVHG KRV
Sbjct: 241 KHGVEPAQLIISWSIQRGYVVLAKSVNPERIVSNFKIFTLPEDDFKTISNLSKVHGTKRV 300

Query: 301 VDMKWSSFPIFK 312
           VDMKW SFPIF+
Sbjct: 301 VDMKWGSFPIFQ 312

>Skud_4.637 Chr4 (1136769..1137707) [939 bp, 312 aa] {ON} YDR368W
           (REAL)
          Length = 312

 Score =  598 bits (1541), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 283/312 (90%), Positives = 303/312 (97%)

Query: 1   MPATLKNSSASLKLNTGASIPVLGFGTWRSVENNGYHSVIAALKAGYRHIDAAAIYLNEE 60
           MPATL+NSSA+LKLNTGASIP LGFGTWRSV+NNGYHSVIAALK GYRHIDAAAIYLNEE
Sbjct: 1   MPATLRNSSATLKLNTGASIPALGFGTWRSVDNNGYHSVIAALKTGYRHIDAAAIYLNEE 60

Query: 61  EVGRAIKDSGVPREDIFITTKLWGTEQRDPEAALNESLKRLGLDYVDLYLMHWPVPLKTE 120
           EVGRAIKDSG+ RE+IFITTKLWGTEQRDPEAALNESLKRLGLDYVDLYLMHWPVPLKT+
Sbjct: 61  EVGRAIKDSGIAREEIFITTKLWGTEQRDPEAALNESLKRLGLDYVDLYLMHWPVPLKTD 120

Query: 121 TITDGNVLCIPTLDDGTVDVDTREWNFIKTWDLMQELPKTGKTKAVGVSNFSINNIKALL 180
           T+TDGNVLCIPTL+DGTVDVDT+EWNFIKTWDLMQELPKTGKT+AVGVSNFSINNIK LL
Sbjct: 121 TVTDGNVLCIPTLEDGTVDVDTKEWNFIKTWDLMQELPKTGKTRAVGVSNFSINNIKELL 180

Query: 181 ESPSNKLVPAANQIEIHPLLPQNELIAFCKEKGIVVEAYSPFGSVNAPLLEEQAIIDMAK 240
           +SPSNKLVPA NQ+EIHPLLPQ+ELIAFCKEKGIVVEAYSPFGS NAPLL+EQAIIDMAK
Sbjct: 181 KSPSNKLVPATNQVEIHPLLPQDELIAFCKEKGIVVEAYSPFGSANAPLLKEQAIIDMAK 240

Query: 241 KHGVAPAQLIISWSIQRGYVVLAKSVNPERIVSNFKIFTLPEDDFKIISNLSKVHGEKRV 300
           KHGV P+QLIISWSIQRGYVVLAKSVNPER+VSNFKIFTLPEDDFK I +LSKVHGEKRV
Sbjct: 241 KHGVEPSQLIISWSIQRGYVVLAKSVNPERVVSNFKIFTLPEDDFKAIGDLSKVHGEKRV 300

Query: 301 VDMKWSSFPIFK 312
           V+MKW+SFPIF+
Sbjct: 301 VNMKWASFPIFE 312

>Suva_2.540 Chr2 (964433..965371) [939 bp, 312 aa] {ON} YDR368W
           (REAL)
          Length = 312

 Score =  597 bits (1540), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 284/312 (91%), Positives = 306/312 (98%)

Query: 1   MPATLKNSSASLKLNTGASIPVLGFGTWRSVENNGYHSVIAALKAGYRHIDAAAIYLNEE 60
           MPATLKNSSA+LKLNTGASIPVLGFGTWRSV+N+GYHSVIAALKAGYRHIDAAAIYLNEE
Sbjct: 1   MPATLKNSSATLKLNTGASIPVLGFGTWRSVDNSGYHSVIAALKAGYRHIDAAAIYLNEE 60

Query: 61  EVGRAIKDSGVPREDIFITTKLWGTEQRDPEAALNESLKRLGLDYVDLYLMHWPVPLKTE 120
           EVG+AIKDSGVPRE+IFITTKLWGTEQRDPEAAL++SLKRLGLDYVDLYLMHWPVPLKT+
Sbjct: 61  EVGKAIKDSGVPREEIFITTKLWGTEQRDPEAALDKSLKRLGLDYVDLYLMHWPVPLKTD 120

Query: 121 TITDGNVLCIPTLDDGTVDVDTREWNFIKTWDLMQELPKTGKTKAVGVSNFSINNIKALL 180
           TITDG+ LCIPTL+DGT+DVDT+EWNF+KTWDLMQ+LPKTGKTKAVGVSNFSINNIK LL
Sbjct: 121 TITDGDFLCIPTLEDGTIDVDTKEWNFVKTWDLMQKLPKTGKTKAVGVSNFSINNIKELL 180

Query: 181 ESPSNKLVPAANQIEIHPLLPQNELIAFCKEKGIVVEAYSPFGSVNAPLLEEQAIIDMAK 240
           +SPSNKLVPA NQIEIHPLLPQ+ELIAFCKEKGIVVEAYSPFGS NAPLL+EQAIIDMAK
Sbjct: 181 KSPSNKLVPATNQIEIHPLLPQDELIAFCKEKGIVVEAYSPFGSANAPLLKEQAIIDMAK 240

Query: 241 KHGVAPAQLIISWSIQRGYVVLAKSVNPERIVSNFKIFTLPEDDFKIISNLSKVHGEKRV 300
           KHGV PAQLIISWSIQRGYVVLAKSVNPER+VSNFKIFTLPEDDFK ISNLSKVHGEKRV
Sbjct: 241 KHGVEPAQLIISWSIQRGYVVLAKSVNPERVVSNFKIFTLPEDDFKTISNLSKVHGEKRV 300

Query: 301 VDMKWSSFPIFK 312
           V+M+W+SFPIF+
Sbjct: 301 VNMQWNSFPIFE 312

>NDAI0C01600 Chr3 complement(342011..342952) [942 bp, 313 aa] {ON}
           Anc_5.434
          Length = 313

 Score =  442 bits (1137), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 206/312 (66%), Positives = 254/312 (81%), Gaps = 1/312 (0%)

Query: 1   MPATLKNSSASLKLNTGASIPVLGFGTWRSV-ENNGYHSVIAALKAGYRHIDAAAIYLNE 59
           M +TLKNS+A+ KLNTGA+IP +G GTW+S  EN GY +V+ ALKAGYRHID AAIY NE
Sbjct: 1   MGSTLKNSTATYKLNTGATIPAVGLGTWQSTNENEGYEAVMNALKAGYRHIDTAAIYKNE 60

Query: 60  EEVGRAIKDSGVPREDIFITTKLWGTEQRDPEAALNESLKRLGLDYVDLYLMHWPVPLKT 119
           ++VG+AI DSG+PRE+IF+TTKLWGT+ RDPE ALN+SL+RLGLDYVDLYLMHWPV  K 
Sbjct: 61  DQVGKAINDSGIPREEIFVTTKLWGTQHRDPETALNQSLERLGLDYVDLYLMHWPVAFKP 120

Query: 120 ETITDGNVLCIPTLDDGTVDVDTREWNFIKTWDLMQELPKTGKTKAVGVSNFSINNIKAL 179
           ++I DGN   +P L +G  D+D   WNF+KTW+LMQELPKTGKT+AVGVSNFSINN+KAL
Sbjct: 121 DSIKDGNYSTMPMLPNGQRDLDLTTWNFVKTWELMQELPKTGKTRAVGVSNFSINNLKAL 180

Query: 180 LESPSNKLVPAANQIEIHPLLPQNELIAFCKEKGIVVEAYSPFGSVNAPLLEEQAIIDMA 239
           L SP NKLVPAANQ+E HPLLPQ+EL  FCKEKGI++EAYSP GS NAP+L E  II++A
Sbjct: 181 LSSPGNKLVPAANQVEAHPLLPQDELQKFCKEKGIILEAYSPLGSTNAPILTEPKIIEIA 240

Query: 240 KKHGVAPAQLIISWSIQRGYVVLAKSVNPERIVSNFKIFTLPEDDFKIISNLSKVHGEKR 299
           KKH V PAQ++ISW +Q+G+VVL KSV+ ERI +NF+ F L +D+   ++NLSK  GE+R
Sbjct: 241 KKHNVQPAQVVISWHVQKGHVVLPKSVHEERIKANFQTFELSKDEMDSLNNLSKEKGERR 300

Query: 300 VVDMKWSSFPIF 311
           +V   W+ F  F
Sbjct: 301 IVQPNWAPFVPF 312

>CAGL0A02816g Chr1 (296851..297783) [933 bp, 310 aa] {ON} highly
           similar to uniprot|Q12458 Saccharomyces cerevisiae
           YDR368w YPR1
          Length = 310

 Score =  439 bits (1128), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 206/309 (66%), Positives = 252/309 (81%)

Query: 4   TLKNSSASLKLNTGASIPVLGFGTWRSVENNGYHSVIAALKAGYRHIDAAAIYLNEEEVG 63
           +LKNS+A+LKLNTGA IPV+G GTWRS  N+GY SV+AALK GYRHIDAAAIY NE++VG
Sbjct: 2   SLKNSTATLKLNTGAEIPVVGLGTWRSAANDGYDSVLAALKLGYRHIDAAAIYGNEDQVG 61

Query: 64  RAIKDSGVPREDIFITTKLWGTEQRDPEAALNESLKRLGLDYVDLYLMHWPVPLKTETIT 123
           RAIKDSGVPR++IFITTKLWGTE R+P  AL+ SLKRLGLDYVDLYLMHWPV LK     
Sbjct: 62  RAIKDSGVPRQEIFITTKLWGTEHRNPAKALDSSLKRLGLDYVDLYLMHWPVALKAHGSE 121

Query: 124 DGNVLCIPTLDDGTVDVDTREWNFIKTWDLMQELPKTGKTKAVGVSNFSINNIKALLESP 183
           + ++L IP   DG  D+D  +W+FIKTW+LMQELPKTGKTKA+GVSNFSINN+KAL  SP
Sbjct: 122 EKDLLNIPKKPDGKTDIDIEDWDFIKTWELMQELPKTGKTKAIGVSNFSINNLKALKNSP 181

Query: 184 SNKLVPAANQIEIHPLLPQNELIAFCKEKGIVVEAYSPFGSVNAPLLEEQAIIDMAKKHG 243
               VPAANQ+EIHPL PQ ELI +CK + I++EAYSPFGS +AP+L+E  +  +A+K+ 
Sbjct: 182 KFNTVPAANQVEIHPLFPQTELIEYCKSENILIEAYSPFGSADAPVLKEPELHKLAEKYN 241

Query: 244 VAPAQLIISWSIQRGYVVLAKSVNPERIVSNFKIFTLPEDDFKIISNLSKVHGEKRVVDM 303
           ++ AQLIISWS+QRGYVVL KSV+ ERI +N K+ TL ++D + I+NLSKV GEKR+V +
Sbjct: 242 ISTAQLIISWSVQRGYVVLPKSVHAERIEANLKVLTLKDEDMETITNLSKVKGEKRLVQL 301

Query: 304 KWSSFPIFK 312
            WS FP F+
Sbjct: 302 DWSPFPTFE 310

>Smik_15.298 Chr15 (512239..513177) [939 bp, 312 aa] {ON} YOR120W
           (REAL)
          Length = 312

 Score =  437 bits (1123), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 206/312 (66%), Positives = 249/312 (79%)

Query: 1   MPATLKNSSASLKLNTGASIPVLGFGTWRSVENNGYHSVIAALKAGYRHIDAAAIYLNEE 60
           M  TL +S+ +L LNTGA IP +G GTW+S +N+ Y SV+AALKAGY+HID AAIY NE+
Sbjct: 1   MSTTLHDSTKTLSLNTGAQIPQVGLGTWQSKDNDAYKSVLAALKAGYKHIDTAAIYRNED 60

Query: 61  EVGRAIKDSGVPREDIFITTKLWGTEQRDPEAALNESLKRLGLDYVDLYLMHWPVPLKTE 120
           +VG+AIKDSGVPRE+IF+TTKLW T+  +P  AL+ESL+RLGLDYVDLYL+HWP  L T 
Sbjct: 61  QVGQAIKDSGVPREEIFVTTKLWSTQHHEPAKALDESLQRLGLDYVDLYLIHWPARLDTN 120

Query: 121 TITDGNVLCIPTLDDGTVDVDTREWNFIKTWDLMQELPKTGKTKAVGVSNFSINNIKALL 180
            I DG++L +PT  DG+  VD   WNFIKTW+LMQELPKTGKTKA+GVSNFSINN+K LL
Sbjct: 121 YIKDGDILSVPTKADGSRAVDVTNWNFIKTWELMQELPKTGKTKAIGVSNFSINNLKDLL 180

Query: 181 ESPSNKLVPAANQIEIHPLLPQNELIAFCKEKGIVVEAYSPFGSVNAPLLEEQAIIDMAK 240
            SP NKL PAANQ+EIHPLLPQNELI FCK K I++EAYSP GS +APLL+E  I+ +AK
Sbjct: 181 ASPGNKLTPAANQVEIHPLLPQNELINFCKSKKIMIEAYSPLGSTDAPLLKEPTILKIAK 240

Query: 241 KHGVAPAQLIISWSIQRGYVVLAKSVNPERIVSNFKIFTLPEDDFKIISNLSKVHGEKRV 300
           K+ V P  ++ISW  QRGYVVL KSVNP+RI +N KIFTL  +DF+ I+N+SK  GEKRV
Sbjct: 241 KNNVQPGHVVISWHAQRGYVVLPKSVNPDRIETNRKIFTLSNEDFEAINNISKEKGEKRV 300

Query: 301 VDMKWSSFPIFK 312
           V+  WS F  FK
Sbjct: 301 VNPNWSPFEAFK 312

>Skud_15.283 Chr15 (507542..508480) [939 bp, 312 aa] {ON} YOR120W
           (REAL)
          Length = 312

 Score =  436 bits (1122), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 205/312 (65%), Positives = 250/312 (80%)

Query: 1   MPATLKNSSASLKLNTGASIPVLGFGTWRSVENNGYHSVIAALKAGYRHIDAAAIYLNEE 60
           MPATL++S+ +L LNTGA IP +G GTW+S +N+ Y SV+AALK GYRHID AAIY NE+
Sbjct: 1   MPATLQDSTRTLSLNTGAQIPQVGLGTWQSKDNDAYKSVLAALKDGYRHIDTAAIYRNED 60

Query: 61  EVGRAIKDSGVPREDIFITTKLWGTEQRDPEAALNESLKRLGLDYVDLYLMHWPVPLKTE 120
           +VG+AI+DSGVPRE IF+TTKLW T+  +P  AL++SL+RLGLDYVDLYLMHWPV L  +
Sbjct: 61  QVGQAIRDSGVPREKIFVTTKLWCTQHHEPAKALDQSLRRLGLDYVDLYLMHWPVRLDPD 120

Query: 121 TITDGNVLCIPTLDDGTVDVDTREWNFIKTWDLMQELPKTGKTKAVGVSNFSINNIKALL 180
            I DGN+L +PT  DG+  VD   WNFIKTW+LMQELPKTGK KAVGVSNFSINN+K LL
Sbjct: 121 YIKDGNILSVPTKQDGSRAVDITNWNFIKTWELMQELPKTGKAKAVGVSNFSINNLKDLL 180

Query: 181 ESPSNKLVPAANQIEIHPLLPQNELIAFCKEKGIVVEAYSPFGSVNAPLLEEQAIIDMAK 240
            S  NKL PAANQ+EIHPLLPQNELI FC+ KGI++E YSP GS +APLL+E  I+++AK
Sbjct: 181 ASKGNKLTPAANQVEIHPLLPQNELIDFCRGKGIMIEGYSPLGSTDAPLLKEPVILEIAK 240

Query: 241 KHGVAPAQLIISWSIQRGYVVLAKSVNPERIVSNFKIFTLPEDDFKIISNLSKVHGEKRV 300
           K+ V PA ++ISW  QRGYVVL KSVNP+R+ +N KIFTL ++DF+ I+ +SK  GEKRV
Sbjct: 241 KNNVQPAHVVISWHAQRGYVVLPKSVNPDRVKANRKIFTLSDEDFEAINGISKAKGEKRV 300

Query: 301 VDMKWSSFPIFK 312
           V   WS F  FK
Sbjct: 301 VHPNWSPFEAFK 312

>YOR120W Chr15 (551114..552052) [939 bp, 312 aa] {ON}  GCY1Putative
           NADP(+) coupled glycerol dehydrogenase, proposed to be
           involved in an alternative pathway for glycerol
           catabolism; also has mRNA binding activity; member of
           the aldo-keto reductase (AKR) family
          Length = 312

 Score =  436 bits (1120), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 208/312 (66%), Positives = 249/312 (79%)

Query: 1   MPATLKNSSASLKLNTGASIPVLGFGTWRSVENNGYHSVIAALKAGYRHIDAAAIYLNEE 60
           MPATL +S+  L LNTGA IP +G GTW+S EN+ Y +V+ ALK GYRHID AAIY NE+
Sbjct: 1   MPATLHDSTKILSLNTGAQIPQIGLGTWQSKENDAYKAVLTALKDGYRHIDTAAIYRNED 60

Query: 61  EVGRAIKDSGVPREDIFITTKLWGTEQRDPEAALNESLKRLGLDYVDLYLMHWPVPLKTE 120
           +VG+AIKDSGVPRE+IF+TTKLW T+  +PE AL++SLKRLGLDYVDLYLMHWP  L   
Sbjct: 61  QVGQAIKDSGVPREEIFVTTKLWCTQHHEPEVALDQSLKRLGLDYVDLYLMHWPARLDPA 120

Query: 121 TITDGNVLCIPTLDDGTVDVDTREWNFIKTWDLMQELPKTGKTKAVGVSNFSINNIKALL 180
            I + ++L +PT  DG+  VD   WNFIKTW+LMQELPKTGKTKAVGVSNFSINN+K LL
Sbjct: 121 YIKNEDILSVPTKKDGSRAVDITNWNFIKTWELMQELPKTGKTKAVGVSNFSINNLKDLL 180

Query: 181 ESPSNKLVPAANQIEIHPLLPQNELIAFCKEKGIVVEAYSPFGSVNAPLLEEQAIIDMAK 240
            S  NKL PAANQ+EIHPLLPQ+ELI FCK KGIVVEAYSP GS +APLL+E  I+++AK
Sbjct: 181 ASQGNKLTPAANQVEIHPLLPQDELINFCKSKGIVVEAYSPLGSTDAPLLKEPVILEIAK 240

Query: 241 KHGVAPAQLIISWSIQRGYVVLAKSVNPERIVSNFKIFTLPEDDFKIISNLSKVHGEKRV 300
           K+ V P  ++ISW +QRGYVVL KSVNP+RI +N KIFTL  +DF+ I+N+SK  GEKRV
Sbjct: 241 KNNVQPGHVVISWHVQRGYVVLPKSVNPDRIKTNRKIFTLSTEDFEAINNISKEKGEKRV 300

Query: 301 VDMKWSSFPIFK 312
           V   WS F +FK
Sbjct: 301 VHPNWSPFEVFK 312

>TBLA0A02825 Chr1 complement(681691..682626) [936 bp, 311 aa] {ON}
          Length = 311

 Score =  436 bits (1120), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 201/312 (64%), Positives = 248/312 (79%), Gaps = 1/312 (0%)

Query: 1   MPATLKNSSASLKLNTGASIPVLGFGTWRSVENNGYHSVIAALKAGYRHIDAAAIYLNEE 60
           M A LKN +A++KLNTGA+IP +G GTWRS  N+GY SVIAA K GYRHID AAIY NE+
Sbjct: 1   MSAALKNCTATVKLNTGANIPAIGLGTWRSENNDGYDSVIAAAKVGYRHIDTAAIYGNED 60

Query: 61  EVGRAIKDSGVPREDIFITTKLWGTEQRDPEAALNESLKRLGLDYVDLYLMHWPVPLKTE 120
           +VG+AI + GV R ++F+TTKLWGT+QRDPE ALN+SLKRLGLDYVDLYL+HWPV  KT+
Sbjct: 61  QVGKAINECGVTRSELFVTTKLWGTQQRDPETALNQSLKRLGLDYVDLYLIHWPVAFKTD 120

Query: 121 TITDGNVLCIPTLDDGTVDVDTREWNFIKTWDLMQELPKTGKTKAVGVSNFSINNIKALL 180
           TI DGN+L IP   DG  D+D  EWNFIKTW+LMQ L KTGKTKA+G+SNFSINNIK LL
Sbjct: 121 TIKDGNLLTIPK-KDGEADIDYPEWNFIKTWELMQNLLKTGKTKAIGISNFSINNIKELL 179

Query: 181 ESPSNKLVPAANQIEIHPLLPQNELIAFCKEKGIVVEAYSPFGSVNAPLLEEQAIIDMAK 240
            +P+  + PA NQ+E+HPLLPQ+ELIAFCKEKGIV+EAYSP G +NAP+L+++ II++AK
Sbjct: 180 AAPTTTVTPACNQVEVHPLLPQDELIAFCKEKGIVIEAYSPLGGINAPVLKDETIIEIAK 239

Query: 241 KHGVAPAQLIISWSIQRGYVVLAKSVNPERIVSNFKIFTLPEDDFKIISNLSKVHGEKRV 300
           ++ V   Q++ SW +QRGYVVL KSV   RI+SN K FTL +DD   I+NL KV GE R 
Sbjct: 240 RNNVDAGQVVTSWHVQRGYVVLPKSVKESRIISNLKTFTLSDDDMTKINNLVKVKGENRT 299

Query: 301 VDMKWSSFPIFK 312
            D+    FP+F+
Sbjct: 300 CDLGIKGFPMFQ 311

>Suva_8.173 Chr8 (308911..309849) [939 bp, 312 aa] {ON} YOR120W
           (REAL)
          Length = 312

 Score =  435 bits (1119), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 206/312 (66%), Positives = 252/312 (80%)

Query: 1   MPATLKNSSASLKLNTGASIPVLGFGTWRSVENNGYHSVIAALKAGYRHIDAAAIYLNEE 60
           M ATL+ S+ +L LNTGA IP +G GTW+S +N+ Y SV+AALK GYRHID AAIY NE+
Sbjct: 1   MSATLQYSTKTLPLNTGAKIPQVGLGTWQSKDNDAYKSVVAALKDGYRHIDTAAIYGNED 60

Query: 61  EVGRAIKDSGVPREDIFITTKLWGTEQRDPEAALNESLKRLGLDYVDLYLMHWPVPLKTE 120
           +VG+AIKDSGVPRE+IF+TTKLW T+  +P  AL++SLKRLGLDYVDLYLMHWPV L   
Sbjct: 61  QVGQAIKDSGVPREEIFVTTKLWCTQHHEPAKALDQSLKRLGLDYVDLYLMHWPVRLDPN 120

Query: 121 TITDGNVLCIPTLDDGTVDVDTREWNFIKTWDLMQELPKTGKTKAVGVSNFSINNIKALL 180
            I DG++L IPT +DG+  VD   WNFIKTW+LMQELPKT KT+AVGVSNFSINN+K LL
Sbjct: 121 YIKDGHILSIPTKEDGSRPVDITNWNFIKTWELMQELPKTNKTRAVGVSNFSINNLKDLL 180

Query: 181 ESPSNKLVPAANQIEIHPLLPQNELIAFCKEKGIVVEAYSPFGSVNAPLLEEQAIIDMAK 240
            SP N+L PAANQ+E+HPLLPQNELI FCK KGI+VEAYSP GS +APLL+E  ++++AK
Sbjct: 181 ASPGNQLTPAANQVELHPLLPQNELIDFCKSKGIMVEAYSPLGSTDAPLLKEPVVLEIAK 240

Query: 241 KHGVAPAQLIISWSIQRGYVVLAKSVNPERIVSNFKIFTLPEDDFKIISNLSKVHGEKRV 300
           K+ V P  ++ISW  QRGYVVL KSVNP+RI +N K+FTL ++DF+ I+N+SK  GEKRV
Sbjct: 241 KNNVQPGHVVISWHAQRGYVVLPKSVNPDRIKTNRKVFTLSDEDFEAINNISKEKGEKRV 300

Query: 301 VDMKWSSFPIFK 312
           V+  WS F  FK
Sbjct: 301 VNPDWSPFEAFK 312

>SAKL0G02530g Chr7 (208952..209890) [939 bp, 312 aa] {ON} similar to
           uniprot|Q12458 Saccharomyces cerevisiae YDR368W YPR1
           2-methylbutyraldehyde reductase may be involved in
           isoleucine catabolism
          Length = 312

 Score =  434 bits (1115), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 203/312 (65%), Positives = 251/312 (80%)

Query: 1   MPATLKNSSASLKLNTGASIPVLGFGTWRSVENNGYHSVIAALKAGYRHIDAAAIYLNEE 60
           M   LKNSSA++KLNTGA IP LG GTWRS +   Y+SV++A+K GYRHID+AAIY NEE
Sbjct: 1   MSIQLKNSSATVKLNTGAIIPQLGLGTWRSSDEEAYNSVLSAIKLGYRHIDSAAIYGNEE 60

Query: 61  EVGRAIKDSGVPREDIFITTKLWGTEQRDPEAALNESLKRLGLDYVDLYLMHWPVPLKTE 120
            VG+AI+DSGVPR ++F+TTKLWGT+QR+PE AL+ SLKRLGLDYVDLYL+HWP+  KT+
Sbjct: 61  PVGKAIRDSGVPRNELFVTTKLWGTQQRNPEKALDASLKRLGLDYVDLYLIHWPIAFKTD 120

Query: 121 TITDGNVLCIPTLDDGTVDVDTREWNFIKTWDLMQELPKTGKTKAVGVSNFSINNIKALL 180
            I D + L +PT  DG  DVD ++WNF+KTW+L+QELP TGK KAVGVSNFS+NN+K LL
Sbjct: 121 NIKDDDYLTVPTGKDGKADVDVKDWNFVKTWELVQELPATGKAKAVGVSNFSVNNLKELL 180

Query: 181 ESPSNKLVPAANQIEIHPLLPQNELIAFCKEKGIVVEAYSPFGSVNAPLLEEQAIIDMAK 240
            SP NKLVPA NQ+E+HPLLPQ+ELI F K KGIV+EAYSP GS  +PLL+E  II++AK
Sbjct: 181 ASPGNKLVPACNQVELHPLLPQDELIEFSKSKGIVIEAYSPLGSNGSPLLKEPVIIEVAK 240

Query: 241 KHGVAPAQLIISWSIQRGYVVLAKSVNPERIVSNFKIFTLPEDDFKIISNLSKVHGEKRV 300
           K+GV PAQ++I+W IQRGYV+L KSVNP+R+ SNFK+F L ++D   I  +SK  G KR 
Sbjct: 241 KYGVEPAQVLINWGIQRGYVILPKSVNPKRVESNFKVFDLSKEDVDRIHKISKEQGVKRF 300

Query: 301 VDMKWSSFPIFK 312
           V   W SFPIF+
Sbjct: 301 VHPDWPSFPIFE 312

>CAGL0I01100g Chr9 complement(91693..92625) [933 bp, 310 aa] {ON}
           highly similar to uniprot|P14065 Saccharomyces
           cerevisiae YOR120w GCY1 or uniprot|Q12458 Saccharomyces
           cerevisiae YDR368w YPR1
          Length = 310

 Score =  431 bits (1107), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 202/309 (65%), Positives = 248/309 (80%), Gaps = 1/309 (0%)

Query: 3   ATLKNSSASLKLNTGASIPVLGFGTWRSVENNGYHSVIAALKAGYRHIDAAAIYLNEEEV 62
           A L  ++++LKLNTGA IPV+G GTW+S EN GY++ + ALKAGYRHID AAIY NEEE+
Sbjct: 2   AALHKNTSTLKLNTGAHIPVIGLGTWQSSENEGYNATLEALKAGYRHIDTAAIYKNEEEI 61

Query: 63  GRAIKDSGVPREDIFITTKLWGTEQRDPEAALNESLKRLGLDYVDLYLMHWPVPLKTETI 122
           GRAI+DS +PR ++F+TTKLWGT+ R+P  AL++SLKRLGLDYVDLYLMHWPV LKT+ I
Sbjct: 62  GRAIRDSNIPRNELFVTTKLWGTQHRNPTEALDQSLKRLGLDYVDLYLMHWPVALKTDLI 121

Query: 123 TDGNVLCIPTLDDGTVDVDTREWNFIKTWDLMQELPKTGKTKAVGVSNFSINNIKALLES 182
            DGN+L IP  +DG+ DVD  +WNF+KTW+LMQELPK  K +A+GVSNFSINN+K LL S
Sbjct: 122 KDGNLLQIPEREDGSRDVDLEDWNFVKTWELMQELPKE-KARAIGVSNFSINNLKELLNS 180

Query: 183 PSNKLVPAANQIEIHPLLPQNELIAFCKEKGIVVEAYSPFGSVNAPLLEEQAIIDMAKKH 242
             NK+VPAANQIEIHPLLPQ+ELI FCKEKGIV+EAYSP GS +AP+L+E+ I ++AKK+
Sbjct: 181 KGNKVVPAANQIEIHPLLPQDELINFCKEKGIVLEAYSPLGSTDAPILKEEEITEIAKKN 240

Query: 243 GVAPAQLIISWSIQRGYVVLAKSVNPERIVSNFKIFTLPEDDFKIISNLSKVHGEKRVVD 302
           GV   QL+ISW  QRGYVVL KSV PERI  N + F L ++DF  +SN +K HGE+RVV 
Sbjct: 241 GVNAGQLVISWHAQRGYVVLPKSVKPERIHGNQETFKLSDEDFATLSNYAKKHGERRVVS 300

Query: 303 MKWSSFPIF 311
             W  F  F
Sbjct: 301 PNWGPFKPF 309

>KAFR0E03850 Chr5 complement(764595..765530) [936 bp, 311 aa] {ON} 
          Length = 311

 Score =  423 bits (1087), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 207/313 (66%), Positives = 265/313 (84%), Gaps = 3/313 (0%)

Query: 1   MPATLKNSSASLKLNTGASIPVLGFGTWRSVENN-GYHSVIAALKAGYRHIDAAAIYLNE 59
           M +TL+N++ +LKLNTGAS+P+LG GTWR+ ++  GY++V +AL+AGYRHID AAIY NE
Sbjct: 1   MASTLQNTTTTLKLNTGASLPILGLGTWRATDDQEGYNAVKSALEAGYRHIDTAAIYQNE 60

Query: 60  EEVGRAIKDSGVPREDIFITTKLWGTEQRDPEAALNESLKRLGLDYVDLYLMHWPVPLKT 119
           E VGRAI++SG+PR++IF+TTKLWGT+ RDP AAL++SL+RLGLDYVDLYLMHWPVP++ 
Sbjct: 61  EVVGRAIRESGIPRDEIFVTTKLWGTQHRDPAAALDQSLERLGLDYVDLYLMHWPVPMEA 120

Query: 120 ETITDGNVLCIPTLDDGTVDVDTREWNFIKTWDLMQELPKTGKTKAVGVSNFSINNIKAL 179
           +     ++L  P   DG++ V++ +W+FIKTW+LMQELPKT KT+A+GVSNFSINNI  L
Sbjct: 121 KYSKSSSLLEFPYRPDGSLAVES-DWDFIKTWELMQELPKT-KTRAIGVSNFSINNINDL 178

Query: 180 LESPSNKLVPAANQIEIHPLLPQNELIAFCKEKGIVVEAYSPFGSVNAPLLEEQAIIDMA 239
           L+SP NK+VPAANQ+E+HPLLPQ EL+ FC+EKGIVVEAYSPFGSV+APLL EQAII++A
Sbjct: 179 LKSPGNKIVPAANQVELHPLLPQAELVTFCQEKGIVVEAYSPFGSVSAPLLSEQAIIEVA 238

Query: 240 KKHGVAPAQLIISWSIQRGYVVLAKSVNPERIVSNFKIFTLPEDDFKIISNLSKVHGEKR 299
           KKH V+ AQ+I+SW I+RG  VL KSV+ ER+VSNFK F+LPEDDF  I+N+SK  GEKR
Sbjct: 239 KKHDVSAAQVILSWHIKRGIAVLPKSVHKERVVSNFKTFSLPEDDFATINNVSKEKGEKR 298

Query: 300 VVDMKWSSFPIFK 312
           VV+  WS F IF+
Sbjct: 299 VVNFDWSPFKIFE 311

>KNAG0C04910 Chr3 complement(949367..950308) [942 bp, 313 aa] {ON}
           Anc_5.434 YOR120W
          Length = 313

 Score =  419 bits (1076), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 194/312 (62%), Positives = 251/312 (80%), Gaps = 1/312 (0%)

Query: 1   MPATLKNSSASLKLNTGASIPVLGFGTWRSVE-NNGYHSVIAALKAGYRHIDAAAIYLNE 59
           M ATL  +++ LKLNTGA+I  +G GTWRS    + Y SVIAAL+AGYRHID AAIY NE
Sbjct: 1   MSATLSKNTSLLKLNTGATIRAIGLGTWRSAAATDAYDSVIAALRAGYRHIDTAAIYGNE 60

Query: 60  EEVGRAIKDSGVPREDIFITTKLWGTEQRDPEAALNESLKRLGLDYVDLYLMHWPVPLKT 119
            EVGRAI++SGVPR +IF+TTKLW T+ ++PE AL++SLKRLGLDYVDLYLMHWPV ++ 
Sbjct: 61  AEVGRAIRESGVPRGEIFVTTKLWCTQHKEPELALDQSLKRLGLDYVDLYLMHWPVRMRG 120

Query: 120 ETITDGNVLCIPTLDDGTVDVDTREWNFIKTWDLMQELPKTGKTKAVGVSNFSINNIKAL 179
           E + +G+ +  PTL +G  D+D  +WNF+KTW+LMQ+LP+TGKT+A+GVSNFSINN+K L
Sbjct: 121 ENMPEGDKIGFPTLPNGKRDIDITDWNFVKTWELMQKLPETGKTRAIGVSNFSINNLKDL 180

Query: 180 LESPSNKLVPAANQIEIHPLLPQNELIAFCKEKGIVVEAYSPFGSVNAPLLEEQAIIDMA 239
           L SP NK+VPAANQ+E+HPLLPQ EL+ FC  KGIV+EAYSP GS +AP+L+E  II++A
Sbjct: 181 LASPGNKIVPAANQVEMHPLLPQQELVDFCHGKGIVIEAYSPLGSADAPILKEPVIIEIA 240

Query: 240 KKHGVAPAQLIISWSIQRGYVVLAKSVNPERIVSNFKIFTLPEDDFKIISNLSKVHGEKR 299
           KK+GV+ AQ++ISW++QRGY+VL KSVN ERI +N   FTL  +DF+ ++N+SKV G KR
Sbjct: 241 KKNGVSAAQVVISWNVQRGYIVLPKSVNKERIEANLLTFTLTSEDFEAVNNISKVQGTKR 300

Query: 300 VVDMKWSSFPIF 311
           ++D  W  F  F
Sbjct: 301 IIDPDWEPFKPF 312

>NCAS0H02060 Chr8 (400615..401583) [969 bp, 322 aa] {ON} Anc_5.434
          Length = 322

 Score =  417 bits (1072), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 195/306 (63%), Positives = 240/306 (78%), Gaps = 1/306 (0%)

Query: 7   NSSASLKLNTGASIPVLGFGTWRSV-ENNGYHSVIAALKAGYRHIDAAAIYLNEEEVGRA 65
           NS+ + KLNTGA+I  +G GTW+S  EN GY +VIAALKAGYRHID AAIY NE +VG+A
Sbjct: 16  NSTTTFKLNTGATISAVGLGTWQSTNENEGYEAVIAALKAGYRHIDTAAIYGNEGQVGKA 75

Query: 66  IKDSGVPREDIFITTKLWGTEQRDPEAALNESLKRLGLDYVDLYLMHWPVPLKTETITDG 125
           I DSGVPRE+IF+TTKLW T+  DP A LN+SLKRLGLDYVDLYLMHWPV L   +I DG
Sbjct: 76  INDSGVPREEIFVTTKLWSTQHHDPAAGLNDSLKRLGLDYVDLYLMHWPVTLNPRSIKDG 135

Query: 126 NVLCIPTLDDGTVDVDTREWNFIKTWDLMQELPKTGKTKAVGVSNFSINNIKALLESPSN 185
           N L IP L DG  DV+   W+++KTW+LMQELPKTGKT+AVGVSNFSINN+K +L SP N
Sbjct: 136 NFLSIPLLPDGKRDVEIDTWDYVKTWELMQELPKTGKTRAVGVSNFSINNLKKVLSSPGN 195

Query: 186 KLVPAANQIEIHPLLPQNELIAFCKEKGIVVEAYSPFGSVNAPLLEEQAIIDMAKKHGVA 245
           K+VPA NQ+EIHPLLPQ EL+ +C  KGI++EAYSP GS NAP+L E  +I++AKKHGV 
Sbjct: 196 KVVPAVNQVEIHPLLPQEELLEWCHSKGILLEAYSPLGSTNAPILTEPVLINLAKKHGVQ 255

Query: 246 PAQLIISWSIQRGYVVLAKSVNPERIVSNFKIFTLPEDDFKIISNLSKVHGEKRVVDMKW 305
            AQ++ISW +QRGY+VL KSV+ ERI +NFK   L +++ + I+N+SK  GE+R+V   W
Sbjct: 256 TAQIVISWHVQRGYIVLPKSVHAERIQANFKTLKLSDEEMREINNISKEKGERRIVQPHW 315

Query: 306 SSFPIF 311
             F  F
Sbjct: 316 EPFVPF 321

>TDEL0E01910 Chr5 complement(361621..362556) [936 bp, 311 aa] {ON}
           Anc_5.434 YOR120W
          Length = 311

 Score =  407 bits (1046), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 192/312 (61%), Positives = 240/312 (76%), Gaps = 1/312 (0%)

Query: 1   MPATLKNSSASLKLNTGASIPVLGFGTWRSVENNGYHSVIAALKAGYRHIDAAAIYLNEE 60
           M ATL N+++++KLNTG +IP +G GTWRS E +GY +V AALKAGYRHID AAIYLNEE
Sbjct: 1   MSATLSNNTSTVKLNTGYTIPQVGLGTWRSKEGDGYKAVTAALKAGYRHIDGAAIYLNEE 60

Query: 61  EVGRAIKDSGVPREDIFITTKLWGTEQRDPEAALNESLKRLGLDYVDLYLMHWPVPLKTE 120
           EVG+AI+DSG+PRE++FITTKLW T+QR+P+ AL +SL+RLGL+YVDLYLMHWPVPLKT+
Sbjct: 61  EVGKAIRDSGIPREELFITTKLWNTQQRNPQEALEQSLERLGLEYVDLYLMHWPVPLKTK 120

Query: 121 TITDGNVLCIPTLDDGTVDVDTREWNFIKTWDLMQELPKTGKTKAVGVSNFSINNIKALL 180
            ITDGN+L  P  +DG  DVDT EW+F+KTW+LMQELPKT K ++VGVSNFSINN+K LL
Sbjct: 121 RITDGNLLSSPAKEDGKPDVDT-EWDFVKTWELMQELPKTKKARSVGVSNFSINNLKELL 179

Query: 181 ESPSNKLVPAANQIEIHPLLPQNELIAFCKEKGIVVEAYSPFGSVNAPLLEEQAIIDMAK 240
            SP NKLVPA  Q+EIHPLLPQ  L  FCKE  I VEAYSP G   AP+L++  I  +A 
Sbjct: 180 ASPGNKLVPAVLQVEIHPLLPQYALCDFCKEHNIQVEAYSPLGGHGAPVLDDPIIKQIAD 239

Query: 241 KHGVAPAQLIISWSIQRGYVVLAKSVNPERIVSNFKIFTLPEDDFKIISNLSKVHGEKRV 300
           +H      +++SW +QRG V L KS  PER+VSN + F L +++   I+NLSK  G+KR 
Sbjct: 240 RHNADAGNVVVSWGVQRGIVTLPKSTTPERVVSNLRTFKLSDEEMGSINNLSKSRGQKRT 299

Query: 301 VDMKWSSFPIFK 312
                S FP+F+
Sbjct: 300 NAPDMSPFPLFE 311

>TBLA0A06510 Chr1 complement(1597737..1598675) [939 bp, 312 aa] {ON}
           Anc_5.434 YOR120W
          Length = 312

 Score =  406 bits (1044), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 195/312 (62%), Positives = 239/312 (76%)

Query: 1   MPATLKNSSASLKLNTGASIPVLGFGTWRSVENNGYHSVIAALKAGYRHIDAAAIYLNEE 60
           MPA LKNS   + LN G  IP +G GTW+S EN+GY+SVI ALKAGYRHID AAIY NE 
Sbjct: 1   MPAQLKNSDTYVTLNNGEKIPSVGLGTWKSQENDGYNSVIYALKAGYRHIDTAAIYRNEG 60

Query: 61  EVGRAIKDSGVPREDIFITTKLWGTEQRDPEAALNESLKRLGLDYVDLYLMHWPVPLKTE 120
           EVGRAIKDSGVPR+ IFITTKLW TE ++P+ AL  SLKRLGLDYVDLYLMHWPV L   
Sbjct: 61  EVGRAIKDSGVPRDQIFITTKLWCTEFQNPKRALESSLKRLGLDYVDLYLMHWPVVLNPR 120

Query: 121 TITDGNVLCIPTLDDGTVDVDTREWNFIKTWDLMQELPKTGKTKAVGVSNFSINNIKALL 180
            I D + L +P L DGT DVD   W++IKTW+L+QELP TG T++VGVSNFSINN++ +L
Sbjct: 121 YIKDDDYLVVPRLPDGTRDVDMETWDYIKTWELVQELPATGLTRSVGVSNFSINNLEKVL 180

Query: 181 ESPSNKLVPAANQIEIHPLLPQNELIAFCKEKGIVVEAYSPFGSVNAPLLEEQAIIDMAK 240
            SP NKL PA NQ+E+HPLLPQ EL  +C  K I +EAYSPFGS NAP L+++ I+D+A 
Sbjct: 181 SSPGNKLTPAVNQVELHPLLPQFELQKYCDSKKIKLEAYSPFGSDNAPNLKQKTIVDIAA 240

Query: 241 KHGVAPAQLIISWSIQRGYVVLAKSVNPERIVSNFKIFTLPEDDFKIISNLSKVHGEKRV 300
           K+GV+PAQ+I SW +QR  VVL KSV+ ER++SNFK+F L ++D   I  L+KV+GEKR+
Sbjct: 241 KNGVSPAQVITSWIVQRDIVVLPKSVHEERVISNFKVFDLSKEDIAEIDALAKVNGEKRI 300

Query: 301 VDMKWSSFPIFK 312
               W  FP+F+
Sbjct: 301 NKPDWDPFPVFE 312

>NCAS0F03380 Chr6 (682072..683013) [942 bp, 313 aa] {ON} Anc_5.434
          Length = 313

 Score =  399 bits (1026), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 199/313 (63%), Positives = 250/313 (79%), Gaps = 1/313 (0%)

Query: 1   MPATLKNSSASLKLNTGASIPVLGFGTWRSV-ENNGYHSVIAALKAGYRHIDAAAIYLNE 59
           M  TLK S+A+LKLNTGA+IP +  GTWRS+   +GY SVIAALKAGYRHID AAIY NE
Sbjct: 1   MTVTLKASTATLKLNTGANIPEISLGTWRSLGATDGYDSVIAALKAGYRHIDTAAIYGNE 60

Query: 60  EEVGRAIKDSGVPREDIFITTKLWGTEQRDPEAALNESLKRLGLDYVDLYLMHWPVPLKT 119
           ++VG+AI+DSG+PRE+IF+T+KLW T+Q +P  AL ++L RLGLDY+DLYLMHWPV   T
Sbjct: 61  DQVGKAIRDSGIPREEIFVTSKLWNTQQHNPAGALKDTLSRLGLDYLDLYLMHWPVTFNT 120

Query: 120 ETITDGNVLCIPTLDDGTVDVDTREWNFIKTWDLMQELPKTGKTKAVGVSNFSINNIKAL 179
             +   + + IP  ++G  D++   WNF+KTW+LMQELP TG TKAVGVSNFSINN+K L
Sbjct: 121 RNVKGTDFMVIPKNENGKPDIEMDTWNFVKTWELMQELPATGMTKAVGVSNFSINNLKEL 180

Query: 180 LESPSNKLVPAANQIEIHPLLPQNELIAFCKEKGIVVEAYSPFGSVNAPLLEEQAIIDMA 239
           L SP NKL PAANQIEIHPLLP+++LI FC+EKGI++EAYSP GS+NAP+L+E  II+++
Sbjct: 181 LTSPGNKLTPAANQIEIHPLLPEHDLIKFCREKGIMIEAYSPLGSINAPILKEPKIIEIS 240

Query: 240 KKHGVAPAQLIISWSIQRGYVVLAKSVNPERIVSNFKIFTLPEDDFKIISNLSKVHGEKR 299
           KK  V PAQLIISW +QRGYVVL KS + ERI++N K+FTL ++DF+ I NL+K  G  R
Sbjct: 241 KKLDVPPAQLIISWHVQRGYVVLVKSTHEERIIANRKVFTLSKEDFEAIKNLAKEKGTLR 300

Query: 300 VVDMKWSSFPIFK 312
           VVD  WS FP+FK
Sbjct: 301 VVDPDWSPFPLFK 313

>Kwal_47.18084 s47 complement(677816..678745) [930 bp, 309 aa] {ON}
           YOR120W (GCY1) - Similar to mammalian aldo/keto
           reductases [contig 198] FULL
          Length = 309

 Score =  399 bits (1025), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 189/309 (61%), Positives = 244/309 (78%), Gaps = 2/309 (0%)

Query: 1   MPATLKNSSASLKLNTGASIPVLGFGTWRSVENNGYHSVIAALKAGYRHIDAAAIYLNEE 60
           MPA LKN++   KLNTGA+IP+LGFGTWRS E  GY++V++A+K GYRHID+AA+Y NE 
Sbjct: 1   MPA-LKNNTDIGKLNTGATIPLLGFGTWRSTEEEGYNAVLSAIKDGYRHIDSAAVYGNEA 59

Query: 61  EVGRAIKDSGVPREDIFITTKLWGTEQRDPEAALNESLKRLGLDYVDLYLMHWPVPLKTE 120
            VGRAI+DSGVPRE++F+TTKLW T+QR+P  AL++SL+RLGLDYVDLYL+HWP+P+KT+
Sbjct: 60  AVGRAIRDSGVPREELFVTTKLWNTQQREPAKALDQSLQRLGLDYVDLYLIHWPLPIKTD 119

Query: 121 TITDGNVLCIPTLDDGTVDVDTREWNFIKTWDLMQELPKTGKTKAVGVSNFSINNIKALL 180
            ITDGN+  IPT +DG  DVDT EW++IKTW LMQELP TGKT+AVGVSN S++ ++ LL
Sbjct: 120 RITDGNLFSIPTKEDGKPDVDT-EWDYIKTWQLMQELPSTGKTRAVGVSNVSVSQLEKLL 178

Query: 181 ESPSNKLVPAANQIEIHPLLPQNELIAFCKEKGIVVEAYSPFGSVNAPLLEEQAIIDMAK 240
               NK+VPA  Q+E HPLLPQN+L+ FC +  I++EAYSP GS  +PL++E  I ++AK
Sbjct: 179 ADKGNKVVPAVCQVETHPLLPQNKLLDFCTKHDILLEAYSPLGSQGSPLIDEPVIKEIAK 238

Query: 241 KHGVAPAQLIISWSIQRGYVVLAKSVNPERIVSNFKIFTLPEDDFKIISNLSKVHGEKRV 300
           K+   PAQ+IISW I+RGYVVL KSV P RI SN +   L ++DF+ I+ L    GEKRV
Sbjct: 239 KYNADPAQIIISWDIKRGYVVLPKSVTPSRIKSNLQTLDLEDEDFEKINKLHVEKGEKRV 298

Query: 301 VDMKWSSFP 309
            D +W +FP
Sbjct: 299 NDPEWFTFP 307

>KLLA0B14707g Chr2 complement(1291951..1292883) [933 bp, 310 aa]
           {ON} similar to uniprot|Q12458 Saccharomyces cerevisiae
           YDR368W YPR1 2-methylbutyraldehyde reductase may be
           involved in isoleucine catabolism
          Length = 310

 Score =  399 bits (1025), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 189/306 (61%), Positives = 236/306 (77%)

Query: 7   NSSASLKLNTGASIPVLGFGTWRSVENNGYHSVIAALKAGYRHIDAAAIYLNEEEVGRAI 66
           N S SLKLNTGASIPV+G GTW+S E + Y++V++AL+ GYRHID AAIY NEE VG+ I
Sbjct: 5   NESPSLKLNTGASIPVVGLGTWKSPEEDAYNAVVSALQNGYRHIDTAAIYGNEEAVGKGI 64

Query: 67  KDSGVPREDIFITTKLWGTEQRDPEAALNESLKRLGLDYVDLYLMHWPVPLKTETITDGN 126
           +DSGVPRE+IF+TTKLWGT+QRDPEAAL+ SL+RLGLDYVDLYL+HWPVPL   +ITDGN
Sbjct: 65  RDSGVPREEIFVTTKLWGTQQRDPEAALDLSLQRLGLDYVDLYLIHWPVPLNASSITDGN 124

Query: 127 VLCIPTLDDGTVDVDTREWNFIKTWDLMQELPKTGKTKAVGVSNFSINNIKALLESPSNK 186
            L  P   DG +D+D  EWNFIKTW+ MQ LPK+GKTKA+GVSNFSI NI+ALL +  + 
Sbjct: 125 YLTFPRTADGKIDIDIEEWNFIKTWEKMQHLPKSGKTKAIGVSNFSIKNIEALLAANPDF 184

Query: 187 LVPAANQIEIHPLLPQNELIAFCKEKGIVVEAYSPFGSVNAPLLEEQAIIDMAKKHGVAP 246
           +VPAANQIEIHP LPQ ELI +CK KGI++EAYSP GS ++ +L +  I  +A K+   P
Sbjct: 185 IVPAANQIEIHPQLPQTELIDYCKSKGILIEAYSPLGSSSSTILTDPTIEGIASKYNAEP 244

Query: 247 AQLIISWSIQRGYVVLAKSVNPERIVSNFKIFTLPEDDFKIISNLSKVHGEKRVVDMKWS 306
           A ++ISW   RGYVVL KSVNP+RI +N K+  L  +D + I+ L++  G KR V   +S
Sbjct: 245 ANILISWGASRGYVVLPKSVNPQRIKTNLKLLDLSTEDLEKINKLTESVGAKRYVAPDFS 304

Query: 307 SFPIFK 312
            F IF+
Sbjct: 305 PFAIFE 310

>Kpol_1062.29 s1062 complement(63895..64830) [936 bp, 311 aa] {ON}
           complement(63895..64830) [936 nt, 312 aa]
          Length = 311

 Score =  399 bits (1024), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 190/309 (61%), Positives = 231/309 (74%), Gaps = 1/309 (0%)

Query: 4   TLKNSSASLKLNTGASIPVLGFGTWRSVENNGYHSVIAALKAGYRHIDAAAIYLNEEEVG 63
           +LKN    +KLNTGA +P +G GTW+S+EN+ Y +V+ ALK GYRHID AAIY NE EVG
Sbjct: 2   SLKNCETRVKLNTGAELPAVGLGTWQSLENDAYKAVLTALKTGYRHIDGAAIYCNEGEVG 61

Query: 64  RAIKDSGVPREDIFITTKLWGTEQRDPEAALNESLKRLGLDYVDLYLMHWPVPLKTETIT 123
           +AI+DSGVPR +IF+TTKLWGT+QR P+ AL +SL+RLGLDYVDLYL+HWP+PL      
Sbjct: 62  KAIRDSGVPRNEIFVTTKLWGTQQRTPQLALEQSLERLGLDYVDLYLIHWPIPLNPAQCE 121

Query: 124 D-GNVLCIPTLDDGTVDVDTREWNFIKTWDLMQELPKTGKTKAVGVSNFSINNIKALLES 182
           + GN L  P L +G  DVD   WNF+KTW+LMQELP TGK KAVGVSNFSINNIK LL S
Sbjct: 122 ESGNYLTFPGLPNGKRDVDLDTWNFVKTWELMQELPATGKCKAVGVSNFSINNIKELLSS 181

Query: 183 PSNKLVPAANQIEIHPLLPQNELIAFCKEKGIVVEAYSPFGSVNAPLLEEQAIIDMAKKH 242
           P NKLVPA NQIE+HPLLPQ EL+ FCKEKGIVVEAYSP G   A +L+E  + ++AKK+
Sbjct: 182 PGNKLVPAVNQIELHPLLPQVELVNFCKEKGIVVEAYSPLGGTGAAILKEPLVEELAKKY 241

Query: 243 GVAPAQLIISWSIQRGYVVLAKSVNPERIVSNFKIFTLPEDDFKIISNLSKVHGEKRVVD 302
            +  A L++SW +QRG VVL KSV   RI+SN +  TL  +D + I+NLSK  GEKR   
Sbjct: 242 NIPAANLVVSWDVQRGVVVLPKSVTESRIISNLQTLTLAPEDVEKITNLSKEKGEKRTCA 301

Query: 303 MKWSSFPIF 311
             +S F  F
Sbjct: 302 PDFSPFNTF 310

>ZYRO0F10032g Chr6 (813814..814746) [933 bp, 310 aa] {ON}
           uniprot|Q9HGX9 Zygosaccharomyces rouxii ZGCY2 Glycerol
           dehydrogenase
          Length = 310

 Score =  398 bits (1022), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 185/309 (59%), Positives = 238/309 (77%), Gaps = 1/309 (0%)

Query: 4   TLKNSSASLKLNTGASIPVLGFGTWRSVENNGYHSVIAALKAGYRHIDAAAIYLNEEEVG 63
           TL+NS+++LKLNTG +IP +G GTWRS EN GY +VI ALKAGYRHID AA+Y NE EVG
Sbjct: 3   TLQNSTSTLKLNTGQTIPQVGLGTWRSKENEGYKAVIEALKAGYRHIDGAAVYGNEGEVG 62

Query: 64  RAIKDSGVPREDIFITTKLWGTEQRDPEAALNESLKRLGLDYVDLYLMHWPVPLKTETIT 123
           +AI+DSGVPR +IF+TTKLW T+QR+P+ AL++SL+RLGLDYVDLYL+HWPVPL+TE I 
Sbjct: 63  KAIQDSGVPRNEIFLTTKLWCTQQRNPQEALDQSLQRLGLDYVDLYLIHWPVPLRTENIK 122

Query: 124 DGNVLCIPTLDDGTVDVDTREWNFIKTWDLMQELPKTGKTKAVGVSNFSINNIKALLESP 183
           DGN+       DG+ DVD  EWNFIKTW+LMQ+L ++GKTKA+GVSNFS+NN+K LL +P
Sbjct: 123 DGNLFQFAEKPDGSKDVDL-EWNFIKTWELMQKLLESGKTKAIGVSNFSVNNLKDLLAAP 181

Query: 184 SNKLVPAANQIEIHPLLPQNELIAFCKEKGIVVEAYSPFGSVNAPLLEEQAIIDMAKKHG 243
           + K+ PA NQ+E+HPLLPQ +LI F KE GIV+EAYSP G  NAP+L +  + ++AK +G
Sbjct: 182 TTKVTPAVNQVELHPLLPQEDLIKFGKENGIVIEAYSPLGGENAPILSDPTVQEIAKANG 241

Query: 244 VAPAQLIISWSIQRGYVVLAKSVNPERIVSNFKIFTLPEDDFKIISNLSKVHGEKRVVDM 303
           V    ++ISW++Q+G V L KSV P RIV N K+ TL + D   +  L K  GE+R    
Sbjct: 242 VEAGHVVISWAVQKGLVTLPKSVTPSRIVGNLKVLTLSDSDVAKVDGLLKAKGERRTCYQ 301

Query: 304 KWSSFPIFK 312
            +S FPIF+
Sbjct: 302 DFSPFPIFQ 310

>KLTH0E15532g Chr5 complement(1380466..1381395) [930 bp, 309 aa]
           {ON} similar to uniprot|Q12458 Saccharomyces cerevisiae
           YDR368W YPR1 2-methylbutyraldehyde reductase may be
           involved in isoleucine catabolism
          Length = 309

 Score =  397 bits (1021), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 181/302 (59%), Positives = 235/302 (77%), Gaps = 1/302 (0%)

Query: 7   NSSASLKLNTGASIPVLGFGTWRSVENNGYHSVIAALKAGYRHIDAAAIYLNEEEVGRAI 66
           NSSA  KL TGA+IP+LGFGTWRS E +GY++V+ ALK GYRHID AA+Y NE  VGRAI
Sbjct: 6   NSSAVGKLRTGATIPLLGFGTWRSTEEDGYNAVLTALKVGYRHIDTAAVYGNEAAVGRAI 65

Query: 67  KDSGVPREDIFITTKLWGTEQRDPEAALNESLKRLGLDYVDLYLMHWPVPLKTETITDGN 126
           +DSGVPR+ +F+TTKLW T+ RDP  AL++SL+RLGLDYVDLYL+HWP+PL+T+ ITDGN
Sbjct: 66  RDSGVPRDQLFVTTKLWNTQHRDPRLALDQSLQRLGLDYVDLYLIHWPLPLRTQRITDGN 125

Query: 127 VLCIPTLDDGTVDVDTREWNFIKTWDLMQELPKTGKTKAVGVSNFSINNIKALLESPSNK 186
           +  +PT +DG  DVD  +W+++KTW++MQ+LP T KT+AVGVSNFS+  ++ LL +   K
Sbjct: 126 LFTVPTKEDGKPDVD-EQWSYVKTWEMMQDLPDTSKTRAVGVSNFSVTQLQNLLAASGTK 184

Query: 187 LVPAANQIEIHPLLPQNELIAFCKEKGIVVEAYSPFGSVNAPLLEEQAIIDMAKKHGVAP 246
           ++PA NQ+E HPLLPQ++L  FC E  I++EAYSP GS  +PL+EE A+ ++A KH   P
Sbjct: 185 VIPAVNQVETHPLLPQDKLYKFCSENNILLEAYSPLGSQGSPLVEEPAVKEIASKHNADP 244

Query: 247 AQLIISWSIQRGYVVLAKSVNPERIVSNFKIFTLPEDDFKIISNLSKVHGEKRVVDMKWS 306
           AQ++ISW I+RGYV+L KSV P RI SNFKI  L +DDF  I+N+ K  GEKR+ D  W 
Sbjct: 245 AQVLISWGIKRGYVILPKSVTPSRIESNFKIVDLTDDDFAKINNIHKEKGEKRINDPDWF 304

Query: 307 SF 308
            F
Sbjct: 305 HF 306

>NDAI0B05670 Chr2 (1383187..1384143) [957 bp, 318 aa] {ON} Anc_5.434
          Length = 318

 Score =  397 bits (1021), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 193/308 (62%), Positives = 242/308 (78%), Gaps = 7/308 (2%)

Query: 12  LKLNTGASIPVLGFGTWRSV-ENNGYHSVIAALKAGYRHIDAAAIYLNEEEVGRAIKDSG 70
           LKL+TGASIP +G GTWRSV  N+ YHSVIAALK GYRHID AAIY NE +VG+AI+DSG
Sbjct: 11  LKLSTGASIPQIGLGTWRSVGTNDAYHSVIAALKNGYRHIDTAAIYGNEAQVGKAIRDSG 70

Query: 71  VPREDIFITTKLWGTEQRDPEAALNESLKRLGLDYVDLYLMHWPVPLKTETITDGN---- 126
           VPR +IF+T+KLW  +  DP+ ALN++LKRLGLDY+DLYLMHWPV     +I D +    
Sbjct: 71  VPRNEIFVTSKLWCAQTHDPKLALNQTLKRLGLDYIDLYLMHWPVTFNPRSIKDEDGSGD 130

Query: 127 -VLCIPTLDDGTVDVDTREWNFIKTWDLMQELPKTGKTKAVGVSNFSINNIKALLESPSN 185
             + IPT  +G VDV+   WNFIKTW+LMQ LP++GKTKAVGVSNFSINN+  LL + + 
Sbjct: 131 AFMTIPTDSNGNVDVEMDTWNFIKTWELMQHLPESGKTKAVGVSNFSINNLNDLLAASTT 190

Query: 186 KLVPAANQIEIHPLLPQNELIAFCKEKGIVVEAYSPFGSVNAPLLEEQAIIDMAKKHGVA 245
           K+VPAANQIE+HPLL QNEL+ +CKEK I+VEAYSPFGS+NAP+L+++ I  +AKK  + 
Sbjct: 191 KVVPAANQIELHPLLAQNELLQYCKEKNILVEAYSPFGSINAPILKDETINAIAKKLDIQ 250

Query: 246 PAQLIISWSIQR-GYVVLAKSVNPERIVSNFKIFTLPEDDFKIISNLSKVHGEKRVVDMK 304
             Q+++SW IQR GYVVL KSV+ ERI++N K+ TLP++DF+ I+NL K  GE RVVD  
Sbjct: 251 VGQVVMSWHIQRGGYVVLPKSVHEERIIANRKVVTLPDEDFQAINNLVKEKGELRVVDPD 310

Query: 305 WSSFPIFK 312
           WS FP+FK
Sbjct: 311 WSPFPLFK 318

>TPHA0G00210 Chr7 (31978..32913) [936 bp, 311 aa] {ON} 
          Length = 311

 Score =  393 bits (1009), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 184/312 (58%), Positives = 232/312 (74%), Gaps = 1/312 (0%)

Query: 1   MPATLKNSSASLKLNTGASIPVLGFGTWRSVENNGYHSVIAALKAGYRHIDAAAIYLNEE 60
           M  T KN   +  +     IP +  GTW++  N  Y +V+ ALKAGYRHID AAIY NEE
Sbjct: 1   MSVTAKNCDITYAIGKDTKIPAVALGTWKAAPNEVYTAVLEALKAGYRHIDGAAIYCNEE 60

Query: 61  EVGRAIKDSGVPREDIFITTKLWGTEQRDPEAALNESLKRLGLDYVDLYLMHWPVPLKTE 120
           EVG+AI+DSG+PR+DIF+TTKLWGTEQR+P  AL+ SLKRLGLDYVDLYLMHWPV LK +
Sbjct: 61  EVGKAIRDSGIPRKDIFVTTKLWGTEQRNPLRALDSSLKRLGLDYVDLYLMHWPVALKAD 120

Query: 121 TITDGNVLCIPTLDDGTVDVDTREWNFIKTWDLMQELPKTGKTKAVGVSNFSINNIKALL 180
           +ITD ++L IP L  G  D+D   WNFIKTW+LMQELP T K KA+GVSNFSINN+  LL
Sbjct: 121 SITDNDLLTIPKLPSGKTDIDIENWNFIKTWELMQELP-TSKAKAIGVSNFSINNLNELL 179

Query: 181 ESPSNKLVPAANQIEIHPLLPQNELIAFCKEKGIVVEAYSPFGSVNAPLLEEQAIIDMAK 240
            +P+ K +PAANQ EIHPLLPQNELI +C++K I+VEAY P G  N PL+    I ++A 
Sbjct: 180 AAPTTKTIPAANQFEIHPLLPQNELIKYCQDKKIIVEAYCPLGGSNVPLVTNPVITEIAT 239

Query: 241 KHGVAPAQLIISWSIQRGYVVLAKSVNPERIVSNFKIFTLPEDDFKIISNLSKVHGEKRV 300
           K GV   QL+ISW IQRGYVVL KSV  ERIV+NF+  T+P ++F+ ++NL+K  G +R 
Sbjct: 240 KLGVNAGQLLISWGIQRGYVVLPKSVRKERIVTNFQTITIPAEEFEKMNNLTKEFGVQRS 299

Query: 301 VDMKWSSFPIFK 312
           V++ +S FP ++
Sbjct: 300 VNIDFSPFPTYQ 311

>KLTH0E00220g Chr5 complement(12415..13335) [921 bp, 306 aa] {ON}
           similar to uniprot|P14065 Saccharomyces cerevisiae
           YOR120W GCY1 Putative NADP( ) coupled glycerol
           dehydrogenase proposed to be involved in an alternative
           pathway for glycerol catabolism
          Length = 306

 Score =  388 bits (996), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 181/305 (59%), Positives = 232/305 (76%)

Query: 8   SSASLKLNTGASIPVLGFGTWRSVENNGYHSVIAALKAGYRHIDAAAIYLNEEEVGRAIK 67
           ++  L++NTG  IPVLG GTW++ + + Y +V+AAL++GYRHID AAIY NE  VGRAI+
Sbjct: 2   ATLELQMNTGKPIPVLGLGTWKAADGDTYRAVLAALESGYRHIDTAAIYRNEAAVGRAIR 61

Query: 68  DSGVPREDIFITTKLWGTEQRDPEAALNESLKRLGLDYVDLYLMHWPVPLKTETITDGNV 127
           DSGVPRE IF+TTKLW T+QRDP++ALN SL+RLGLDYVDLYLMH+PV LKT+ I DGNV
Sbjct: 62  DSGVPREKIFVTTKLWCTQQRDPQSALNASLERLGLDYVDLYLMHFPVALKTDLIKDGNV 121

Query: 128 LCIPTLDDGTVDVDTREWNFIKTWDLMQELPKTGKTKAVGVSNFSINNIKALLESPSNKL 187
           L IP   DG  DVD   W+F+KTW LMQ+LPK+GKTKA+GVSNFSI NI+ +L+      
Sbjct: 122 LSIPVRADGARDVDIDGWSFVKTWQLMQDLPKSGKTKAIGVSNFSIKNIEEILKPELGLS 181

Query: 188 VPAANQIEIHPLLPQNELIAFCKEKGIVVEAYSPFGSVNAPLLEEQAIIDMAKKHGVAPA 247
           VPAANQIEIHP LPQ+ELI +CK KGI+VEAYSP GS  + +L +  +I +A+KH V PA
Sbjct: 182 VPAANQIEIHPQLPQDELIEYCKSKGIIVEAYSPLGSSESSMLTDPDLIKLAEKHQVEPA 241

Query: 248 QLIISWSIQRGYVVLAKSVNPERIVSNFKIFTLPEDDFKIISNLSKVHGEKRVVDMKWSS 307
           Q++ISW + RGY +L KSVN +R+ SN KI  L  +D + IS + +  G KR V   W+ 
Sbjct: 242 QILISWGVTRGYCILPKSVNSKRVQSNLKIVKLSSNDVQQISKILEKLGSKRYVSPSWAP 301

Query: 308 FPIFK 312
           FP+++
Sbjct: 302 FPMYE 306

>KLTH0A00528g Chr1 complement(46253..47173) [921 bp, 306 aa] {ON}
           similar to uniprot|P14065 Saccharomyces cerevisiae
           YOR120W GCY1 Putative NADP( ) coupled glycerol
           dehydrogenase proposed to be involved in an alternative
           pathway for glycerol catabolism
          Length = 306

 Score =  388 bits (996), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 181/305 (59%), Positives = 232/305 (76%)

Query: 8   SSASLKLNTGASIPVLGFGTWRSVENNGYHSVIAALKAGYRHIDAAAIYLNEEEVGRAIK 67
           ++  L++NTG  IPVLG GTW++ + + Y +V+AAL++GYRHID AAIY NE  VGRAI+
Sbjct: 2   ATLELQMNTGKPIPVLGLGTWKAADGDTYRAVLAALESGYRHIDTAAIYRNEAAVGRAIR 61

Query: 68  DSGVPREDIFITTKLWGTEQRDPEAALNESLKRLGLDYVDLYLMHWPVPLKTETITDGNV 127
           DSGVPRE IF+TTKLW T+QRDP++ALN SL+RLGLDYVDLYLMH+PV LKT+ I DGNV
Sbjct: 62  DSGVPREKIFVTTKLWCTQQRDPQSALNASLERLGLDYVDLYLMHFPVALKTDLIKDGNV 121

Query: 128 LCIPTLDDGTVDVDTREWNFIKTWDLMQELPKTGKTKAVGVSNFSINNIKALLESPSNKL 187
           L IP   DG  DVD   W+F+KTW LMQ+LPK+GKTKA+GVSNFSI NI+ +L+      
Sbjct: 122 LSIPVRADGARDVDIDGWSFVKTWQLMQDLPKSGKTKAIGVSNFSIKNIEEILKPELGLS 181

Query: 188 VPAANQIEIHPLLPQNELIAFCKEKGIVVEAYSPFGSVNAPLLEEQAIIDMAKKHGVAPA 247
           VPAANQIEIHP LPQ+ELI +CK KGI+VEAYSP GS  + +L +  +I +A+KH V PA
Sbjct: 182 VPAANQIEIHPQLPQDELIEYCKSKGIIVEAYSPLGSSESSMLTDPDLIKLAEKHQVEPA 241

Query: 248 QLIISWSIQRGYVVLAKSVNPERIVSNFKIFTLPEDDFKIISNLSKVHGEKRVVDMKWSS 307
           Q++ISW + RGY +L KSVN +R+ SN KI  L  +D + IS + +  G KR V   W+ 
Sbjct: 242 QILISWGVTRGYCILPKSVNSKRVQSNLKIVKLSSNDVQQISKILEKLGSKRYVSPSWAP 301

Query: 308 FPIFK 312
           FP+++
Sbjct: 302 FPMYE 306

>KLTH0F16060g Chr6 complement(1304479..1305408) [930 bp, 309 aa]
           {ON} similar to uniprot|Q12458 Saccharomyces cerevisiae
           YDR368W YPR1 2-methylbutyraldehyde reductase may be
           involved in isoleucine catabolism
          Length = 309

 Score =  385 bits (990), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 173/308 (56%), Positives = 235/308 (76%), Gaps = 1/308 (0%)

Query: 1   MPATLKNSSASLKLNTGASIPVLGFGTWRSVENNGYHSVIAALKAGYRHIDAAAIYLNEE 60
           M   LK  +A+ KLNTGA IP+LG GTWRS + NGY++ +AA+KAGYRHID AA+ +NE+
Sbjct: 1   MTTVLKKCTATAKLNTGAQIPLLGLGTWRSTKENGYNATLAAIKAGYRHIDIAAVCMNEQ 60

Query: 61  EVGRAIKDSGVPREDIFITTKLWGTEQRDPEAALNESLKRLGLDYVDLYLMHWPVPLKTE 120
            VGRAI+DSGVPRE++F+TTKLW T+ RDP+ AL++SLKRLGLDYVDLY+MHWPV  ++E
Sbjct: 61  VVGRAIRDSGVPREELFVTTKLWCTQHRDPKTALSQSLKRLGLDYVDLYMMHWPVAFRSE 120

Query: 121 TITDGNVLCIPTLDDGTVDVDTREWNFIKTWDLMQELPKTGKTKAVGVSNFSINNIKALL 180
            +   N + IP   DG  DVD   W+++KTW+LMQELP TGKT A+GV+NFS++ +K L+
Sbjct: 121 QVKHTNYMLIPKRKDGQPDVD-EGWDYVKTWELMQELPATGKTNALGVANFSVSQLKKLI 179

Query: 181 ESPSNKLVPAANQIEIHPLLPQNELIAFCKEKGIVVEAYSPFGSVNAPLLEEQAIIDMAK 240
           +SP NK+VPAA+Q+E HP LPQN++++FCK+  I++EAYSP GS  APLL+E  + +++K
Sbjct: 180 DSPGNKIVPAASQLETHPFLPQNKMLSFCKKNNILMEAYSPLGSEGAPLLDEPVVREISK 239

Query: 241 KHGVAPAQLIISWSIQRGYVVLAKSVNPERIVSNFKIFTLPEDDFKIISNLSKVHGEKRV 300
           K  V PAQL++SW +QRG+ VL KS  P RI +N   F +PE D + I+ L++  G KR+
Sbjct: 240 KLHVEPAQLLVSWGLQRGHAVLVKSKTPSRIEANLHTFDIPEGDLRRINELAQERGTKRI 299

Query: 301 VDMKWSSF 308
            +  W SF
Sbjct: 300 HNPTWFSF 307

>TPHA0E01760 Chr5 complement(354862..355794) [933 bp, 310 aa] {ON}
           Anc_5.434 YOR120W
          Length = 310

 Score =  377 bits (968), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 186/309 (60%), Positives = 227/309 (73%), Gaps = 2/309 (0%)

Query: 4   TLKNSSASLKLNTGASIPVLGFGTWRSVENNGYHSVIAALKAGYRHIDAAAIYLNEEEVG 63
           TL NS+A + LN G  +P +G GTW+S EN+ Y +V+AALKAGYRHID AAIY NEEEVG
Sbjct: 2   TLSNSTAKVTLNDGNQLPYVGLGTWQSKENDAYKAVVAALKAGYRHIDTAAIYGNEEEVG 61

Query: 64  RAIKDSGVPREDIFITTKLWGTEQRDPEAALNESLKRLGLDYVDLYLMHWPVPLK-TETI 122
           RAIKDSGV R +IF+TTKLWGT+ R P+ ALN+SL+RLGLDYVDLYLMHWPVP+   +  
Sbjct: 62  RAIKDSGVRRSEIFVTTKLWGTQHRHPDDALNQSLERLGLDYVDLYLMHWPVPINDAQCK 121

Query: 123 TDGNVLCIPTLDDGTVDVDTREWNFIKTWDLMQELPKTGKTKAVGVSNFSINNIKALLES 182
            D N L IP  +DGT D+D   W+FIKTW+LMQ LPK+ K K++GVSNFSINNIK LL S
Sbjct: 122 KDNNYLQIPMNEDGTRDLDLASWDFIKTWELMQALPKS-KVKSIGVSNFSINNIKDLLAS 180

Query: 183 PSNKLVPAANQIEIHPLLPQNELIAFCKEKGIVVEAYSPFGSVNAPLLEEQAIIDMAKKH 242
           P NK VP  NQ+E+HPLLPQ EL+ FCK K IVVEAYSP GS  AP+LE   I +++KK 
Sbjct: 181 PGNKEVPVVNQVELHPLLPQFELVEFCKSKNIVVEAYSPLGSTGAPILELGTINEVSKKL 240

Query: 243 GVAPAQLIISWSIQRGYVVLAKSVNPERIVSNFKIFTLPEDDFKIISNLSKVHGEKRVVD 302
            + PA ++ SW IQR  VVL KSV   RI+SN +   LP ++F  ++N+S   GEKR V 
Sbjct: 241 AIPPANVVFSWLIQRKIVVLPKSVTESRIISNLQTMELPAEEFSKLNNISSEVGEKRSVK 300

Query: 303 MKWSSFPIF 311
             W+ F  F
Sbjct: 301 PNWTPFIPF 309

>TBLA0A02835 Chr1 complement(683118..684053) [936 bp, 311 aa] {ON}
          Length = 311

 Score =  372 bits (955), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 174/312 (55%), Positives = 236/312 (75%), Gaps = 1/312 (0%)

Query: 1   MPATLKNSSASLKLNTGASIPVLGFGTWRSVENNGYHSVIAALKAGYRHIDAAAIYLNEE 60
           M  TLKN + ++ LN G  IPV+G GT+ S +N  Y +V+ A KAGYRH+D AA Y NEE
Sbjct: 1   MAVTLKNCTETITLNNGTKIPVIGLGTYLSKQNEVYEAVVTAAKAGYRHVDTAAFYKNEE 60

Query: 61  EVGRAIKDSGVPREDIFITTKLWGTEQRDPEAALNESLKRLGLDYVDLYLMHWPVPLKTE 120
           +VG+A+KD GVPR ++++TTK+W TE RDPEAAL++SLKRLGL+Y+DLYLMHWPV LKT+
Sbjct: 61  QVGKAVKDCGVPRSEMYVTTKVWPTELRDPEAALDKSLKRLGLEYIDLYLMHWPVTLKTD 120

Query: 121 TITDGNVLCIPTLDDGTVDVDTREWNFIKTWDLMQELPKTGKTKAVGVSNFSINNIKALL 180
           TI DG ++CIP L DG  DVD ++W F++ W+ MQ+L K+GK K++GVSNFSINNIK LL
Sbjct: 121 TIKDGELMCIPRLPDGNADVD-KDWTFVQAWEAMQKLLKSGKVKSIGVSNFSINNIKELL 179

Query: 181 ESPSNKLVPAANQIEIHPLLPQNELIAFCKEKGIVVEAYSPFGSVNAPLLEEQAIIDMAK 240
            +P+  +VP  NQ+E+ PLLP +ELI FC+ K I+ +AY PFG   APL+++  ++++AK
Sbjct: 180 AAPTTTVVPVVNQVEVQPLLPNDELIEFCRSKDIITQAYCPFGGSEAPLIKDATVVEIAK 239

Query: 241 KHGVAPAQLIISWSIQRGYVVLAKSVNPERIVSNFKIFTLPEDDFKIISNLSKVHGEKRV 300
            +GV   Q+I SW +QRGYVVL KSV   RI+SN K FTL + D   ++N+SK  GEKR+
Sbjct: 240 GNGVDAGQVITSWHVQRGYVVLPKSVKESRIISNLKTFTLSDADMTKMNNISKTQGEKRL 299

Query: 301 VDMKWSSFPIFK 312
            ++ +S FPIF+
Sbjct: 300 NNVNFSPFPIFE 311

>KLTH0A03476g Chr1 complement(298735..299661) [927 bp, 308 aa] {ON}
           similar to uniprot|Q12458 Saccharomyces cerevisiae
           YDR368W YPR1 2-methylbutyraldehyde reductase may be
           involved in isoleucine catabolism
          Length = 308

 Score =  369 bits (948), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 176/303 (58%), Positives = 228/303 (75%), Gaps = 2/303 (0%)

Query: 6   KNSSASLKLNTGASIPVLGFGTWRSVENNGYHSVIAALKAGYRHIDAAAIYLNEEEVGRA 65
           K S++  KLNTGASIP++G GT+ S +  GY +V+ A+K GYRHID AA+Y NE+ VGRA
Sbjct: 5   KPSTSVGKLNTGASIPLVGLGTYLSEDETGYKAVLHAIKVGYRHIDCAALYKNEDFVGRA 64

Query: 66  IKDSGVPREDIFITTKLWGTEQRDPEAALNESLKRLGLDYVDLYLMHWPVPLKTETITDG 125
           I+DSGVPRE++F+TTK+W T+ R+P  AL ESL RLGLDYVDL+LMHWP  L+TE ITDG
Sbjct: 65  IRDSGVPREELFVTTKVWNTQHREPAKALEESLSRLGLDYVDLFLMHWPQALRTERITDG 124

Query: 126 NVLCIPTLDDGTVDVDTREWNFIKTWDLMQELPKTGKTKAVGVSNFSINNIKALLESPSN 185
           N++ +P  +D   DVDT EWN+IKTW LMQ+LP +GKTKAVGVSNFS+  ++ LL  P +
Sbjct: 125 NMITVPKREDEKPDVDT-EWNYIKTWHLMQDLPASGKTKAVGVSNFSVKQLEKLLADPGS 183

Query: 186 KLVPAANQIEIHPLLPQNELIAFCKEKGIVVEAYSPFGSVNAPLLEEQAIIDMAKKHGVA 245
           K+VPA NQ+E+HPLLPQ  L  FCK+K I++ AYSP GS  APLL++  I+++A KH   
Sbjct: 184 KVVPACNQVEVHPLLPQIPLYDFCKKKNIMLAAYSPLGSQKAPLLDDPVILEIAAKHKAD 243

Query: 246 PAQLIISWSIQRGYVVLAKSVNPERIVSNFKIFTLPEDDFKIISNLSKVHGEKRVVDMKW 305
           PAQ+II W ++RGYV L KSV P RI SN +I  L + + + I+ + K  GEKRVVD +W
Sbjct: 244 PAQIIIGWDVKRGYVALPKSVTPSRIESNLQIVNLTDSELEKINEIHK-KGEKRVVDPEW 302

Query: 306 SSF 308
             F
Sbjct: 303 FDF 305

>TDEL0D00230 Chr4 (37458..38396) [939 bp, 312 aa] {ON}  possible
           pseudogene; NNN added to avoid internal stop codon
          Length = 312

 Score =  369 bits (948), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 175/305 (57%), Positives = 227/305 (74%), Gaps = 1/305 (0%)

Query: 9   SASLKLNTGASIPVLGFGTWRSVENNGYHSVIAALKAGYRHIDAAAIYLNEEEVGRAIKD 68
           + S KLNTGA +P +G GTW+S E + Y +V++ALKAGY+HID AAIY NE  VG+AI+D
Sbjct: 8   TPSFKLNTGALLPAIGLGTWKSSEEDAYTAVLSALKAGYKHIDTAAIYRNERAVGKAIRD 67

Query: 69  SGVPREDIFITTKLWGTEQRDPEAALNESLKRLGLDYVDLYLMHWPVPLKTETITDGNVL 128
           SG+PR+++FITTKLW T+ RDP+AAL+ SL+RLGLDYVDLYL+H+PV  KT+ I DGN  
Sbjct: 68  SGIPRDELFITTKLWSTQHRDPKAALDGSLERLGLDYVDLYLIHYPVAFKTDRIEDGNPF 127

Query: 129 CIPTLDDGTVDVDTREWNFIKTWDLMQELPKTGKTKAVGVSNFSINNIKALLESPSNKLV 188
           C P L +G  DVD  +W+F+KTW L+Q LP++GK KAVGVSNFSINN+K LLES     V
Sbjct: 128 CFPLLPNGKRDVDIVDWDFVKTWRLVQHLPESGKCKAVGVSNFSINNLKTLLESDEKFAV 187

Query: 189 PAANQIEIHPLLPQNELIAFCKEKGIVVEAYSPFGSVNAPLLEEQAIIDMAKKHGVA-PA 247
           PA NQ+EIHP LPQ ELI FCK K IVVEAYSP GS  + +L +  +  +A+K   A PA
Sbjct: 188 PAVNQVEIHPQLPQTELIDFCKSKDIVVEAYSPLGSTGSQMLTDDTLQKIAEKXXDAQPA 247

Query: 248 QLIISWSIQRGYVVLAKSVNPERIVSNFKIFTLPEDDFKIISNLSKVHGEKRVVDMKWSS 307
           Q++I+W I RGY VL KSV P+RI +N +I  + ++D   ++NL  + G KR ++  WS 
Sbjct: 248 QILINWGISRGYCVLPKSVTPKRIEANARIIDIKKEDLLKVTNLIDILGPKRYLEPDWSP 307

Query: 308 FPIFK 312
           FPIF+
Sbjct: 308 FPIFE 312

>KAFR0E03840 Chr5 complement(763027..763959) [933 bp, 310 aa] {ON}
           Anc_5.434 YOR120W
          Length = 310

 Score =  358 bits (920), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 172/312 (55%), Positives = 231/312 (74%), Gaps = 4/312 (1%)

Query: 1   MPATLKNSSASLKLNTGASIPVLGFGTWRSV-ENNGYHSVIAALKAGYRHIDAAAIYLNE 59
           M A LKNS+ +LKLN G+ IP++G GTW++  E + Y++V AAL AGYRHID AAIY NE
Sbjct: 1   MSANLKNSTKTLKLNDGSQIPIVGLGTWQATDERDAYNAVRAALDAGYRHIDTAAIYKNE 60

Query: 60  EEVGRAIKDSGVPREDIFITTKLWGTEQRDPEAALNESLKRLGLDYVDLYLMHWPVPLKT 119
            +VG AI+DSGVPRE+IF+TTKLW  +  +PE AL+ESL+RLGLDYVDLYLMHWPV L  
Sbjct: 61  VQVGEAIRDSGVPREEIFVTTKLWNAQHHEPEVALDESLQRLGLDYVDLYLMHWPVSLDK 120

Query: 120 ETITDGNVLCIPTLDDGTVDVDTREWNFIKTWDLMQELPKTGKTKAVGVSNFSINNIKAL 179
             + +   L +    DGT  V+T +W FI TW+LMQ+LPK  K +++GVSNFS+NN+K L
Sbjct: 121 SYMKESP-LELMKRPDGTRPVET-DWTFINTWELMQKLPK-NKVRSIGVSNFSVNNLKDL 177

Query: 180 LESPSNKLVPAANQIEIHPLLPQNELIAFCKEKGIVVEAYSPFGSVNAPLLEEQAIIDMA 239
           L++P+  +VP  NQ+E+HPLLPQ EL+ +C++  I VEAYSP GS +APLL E  +ID+A
Sbjct: 178 LKAPTTNVVPTINQVELHPLLPQYELVDYCQQNKIEVEAYSPLGSTSAPLLSEPIVIDVA 237

Query: 240 KKHGVAPAQLIISWSIQRGYVVLAKSVNPERIVSNFKIFTLPEDDFKIISNLSKVHGEKR 299
           KK+GV PA +++SW +QR  +VL KSV+ ER+ +N K FTLPE+DF  I  +S+  GE+R
Sbjct: 238 KKNGVQPAHVVLSWIVQRNIIVLPKSVHAERVAANLKTFTLPEEDFDAIGKISQQRGERR 297

Query: 300 VVDMKWSSFPIF 311
           + +  +  F  F
Sbjct: 298 INNPNFEPFKTF 309

>KLLA0D10109g Chr4 (854495..855424) [930 bp, 309 aa] {ON} similar to
           uniprot|P14065 Saccharomyces cerevisiae YOR120W GCY1
           Putative NADP( ) coupled glycerol dehydrogenase proposed
           to be involved in an alternative pathway for glycerol
           catabolism
          Length = 309

 Score =  351 bits (901), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 176/302 (58%), Positives = 219/302 (72%), Gaps = 2/302 (0%)

Query: 11  SLKLNTGASIPVLGFGTWRSVENNGYHSVIAALKAGYRHIDAAAIYLNEEEVGRAIKDSG 70
           SLKLNTGASIP LGFGTW S   + Y +VI ALK GYRHIDAAA+Y NE  VG+ I+DSG
Sbjct: 10  SLKLNTGASIPQLGFGTWPSSHADAYTAVITALKTGYRHIDAAAMYGNEAAVGKGIRDSG 69

Query: 71  VPREDIFITTKLWGTEQRDPEAALNESLKRLGLDYVDLYLMHWPVPLKTETITDGNVLCI 130
           +PRE+IF+TTKLW T+QRDP +AL+ESL+RLGLDYVDL+L+HWPVPLK     + N+L  
Sbjct: 70  IPREEIFVTTKLWNTQQRDPASALDESLERLGLDYVDLFLIHWPVPLKPVGGPE-NLLKY 128

Query: 131 PTLDDGTVDVDTREWNFIKTWDLMQELPKTGKTKAVGVSNFSINNIKALLESPSNKLVPA 190
           PT       +DT +W+FIKTW+LMQ LPKTGKT+AVGVSNFSI N++ LL S  + LVPA
Sbjct: 129 PT-PGIKPQIDTEDWSFIKTWELMQTLPKTGKTRAVGVSNFSIKNLEDLLNSSPDVLVPA 187

Query: 191 ANQIEIHPLLPQNELIAFCKEKGIVVEAYSPFGSVNAPLLEEQAIIDMAKKHGVAPAQLI 250
            NQ EIHP LPQ ELI +CK KGIVVEAY P GS ++ +L +  I ++A K+ V PA ++
Sbjct: 188 VNQFEIHPQLPQTELINYCKSKGIVVEAYCPLGSSSSAMLSDPTIAEIADKYHVKPANVL 247

Query: 251 ISWSIQRGYVVLAKSVNPERIVSNFKIFTLPEDDFKIISNLSKVHGEKRVVDMKWSSFPI 310
           I+W I RGY VL KS  P RI SN     L  +D + I+ LS+  G KR V   +  +P+
Sbjct: 248 INWGISRGYCVLPKSFTPARIASNKTPVHLSREDTERITKLSETLGVKRYVHPDFEPYPL 307

Query: 311 FK 312
           F+
Sbjct: 308 FE 309

>Kwal_55.21426 s55 complement(832981..833907) [927 bp, 308 aa] {ON}
           YOR120W (GCY1) - Similar to mammalian aldo/keto
           reductases [contig 130] FULL
          Length = 308

 Score =  351 bits (900), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 160/308 (51%), Positives = 230/308 (74%), Gaps = 2/308 (0%)

Query: 1   MPATLKNSSASLKLNTGASIPVLGFGTWRSVENNGYHSVIAALKAGYRHIDAAAIYLNEE 60
           M   LK  +A+  LNTGA IP+LG GTWR  +  GY +++AALKAGYRHID+AA+ +NE+
Sbjct: 1   MTGILKKCTATATLNTGAKIPLLGLGTWRLTKEGGYKAILAALKAGYRHIDSAAVCMNEQ 60

Query: 61  EVGRAIKDSGVPREDIFITTKLWGTEQRDPEAALNESLKRLGLDYVDLYLMHWPVPLKTE 120
            +G+AI+DSGV R+++F+TTKLW T+ RDP AAL++SLKRLGL+YVDLY+MHWP+  + +
Sbjct: 61  VIGKAIRDSGVRRDELFVTTKLWSTQHRDPSAALDQSLKRLGLEYVDLYMMHWPLAFRVD 120

Query: 121 TITDGNVLCIPTLDDGTVDVDTREWNFIKTWDLMQELPKTGKTKAVGVSNFSINNIKALL 180
            I   N + IP   +G   VDT +W+++KTW+LMQ+LP T KT+A+GV+NFS+  + +LL
Sbjct: 121 QIKAKNFMLIPRNSEGKPYVDT-DWDYVKTWELMQKLP-TEKTRAIGVANFSVPQLTSLL 178

Query: 181 ESPSNKLVPAANQIEIHPLLPQNELIAFCKEKGIVVEAYSPFGSVNAPLLEEQAIIDMAK 240
           +SP+NK++PAA+Q+E HP LP +E++AFC+EKGI++EAYSP G    PL++E  I +++K
Sbjct: 179 KSPNNKIIPAASQLETHPFLPHDEMLAFCREKGILMEAYSPLGGDGGPLIDEPVIREISK 238

Query: 241 KHGVAPAQLIISWSIQRGYVVLAKSVNPERIVSNFKIFTLPEDDFKIISNLSKVHGEKRV 300
           K  V PAQL+ISW ++RG  VL KS    RI SN ++F L ++D++ I  +++  G KR 
Sbjct: 239 KLHVEPAQLLISWGLKRGCAVLPKSKTQTRIESNLEVFDLSDEDYERIHEIAQERGPKRT 298

Query: 301 VDMKWSSF 308
            +  W SF
Sbjct: 299 HNPPWFSF 306

>AER401W Chr5 (1406905..1407846) [942 bp, 313 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR368W (YPR1) and
           YOR120W (GCY1)
          Length = 313

 Score =  332 bits (850), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 162/310 (52%), Positives = 226/310 (72%), Gaps = 1/310 (0%)

Query: 3   ATLKNSSASLKLNTGASIPVLGFGTWRSVENNGYHSVIAALKAGYRHIDAAAIYLNEEEV 62
           ATLK S+ ++ LNTGA IP+ G GTW+S +++   +V AALK GY+HID A+ Y NEE V
Sbjct: 5   ATLKASTDTVTLNTGAKIPLFGLGTWQSTDDDASSAVAAALKHGYKHIDTASFYKNEELV 64

Query: 63  GRAIKDSGVPREDIFITTKLWGTEQRDPEAALNESLKRLGLDYVDLYLMHWPVPLKTETI 122
           G+A+K+SG+PRE++FITTK+W  +QRDP  AL+ SLK+LG +YVDL LMHWPVP K    
Sbjct: 65  GKAVKESGIPREELFITTKVWNDQQRDPAGALDLSLKKLGTEYVDLLLMHWPVPFKEPEN 124

Query: 123 TDGNVLCIPTLDDGTVDVDTREWNFIKTWDLMQELPKTGKTKAVGVSNFSINNIKALLES 182
           +  +   +P   DG V  D  EW+F+KTW LMQ+L  TGK KA+GVSNFSINN++ LL +
Sbjct: 125 STLDAYKVPRGPDGKVTRD-EEWDFVKTWHLMQKLLGTGKVKAIGVSNFSINNLEELLNA 183

Query: 183 PSNKLVPAANQIEIHPLLPQNELIAFCKEKGIVVEAYSPFGSVNAPLLEEQAIIDMAKKH 242
               +VPA NQ+E+H  LPQ EL+ +C++KGIVVEAYSP GS +APLL++  +  +A+K+
Sbjct: 184 EGTTVVPAVNQVELHIRLPQLELVEYCQKKGIVVEAYSPLGSSSAPLLKDATVNKVAEKY 243

Query: 243 GVAPAQLIISWSIQRGYVVLAKSVNPERIVSNFKIFTLPEDDFKIISNLSKVHGEKRVVD 302
           GV PA +++++   RG VVL KSV   RI+SNF+ F + E+D K+++++ K  G +R VD
Sbjct: 244 GVTPAHVLLNYVANRGIVVLPKSVKESRIISNFEYFKMDEEDIKLLNDIHKKEGVQRFVD 303

Query: 303 MKWSSFPIFK 312
             +S FP+F+
Sbjct: 304 PDFSPFPLFQ 313

>NDAI0A07000 Chr1 complement(1596632..1597594) [963 bp, 320 aa] {ON}
           Anc_3.108
          Length = 320

 Score =  211 bits (536), Expect = 7e-66,   Method: Compositional matrix adjust.
 Identities = 114/305 (37%), Positives = 184/305 (60%), Gaps = 13/305 (4%)

Query: 12  LKLNTGASIPVLGFGTWRSVEN--NGYHSVIAALKAGYRHIDAAAIYLNEEEVGRAIKD- 68
             LN G  IP +G GT    +       +V AA++AGYRHID A  Y  E  +G+A+K+ 
Sbjct: 11  FNLNNGTRIPAIGLGTASPKDRYPETKEAVKAAIRAGYRHIDTAYFYKTEPYIGQALKEL 70

Query: 69  ---SGVPREDIFITTKLWGTEQRDPEAALNESLKRLGLDYVDLYLMHWPVPLKTETITDG 125
              + + RE++FITTK+W T   +P  ++++SLK LG+DYVDL L HWPV  +    + G
Sbjct: 71  FESAEIKREELFITTKVWPTFWNNPSDSIDQSLKDLGIDYVDLVLQHWPVCFQKVENSQG 130

Query: 126 NVLCIPTLDDGTVDVDTREWNFIKTWDLMQEL---PKTGKTKAVGVSNFSINNIKALLES 182
           N++ +P   DG    + ++ +++ T+  ++++   PK  + +A+GVSN+ I  ++ L + 
Sbjct: 131 NIIGLPRDKDGNALFE-KDADWLFTYKALEKIYLDPKDNRVRAIGVSNYPIEYLERLFKE 189

Query: 183 PSNKLVPAANQIEIHPLLPQNELIAFCKEKGIVVEAYSPFGSVNAPLLEEQAIIDMAKKH 242
              K+ PA NQ+E+HP LPQ EL  FC +  I++ AYSP GS  AP L+ +++ D+AKK+
Sbjct: 190 --CKVTPAINQVEVHPHLPQLELNKFCHDHAILLTAYSPLGSDGAPNLKIKSVQDLAKKY 247

Query: 243 GVAPAQLIISWSIQRGYVVLAKSVNPERIVSNFKIFTLPEDDFKIISNLSKVHGEKRVVD 302
            V PA ++ S+ I +G VVL +S+NP+RI +N     L +DD   +  +  +    R +D
Sbjct: 248 KVEPADILTSYHISKGNVVLPRSLNPKRIAANVSFAKLTDDDLSKLDQVG-IDEPNRFID 306

Query: 303 MKWSS 307
             ++S
Sbjct: 307 EFFTS 311

>NCAS0I02420 Chr9 complement(454156..455118) [963 bp, 320 aa] {ON}
           Anc_3.108
          Length = 320

 Score =  209 bits (532), Expect = 3e-65,   Method: Compositional matrix adjust.
 Identities = 116/298 (38%), Positives = 175/298 (58%), Gaps = 16/298 (5%)

Query: 6   KNSSASLKLNTGASIPVLGFGT----WRSVENNGYHSVIAALKAGYRHIDAAAIYLNEEE 61
           +N+     LN G  IP +G GT     R  E     +V AA++AGYR ID A  Y  E  
Sbjct: 5   RNTEIYFNLNNGGRIPAIGLGTASPKGRYPETK--KAVKAAIRAGYRQIDTAWYYKTEPY 62

Query: 62  VGRAIK----DSGVPREDIFITTKLWGTEQRDPEAALNESLKRLGLDYVDLYLMHWPVPL 117
           +G A+K    D  + RED+FITTK+W     DP  ++NESLK LG+DYVD+ L HWP+  
Sbjct: 63  IGEALKELFRDGEIKREDLFITTKVWPCYWDDPSTSINESLKSLGIDYVDMVLQHWPLCY 122

Query: 118 KTETITDGNVLCIPTLDDGTVDVDTREWNFIKTWDLMQEL---PKTGKTKAVGVSNFSIN 174
           K     +G ++  P   DG V +     ++I T+ LM+++   PK  + +A+GVSN+ I 
Sbjct: 123 KKTYDENGTIIGKPLDKDGKV-IFAEGADWITTYQLMEKIYLDPKDTRVRAIGVSNYPIE 181

Query: 175 NIKALLESPSNKLVPAANQIEIHPLLPQNELIAFCKEKGIVVEAYSPFGSVNAPLLEEQA 234
            ++ +++    K+ P  NQ+E+HP LPQ EL  FC + GI++ AYSP GS  AP  +   
Sbjct: 182 YLERVIKE--CKVTPVINQVELHPHLPQLELNDFCHKNGILLTAYSPLGSGGAPNTKIPL 239

Query: 235 IIDMAKKHGVAPAQLIISWSIQRGYVVLAKSVNPERIVSNFKIFTLPEDDFKIISNLS 292
           + + AKKH VAPA ++ S+ +++G VV+ +S+NPER+ SN     L +++ K + +  
Sbjct: 240 VQEYAKKHEVAPADILTSYHVRKGNVVIPRSLNPERVASNIYFAPLTKNEMKSLDDFG 297

>Kwal_56.22611 s56 complement(202750..203715) [966 bp, 321 aa] {ON}
           YBR149W (ARA1) - D-arabinose dehydrogenase [contig 184]
           FULL
          Length = 321

 Score =  199 bits (507), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 112/318 (35%), Positives = 192/318 (60%), Gaps = 15/318 (4%)

Query: 6   KNSSASLKLNTGASIPVLGFGTWRSVEN--NGYHSVIAALKAGYRHIDAAAIYLNEEEVG 63
           KN+     LN G  +P LG GT   +E       +V AA+K+GYRHID A  Y  E+ +G
Sbjct: 5   KNTEIYFTLNNGVKMPALGLGTANVIEQIPQTKQAVKAAIKSGYRHIDTAWAYRCEDRIG 64

Query: 64  RAIKD----SGVPREDIFITTKLWGTEQRDPEAALNESLKRLGLDYVDLYLMHWPVPLKT 119
            A+K+      + REDIFITTK+W T     + +++ SL+ LG+DYVDL L HWP+    
Sbjct: 65  EALKELFEEGVIKREDIFITTKVWPTNWDRADESISRSLENLGVDYVDLVLQHWPLCFNR 124

Query: 120 ETITDG-NVLCI-PTLDDGTVDVDTREWNFIKTWDLMQE--LPKTGKTKAVGVSNFSINN 175
               +G + +C  PT +DG+   + +  ++++T+  +++  L K  + +++GVSN+ +  
Sbjct: 125 LQDPEGIDGICRNPTHEDGSPHYNEK-GDYLQTFKSLEKMYLSKDPRFRSIGVSNYPVEY 183

Query: 176 IKALLESPSNKLVPAANQIEIHPLLPQNELIAFCKEKGIVVEAYSPFGSVNAPLLEEQAI 235
           ++ LL+    K+VPA NQ+E+HP LPQ EL  FC +  I +EA+SPFG+  +P+++ + +
Sbjct: 184 LERLLKE--CKVVPAVNQVEMHPHLPQMELRDFCTKHNIRLEAFSPFGATGSPMVKNELV 241

Query: 236 IDMAKKHGVAPAQLIISWSIQRGYVVLAKSVNPERIVSNFKIFTLPEDDFKIISNLSKVH 295
             +A+K+   P  ++I++ +++G V + +SVNP+ I SN +   L ++D   ++    V 
Sbjct: 242 QKVAQKYSCTPNDVLIAYHLRQGVVTVPRSVNPKNIASNVQFVPLSKEDIDELNKFG-VE 300

Query: 296 GEKRVVDMKWS-SFPIFK 312
             KR+VD +++ + P F+
Sbjct: 301 NPKRLVDEEFAVAIPGFR 318

>KAFR0G01350 Chr7 (304389..305363) [975 bp, 324 aa] {ON} Anc_3.108
           YBR149W
          Length = 324

 Score =  199 bits (507), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 118/314 (37%), Positives = 186/314 (59%), Gaps = 16/314 (5%)

Query: 6   KNSSASLKLNTGASIPVLGFGTWRSVEN--NGYHSVIAALKAGYRHIDAAAIYLNEEEVG 63
           K++    KLN G +IP LGFGT+   E       +V AA+KAGYRHID A +Y +E  VG
Sbjct: 5   KSTEIYFKLNNGTTIPALGFGTYAPRERIPETKQAVKAAIKAGYRHIDTAWVYESEPYVG 64

Query: 64  RAIKD----SGVPREDIFITTKLWGTEQRDPEAALNESLKRLGLDYVDLYLMHWPVPL-K 118
            AIK+      V R D+F+TTK+W     + E +LNESL+ LGLDYVDL L HWP+   +
Sbjct: 65  EAIKEMIEEGEVSRSDLFVTTKVWPVYWDNVEKSLNESLEALGLDYVDLLLQHWPLCFPR 124

Query: 119 TETITDG--NVLCIPTLDDGTVDVDTREWNFIKTWDLMQEL---PKTGKTKAVGVSNFSI 173
            E   +G   ++  P  D+G   ++ +  +F++T+  ++++   P   + +A+GVSN++I
Sbjct: 125 VEDEKNGVNGLVAYPEDDEGKPLLNEK-GDFLETYRQIEKIYLNPDDHRVRAIGVSNYAI 183

Query: 174 NNIKALLESPSNKLVPAANQIEIHPLLPQNELIAFCKEKGIVVEAYSPFGSVNAPLLEEQ 233
             ++AL +    K+ P  NQ+EIHP LPQ EL  FC   GI++ AYSP GS  AP L+  
Sbjct: 184 EYLEALFKE--CKVKPVVNQVEIHPHLPQLELNKFCHNHGILLTAYSPLGSDGAPNLKIP 241

Query: 234 AIIDMAKKHGVAPAQLIISWSIQRGYVVLAKSVNPERIVSNFKIFTLPEDDFKIISNLSK 293
            +  +A+K+ ++   ++IS+ I++G  V+ +S+NP RI S  +     +++ K + N+  
Sbjct: 242 LVHQLAEKYDMSLNDILISYHIRKGNTVIPRSLNPVRIASTIEFAPFTQEELKQLDNVG- 300

Query: 294 VHGEKRVVDMKWSS 307
           +    R VD  ++ 
Sbjct: 301 IEEPARFVDAAFAQ 314

>KLTH0C10010g Chr3 (829145..830110) [966 bp, 321 aa] {ON} similar to
           uniprot|P38115 Saccharomyces cerevisiae YBR149W ARA1
           Large subunit of NADP dependent arabinose dehydrogenase
           involved in carbohydrate metabolism small subunit is
           unidentified
          Length = 321

 Score =  198 bits (504), Expect = 4e-61,   Method: Compositional matrix adjust.
 Identities = 115/318 (36%), Positives = 186/318 (58%), Gaps = 15/318 (4%)

Query: 6   KNSSASLKLNTGASIPVLGFGTWRSVEN--NGYHSVIAALKAGYRHIDAAAIYLNEEEVG 63
           KN+     LN G  +P +G GT   VE       +V AA+K+GYRHID A  Y  E+ VG
Sbjct: 5   KNTEVYFTLNNGVRMPAIGLGTANVVEQIPQTKQAVKAAIKSGYRHIDTAWAYQCEDRVG 64

Query: 64  RAIKD----SGVPREDIFITTKLWGTEQRDPEAALNESLKRLGLDYVDLYLMHWPVPLKT 119
            A+K+      V REDIF+TTK+W T     + +++ SL+ LGLD+VDL L HWP+    
Sbjct: 65  EALKELFEEGVVKREDIFVTTKVWPTNWDRVDESISRSLENLGLDHVDLVLQHWPLCFNR 124

Query: 120 ETITDG--NVLCIPTLDDGTVDVDTREWNFIKTWDLMQEL--PKTGKTKAVGVSNFSINN 175
               DG   V   P  +DG+   + +  ++++T+  +++L   K  + +A+GVSN+ +  
Sbjct: 125 LEDPDGIDGVRRNPYHEDGSPHYNEK-GDYLETFKTLEKLYLAKDPRFRAIGVSNYPVEY 183

Query: 176 IKALLESPSNKLVPAANQIEIHPLLPQNELIAFCKEKGIVVEAYSPFGSVNAPLLEEQAI 235
           ++ LL+    ++VPA NQ+E HP LPQ EL  FC +  I +EAYSP G+ NAPL++ + +
Sbjct: 184 LERLLKE--CQVVPAINQVECHPHLPQMELRDFCTKHNIRLEAYSPLGATNAPLIDNELV 241

Query: 236 IDMAKKHGVAPAQLIISWSIQRGYVVLAKSVNPERIVSNFKIFTLPEDDFKIISNLSKVH 295
             +A K+  +   ++I++ +++G V + +SVNP+ I SN +   L ++D   ++    V 
Sbjct: 242 KKIAGKYACSTQNVLIAYHMRQGVVSVPRSVNPKHIASNVQFVALSKEDIDTLNKFG-VE 300

Query: 296 GEKRVVDMKW-SSFPIFK 312
             KR+VD  + ++ P F+
Sbjct: 301 NTKRIVDEPFAAAIPGFR 318

>ZYRO0B06138g Chr2 complement(491830..492816) [987 bp, 328 aa] {ON}
           similar to uniprot|P38115 Saccharomyces cerevisiae
           YBR149W ARA1 Large subunit of NADP dependent arabinose
           dehydrogenase involved in carbohydrate metabolism small
           subunit is unidentified
          Length = 328

 Score =  197 bits (500), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 123/315 (39%), Positives = 186/315 (59%), Gaps = 19/315 (6%)

Query: 6   KNSSASLKLNTGASIPVLGFGTWRSVENNGY--HSVIAALKAGYRHIDAAAIYLNEEEVG 63
           K +  S  LN G  +P LG GT       G    +V AA+KAGYRHID A  Y +E  VG
Sbjct: 8   KGTEISFTLNNGVRMPALGLGTANPHPEIGRTKQAVKAAVKAGYRHIDTAWAYGSEPFVG 67

Query: 64  RAIKD----SGVPREDIFITTKLWGTEQRDPEAALNESLKRLGLDYVDLYLMHWPVPLKT 119
            AIK+      + REDIFIT+K+W     D E +LNESL+ LG+DY+DL+L HWP+    
Sbjct: 68  EAIKELMEEGVIRREDIFITSKVWPVLWDDVERSLNESLESLGVDYIDLWLQHWPLCYVK 127

Query: 120 ETITDG-NVLCI-PTLDDGT--VDVDTREWNFIKTWDLMQEL---PKTGKTKAVGVSNFS 172
           +  T G N L   P   +G    +VD    ++++T+  M+++   P   + +++GVSNF 
Sbjct: 128 QEDTHGINGLARNPETPNGEPYYEVDG---DWLETYVQMEKIYLDPSDNRVRSIGVSNFP 184

Query: 173 INNIKALLESPSNKLVPAANQIEIHPLLPQNELIAFCKEKGIVVEAYSPFGSVNAPLLEE 232
           +  ++  L   + K  PA NQ+E+HP LPQ EL  FC+   I++EAYSP GS NAP +  
Sbjct: 185 VQYLERTLFECAVK--PAVNQVEMHPRLPQFELNKFCRAHNILLEAYSPLGSHNAPNVHL 242

Query: 233 QAIIDMAKKHGVAPAQLIISWSIQRGYVVLAKSVNPERIVSNFKIFTLPEDDFKIISNLS 292
           Q + D+A+K+ ++P+ ++ S+ I++G  V+++SVN  RI SN +   L E++   +  L 
Sbjct: 243 QLVQDLAEKYSMSPSGILNSYHIRQGNAVVSRSVNTMRIASNVEFAALTEEELDNLDQLG 302

Query: 293 KVHGEKRVVDMKWSS 307
            +   KR V+ KW++
Sbjct: 303 -ITKPKRFVNEKWNA 316

>SAKL0C10626g Chr3 (962421..963389) [969 bp, 322 aa] {ON} similar to
           uniprot|P38115 Saccharomyces cerevisiae YBR149W ARA1
           Large subunit of NADP dependent arabinose dehydrogenase
           involved in carbohydrate metabolism small subunit is
           unidentified
          Length = 322

 Score =  192 bits (487), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 115/312 (36%), Positives = 181/312 (58%), Gaps = 18/312 (5%)

Query: 12  LKLNTGASIPVLGFGTWRSVEN--NGYHSVIAALKAGYRHIDAAAIYLNEEEVGRAIKD- 68
             LNTGA IP LG GT    E       +V  A+K GYR ID A +Y +E  +G A+++ 
Sbjct: 11  FNLNTGAKIPSLGLGTVNPPEKMPQTKDAVKHAVKNGYRLIDTAWMYGSEPYIGEALQEL 70

Query: 69  ---SGVPREDIFITTKLWGTEQRDPEAALNESLKRLGLDYVDLYLMHWPVPLKTETITDG 125
                V RED+FITTK+W       E +L ESLK+L LDYVDL L HWP+    +    G
Sbjct: 71  FEEGVVKREDLFITTKVWPCHYNTVEQSLQESLKQLKLDYVDLLLQHWPLCFVKQYDEHG 130

Query: 126 NVLCIPTLDDGTVDVDTRE-WNFIKTWDLMQELPK--TGKTKAVGVSNFSINNIKALLES 182
            +   P +D  + D+   E  +++ TW  ++++ K  +G+ + +GVSN+ +  ++ LL+ 
Sbjct: 131 KLKSHP-VDPKSGDIVLDEKGDYLTTWKQLEKVYKDGSGRVRNIGVSNYPVEYLERLLKE 189

Query: 183 PSNKLVPAANQIEIHPLLPQNELIAFCKEKGIVVEAYSPFGSVNAPLLEEQAIIDMAKKH 242
              ++VP  NQ+E+HPLLPQ EL  +C   GI++E++SP GS   P LE   + +++KK+
Sbjct: 190 --TEVVPVLNQVELHPLLPQEELSEYCNSHGILMESFSPLGSSGTPHLEHPLVKELSKKY 247

Query: 243 GVAPAQLIISWSIQRGYVVLAKSVNPERIVSNFKIFTLPEDDFKIISNLSKVHGEK--RV 300
              P  +++++ +++G VV+ +S+N  RI+ N     L E+D   +S L +   EK  RV
Sbjct: 248 DCEPGSVLLNYHVRKGNVVVPRSLNHGRIIKNADFVALSEEDLDKLSGLGR---EKPVRV 304

Query: 301 VDMKW-SSFPIF 311
           +D  + +S P F
Sbjct: 305 MDEYFATSIPGF 316

>KNAG0K02070 Chr11 complement(419556..420527) [972 bp, 323 aa] {ON}
           Anc_3.108 YBR149W
          Length = 323

 Score =  191 bits (486), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 114/299 (38%), Positives = 172/299 (57%), Gaps = 13/299 (4%)

Query: 6   KNSSASLKLNTGASIPVLGFGTWRSVENNG--YHSVIAALKAGYRHIDAAAIYLNEEEVG 63
           K++    KLN G ++P LG GT    E+      +V AA+KAGYRHID A  Y  E  +G
Sbjct: 5   KSTEIYFKLNNGVNMPALGLGTASPREHMAETKQAVKAAIKAGYRHIDTAWFYGTEGYIG 64

Query: 64  RAIKD----SGVPREDIFITTKLWGTEQRDPEAALNESLKRLGLDYVDLYLMHWPVPL-K 118
            A+K+      V R D+FIT+K+W     D + +LNESLK LGLDYVDLYL HWP+   K
Sbjct: 65  DALKELLENGDVKRSDLFITSKVWPVYWDDVDLSLNESLKSLGLDYVDLYLQHWPLCFQK 124

Query: 119 TETITDG-NVLCIPTLDDGTVDVDTREWNFIKTWDLMQEL---PKTGKTKAVGVSNFSIN 174
            E   DG N L    +D     +     +++ T+  M+++   PK  + +A+GVSN+ + 
Sbjct: 125 IEDSKDGVNGLKGKPIDKDGNALIVEGADYLSTYKQMEKIYLDPKDNRVRAIGVSNYPVE 184

Query: 175 NIKALLESPSNKLVPAANQIEIHPLLPQNELIAFCKEKGIVVEAYSPFGSVNAPLLEEQA 234
            +  LL+  + K  PA NQ+E+HP LPQ EL  FC+   I + AYSP GS  APLL+   
Sbjct: 185 YLDRLLKVCTVK--PAVNQVEMHPHLPQFELREFCELHDIKLTAYSPLGSSGAPLLKLPL 242

Query: 235 IIDMAKKHGVAPAQLIISWSIQRGYVVLAKSVNPERIVSNFKIFTLPEDDFKIISNLSK 293
           + ++++K+ V    ++IS+ I++G  V+ +S+NP R+       TL E +   + ++ +
Sbjct: 243 VKELSEKYQVTLNDVLISYHIRKGSFVIPRSLNPVRLAGCVNFVTLTEGELDQLDDIGR 301

>KLLA0F02728g Chr6 (249240..250232) [993 bp, 330 aa] {ON} similar to
           uniprot|P38115 Saccharomyces cerevisiae YBR149W ARA1
           Large subunit of NADP dependent arabinose dehydrogenase
           involved in carbohydrate metabolism small subunit is
           unidentified
          Length = 330

 Score =  191 bits (486), Expect = 3e-58,   Method: Compositional matrix adjust.
 Identities = 115/312 (36%), Positives = 174/312 (55%), Gaps = 18/312 (5%)

Query: 14  LNTGASIPVLGFGTWRSVEN--NGYHSVIAALKAGYRHIDAAAIYLNEEEVGRAIKD--- 68
            N G  +P  G GT    E       +V AA+KAGYRHID A  Y  EE VG A+++   
Sbjct: 13  FNNGNKVPAFGLGTAAQHERVAETKQAVKAAIKAGYRHIDTAWAYGVEEYVGEALQELFE 72

Query: 69  -SGVPREDIFITTKLWGTEQRDPEAALNESLKRLGLDYVDLYLMHWPVPLKTETITD--- 124
              V RED+ IT+K+W T   D + +LNESL RL +DYVDL+L HWP  L T+ + D   
Sbjct: 73  ERVVKREDLHITSKVWHTMWNDVDKSLNESLARLKVDYVDLFLQHWP--LCTQKVPDPHG 130

Query: 125 -GNVLCIPTLDDGTVDVDTREWNFIKTWDLMQEL---PKTGKTKAVGVSNFSINNIKALL 180
              +   P  D G    D +  ++I+T+  ++++       + +A+GVSNF I  +K +L
Sbjct: 131 VDKIAKEPVDDQGNPLYDEK-GDWIETYKQIEKIYLDKNDKRVRAIGVSNFPIEYLKRVL 189

Query: 181 ESPSNKLVPAANQIEIHPLLPQNELIAFCKEKGIVVEAYSPFGSVNAPLLEEQAIIDMAK 240
           +    + VPA NQ+E+HP LPQ EL  FC E  I+V AYSP G   APLLE   +  + +
Sbjct: 190 KE--CRTVPACNQVELHPHLPQRELCEFCSEHKILVTAYSPLGGNGAPLLELPILKGLCE 247

Query: 241 KHGVAPAQLIISWSIQRGYVVLAKSVNPERIVSNFKIFTLPEDDFKIISNLSKVHGEKRV 300
           K+  +P  ++ S+ +++G +V+ +S+N  RI SN +   L E+D   ++   + + ++ +
Sbjct: 248 KYNASPNDILTSYHLRQGTIVIPRSLNSTRIASNLEFVPLSEEDVNKLNEFGQKNKKRYI 307

Query: 301 VDMKWSSFPIFK 312
                S  P FK
Sbjct: 308 NGAVSSVIPGFK 319

>YBR149W Chr2 (539987..541021) [1035 bp, 344 aa] {ON}  ARA1NADP+
           dependent arabinose dehydrogenase, involved in
           carbohydrate metabolism; purified as homodimer;
           naturally occurs with a N-terminus degradation product
          Length = 344

 Score =  189 bits (481), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 117/315 (37%), Positives = 180/315 (57%), Gaps = 19/315 (6%)

Query: 6   KNSSASLKLNTGASIPVLGFGTWRSVEN--NGYHSVIAALKAGYRHIDAAAIYLNEEEVG 63
           K +     LN G  IP LG GT    E       +V AA+KAGYRHID A  Y  E  VG
Sbjct: 19  KTTEIYFSLNNGVRIPALGLGTANPHEKLAETKQAVKAAIKAGYRHIDTAWAYETEPFVG 78

Query: 64  RAIK----DSGVPREDIFITTKLWGTEQRDPEAALNESLKRLGLDYVDLYLMHWPVPLKT 119
            AIK    D  + RED+FITTK+W     + + +LNESLK LGL+YVDL L HWP+  + 
Sbjct: 79  EAIKELLEDGSIKREDLFITTKVWPVLWDEVDRSLNESLKALGLEYVDLLLQHWPLCFEK 138

Query: 120 ETITDGNVLCIPT-LDDGTVDVDTREWNFIKTWDLMQEL---PKTGKTKAVGVSNFSINN 175
                G    + T +DD    +   + ++++T+  ++++   P   + +A+GVSNFSI  
Sbjct: 139 IKDPKGISGLVKTPVDDSGKTMYAADGDYLETYKQLEKIYLDPNDHRVRAIGVSNFSIEY 198

Query: 176 IKALLESPSNKLVPAANQIEIHPLLPQNELIAFCKEKGIVVEAYSPFGSVNAPLLEEQAI 235
           ++ L++    ++ P  NQ+E HP LPQ EL  FC    I++ AYSP GS  AP L+   +
Sbjct: 199 LERLIKE--CRVKPTVNQVETHPHLPQMELRKFCFMHDILLTAYSPLGSHGAPNLKIPLV 256

Query: 236 IDMAKKHGVAPAQLIISWSIQRGYVVLAKSVNPERIVSNFKIFTLPEDDFKIISNLSKVH 295
             +A+K+ V    L+IS+ I++G +V+ +S+NP RI S+ +  +L +D+ + +++     
Sbjct: 257 KKLAEKYNVTGNDLLISYHIRQGTIVIPRSLNPVRISSSIEFASLTKDELQELNDF---- 312

Query: 296 GEK---RVVDMKWSS 307
           GEK   R +D  +++
Sbjct: 313 GEKYPVRFIDEPFAA 327

>Smik_2.288 Chr2 (524564..525598) [1035 bp, 344 aa] {ON} YBR149W
           (REAL)
          Length = 344

 Score =  186 bits (473), Expect = 3e-56,   Method: Compositional matrix adjust.
 Identities = 115/293 (39%), Positives = 165/293 (56%), Gaps = 16/293 (5%)

Query: 6   KNSSASLKLNTGASIPVLGFGTWRSVEN--NGYHSVIAALKAGYRHIDAAAIYLNEEEVG 63
           K +     LN G  IP LG GT    E       +V AA+KAGYRHID A  Y  E  VG
Sbjct: 19  KTTEIYFSLNNGVRIPALGLGTANPQEKLAETKQAVKAAIKAGYRHIDTAWAYETEPFVG 78

Query: 64  RAIKD----SGVPREDIFITTKLWGTEQRDPEAALNESLKRLGLDYVDLYLMHWPVPLKT 119
            AIK+      + RED+FITTK+W     + + +LNESLK LGLDYVDL L HWP+    
Sbjct: 79  EAIKELLEEGTIQREDLFITTKVWPVLWDEVDRSLNESLKALGLDYVDLLLQHWPICFGK 138

Query: 120 ETITDG--NVLCIPTLDDG-TVDVDTREWNFIKTWDLMQEL---PKTGKTKAVGVSNFSI 173
               +G    + +P  D G TV     +W  ++T+  ++++       + +A+GVSNFSI
Sbjct: 139 VKDPEGISGYMKLPVDDSGKTVYASNGDW--LETYKQLEKIYLDSNDHRVRAIGVSNFSI 196

Query: 174 NNIKALLESPSNKLVPAANQIEIHPLLPQNELIAFCKEKGIVVEAYSPFGSVNAPLLEEQ 233
             ++ L++    K+ P  NQ+E HP LPQ EL  FC    I++ AYSP GS  AP L+  
Sbjct: 197 EYLERLIKE--CKVKPTVNQVESHPHLPQVELRKFCFMHDILLTAYSPLGSQGAPNLKIP 254

Query: 234 AIIDMAKKHGVAPAQLIISWSIQRGYVVLAKSVNPERIVSNFKIFTLPEDDFK 286
            +  + +K+ V    L+IS+ I++G +V+ +S+NP RI SN +   L +D+ +
Sbjct: 255 LVKKLCEKYNVTGNDLLISYHIRQGTIVIPRSLNPVRISSNIEFVCLTKDELQ 307

>Smik_2.289 Chr2 (526189..527223) [1035 bp, 344 aa] {ON} YBR149W
           (REAL)
          Length = 344

 Score =  186 bits (472), Expect = 5e-56,   Method: Compositional matrix adjust.
 Identities = 118/315 (37%), Positives = 175/315 (55%), Gaps = 19/315 (6%)

Query: 6   KNSSASLKLNTGASIPVLGFGTWRSVEN--NGYHSVIAALKAGYRHIDAAAIYLNEEEVG 63
           K +     LN G  IP LG GT    E       +V AA+KAGYRHID A  Y  E  VG
Sbjct: 19  KTTEIYFSLNNGVRIPALGLGTANPQEKLAETKQAVKAAIKAGYRHIDTAWAYRTEPFVG 78

Query: 64  RAIKD----SGVPREDIFITTKLWGTEQRDPEAALNESLKRLGLDYVDLYLMHWPVPLKT 119
            AIK+      + RED+FITTK+W     + + +LNESLK LGLDYVDL L HWP+  + 
Sbjct: 79  EAIKELLEEGTIQREDLFITTKVWPVLWDEVDRSLNESLKALGLDYVDLLLQHWPLCFEK 138

Query: 120 ETITDGNVLCIPT-LDDGTVDVDTREWNFIKTWDLMQEL---PKTGKTKAVGVSNFSINN 175
                G    + T +DD    V     ++++T+  ++++       + +A+GVSNFSI  
Sbjct: 139 VKDPKGISGLVKTPVDDSGKTVYASNGDWLETYKQLEKIYLDSNDHRVRAIGVSNFSIEY 198

Query: 176 IKALLESPSNKLVPAANQIEIHPLLPQNELIAFCKEKGIVVEAYSPFGSVNAPLLEEQAI 235
           ++ L++    K+ P  NQ+E HP LPQ EL  FC    I++ AYSP GS  AP L+   +
Sbjct: 199 LERLIKE--CKVKPTVNQVESHPHLPQVELRKFCFMHDILLTAYSPLGSQGAPNLKIPLV 256

Query: 236 IDMAKKHGVAPAQLIISWSIQRGYVVLAKSVNPERIVSNFKIFTLPEDDFKIISNLSKVH 295
             + +K+ V    L+IS+ I++G +V+ +S+NP RI SN +   L +D+ + ++      
Sbjct: 257 KKLCEKYNVTGNDLLISYHIRQGTIVIPRSLNPVRISSNIEFVCLTKDELQELNEF---- 312

Query: 296 GEK---RVVDMKWSS 307
           GEK   R +D  +++
Sbjct: 313 GEKYPVRFIDEPFAA 327

>Skud_2.276 Chr2 (507436..508470) [1035 bp, 344 aa] {ON} YBR149W
           (REAL)
          Length = 344

 Score =  183 bits (465), Expect = 6e-55,   Method: Compositional matrix adjust.
 Identities = 113/315 (35%), Positives = 177/315 (56%), Gaps = 19/315 (6%)

Query: 6   KNSSASLKLNTGASIPVLGFGTWRSVEN--NGYHSVIAALKAGYRHIDAAAIYLNEEEVG 63
           K +     LN G  IP LG GT    E       +V AA+KAGYRHID A  Y  E  VG
Sbjct: 19  KTTEIYFSLNNGVRIPALGLGTANPHEKLAETKQAVKAAIKAGYRHIDTAWAYETEPFVG 78

Query: 64  RAIK----DSGVPREDIFITTKLWGTEQRDPEAALNESLKRLGLDYVDLYLMHWPVPLKT 119
            AIK    D  + RED+FITTK+W     + + +LNESLK LGLDYVDL+L HWP+  + 
Sbjct: 79  EAIKELLEDGSIKREDLFITTKVWPVLWDEVDRSLNESLKALGLDYVDLFLQHWPLCFEK 138

Query: 120 ETITDGNVLCIPT-LDDGTVDVDTREWNFIKTWDLMQEL---PKTGKTKAVGVSNFSINN 175
                G    + T +DD    +     ++++T+  ++++   P   + +A+GVSNFSI  
Sbjct: 139 VKDPKGLSGLVKTPVDDSGKTMYASNGDWLETYKQLEKIYLDPNDHRIRAIGVSNFSIEY 198

Query: 176 IKALLESPSNKLVPAANQIEIHPLLPQNELIAFCKEKGIVVEAYSPFGSVNAPLLEEQAI 235
           ++ L++    ++ P  NQ+E HP LPQ  +  FC    I++ AYSP GS  AP L+   +
Sbjct: 199 LERLIKE--CRVKPTVNQVETHPHLPQMAMRKFCFMHDILLTAYSPLGSNGAPNLKIPLV 256

Query: 236 IDMAKKHGVAPAQLIISWSIQRGYVVLAKSVNPERIVSNFKIFTLPEDDFKIISNLSKVH 295
             + +K+ +    ++IS+ I++G +V+ +S+NP RI S+ +   L +D+ + +++     
Sbjct: 257 KKLTEKYNLTGNDVLISYHIRQGTIVIPRSLNPVRISSSIEFSCLTKDELQELNDF---- 312

Query: 296 GEK---RVVDMKWSS 307
           GEK   R +D  +++
Sbjct: 313 GEKYPVRFIDEPFAA 327

>TDEL0D05160 Chr4 complement(935981..936958) [978 bp, 325 aa] {ON}
           Anc_3.108 YBR149W
          Length = 325

 Score =  182 bits (462), Expect = 8e-55,   Method: Compositional matrix adjust.
 Identities = 117/314 (37%), Positives = 180/314 (57%), Gaps = 17/314 (5%)

Query: 6   KNSSASLKLNTGASIPVLGFGTWRSVEN--NGYHSVIAALKAGYRHIDAAAIYLNEEEVG 63
           K++  S  LN G  +P +G GT    E       +V AA+KAGYR+ID A  Y +E  VG
Sbjct: 5   KSTEISFLLNNGVRMPAIGLGTANPPEKLAETKQAVKAAVKAGYRNIDTAWAYGSEPFVG 64

Query: 64  RAIKD----SGVPREDIFITTKLWGTEQRDPEAALNESLKRLGLDYVDLYLMHWPVPLKT 119
            AIK+      + RED+FIT+K+W     D E +L ESLK LG+DY+DL+L HWP+    
Sbjct: 65  EAIKELIEEGAIKREDLFITSKVWPVLWDDAERSLQESLKSLGVDYIDLWLQHWPLCYNR 124

Query: 120 ETITDG-NVLCI-PTLDDGTVDVDTREWNFIKTWDLMQEL---PKTGKTKAVGVSNFSIN 174
                G N L   P   DG+ D + +  +++ T+  M+ +   PK  + +A+GVSNF + 
Sbjct: 125 REDPHGINGLARNPEKADGSPDFNEKA-DWLDTYKQMERIYSNPKDNRVRAIGVSNFPVE 183

Query: 175 NIKALL-ESPSNKLVPAANQIEIHPLLPQNELIAFCKEKGIVVEAYSPFGSVNAPLLEEQ 233
            +K +L E P   + P  NQ+E+HP LPQ EL  FC +  I + AYSP GS  AP+++  
Sbjct: 184 YLKRVLKECP---VKPVLNQVEMHPRLPQFELNEFCHDNDIKLTAYSPLGSHGAPMVKHP 240

Query: 234 AIIDMAKKHGVAPAQLIISWSIQRGYVVLAKSVNPERIVSNFKIFTLPEDDFKIISNLSK 293
            I +M++K+  +   ++ S+ I++G  V+ +S+N  RI SN +   L +DD   + +L +
Sbjct: 241 LIKEMSQKYKASENDILTSFHIRQGNTVVPRSINSVRIASNIEFVPLSKDDLDKLKDLGR 300

Query: 294 VHGEKRVVDMKWSS 307
               KR ++ KW++
Sbjct: 301 TE-PKRFINEKWNA 313

>Suva_4.398 Chr4 (709192..710226) [1035 bp, 344 aa] {ON} YBR149W
           (REAL)
          Length = 344

 Score =  181 bits (458), Expect = 6e-54,   Method: Compositional matrix adjust.
 Identities = 117/323 (36%), Positives = 181/323 (56%), Gaps = 26/323 (8%)

Query: 6   KNSSASLKLNTGASIPVLGFGTWRSVEN--NGYHSVIAALKAGYRHIDAAAIYLNEEEVG 63
           K +     LN G  +P LG GT    E       +V AA+KAGYRHID A  Y  E  VG
Sbjct: 19  KTTEIYFTLNNGVRVPALGLGTANPHEKLAETKQAVKAAIKAGYRHIDTAWAYETEPFVG 78

Query: 64  RAIKD----SGVPREDIFITTKLWGTEQRDPEAALNESLKRLGLDYVDLYLMHWPVPLKT 119
            AIK+      + RED+FITTK+W     + E +L+ESLK +GLDYVDL+L HWP  L  
Sbjct: 79  EAIKELLEEGSIKREDLFITTKVWPVLWDEVERSLSESLKAMGLDYVDLFLQHWP--LCF 136

Query: 120 ETITD----GNVLCIPTLDDGTVDVDTREWNFIKTWDLMQEL---PKTGKTKAVGVSNFS 172
           E + D      ++  P    G   + +   ++++T+  ++++   P   + +A+GVSNFS
Sbjct: 137 EKVKDPKGISGLVKTPVHKSGEAMLASN-GDWMETYKQLEKIYLDPNDHRVRAIGVSNFS 195

Query: 173 INNIKALLESPSNKLVPAANQIEIHPLLPQNELIAFCKEKGIVVEAYSPFGSVNAPLLEE 232
           I  ++ L++    ++ P  NQ+E HP LPQ EL  FC    I++ AYSP GS  AP L+ 
Sbjct: 196 IEYLERLVKE--CRVKPTVNQVETHPHLPQMELRKFCFMHDILLTAYSPLGSNGAPNLKI 253

Query: 233 QAIIDMAKKHGVAPAQLIISWSIQRGYVVLAKSVNPERIVSNFKIFTLPEDDFKIISNLS 292
             +  + +K+ V    ++IS+ I++G +V+ +S+NP RI S+ +   L +D+ + +++  
Sbjct: 254 PLVKKLVEKYNVTGNDVLISYHIRQGTIVIPRSLNPVRISSSIEFACLTKDELQELNDF- 312

Query: 293 KVHGEK---RVVDMKW-SSFPIF 311
              GEK   R +D  + +S P F
Sbjct: 313 ---GEKYPVRFIDEPFAASLPEF 332

>SAKL0C09922g Chr3 (897779..898747) [969 bp, 322 aa] {ON} similar to
           uniprot|P38115 Saccharomyces cerevisiae YBR149W ARA1
           Large subunit of NADP dependent arabinose dehydrogenase
           involved in carbohydrate metabolism small subunit is
           unidentified
          Length = 322

 Score =  178 bits (451), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 109/308 (35%), Positives = 169/308 (54%), Gaps = 15/308 (4%)

Query: 6   KNSSASLKLNTGASIPVLGFGTWRSVEN--NGYHSVIAALKAGYRHIDAAAIYLNEEEVG 63
           K +     LN G  IP +G GT    +       +V AA+KAG+R ID A  Y  EE +G
Sbjct: 5   KATEIYFNLNNGTRIPAVGLGTANPKDKWPQTKEAVKAAVKAGFRQIDTAWAYGTEEYIG 64

Query: 64  RAIKD----SGVPREDIFITTKLWGTEQRDPEAALNESLKRLGLDYVDLYLMHWPVPL-- 117
            A+++      V RED+FITTK+W       E +LNESLKRL LDYVDL L HWP     
Sbjct: 65  EALQELFAEGVVKREDLFITTKVWPNYWDQAEKSLNESLKRLQLDYVDLLLQHWPFCFVK 124

Query: 118 KTETITDGNVLCIPTLDDGTVDVDTREWNFIKTWDLMQEL---PKTGKTKAVGVSNFSIN 174
           K +    G ++  P  +DG+   DT   ++++T+  ++ +       + +A+GVSN+ I 
Sbjct: 125 KQDPEGSGQLVNHPQHEDGSPFYDTAG-DWLETYKQIEAIYLAENDTRVRAIGVSNYPIE 183

Query: 175 NIKALLESPSNKLVPAANQIEIHPLLPQNELIAFCKEKGIVVEAYSPFGSVNAPLLEEQA 234
            ++ L +    K VPA NQ+E+HP LPQ EL  +C + GI++ +YSP GS  AP L    
Sbjct: 184 YLERLFKE--CKTVPAINQVELHPRLPQRELCDYCNKHGILMTSYSPLGSNGAPNLRIPL 241

Query: 235 IIDMAKKHGVAPAQLIISWSIQRGYVVLAKSVNPERIVSNFKIFTLPEDDFKIISNLSKV 294
           + ++A K+      +++S+ I++G +V+ +S+N ERI        L +++   ++     
Sbjct: 242 VQELASKYNANGNDVLVSYHIRQGTIVIPRSLNLERISKGLGFVPLTKEELDKLNQYGVE 301

Query: 295 HGEKRVVD 302
           H E R +D
Sbjct: 302 H-EYRYID 308

>Ecym_5508 Chr5 (1035144..1036124) [981 bp, 326 aa] {ON} similar to
           Ashbya gossypii ACL107C
          Length = 326

 Score =  178 bits (452), Expect = 4e-53,   Method: Compositional matrix adjust.
 Identities = 114/325 (35%), Positives = 171/325 (52%), Gaps = 35/325 (10%)

Query: 14  LNTGASIPVLGFGTWRSVENNGYHSVIAALKAGYRHIDAAAIYLNEEEVG----RAIKDS 69
           LN G  +PV+G G W+   +     V  A+K GYR  D A  Y NE+E+G    +AI + 
Sbjct: 9   LNNGMKMPVVGLGCWKLSADVAATQVYEAIKLGYRLFDGALCYGNEKEIGVGIKQAINEG 68

Query: 70  GVPREDIFITTKLWGTEQRDPEA--ALNESLKRLGLDYVDLYLMHWPVPLKTETITDGNV 127
            V RED+FI +KLW           AL  +L  LGLDYVDLY +H+P+P+K   + +   
Sbjct: 69  LVKREDLFIVSKLWCNFHHPDHVKLALQRTLNDLGLDYVDLYYIHFPLPIKYVPLEEKYP 128

Query: 128 LCIPTLDDGTVD-----VDTREWNFIKTWDLMQELPKTGKTKAVGVSNFSINNIKALLES 182
              P +  G  D     V  ++   + T+  M++L   G  K++G+SNF    I+ LL  
Sbjct: 129 ---PEMYTGEEDRRNNIVSEQQVPILDTYRAMEKLVDEGLVKSLGLSNFQACLIQDLLRG 185

Query: 183 PSNKLVPAANQIEIHPLLPQNELIAFCKEKGIVVEAYSPFGSVN------------APLL 230
              ++ P A Q+E+HP L Q  L+ + + K I V AYS FG ++             PLL
Sbjct: 186 A--RIKPVALQVELHPYLSQERLVTYAQSKDIQVVAYSTFGPLSFLELGNSAAKDVTPLL 243

Query: 231 EEQAIIDMAKKHGVAPAQLIISWSIQRGYVVLAKSVNPERIVSNF---KIFTLPEDDFKI 287
           E + ++++AKKH V P+Q+I+ W+ QRG  V+ KS   ER+++N    K  TL + +   
Sbjct: 244 EHEIVLNIAKKHDVTPSQVILRWATQRGIAVIPKSSKKERLLNNLNSDKALTLSDSEMSD 303

Query: 288 ISNLSKVHGEKRVVD-MKWSSFPIF 311
           I +L+K     R +D   W+  P F
Sbjct: 304 IFSLNK---NLRFLDPWDWARLPGF 325

>ACL107C Chr3 complement(152564..153628) [1065 bp, 354 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YHR104W
           (GRE3)
          Length = 354

 Score =  172 bits (435), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 102/307 (33%), Positives = 163/307 (53%), Gaps = 29/307 (9%)

Query: 11  SLKLNTGASIPVLGFGTWRSVENNGYHSVIAALKAGYRHIDAAAIYLNEEEVG----RAI 66
           ++KLN GA +P++G G W+         V  A+K GYR +D A  Y NE EVG    RAI
Sbjct: 32  TIKLNNGADMPLVGLGCWKIPNEVAAEQVYEAIKLGYRLLDGAEDYANEREVGQGIRRAI 91

Query: 67  KDSGVPREDIFITTKLWGTEQR--DPEAALNESLKRLGLDYVDLYLMHWPVPLK----TE 120
            +  V RE++F+ +KLW    R  D   AL  +L  LGLDY+DL+ +H+P+  K     E
Sbjct: 92  DEGLVRREELFVVSKLWNNYHRPEDVGKALQRTLSDLGLDYLDLFYIHFPLAFKFVPLEE 151

Query: 121 TITDGNVLCIPTLDDGTVDVDTREWNFIKTWDLMQELPKTGKTKAVGVSNFSINNIKALL 180
               G  L     D+    +       I+T+  +++L   G+ +A+G+SNF    ++ LL
Sbjct: 152 RYPAG--LYTGAADEQAGRLAQEPVPLIETYRALEQLVDEGRIRAIGLSNFQGCLVQDLL 209

Query: 181 ESPSNKLVPAANQIEIHPLLPQNELIAFCKEKGIVVEAYSPFGSVN------------AP 228
                ++ PAA QIE HP L Q  L+ + K +G+ V  YS  G  +            AP
Sbjct: 210 R--GCRIRPAALQIEHHPYLTQERLVQYAKSEGLAVVGYSSLGPQSFLELGNTAAQNAAP 267

Query: 229 LLEEQAIIDMAKKHGVAPAQLIISWSIQRGYVVLAKSVNPERIVSNFKI---FTLPEDDF 285
           LL+ + +  +A++H   PA++++ W+ QR   V+ KS   ER+ +N ++    TL +D+ 
Sbjct: 268 LLQHEVVCRIAERHTATPAEVLLRWATQRDIAVIPKSSRKERLATNLRVDEALTLADDEL 327

Query: 286 KIISNLS 292
           + +S+L+
Sbjct: 328 RELSSLN 334

>KLLA0E21627g Chr5 complement(1929294..1930283) [990 bp, 329 aa]
           {ON} highly similar to uniprot|P38715 Saccharomyces
           cerevisiae YHR104W GRE3 Aldose reductase involved in
           methylglyoxal d-xylose and arabinose metabolism stress
           induced (osmotic ionic oxidative heat shock starvation
           and heavy metals) regulated by the HOG pathway
          Length = 329

 Score =  168 bits (426), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 107/308 (34%), Positives = 160/308 (51%), Gaps = 25/308 (8%)

Query: 9   SASLKLNTGASIPVLGFGTWRSVENNGYHSVIAALKAGYRHIDAAAIYLNEEEVG----R 64
           + ++ LN G  +P++G G W+   +     +  A+K GYR  D A  Y NE+EVG    R
Sbjct: 5   AETVTLNNGEKMPLVGLGCWKMPNDVCADQIYEAIKIGYRLFDGAQDYANEKEVGQGVNR 64

Query: 65  AIKDSGVPREDIFITTKLWGTEQR--DPEAALNESLKRLGLDYVDLYLMHWPVPLKTETI 122
           AIK+  V RED+ + +KLW +     +   AL  +L  L LDYVD++ +H+P+  K    
Sbjct: 65  AIKEGLVKREDLVVVSKLWNSFHHPDNVPRALERTLSDLQLDYVDIFYIHFPLAFKPVPF 124

Query: 123 TDGNVLCIPT--LDDGTVDVDTREWNFIKTWDLMQELPKTGKTKAVGVSNFSINNIKALL 180
            +       T   D+    ++  +   + TW  +++L   GK K++G+SNFS   I+ LL
Sbjct: 125 DEKYPPGFYTGKEDEAKGHIEEEQVPLLDTWRALEKLVDQGKIKSLGISNFSGALIQDLL 184

Query: 181 ESPSNKLVPAANQIEIHPLLPQNELIAFCKEKGIVVEAYSPFGSV-----------NAP- 228
                ++ P A QIE HP L Q  LI + K  GI V AYS FG V           N P 
Sbjct: 185 RGA--RIKPVALQIEHHPYLTQERLIKYVKNAGIQVVAYSSFGPVSFLELENKKALNTPT 242

Query: 229 LLEEQAIIDMAKKHGVAPAQLIISWSIQRGYVVLAKSVNPERIVSNFKI---FTLPEDDF 285
           L E   I  +A KH V P Q+++ W+ Q G  ++ KS   ER++ N +I    TL +D+ 
Sbjct: 243 LFEHDTIKSIASKHKVTPQQVLLRWATQNGIAIIPKSSKKERLLDNLRINDALTLTDDEL 302

Query: 286 KIISNLSK 293
           K IS L++
Sbjct: 303 KQISGLNQ 310

>NCAS0A06660 Chr1 (1316398..1317378) [981 bp, 326 aa] {ON} 
          Length = 326

 Score =  168 bits (426), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 111/326 (34%), Positives = 164/326 (50%), Gaps = 31/326 (9%)

Query: 12  LKLNTGASIPVLGFGTWRSVENNGYHSVIAALKAGYRHIDAAAIYLNEEEVG----RAIK 67
           L LN G  +P +G G W+   +     V  A+KAGYR  D A  Y NE EVG    RA+ 
Sbjct: 5   LTLNNGMKMPQVGLGCWKIPNDICADQVYEAIKAGYRLFDGATDYANEVEVGKGLKRAMD 64

Query: 68  DSGVPREDIFITTKLWGTEQRDPEAALN--ESLKRLGLDYVDLYLMHWPVPLKTETITDG 125
           D  V R+D+F+ +KLW          LN   +LK LGLDY+DLY +H+P+  K   + + 
Sbjct: 65  DGIVKRQDLFVVSKLWNNFHHPDHVKLNLKRNLKDLGLDYLDLYYIHFPIAFKFVPMEER 124

Query: 126 NVLCIPTLDDGTVD-----VDTREWNFIKTWDLMQELPKTGKTKAVGVSNFSINNIKALL 180
                P +  G  D     +       + T+  ++E  + G  K++G+SNF+   +  +L
Sbjct: 125 YP---PQMYTGKADEAKGILTEENVPLLDTYRALEECQREGLIKSIGISNFNGGLVADIL 181

Query: 181 ESPSNKLVPAANQIEIHPLLPQNELIAFCKEKGIVVEAYSPFGSVN------------AP 228
              S K  P A QIE HP L Q +L+ +CK   + V  YS FG  +             P
Sbjct: 182 RGCSIK--PVALQIEHHPYLTQEKLLEYCKIHDVQVVGYSSFGPQSFADCGMDLAKNTPP 239

Query: 229 LLEEQAIIDMAKKHGVAPAQLIISWSIQRGYVVLAKSVNPERIVSNFKI---FTLPEDDF 285
           L +   I  +A+KH V+ A++++ W+ QRG  ++ KS + +R++SN  I    TL E+D 
Sbjct: 240 LFDHPVIKKIAEKHNVSTAEVLLRWATQRGVAIIPKSSHKKRLLSNLNIDDNVTLTEEDL 299

Query: 286 KIISNLSKVHGEKRVVDMKWSSFPIF 311
           K IS L++        D   S FPIF
Sbjct: 300 KSISGLNQNLRFNDPWDWNNSKFPIF 325

>KLTH0F16610g Chr6 complement(1346319..1347308) [990 bp, 329 aa]
           {ON} highly similar to uniprot|P38715 Saccharomyces
           cerevisiae YHR104W GRE3 Aldose reductase involved in
           methylglyoxal d-xylose and arabinose metabolism stress
           induced (osmotic ionic oxidative heat shock starvation
           and heavy metals) regulated by the HOG pathway
          Length = 329

 Score =  163 bits (412), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 109/331 (32%), Positives = 178/331 (53%), Gaps = 35/331 (10%)

Query: 9   SASLKLNTGASIPVLGFGTWRSVENNGYHSVIAALKAGYRHIDAAAIYLNEEEVGRAIK- 67
           S ++KLN G  +P++G G W+         V  A+K GYR  D A  Y NE+EVG+ I+ 
Sbjct: 5   SETVKLNNGLEMPLVGLGCWKIPNEVCASQVYEAIKLGYRLFDGAQDYGNEKEVGQGIRK 64

Query: 68  --DSG-VPREDIFITTKLWGT--EQRDPEAALNESLKRLGLDYVDLYLMHWPVPLK---- 118
             D G V RED+F+ +KLW +  + ++ + AL  +L+ LGL+Y+DL+ +H+P+  K    
Sbjct: 65  AIDEGIVKREDLFVVSKLWNSYHDPKNVKKALKRTLQDLGLEYLDLFYIHFPLAFKFVPF 124

Query: 119 TETITDGNVLCIPTLDDGTVDVDTREWNFIKTWDLMQELPKTGKTKAVGVSNFSINNIKA 178
            E    G          G + ++  +   + T+  +++    G  KA+GVSNF    +  
Sbjct: 125 EERYPPGFYTGAEDEKKGVISLE--KVTVLDTYRALEQCVDEGLIKAIGVSNFRGILLHD 182

Query: 179 LLESPSNKLVPAANQIEIHPLLPQNELIAFCKEKGIVVEAYSPFG-----------SVNA 227
           LL     K+ PA  QIE HP L Q +L+ +CK++GI V AYS FG           + + 
Sbjct: 183 LLAGA--KIPPACLQIEHHPYLTQEKLVEYCKQQGIQVVAYSSFGPQSFLEMDSQLAKST 240

Query: 228 P-LLEEQAIIDMAKKHGVAPAQLIISWSIQRGYVVLAKSVNPERIVSNFKI---FTLPED 283
           P L E   +  +A  HGV+ +++++ W+ QR   ++ KS   ER+++N +I    TL ++
Sbjct: 241 PTLFEHDVVKKVANNHGVSTSEVLLRWATQRRVAIIPKSSKKERLLNNLQINEKLTLSDE 300

Query: 284 DFKIISNLSK---VHGEKRVVDMKWSSFPIF 311
           + + IS+L+K    +     +DMK   FP+F
Sbjct: 301 ELQEISSLNKDIRFNDPFNWLDMK---FPVF 328

>KNAG0B03780 Chr2 (725307..726287) [981 bp, 326 aa] {ON} 
          Length = 326

 Score =  162 bits (411), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 111/327 (33%), Positives = 168/327 (51%), Gaps = 27/327 (8%)

Query: 9   SASLKLNTGASIPVLGFGTWRSVENNGYHSVIAALKAGYRHIDAAAIYLNEEEVG----R 64
           S ++ LN G ++P++G G W+   +     V  A+K GYR  D A  Y NE++VG    R
Sbjct: 2   SETVTLNNGLTMPLVGLGCWKISPDICAEQVYEAIKLGYRLFDGACDYGNEKQVGDGIRR 61

Query: 65  AIKDSGVPREDIFITTKLWGTEQRDPEA---ALNESLKRLGLDYVDLYLMHWPVPLKTET 121
           AI +  V RED+F+ +KLW T   DP+    AL  +L  + L+Y+DLY +H+P+  K   
Sbjct: 62  AIDEGIVKREDLFVVSKLWNT-YHDPKHVKLALQRTLDDMKLEYLDLYYIHFPLAFKFVP 120

Query: 122 ITDGNVLCIPT-LDDGTVDVDTRE-WNFIKTWDLMQELPKTGKTKAVGVSNFSINNIKAL 179
             +       T  +D    + T E    I T+  M+EL   G TK++G+SN++   ++  
Sbjct: 121 FEERYPPGFYTGAEDAKKGILTEEKVALIDTYRAMEELVDEGLTKSIGISNYAGALVQDT 180

Query: 180 LESPSNKLVPAANQIEIHPLLPQNELIAFCKEKGIVVEAYSPFGSVN------------A 227
           L     ++ P   QIE HP L Q +L+ +CK  GI V AYS FG  +             
Sbjct: 181 LR--GCRIKPVCLQIEHHPYLTQEKLVEYCKLNGIQVVAYSSFGPQSFVDIDQKLAKHTP 238

Query: 228 PLLEEQAIIDMAKKHGVAPAQLIISWSIQRGYVVLAKSVNPERIVSNFKI---FTLPEDD 284
           PL +   I  +A++H V  +Q+I+ W+ QRG  V+ KS +  R++ N +I    TL   D
Sbjct: 239 PLFDHPVIKKIAQEHKVTTSQVILRWATQRGIAVIPKSAHKGRLLGNLQIDQAVTLTPKD 298

Query: 285 FKIISNLSKVHGEKRVVDMKWSSFPIF 311
            + IS+L+K        D   S FP F
Sbjct: 299 LEEISSLNKNLRFNDTWDWTISKFPSF 325

>CAGL0I01122g Chr9 (93934..94914) [981 bp, 326 aa] {ON} highly
           similar to uniprot|P38715 Saccharomyces cerevisiae
           YHR104w GRE3 aldose reductase
          Length = 326

 Score =  162 bits (410), Expect = 5e-47,   Method: Compositional matrix adjust.
 Identities = 108/326 (33%), Positives = 163/326 (50%), Gaps = 25/326 (7%)

Query: 9   SASLKLNTGASIPVLGFGTWRSVENNGYHSVIAALKAGYRHIDAAAIYLNEEEVGRAIK- 67
           S+ + LN G  +P++G G W+   +     V  A+K GYR  D A  Y NE+EVG+ I+ 
Sbjct: 2   SSVVTLNNGLKMPLVGLGCWKIPNDVCAQQVYDAIKIGYRLFDGAEDYGNEKEVGQGIRK 61

Query: 68  --DSG-VPREDIFITTKLWGTEQR--DPEAALNESLKRLGLDYVDLYLMHWPVPLKTETI 122
             D G V RED+F+ +KLW +       + AL  +L  +GLDY+DL+ +H+P+  K    
Sbjct: 62  AIDEGVVKREDVFVVSKLWNSFHHPDHVKMALKRTLSDMGLDYLDLFYIHFPIAFKYVPF 121

Query: 123 TDGNVLCIPT--LDDGTVDVDTREWNFIKTWDLMQELPKTGKTKAVGVSNFSINNIKALL 180
            +       T   D+    +       I T+  +++  + G  K++G+SNFS + ++ LL
Sbjct: 122 EEKYPPGFYTGKEDEKNGHITEAHVPIIDTYRALEQCVEEGLIKSIGISNFSGSLVQDLL 181

Query: 181 ESPSNKLVPAANQIEIHPLLPQNELIAFCKEKGIVVEAYSPFG-----SVNAP------- 228
                K+ P A Q+E HP L Q  L+ +CK+ GI V AYS FG      +N P       
Sbjct: 182 RQC--KIKPVALQVEHHPYLTQEHLVEYCKDNGIQVVAYSSFGPQSYIELNHPLAKNTPN 239

Query: 229 LLEEQAIIDMAKKHGVAPAQLIISWSIQRGYVVLAKSVNPERIVSNFKI---FTLPEDDF 285
           L     I  +A  H VA +Q+++ W+ QRG  ++ KS   ER+  N  I    TL   + 
Sbjct: 240 LFHHDTIKQIANNHNVATSQVLLRWATQRGIAIIPKSSKKERLQDNLMIDEKLTLTHKEL 299

Query: 286 KIISNLSKVHGEKRVVDMKWSSFPIF 311
           + IS L+K        D     FPIF
Sbjct: 300 EAISKLNKNLRLNDPWDWLDGKFPIF 325

>KLTH0F01892g Chr6 (149177..150085) [909 bp, 302 aa] {ON} similar to
           uniprot|P47137 Saccharomyces cerevisiae YJR096W
          Length = 302

 Score =  161 bits (408), Expect = 5e-47,   Method: Compositional matrix adjust.
 Identities = 98/297 (32%), Positives = 157/297 (52%), Gaps = 49/297 (16%)

Query: 7   NSSASLKLNTGASIPVLGFGTWRSVENNGYHSVIAALKAGYRHIDAAAIYLNEEE----V 62
           N     KLN G  +PV+GFG +          V  AL+ GYRHID A +Y N+++    V
Sbjct: 8   NRDTRYKLNNGTEVPVIGFGVYDIPVEETAQRVYTALQEGYRHIDTAVVYENQKQAAQGV 67

Query: 63  GRAIKDSGVPREDIFITTKLWGTEQ-RDPEAALNESLKRLGLD------YVDLYLMHWPV 115
            R ++++G PRE+++ TTKLW T+Q RD   A   +L+ +  D      YVDL L+H P 
Sbjct: 68  HRFLEETGTPREEVWFTTKLWNTQQGRD---ATPRALEEIAADVKEFIGYVDLLLLHSP- 123

Query: 116 PLKTETITDGNVLCIPTLDDGTVDVDTREWNFIKTWDLMQ---ELPKTG--KTKAVGVSN 170
                 +TD                       ++TW +++   + P +   + +A+GVSN
Sbjct: 124 ------LTDAQ-------------------RRLETWAVLERAVQEPASSALEIRAIGVSN 158

Query: 171 FSINNIKALLESPSNKLVPAANQIEIHPLLPQNELIAFCKEKGIVVEAYSPFGSVNAPLL 230
           F + +++ LLE  + K  P  +Q+E+HP LP+ EL AF +E GI+ EAYSP        L
Sbjct: 159 FGVRHLQELLEVATVK--PVVDQLELHPWLPRAELRAFLRENGILAEAYSPL--TQGVRL 214

Query: 231 EEQAIIDMAKKHGVAPAQLIISWSIQRGYVVLAKSVNPERIVSNFKIFTLPEDDFKI 287
           ++  ++ +  K G++  ++++ WS  +G+ VL KS NP+RI  N  +     D +K+
Sbjct: 215 QDPELLALEAKSGLSKGEILLRWSFLQGFAVLVKSNNPQRIRDNLAVLPAKTDSWKV 271

>ZYRO0A06336g Chr1 complement(505818..506801) [984 bp, 327 aa] {ON}
           highly similar to uniprot|P38715 Saccharomyces
           cerevisiae YHR104W GRE3 Aldose reductase involved in
           methylglyoxal d-xylose and arabinose metabolism stress
           induced (osmotic ionic oxidative heat shock starvation
           and heavy metals) regulated by the HOG pathway
          Length = 327

 Score =  161 bits (407), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 111/333 (33%), Positives = 168/333 (50%), Gaps = 38/333 (11%)

Query: 9   SASLKLNTGASIPVLGFGTWRSVENNGYHSVIAALKAGYRHIDAAAIYLNEEEVG----R 64
           ++ + LN G  +P++G G W+         +  A+  GYR  D A  Y NE+EVG    R
Sbjct: 2   ASVVALNNGNKMPLVGLGCWKIPNETCSQQIYDAISVGYRVFDGAQDYGNEKEVGEGVRR 61

Query: 65  AIKDSGVPREDIFITTKLWGT--EQRDPEAALNESLKRLGLDYVDLYLMHWPVPLKTETI 122
           AIKD  V RE++F+ +KLW +    ++ + AL  +L  +GLDY+DL+ +H+P+ LK  + 
Sbjct: 62  AIKDGLVKREELFVVSKLWNSFHHPKNVKLALKRTLSDMGLDYLDLFYIHFPIALKPVSF 121

Query: 123 TDGNVLCIPTLDDGTVDVDTREWN-----FIKTWDLMQELPKTGKTKAVGVSNFSINNIK 177
            +      P L  G  D      +      + T+  ++E  + G  K++GVSNFS + + 
Sbjct: 122 EEK---YPPGLYTGEADAKAGVLSEEPVPILDTYRALEECVEEGLIKSIGVSNFSGSIML 178

Query: 178 ALLESPSNKLVPAANQIEIHPLLPQNELIAFCKEKGIVVEAYSPFG------------SV 225
            LL     ++ PAA QIE+HP L Q   + + + KGI V AYS FG              
Sbjct: 179 DLLRGA--RIPPAALQIELHPYLTQERYVKWVQSKGIQVVAYSSFGPQSFVDIGSEVAKA 236

Query: 226 NAPLLEEQAIIDMAKKHGVAPAQLIISWSIQRGYVVLAKSVNPERIVSNFKI---FTLPE 282
             PL E   +  +A KH V+ +Q+++ W+ Q+   V+ KS   ER+  N  +    TL  
Sbjct: 237 TPPLFEHDVVKKIAAKHNVSTSQVLLRWATQQKVAVIPKSSKKERLRQNLLVDQEVTLTG 296

Query: 283 DDFKIISNLSKVHGEKRVVD-MKWSS---FPIF 311
           D+ K IS L+K     R  D   WS    FPIF
Sbjct: 297 DEIKEISGLNK---NLRFNDPFTWSEKTPFPIF 326

>TPHA0E01860 Chr5 complement(373074..374054) [981 bp, 326 aa] {ON}
           Anc_5.409 YHR104W
          Length = 326

 Score =  160 bits (406), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 107/310 (34%), Positives = 160/310 (51%), Gaps = 31/310 (10%)

Query: 9   SASLKLNTGASIPVLGFGTWRSVENNGYHSVIAALKAGYRHIDAAAIYLNEEEVG----R 64
           S  + LN G  +P++G G W+   +     V  A+K GYR  D A  Y NE+EVG    +
Sbjct: 2   SKLITLNNGLKMPIVGLGCWKIPNDTCAAQVYEAIKLGYRAFDGAQDYGNEKEVGEGINQ 61

Query: 65  AIKDSGVPREDIFITTKLWGTEQRDP---EAALNESLKRLGLDYVDLYLMHWPVPLK--- 118
           AI +  V RE++F+ +KLW +   DP   + AL  +L  + LDY+DLY +H+P+  K   
Sbjct: 62  AISEGIVKREELFVISKLWNS-YHDPKHVKMALQRTLSDMKLDYLDLYYIHFPIAFKFVP 120

Query: 119 -TETITDGNVLCIPTLDDGTVDVDTREWNFIKTWDLMQELPKTGKTKAVGVSNFSINNIK 177
             E    G        + G +  +      I T+  M++L   G  K++G+SNF+   I+
Sbjct: 121 FEEKYPAGFYTGKEDAEKGIISEEVVP--LIDTYRAMEQLATDGLIKSIGISNFNGALIQ 178

Query: 178 ALLESPSNKLVPAANQIEIHPLLPQNELIAFCKEKGIVVEAYSPFG-----------SVN 226
            LL   S K+ P   QIE HP L Q  LI +CK   I V AYS FG           +++
Sbjct: 179 DLLR--SCKIKPTCLQIEHHPYLTQPHLIEYCKLNDIQVVAYSSFGPQSFLELNVQKALD 236

Query: 227 APLLEEQAII-DMAKKHGVAPAQLIISWSIQRGYVVLAKSVNPERIVSNFKI---FTLPE 282
           A +L E  +I  +A  H V P+Q+++ W+ QRG  ++ KS   ER++ N  I    TL E
Sbjct: 237 AKVLFEHEVIKSIATNHSVEPSQVLLRWATQRGIAIIPKSSKKERLLENLLIDEKLTLSE 296

Query: 283 DDFKIISNLS 292
            +   IS+L+
Sbjct: 297 QELSTISDLN 306

>NDAI0D01600 Chr4 (382637..383620) [984 bp, 327 aa] {ON} 
          Length = 327

 Score =  160 bits (405), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 112/328 (34%), Positives = 165/328 (50%), Gaps = 26/328 (7%)

Query: 9   SASLKLNTGASIPVLGFGTWRSVENNGYHSVIAALKAGYRHIDAAAIYLNEEEVGRAIK- 67
           SA + LN G  +P++G G W+   +     +  A+K GYR  D A  Y NE+EVG+ IK 
Sbjct: 2   SALVTLNNGLKMPLVGLGCWKIPTSTCAQQIYDAIKVGYRLFDGATDYGNEKEVGQGIKR 61

Query: 68  --DSG-VPREDIFITTKLWGTEQRDPEAALN--ESLKRLGLDYVDLYLMHWPVPLKTETI 122
             D G V RED+FI +KLW          LN   +LK LGLDYVDLY +H+P+  K  + 
Sbjct: 62  AIDEGLVKREDLFIVSKLWNNFHHPDHVKLNLQRNLKDLGLDYVDLYYIHFPIAFKFVSP 121

Query: 123 TDGNVLCIPTLDDGTVDVDTREWN--FIKTWDLMQELPKTGKTKAVGVSNFSINNIKALL 180
            +     + T  +        E N   I T+  M++L   G  K++G+SN++   +   L
Sbjct: 122 DERYPPGMYTGKEDEAKGILTEENVPLIDTYRAMEKLVDEGLIKSIGISNYNGGLVADTL 181

Query: 181 ESPSNKLVPAANQIEIHPLLPQNELIAFCKEKGIVVEAYSPFGSVN------------AP 228
                ++ P A QIE HP L Q +L+ +CK   + V AYS FG  +             P
Sbjct: 182 R--GCRIKPVALQIEHHPYLTQEKLLEYCKIHDVQVVAYSSFGPQSFVDCGQEMAKNTPP 239

Query: 229 LLEEQAIIDMAKKH-GVAPAQLIISWSIQRGYVVLAKSVNPERIVSNFKI---FTLPEDD 284
           L +   I  +A K+  V  +Q+++ W+ QRG  ++ KS   ER++ N  I    TL E+D
Sbjct: 240 LFDHPTIKKIADKYEAVTTSQVLLRWATQRGVAIIPKSSKKERLLENLTIDQKVTLAEED 299

Query: 285 FKIISNLSKVHGEKRVVDMKWSSFPIFK 312
            + IS L++        D   S FPIF+
Sbjct: 300 LREISALNQNLRFNDPWDWNNSKFPIFQ 327

>TDEL0E02150 Chr5 complement(403001..403990) [990 bp, 329 aa] {ON}
           Anc_5.409 YHR104W
          Length = 329

 Score =  159 bits (403), Expect = 6e-46,   Method: Compositional matrix adjust.
 Identities = 107/312 (34%), Positives = 163/312 (52%), Gaps = 31/312 (9%)

Query: 9   SASLKLNTGASIPVLGFGTWRSVENNGYHSVIAALKAGYRHIDAAAIYLNEEEVGRAIK- 67
           S  + LN G  +P++G G W+         V  A+K GYR  D A  Y NE+EVG+ I+ 
Sbjct: 2   SRVVTLNNGMKMPLVGLGCWKIPNEVCASQVYEAIKIGYRLFDGAQDYGNEKEVGQGIRK 61

Query: 68  --DSG-VPREDIFITTKLWGT--EQRDPEAALNESLKRLGLDYVDLYLMHWPVPLK---- 118
             D G V RE++F+ +KLW +  + ++ +AAL  +L  + LDY+DL+ +H+P+ LK    
Sbjct: 62  AIDEGIVKREELFVVSKLWNSFHDPKNVKAALQRTLDDMKLDYLDLFYIHFPIALKFVPF 121

Query: 119 TETITDGNVLCIPTLDDGTVDVDTREWNFIKTWDLMQELPKTGKTKAVGVSNFSINNIKA 178
            E    G  L   + D+    +       I T+  +++L   G  K++G+SNFS + I  
Sbjct: 122 KEKYPPG--LYTGSQDEKQGTMSEENVPIIDTYRALEQLVDEGLIKSIGISNFSGSIIMD 179

Query: 179 LLESPSNKLVPAANQIEIHPLLPQNELIAFCKEKGIVVEAYSPFG------------SVN 226
           LL     ++ P A QIE HP L Q  L+ + K +G+ V AYS FG               
Sbjct: 180 LLR--GCRIKPVALQIEHHPYLTQERLVHYVKLQGLQVVAYSSFGPQSFIEMGSDLAKTT 237

Query: 227 APLLEEQAIIDMAKKHG--VAPAQLIISWSIQRGYVVLAKSVNPERIVSNFKI---FTLP 281
            PL E   II++AK HG  ++P+Q+++ W+ Q    V+ KS   ER+  N  I    TL 
Sbjct: 238 PPLFENPKIIEIAKNHGKEISPSQVLLRWATQNNVAVIPKSSKKERLHDNLHIDDKLTLT 297

Query: 282 EDDFKIISNLSK 293
           + + K IS L+K
Sbjct: 298 DQELKEISALNK 309

>Kwal_55.21536 s55 complement(877191..878180) [990 bp, 329 aa] {ON}
           YHR104W (GRE3) - a keto-aldose reductase [contig 128]
           FULL
          Length = 329

 Score =  157 bits (397), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 103/311 (33%), Positives = 164/311 (52%), Gaps = 29/311 (9%)

Query: 8   SSASLKLNTGASIPVLGFGTWRSVENNGYHSVIAALKAGYRHIDAAAIYLNEEEVG---- 63
           +S ++KLN G  +P++G G W+         V  A+K GYR  D A  Y NE+EVG    
Sbjct: 4   TSETVKLNNGLQMPLVGLGCWKIPNEVCASQVYEAIKLGYRLFDGAQDYGNEKEVGQGIH 63

Query: 64  RAIKDSGVPREDIFITTKLWGT--EQRDPEAALNESLKRLGLDYVDLYLMHWPVPLK--- 118
           +AI +  V RED+F+ +KLW +  + ++ + AL  +L+ + L+Y+DL+ +H+P+  K   
Sbjct: 64  KAIDEGIVKREDLFVVSKLWNSYHDPKNVKKALKRTLEDMELEYLDLFYIHFPLAFKYVP 123

Query: 119 -TETITDGNVLCIPTLDDGTVDVDTREWNFIKTWDLMQELPKTGKTKAVGVSNFSINNIK 177
             E    G          G + ++  +   I T+  ++E  K G  K++G+SNF    I 
Sbjct: 124 FEEKYPPGFYTGAEDAKKGVISLE--QVPIIDTYRALEECVKEGLIKSIGISNFRGILIH 181

Query: 178 ALLESPSNKLVPAANQIEIHPLLPQNELIAFCKEKGIVVEAYSPFG-----------SVN 226
            LL   + K  P   QIE HP L Q +LI +C ++ I V AYS FG           + +
Sbjct: 182 DLLAGATIK--PVCLQIEHHPYLTQEKLIEYCAQEQIQVVAYSSFGPQSFLELDSELAKS 239

Query: 227 AP-LLEEQAIIDMAKKHGVAPAQLIISWSIQRGYVVLAKSVNPERIVSNFKI---FTLPE 282
            P L E + I  +A  HGV+ +Q+++ W+ QR   ++ KS   ER++ N +I    TL E
Sbjct: 240 TPTLFEHEGIQKIATNHGVSSSQVLLRWATQRRIAIIPKSSKKERLLDNLQINEKLTLTE 299

Query: 283 DDFKIISNLSK 293
            + + IS L+K
Sbjct: 300 AELQEISALNK 310

>KLLA0F03256g Chr6 (306731..307588) [858 bp, 285 aa] {ON} highly
           similar to uniprot|P47137 Saccharomyces cerevisiae
           YJR096W
          Length = 285

 Score =  156 bits (394), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 96/279 (34%), Positives = 147/279 (52%), Gaps = 37/279 (13%)

Query: 11  SLKLNTGASIPVLGFGTWRSVENNGYHSVIAALKAGYRHIDAAAIYLNEEEVGRAIKD-- 68
           S KL++G +IP +G GT+    N   + V  AL+ GYRH D A +Y NE EVG+ IK   
Sbjct: 8   SYKLSSGYTIPSVGLGTYELPPNKTAYLVHQALEVGYRHFDTAVLYGNEYEVGQGIKKWL 67

Query: 69  ----SGVPREDIFITTKLWGTEQRDPEA--ALNESLKRL-GLDYVDLYLMHWPVPLKTET 121
               +   R D+F TTKLW ++    +A  A++  L+ +  L Y+DL L+H P+  K   
Sbjct: 68  NENPAENKRGDVFYTTKLWDSQHGYEKAKKAIDHCLQEVEDLGYIDLLLIHSPLGGKKLR 127

Query: 122 ITDGNVLCIPTLDDGTVDVDTREWNFIKTWDLMQELPKTGKTKAVGVSNFSINNIKALLE 181
                                     ++T++ MQE    GK +++GVSN+   +I+ LL 
Sbjct: 128 --------------------------LETYEAMQEAVDAGKVRSIGVSNYGFQHIEELLN 161

Query: 182 SPSNKLVPAANQIEIHPLLPQNELIAFCKEKGIVVEAYSPFGSVNAPLLEEQAIIDMAKK 241
               K  P  NQIEI P   + EL  FCK+KGI+VEAY+P    +   L++  ++ +A +
Sbjct: 162 WEKLKYKPVVNQIEISPWCMRQELADFCKKKGILVEAYAPL--THGTKLKDPDLVKVANE 219

Query: 242 HGVAPAQLIISWSIQRGYVVLAKSVNPERIVSNFKIFTL 280
            G    Q +I WS+Q+GY+ L K+ +  R+ SN  +F+ 
Sbjct: 220 VGCDVGQALIRWSLQKGYIPLPKTQSVSRLASNLDVFSF 258

>KNAG0D01370 Chr4 complement(230193..231041) [849 bp, 282 aa] {ON}
           Anc_7.468 YJR096W
          Length = 282

 Score =  155 bits (391), Expect = 9e-45,   Method: Compositional matrix adjust.
 Identities = 97/276 (35%), Positives = 145/276 (52%), Gaps = 36/276 (13%)

Query: 11  SLKLNTGASIPVLGFGTWRSVENNGYHSVIAALKAGYRHIDAAAIYLNEEEVGRAI---- 66
           S KL +G +IP +G GT+    +N    V AAL+ GYRH+D A +Y NE EV +      
Sbjct: 6   SYKLASGFNIPTIGLGTYDLPPSNTTAIVEAALEVGYRHLDTAVLYGNEAEVAQGAMNFL 65

Query: 67  -KDSGVPREDIFITTKLWGTE--QRDPEAALNESLKRLG-LDYVDLYLMHWPVPLKTETI 122
            +   V REDIF TTKLW ++      + A+ E ++ +G L Y+DL LMH   P+  + +
Sbjct: 66  GRHPDVSREDIFYTTKLWNSQFGYEKAKRAIRECVECIGGLGYIDLLLMH--SPIGGKQV 123

Query: 123 TDGNVLCIPTLDDGTVDVDTREWNFIKTWDLMQELPKTGKTKAVGVSNFSINNIKALLES 182
             G                        TW  MQE    G  +++GVS++   +++ L E 
Sbjct: 124 RRG------------------------TWKAMQEAVDDGLVRSIGVSSYGQRHLEDLFEW 159

Query: 183 PSNKLVPAANQIEIHPLLPQNELIAFCKEKGIVVEAYSPFGSVNAPLLEEQAIIDMAKKH 242
              K  PA NQIEI P + + +L  +CK KGIVVEAYSP    +   L++  ++ +A++ 
Sbjct: 160 SELKHAPAVNQIEISPWIMRQQLADYCKSKGIVVEAYSPL--THGYKLDDPDLLKVAEET 217

Query: 243 GVAPAQLIISWSIQRGYVVLAKSVNPERIVSNFKIF 278
           G  P Q+++ WS+Q GYV L K+    R+  N  +F
Sbjct: 218 GKNPGQVLLRWSLQHGYVPLPKTKTVSRLQLNLDVF 253

>YHR104W Chr8 (323409..324392) [984 bp, 327 aa] {ON}  GRE3Aldose
           reductase involved in methylglyoxal, d-xylose,
           arabinose, and galactose metabolism; stress induced
           (osmotic, ionic, oxidative, heat shock, starvation and
           heavy metals); regulated by the HOG pathway
          Length = 327

 Score =  156 bits (394), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 105/308 (34%), Positives = 154/308 (50%), Gaps = 26/308 (8%)

Query: 9   SASLKLNTGASIPVLGFGTWRSVENNGYHSVIAALKAGYRHIDAAAIYLNEEEVG----R 64
           S+ + LN G  +P++G G W+  +    + +  A+K GYR  D A  Y NE+EVG    +
Sbjct: 2   SSLVTLNNGLKMPLVGLGCWKIDKKVCANQIYEAIKLGYRLFDGACDYGNEKEVGEGIRK 61

Query: 65  AIKDSGVPREDIFITTKLWGTEQRDPEA--ALNESLKRLGLDYVDLYLMHWPVPLKTETI 122
           AI +  V R+DIF+ +KLW           AL ++L  +GLDY+DLY +H+P+  K    
Sbjct: 62  AISEGLVSRKDIFVVSKLWNNFHHPDHVKLALKKTLSDMGLDYLDLYYIHFPIAFKYVPF 121

Query: 123 TDGNVLCIPTLDDGTVDVDTREWN--FIKTWDLMQELPKTGKTKAVGVSNFSINNIKALL 180
            +       T  D        E +   I T+  ++E    G  K++GVSNF  + I+ LL
Sbjct: 122 EEKYPPGFYTGADDEKKGHITEAHVPIIDTYRALEECVDEGLIKSIGVSNFQGSLIQDLL 181

Query: 181 ESPSNKLVPAANQIEIHPLLPQNELIAFCKEKGIVVEAYSPFG------------SVNAP 228
                ++ P A QIE HP L Q  L+ FCK   I V AYS FG                 
Sbjct: 182 R--GCRIKPVALQIEHHPYLTQEHLVEFCKLHDIQVVAYSSFGPQSFIEMDLQLAKTTPT 239

Query: 229 LLEEQAIIDMAKKH-GVAPAQLIISWSIQRGYVVLAKSVNPERIVSNFKI---FTLPEDD 284
           L E   I  +++ H G   +Q+++ W+ QRG  V+ KS   ER++ N +I   FTL E +
Sbjct: 240 LFENDVIKKVSQNHPGSTTSQVLLRWATQRGIAVIPKSSKKERLLGNLEIEKKFTLTEQE 299

Query: 285 FKIISNLS 292
            K IS L+
Sbjct: 300 LKDISALN 307

>KAFR0C05320 Chr3 complement(1065934..1066917) [984 bp, 327 aa] {ON}
           
          Length = 327

 Score =  155 bits (393), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 104/306 (33%), Positives = 156/306 (50%), Gaps = 30/306 (9%)

Query: 14  LNTGASIPVLGFGTWRSVENNGYHSVIAALKAGYRHIDAAAIYLNEEEVGRAIK---DSG 70
           LN G  +P++G G W+   +     V  A+K GYR  D A  Y NE EVG+ IK   D G
Sbjct: 7   LNNGQKMPLVGLGCWKISNDICAEQVYQAIKLGYRLFDGATDYGNEVEVGQGIKKAIDEG 66

Query: 71  -VPREDIFITTKLWGTEQRDPEA--ALNESLKRLGLDYVDLYLMHWPVPLK----TETIT 123
            V R D+F+ +KLW +         AL  +L+ LGLDY+DLY +H+P+  K     E   
Sbjct: 67  LVKRSDLFVVSKLWNSYHHPDHVKLALKRNLQDLGLDYIDLYYIHFPIAFKFVPFEEKYP 126

Query: 124 DGNVLCIPTLDDGTVDVDTREWNFIKTWDLMQELPKTGKTKAVGVSNFSINNIKALLESP 183
            G    +    +G   +   +   + T+  ++E    G  K++G+SNF+   ++ LL   
Sbjct: 127 PGFYTGVDDAREGI--LSEAKVPILDTYRALEECVDNGLIKSIGISNFNGVLVQDLLN-- 182

Query: 184 SNKLVPAANQIEIHPLLPQNELIAFCKEKGIVVEAYSPFG-----------SVNAPLLEE 232
             ++ P A QIE HP L Q +L+ +CK KGI V AYS FG           + + P L E
Sbjct: 183 GCRIKPVALQIEHHPYLTQEKLVEYCKLKGIQVVAYSSFGPQSFIELDSQLAKSTPSLLE 242

Query: 233 QAIID--MAKKHGVAPAQLIISWSIQRGYVVLAKSVNPERIVSNFKI---FTLPEDDFKI 287
             II    A      P+++++ W+ QRG  V+ KS   ER++ N  +    TL E++   
Sbjct: 243 HPIIKKIAAAHRSSTPSEVLLRWATQRGIAVIPKSTKKERLLQNLNVEDSITLTEEELNE 302

Query: 288 ISNLSK 293
           IS+L+K
Sbjct: 303 ISSLNK 308

>Skud_8.165 Chr8 (297201..298184) [984 bp, 327 aa] {ON} YHR104W
           (REAL)
          Length = 327

 Score =  155 bits (393), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 102/310 (32%), Positives = 156/310 (50%), Gaps = 30/310 (9%)

Query: 9   SASLKLNTGASIPVLGFGTWRSVENNGYHSVIAALKAGYRHIDAAAIYLNEEEVG----R 64
           S+ + LN G  +P++G G W+  +N   + +  A+K GYR  D A  Y NE+EVG    +
Sbjct: 2   SSLVTLNNGLKMPLVGLGCWKIDKNACANQIYEAIKLGYRLFDGACDYGNEKEVGEGIRK 61

Query: 65  AIKDSGVPREDIFITTKLWGTEQRDPEA--ALNESLKRLGLDYVDLYLMHWPVPLK---- 118
           AI +  V R+D+F+ +KLW           AL ++L  +GLDY+DLY +H+P+  K    
Sbjct: 62  AIYEGLVTRKDVFVVSKLWNNFHHPDHVKLALKKTLSDMGLDYLDLYYIHFPIAFKYIPF 121

Query: 119 TETITDGNVLCIPTLDDGTVDVDTREWNFIKTWDLMQELPKTGKTKAVGVSNFSINNIKA 178
            E    G      T D+    +       I T+  +++    G  K++G+SNF  + ++ 
Sbjct: 122 EEKYPPG--FYTGTEDEEKGHITEAHVPIIDTYRALEKCVDEGLIKSIGISNFQGSLVQD 179

Query: 179 LLESPSNKLVPAANQIEIHPLLPQNELIAFCKEKGIVVEAYSPFG------------SVN 226
           LL     ++ P A QIE HP L Q  L+ FCK   I V AYS FG               
Sbjct: 180 LLRGC--RIKPVALQIEHHPYLTQEHLVEFCKLHDIQVVAYSSFGPQSFIEMDLQLAKAT 237

Query: 227 APLLEEQAIIDMAKKH-GVAPAQLIISWSIQRGYVVLAKSVNPERIVSNFKI---FTLPE 282
             L E   I  +++ H G   +Q+++ W+ QRG  V+ KS   ER++ N +I   F+L E
Sbjct: 238 QTLFENDVIKKVSENHTGSTTSQVLLRWATQRGIAVIPKSSKKERLLGNLEIEKKFSLTE 297

Query: 283 DDFKIISNLS 292
            + K IS L+
Sbjct: 298 QELKKISALN 307

>SAKL0G01914g Chr7 (162612..163601) [990 bp, 329 aa] {ON} highly
           similar to uniprot|P38715 Saccharomyces cerevisiae
           YHR104W GRE3 Aldose reductase involved in methylglyoxal
           d-xylose and arabinose metabolism stress induced
           (osmotic ionic oxidative heat shock starvation and heavy
           metals) regulated by the HOG pathway
          Length = 329

 Score =  155 bits (393), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 100/311 (32%), Positives = 157/311 (50%), Gaps = 31/311 (9%)

Query: 9   SASLKLNTGASIPVLGFGTWRSVENNGYHSVIAALKAGYRHIDAAAIYLNEEEVGRAIK- 67
           S ++ LN G  +P++G G W+   +     V  A+K GYR  D A  Y NE+EVG+ IK 
Sbjct: 5   SKTVTLNNGLEMPLIGLGCWKIPNDVCASQVYEAIKLGYRLFDGAQDYGNEKEVGQGIKK 64

Query: 68  ---DSGVPREDIFITTKLWGTEQR--DPEAALNESLKRLGLDYVDLYLMHWPVPLKTETI 122
              +  V RED+F+ +KLW +     + + AL ++L  +GLDY+DL+ +H+P+  K    
Sbjct: 65  AIAEGIVKREDLFVVSKLWNSFHHPDNVKLALKKTLDDIGLDYLDLFYIHFPLAFKFVPF 124

Query: 123 TDGNVLCIPTLDDGTVD-----VDTREWNFIKTWDLMQELPKTGKTKAVGVSNFSINNIK 177
            +      P    G  D     +   +   I T+  +++    G  K++G+SNF+ + ++
Sbjct: 125 EEKYP---PGFYTGAEDEKNGVISQEDVPLIDTYRALEKCVDEGLIKSIGISNFNGSLVQ 181

Query: 178 ALLESPSNKLVPAANQIEIHPLLPQNELIAFCKEKGIVVEAYSPFG------------SV 225
            LL     ++ P A QIE HP L Q  L+ +CK  GI V AYS FG              
Sbjct: 182 DLLRGA--RIKPVALQIEHHPYLTQENLVKYCKNVGIQVVAYSSFGPQSFIELDSELAKT 239

Query: 226 NAPLLEEQAIIDMAKKHGVAPAQLIISWSIQRGYVVLAKSVNPERIVSNFKI---FTLPE 282
              L     +  +A  H V+ +Q+++ W+ QRG  V+ KS   ER++ N  I    TL +
Sbjct: 240 TPTLFRNDTVKLIANNHKVSTSQVLLRWATQRGVAVIPKSSKKERLLENLTINDSLTLSD 299

Query: 283 DDFKIISNLSK 293
            + K IS L+K
Sbjct: 300 KELKAISALNK 310

>Ecym_7160 Chr7 (334780..335595) [816 bp, 271 aa] {ON} similar to
           Ashbya gossypii ABL209C
          Length = 271

 Score =  154 bits (388), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 93/282 (32%), Positives = 140/282 (49%), Gaps = 43/282 (15%)

Query: 11  SLKLNTGASIPVLGFGTWRSVENNGYHSVIAALKAGYRHIDAAAIYLNEEEVGRAIKD-- 68
           +  L  G  +P LG G +   +N     V  ALK GYRH D A  Y NE EVG  I    
Sbjct: 5   TYTLTNGCLMPSLGLGCYSIPKNTTAQVVHQALKCGYRHFDTAVFYGNETEVGEGIAAWL 64

Query: 69  ----SGVPREDIFITTKLWGTEQRDPEA--ALNESLKRLG-LDYVDLYLMHWPVPLKTET 121
               S   R+D+F  TKLW ++    EA  A+ + L+++  L Y+DL L+H P     + 
Sbjct: 65  AEDPSSNRRQDVFYVTKLWNSQNGYTEAKTAIQQCLQKVAPLGYIDLLLIHSPACGSAKR 124

Query: 122 ITDGNVLCIPTLDDGTVDVDTREWNFIKTWDLMQELPKTGKTKAVGVSNFSINNIKALLE 181
           +                           T++ MQE    G  K++GVSN+  ++++ L  
Sbjct: 125 LA--------------------------TYEAMQESVDAGIVKSIGVSNYERHHLQELYA 158

Query: 182 SPSNKLVPAANQIEIHPLLPQNELIAFCKEKGIVVEAYSPFGS---VNAPLLEEQAIIDM 238
            P+ K  P  NQIE+ P LP+N+L+ +CK  G+ ++AYSP G    VN P      I  +
Sbjct: 159 MPNLKHNPVVNQIEVTPWLPRNDLVDYCKSIGLAIQAYSPLGCGDRVNDPY-----IASL 213

Query: 239 AKKHGVAPAQLIISWSIQRGYVVLAKSVNPERIVSNFKIFTL 280
           A +    PAQ++I+WS+ +GY  L K+ N +R+ SN   + +
Sbjct: 214 ATQKNCTPAQILIAWSLAKGYAPLPKTQNIQRLQSNLDSYNV 255

>SAKL0F14278g Chr6 (1143922..1144782) [861 bp, 286 aa] {ON} highly
           similar to uniprot|P47137 Saccharomyces cerevisiae
           YJR096W
          Length = 286

 Score =  153 bits (386), Expect = 6e-44,   Method: Compositional matrix adjust.
 Identities = 93/282 (32%), Positives = 146/282 (51%), Gaps = 43/282 (15%)

Query: 11  SLKLNTGASIPVLGFGTWRSVENNGYHSVIAALKAGYRHIDAAAIYLNEEEVGRAI---- 66
           + KL++G ++P +G GT+    N     V  ALK GYRH+D A +Y NE EVG  I    
Sbjct: 9   AYKLSSGYTLPSIGLGTYDLPSNATSEIVYEALKCGYRHLDTAVLYGNEREVGEGILKWL 68

Query: 67  --KDSGVPREDIFITTKLWGTEQ--RDPEAALNESLKRL-GLDYVDLYLMHWPVPLKTET 121
               S   RED+F  TKLW ++    + + A+ E  +++ GL Y+DL L+H P+    + 
Sbjct: 69  KENPSSNKREDVFYATKLWNSQNGYNNAKRAIQECFEKVEGLGYIDLLLIHSPLSGSRKR 128

Query: 122 ITDGNVLCIPTLDDGTVDVDTREWNFIKTWDLMQELPKTGKTKAVGVSNFSINNIKALLE 181
           +                          +T+  MQE    G  +++GVSN+ +++I  LL 
Sbjct: 129 L--------------------------ETYKAMQEAVDKGIVRSIGVSNYGVHHIDELLN 162

Query: 182 SPSNKLVPAANQIEIHPLLPQNELIAFCKEKGIVVEAYSPFG---SVNAPLLEEQAIIDM 238
               K  P  NQIEI P L + EL  +CK +G++VEAY+P      +N P      ++ +
Sbjct: 163 WNELKYKPFVNQIEISPWLMRQELADYCKSRGLIVEAYAPLTHGYKINHP-----NVLRV 217

Query: 239 AKKHGVAPAQLIISWSIQRGYVVLAKSVNPERIVSNFKIFTL 280
           AK+ G    Q++I WS+Q GYV L K+ + +R+ SN  ++ +
Sbjct: 218 AKEAGCNSGQVLIRWSLQHGYVPLPKTKSVKRLPSNLDVYNI 259

>TBLA0A00630 Chr1 complement(126399..127385) [987 bp, 328 aa] {ON} 
          Length = 328

 Score =  154 bits (389), Expect = 7e-44,   Method: Compositional matrix adjust.
 Identities = 103/310 (33%), Positives = 161/310 (51%), Gaps = 27/310 (8%)

Query: 9   SASLKLNTGASIPVLGFGTWRSVENNGYHSVIAALKAGYRHIDAAAIYLNEEEVG----R 64
           +A + LN G  +P++G G W+   +     V  A+K GYR  D AA Y NE+EVG    +
Sbjct: 2   TAMITLNNGLKMPLVGLGCWKIPNDVCASQVYEAIKLGYRLFDGAADYGNEKEVGQGINK 61

Query: 65  AIKDSGVPREDIFITTKLWGTEQRDPEA--ALNESLKRLGLDYVDLYLMHWPVPLKTETI 122
           A+ +  V R D+FI +KLW T         AL  +L  LGLDY+DLY +H+P+  K    
Sbjct: 62  ALSEGIVKRSDLFIISKLWNTFHHPDHVKLALQRTLSDLGLDYLDLYYIHFPLAFKYVPF 121

Query: 123 TDGNVLCIPT-LDDGTV-DVDTREWNFIKTWDLMQELPKTGKTKAVGVSNFSINNIKALL 180
            +    C  T  +D  +  +  +   ++ T+  M++L   G TK++GVSN   + ++ +L
Sbjct: 122 EEKYPPCFYTGAEDAKIGKISLQNVPYLDTYRAMEKLVDEGLTKSIGVSNLQGSILQDVL 181

Query: 181 ESPSNKLVPAANQIEIHPLLPQNELIAFCKEKGIVVEAYSPFG-----------SVNAPL 229
                ++ PAA QIE HP L Q  L+ FCK + I V +YS FG           + + P 
Sbjct: 182 MGC--RIRPAALQIEHHPYLTQEHLVQFCKNENIAVVSYSSFGPQSFLELGSKRAEDTPA 239

Query: 230 LEEQAII-DMAKKHG--VAPAQLIISWSIQRGYVVLAKSVNPERIVSNFKI---FTLPED 283
           L +  +I  +A  HG  V  +++++ W+ QR   ++ KS   ER++ N  +    TL E 
Sbjct: 240 LFDHPVIKKIAAAHGKDVTTSEVLLRWATQRDIAIIPKSSRKERLLLNLNVNEKLTLTEA 299

Query: 284 DFKIISNLSK 293
           +   IS L+K
Sbjct: 300 ELLEISALNK 309

>Kwal_33.13276 s33 (153537..154445) [909 bp, 302 aa] {ON} YDL124W -
           Hypothetical ORF [contig 119] FULL
          Length = 302

 Score =  152 bits (385), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 95/289 (32%), Positives = 150/289 (51%), Gaps = 33/289 (11%)

Query: 7   NSSASLKLNTGASIPVLGFGTWRSVENNGYHSVIAALKAGYRHIDAAAIYLNEEEVGRAI 66
           N     KLN G  IPV+GFG +   + +    V +ALK GYRHID A +Y N++E  + +
Sbjct: 8   NRETRYKLNNGQQIPVIGFGVYEIPKEDTADLVYSALKDGYRHIDTAVLYKNQKEAAQGV 67

Query: 67  K----DSGVPREDIFITTKLWGTE--QRDPEAALNESLKRLG--LDYVDLYLMHWPVPLK 118
           +    ++G  RE+I+ TTKLW ++  + + E AL E    +   + YVDL L+H P    
Sbjct: 68  RKYLDETGEARENIWFTTKLWDSQFGREETEKALQEVAADVKEYIGYVDLLLLHSPRGGA 127

Query: 119 TETITDGNVLCIPTLDDGTVDVDTREWNFIKTWDLMQELPKTGKTKAVGVSNFSINNIKA 178
              +    +L     + G+                     K  + K++GVSNF +++++ 
Sbjct: 128 KRRLETWAILEQAVQEPGS---------------------KALEIKSIGVSNFGVDHLEE 166

Query: 179 LLESPSNKLVPAANQIEIHPLLPQNELIAFCKEKGIVVEAYSPFGSVNAPLLEEQAIIDM 238
           LL+    K+ P  +Q+E+HP LP+ EL  + KEK I  EAYSP        L++  ++ +
Sbjct: 167 LLKVA--KVKPVLDQLELHPWLPRVELRKYLKEKDIFAEAYSPL--TQGYRLQDPELLAL 222

Query: 239 AKKHGVAPAQLIISWSIQRGYVVLAKSVNPERIVSNFKIFTLPEDDFKI 287
             K G+  A +++ WS  +G+VVL KS NPERI  N  +     D +K+
Sbjct: 223 EAKTGINKAVILLRWSFLQGFVVLVKSSNPERIRQNLAVLPSENDSWKV 271

>KLTH0G02420g Chr7 complement(188767..189636) [870 bp, 289 aa] {ON}
           similar to uniprot|P47137 Saccharomyces cerevisiae
           YJR096W
          Length = 289

 Score =  152 bits (383), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 99/296 (33%), Positives = 157/296 (53%), Gaps = 40/296 (13%)

Query: 7   NSSASLKLNTGASIPVLGFGTWRSVENNGYHSVIAALKAGYRHIDAAAIYLNEEE----V 62
            +S +  L  G  IPVLGFGT+ + +      V AA K GYRH+D A +Y NE E    V
Sbjct: 4   TASTTKTLTNGVKIPVLGFGTYETPKEKAESIVHAAFKQGYRHVDTAQLYENERECATAV 63

Query: 63  GRAIKDS-GVPREDIFITTKLWGTEQRDPEA--ALNESLKRLG-LDYVDLYLMHWPVPLK 118
            + +K+S  V R+ +F TTK+ G      +A  ++ ESL+    L+YVDL+L+H P    
Sbjct: 64  AKFLKESPKVSRDQVFYTTKVAGDNHGYEKAKKSIIESLEMAKELEYVDLFLIHNPC--- 120

Query: 119 TETITDGNVLCIPTLDDGTVDVDTREWNFIKTWDLMQELPKTGKTKAVGVSNFSINNIKA 178
                               + + R    + T+  +QE  K GK KA+GVS++SI +++ 
Sbjct: 121 -------------------AETEKR----LGTYKALQEFYKAGKIKAIGVSSYSIKHLEE 157

Query: 179 LLESPSNKLVPAANQIEIHPLLPQNELIAFCKEKGIVVEAYSPFGSVNAPLLEEQAIIDM 238
           L      ++ P  NQ E++P L + +L+ +CKE+ +V+EA+SP     +    +  +  +
Sbjct: 158 LYSWEGLEVKPMVNQFELNPWLTRKDLVKYCKERDLVIEAFSPI--TRSKRFSDPVVQKL 215

Query: 239 AKKH--GVAPAQLIISWSIQRGYVVLAKSVNPERIVSNFKI--FTLPEDDFKIISN 290
            K+   G  PAQL+I WS+Q G+V L KSV+ +R  SN     F +  +D K +++
Sbjct: 216 LKESYPGRTPAQLLIRWSLQMGFVPLPKSVHEDRAESNLHALDFEISAEDMKTLTH 271

>Smik_8.182 Chr8 (299804..300787) [984 bp, 327 aa] {ON} YHR104W
           (REAL)
          Length = 327

 Score =  153 bits (386), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 101/310 (32%), Positives = 154/310 (49%), Gaps = 30/310 (9%)

Query: 9   SASLKLNTGASIPVLGFGTWRSVENNGYHSVIAALKAGYRHIDAAAIYLNEEEVG----R 64
           S+ + LN G  +P++G G W+  +    + +  A+K GYR  D A  Y NE+EVG    R
Sbjct: 2   SSLVTLNNGLKMPLVGLGCWKIDKKVCANQIYEAIKLGYRLFDGACDYGNEKEVGEGIRR 61

Query: 65  AIKDSGVPREDIFITTKLWGTEQRDPEA--ALNESLKRLGLDYVDLYLMHWPVPLK---- 118
           AI +  V R+D+F+ +KLW           AL ++L  +GLDY+DLY +H+P+  K    
Sbjct: 62  AISEGLVARKDVFVVSKLWNNFHHPDHVKLALKKTLNDMGLDYLDLYYIHFPIAFKYVPF 121

Query: 119 TETITDGNVLCIPTLDDGTVDVDTREWNFIKTWDLMQELPKTGKTKAVGVSNFSINNIKA 178
            E    G    +   D+    +       + T+  ++E    G  K++G+SNF  + ++ 
Sbjct: 122 EEKYPPGFYTGVD--DEKKGHITEAHVPILDTYRALEECVDEGLIKSIGISNFQGSLVQD 179

Query: 179 LLESPSNKLVPAANQIEIHPLLPQNELIAFCKEKGIVVEAYSPFG------------SVN 226
           LL     ++ P A QIE HP L Q  L+ FC+   I V AYS FG               
Sbjct: 180 LLR--GCRIKPVALQIEHHPYLTQEHLVEFCRLHNIQVVAYSSFGPQSFIEMDLQLAKTT 237

Query: 227 APLLEEQAIIDMAKKH-GVAPAQLIISWSIQRGYVVLAKSVNPERIVSNFKI---FTLPE 282
             L E   I  ++  H G   +Q+++ W+ QRG  V+ KS   ER++ N +I   FTL E
Sbjct: 238 PTLFENDVIKKISLNHPGSTTSQVLLRWATQRGIAVIPKSSKKERLLGNLEIEKKFTLTE 297

Query: 283 DDFKIISNLS 292
            + K IS L+
Sbjct: 298 QELKEISALN 307

>Kwal_47.18893 s47 (1017098..1017967) [870 bp, 289 aa] {ON} YJR096W
           - Hypothetical ORF [contig 189] FULL
          Length = 289

 Score =  152 bits (383), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 97/296 (32%), Positives = 149/296 (50%), Gaps = 44/296 (14%)

Query: 9   SASLKLNTGASIPVLGFGTWRSVENNGYHSVIAALKAGYRHIDAAAIYLNEEEVGRAI-- 66
           S +  L  G  IPVL  G + + +    H+V  ALK+GYRH+D A +Y NE EVG  I  
Sbjct: 6   STTKTLTNGVKIPVLALGVYEAPKEETEHTVFTALKSGYRHVDCAQLYGNEREVGLGIAK 65

Query: 67  ---KDSGVPREDIFITTKLWGTEQRDPEAALNESLKRLG----LDYVDLYLMHWPVPLKT 119
              +   V R +IF TTK+ G +    E A    +K L     ++Y+DL L+H P+    
Sbjct: 66  FLKETPNVSRSEIFYTTKVSG-DNHGYEKAKKSIIKSLEDVKEIEYIDLLLIHNPIAATE 124

Query: 120 ETITDGNVLCIPTLDDGTVDVDTREWNFIKTWDLMQELPKTGKTKAVGVSNFSINNIKAL 179
           E +                           TW  +QE    GK +A+GVSN+SI +++ L
Sbjct: 125 ERLG--------------------------TWKALQEAYAEGKVRAIGVSNYSIKHLEEL 158

Query: 180 LESPSNKLVPAANQIEIHPLLPQNELIAFCKEKGIVVEAYSPF---GSVNAPLLEEQAII 236
                 K+ P  NQ E++P L + EL  +C++KG+V+EA+SP       + P L+E    
Sbjct: 159 YNWEGLKVEPMVNQFELNPWLTRKELCEYCEKKGMVLEAFSPLTRGQKFSDPQLQELIKT 218

Query: 237 DMAKKHGVAPAQLIISWSIQRGYVVLAKSVNPERIVSNFKI--FTLPEDDFKIISN 290
               +    PAQ++I WS+Q G++ L KS N +R +SN +   F + + D K +++
Sbjct: 219 SYPNQ---TPAQILIRWSLQMGFIPLPKSSNSKRQISNLQALDFEISDKDMKALTH 271

>CAGL0C04543g Chr3 (434137..435000) [864 bp, 287 aa] {ON} highly
           similar to uniprot|P47137 Saccharomyces cerevisiae
           YJR096w
          Length = 287

 Score =  150 bits (379), Expect = 8e-43,   Method: Compositional matrix adjust.
 Identities = 96/278 (34%), Positives = 142/278 (51%), Gaps = 43/278 (15%)

Query: 13  KLNTGASIPVLGFGTWRSVENNGYHSVIAALKAGYRHIDAAAIYLNEEEVGRAIKD---- 68
           +L  G  IP L  GT+    +     V  ALK GYRH D A +Y NE EVG+ I +    
Sbjct: 12  ELQDGRKIPSLALGTYDIPNSVTAKVVTEALKCGYRHFDTAVLYGNEREVGQGIVNWINE 71

Query: 69  --SGVPREDIFITTKLWGTEQRDPEA--ALNESLKRL-GLDYVDLYLMHWPVPLKTETIT 123
             +   RED+F TTKLW ++    EA  A+ E ++++ GL Y+D+ L+H P+        
Sbjct: 72  DKAHNKREDVFYTTKLWNSQNGYNEAKRAIKECMQKVSGLGYIDMLLIHSPL-------- 123

Query: 124 DGNVLCIPTLDDGTVDVDTREWNFIKTWDLMQELPKTGKTKAVGVSNFSINNIKALLESP 183
                             + +   ++TW  MQE    G  K++GVSN+  ++I+ LL   
Sbjct: 124 ------------------SGQRRRLETWKAMQEAVDEGIVKSIGVSNYGKHHIEELLGWD 165

Query: 184 SNKLVPAANQIEIHPLLPQNELIAFCKEKGIVVEAYSPFG---SVNAPLLEEQAIIDMAK 240
             K  P  NQIEI P + + EL  +CK   +VVEAY+P      +N P L E     ++K
Sbjct: 166 ELKYKPVVNQIEISPWVMRQELADYCKSVNLVVEAYAPMAHGYKMNDPGLRE-----ISK 220

Query: 241 KHGVAPAQLIISWSIQRGYVVLAKSVNPERIVSNFKIF 278
           + G+ P QL+I WS+Q GY+ L K+    R+ SN  ++
Sbjct: 221 ETGMNPGQLLIRWSLQHGYLPLPKTKTVARLASNLDVY 258

>Kpol_1013.82 s1013 complement(200564..201421) [858 bp, 285 aa] {ON}
           complement(200564..201421) [858 nt, 286 aa]
          Length = 285

 Score =  150 bits (378), Expect = 9e-43,   Method: Compositional matrix adjust.
 Identities = 101/289 (34%), Positives = 143/289 (49%), Gaps = 39/289 (13%)

Query: 13  KLNTGASIPVLGFGTWRSVENNGYHSVIAALKAGYRHIDAAAIYLNEEEVGRAIKD---- 68
           KL+ G SIP +G GT+    N   + V  ALKAGYRH D A +Y NEEEVG+ I      
Sbjct: 10  KLSNGYSIPSVGLGTYDIPNNVTANVVYEALKAGYRHFDTAVLYGNEEEVGQGIHRWLLE 69

Query: 69  --SGVPREDIFITTKLWGTEQRDPEA--ALNESLKRL-GLDYVDLYLMHWPVPLKTETIT 123
                 RE +F TTKLW ++    +A  A+   L ++  L+Y+DL L+H P+        
Sbjct: 70  DPENNRREAVFYTTKLWNSQNGYEKATKAIKNCLDKVKALEYIDLLLIHSPL-------- 121

Query: 124 DGNVLCIPTLDDGTVDVDTREWNFIKTWDLMQELPKTGKTKAVGVSNFSINNIKALLESP 183
            G  L                   ++TW  MQE    G  K++GVSN+ +++I  LL   
Sbjct: 122 GGTKL------------------RLETWKAMQEAVDHGMVKSIGVSNYGMHHIDELLTWQ 163

Query: 184 SNKLVPAANQIEIHPLLPQNELIAFCKEKGIVVEAYSPFGSVNAPLLEEQAIIDMAKKHG 243
             K  P  NQIEI P L + EL  +CK   I VE YSP    +   L +Q +  +A + G
Sbjct: 164 YLKYKPVVNQIEISPWLMRQELADYCKSNSIFVECYSPL--THGYKLNDQDLKKVANETG 221

Query: 244 VAPAQLIISWSIQRGYVVLAKSVNPERIVSNFKI--FTLPEDDFKIISN 290
               Q++I WS+Q GY+ L K+    R+ +N  +  F L  D   I+ +
Sbjct: 222 KNVGQVLIRWSLQHGYIPLPKTRTINRLKTNLDVYDFNLTSDQMTILDH 270

>Suva_15.300 Chr15 (525715..526698) [984 bp, 327 aa] {ON} YHR104W
           (REAL)
          Length = 327

 Score =  150 bits (378), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 101/310 (32%), Positives = 156/310 (50%), Gaps = 30/310 (9%)

Query: 9   SASLKLNTGASIPVLGFGTWRSVENNGYHSVIAALKAGYRHIDAAAIYLNEEEVG----R 64
           S+ + LN G  +P++G G W+       + +  A+K GYR  D A  Y NE+EVG    +
Sbjct: 2   SSLVTLNNGCKMPLVGLGCWKIDNKVCANQIYEAIKLGYRLFDGACDYGNEKEVGEGIRK 61

Query: 65  AIKDSGVPREDIFITTKLWGTEQRDPEA--ALNESLKRLGLDYVDLYLMHWPVPLK---- 118
           AI +  V R+DIF+T+KLW           AL ++L  +GLDY+DLY +H+P+  K    
Sbjct: 62  AISEGLVTRKDIFVTSKLWNNFHHPDHVKLALKKTLDDMGLDYLDLYYIHFPIAFKYVPF 121

Query: 119 TETITDGNVLCIPTLDDGTVDVDTREWNFIKTWDLMQELPKTGKTKAVGVSNFSINNIKA 178
            E    G        DD    +       I T+  ++     G  K++G+SNF  + ++ 
Sbjct: 122 EEKYPPG--FYTGAEDDKRGHITEAHVPIIDTYRALEACVDEGLIKSIGISNFQGSLVQD 179

Query: 179 LLESPSNKLVPAANQIEIHPLLPQNELIAFCKEKGIVVEAYSPFG-----------SVNA 227
           LL     ++ P A QIE HP L Q  L+ +CK   I V AYS FG           + + 
Sbjct: 180 LLR--GCRIKPVALQIEHHPYLTQEHLVDYCKLHDIQVVAYSSFGPQSFIEMDLGLAKST 237

Query: 228 P-LLEEQAIIDMAKKH-GVAPAQLIISWSIQRGYVVLAKSVNPERIVSNFKI---FTLPE 282
           P L E   +  +++ H G   +Q+++ W+ QRG  V+ KS   ER++ N +I    TL +
Sbjct: 238 PTLFENDVVKKVSENHPGSTTSQVLLRWATQRGIAVIPKSSKKERLLGNLEIEKKLTLTD 297

Query: 283 DDFKIISNLS 292
            + K IS+L+
Sbjct: 298 QELKEISSLN 307

>TBLA0F01720 Chr6 complement(430289..431269) [981 bp, 326 aa] {ON} 
          Length = 326

 Score =  148 bits (373), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 101/311 (32%), Positives = 156/311 (50%), Gaps = 31/311 (9%)

Query: 9   SASLKLNTGASIPVLGFGTWRSVENNGYHSVIAALKAGYRHIDAAAIYLNEEEVG----R 64
           S+   LN G  +P++G G W+         V  A+K GYR  D A  Y NE+EVG    R
Sbjct: 2   SSLAALNNGLKMPMVGLGCWKIPNTVCAEQVYQAIKLGYRLFDGAEDYGNEKEVGQGIRR 61

Query: 65  AIKDSGVPREDIFITTKLWGTEQRDPEA--ALNESLKRLGLDYVDLYLMHWPVPLKTETI 122
           AI +  V R D+FI +KLW T         A+ ++L  LGLDY+DLY +H+P+  K   I
Sbjct: 62  AIDEKIVKRSDLFIVSKLWNTYHHPDHVKLAVKKTLSDLGLDYLDLYYIHFPLAFKFVPI 121

Query: 123 TDGNVLCIPTLDDGTVD-----VDTREWNFIKTWDLMQELPKTGKTKAVGVSNFSINNIK 177
            +      P    G  D     +  ++  ++ T+  M+ L + G  K++GVSN     ++
Sbjct: 122 EEKYP---PGFYTGKEDAAQGKISLQKVPYLDTYHAMEALVEEGLIKSIGVSNLQGGLLQ 178

Query: 178 ALLESPSNKLVPAANQIEIHPLLPQNELIAFCKEKGIVVEAYSPFGSV-----------N 226
            +L     K+ P   QIE HP L Q+ L+ +CK + I+V AYS FG             +
Sbjct: 179 DVLMGC--KIKPVTLQIEHHPYLTQSRLVDYCKREQIIVVAYSSFGQQSYLELGSELKED 236

Query: 227 AP-LLEEQAIIDMAKKHGVAPAQLIISWSIQRGYVVLAKSVNPERIVSNFKI---FTLPE 282
            P L +   I  +A K+ V  +++++ W+ Q G  V+ KS   ER++ N  I    TL  
Sbjct: 237 TPNLFDHPVIKRIASKYNVTTSEVLLRWANQNGVAVIPKSSKKERLLMNLNIESTLTLSN 296

Query: 283 DDFKIISNLSK 293
           ++   ISN+++
Sbjct: 297 EELVEISNINR 307

>SAKL0F02574g Chr6 complement(220827..221696) [870 bp, 289 aa] {ON}
           similar to uniprot|P47137 Saccharomyces cerevisiae
           YJR096W
          Length = 289

 Score =  145 bits (367), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 92/289 (31%), Positives = 150/289 (51%), Gaps = 40/289 (13%)

Query: 14  LNTGASIPVLGFGTWRSVENNGYHSVIAALKAGYRHIDAAAIYLNEEEVGRAI-----KD 68
           L  G  +P LG G +++ +    + V  ALK GYR +D+A +Y NE E    I     + 
Sbjct: 11  LKNGVKMPCLGLGLYQTPKEETTNIVHNALKLGYRQVDSAQLYGNEREACLGITKFLEES 70

Query: 69  SGVPREDIFITTKLWGTEQ--RDPEAALNESLKRLG-LDYVDLYLMHWPVPLKTETITDG 125
             V R DIF TTK+   +Q     + ++ ESL R+  LDY+DL+L+H P+          
Sbjct: 71  PKVSRSDIFFTTKIKTQDQGYESAKKSIEESLNRVKELDYIDLFLIHAPL---------- 120

Query: 126 NVLCIPTLDDGTVDVDTREWNFIKTWDLMQELPKTGKTKAVGVSNFSINNIKALLESPSN 185
                           T +   + TW   QE  +TGK KA+GVSN+ I +++ + +    
Sbjct: 121 ----------------TNKEKRLGTWKAFQEYYETGKIKAIGVSNYGIQHLEEMYQWDGL 164

Query: 186 KLVPAANQIEIHPLLPQNELIAFCKEKGIVVEAYSPFGSVNAPLLEEQAIIDMAKKH--G 243
           K+ P  NQ E++P L + EL  +C +KG+V++AYSP     A  L++  ++ + +     
Sbjct: 165 KIDPMVNQYELNPWLTRKELSNYCHQKGMVIQAYSPL--TRARRLQDPELVKLVEDSYPE 222

Query: 244 VAPAQLIISWSIQRGYVVLAKSVNPERIVSNFKI--FTLPEDDFKIISN 290
              AQ++++WS+Q G+V L K+V+ +R+  N K   F L   D K +++
Sbjct: 223 QTSAQILVNWSLQMGFVPLVKTVHEDRLKENIKSCDFELSSADLKKLTH 271

>ZYRO0G17600g Chr7 (1455426..1456277) [852 bp, 283 aa] {ON} highly
           similar to uniprot|P47137 Saccharomyces cerevisiae
           YJR096W
          Length = 283

 Score =  145 bits (366), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 95/279 (34%), Positives = 142/279 (50%), Gaps = 40/279 (14%)

Query: 17  GASIPVLGFGTWRSVENNGYHSVIAALKAGYRHIDAAAIYLNEEEVGRAIKD------SG 70
           G  IP L  G +    +   + V  ALK GYRH D A +Y NE+EVG  I        + 
Sbjct: 12  GIKIPSLALGCYDIPRSQTANVVYEALKRGYRHFDTAVLYGNEKEVGEGIYKWLKEDPAN 71

Query: 71  VPREDIFITTKLWGTEQRDPEA--ALNESLKRLG-LDYVDLYLMHWPVPLKTETITDGNV 127
             RED+F TTKLW ++     A   ++E + ++  L Y+DL L+H P             
Sbjct: 72  NKREDVFYTTKLWNSQNGYSPAKRGISECMNKVKELGYIDLLLIHSP------------- 118

Query: 128 LCIPTLDDGTVDVDTREWNFIKTWDLMQELPKTGKTKAVGVSNFSINNIKALLESPSNKL 187
           L  P                ++T+  MQE    G  K++GVSN+   +I+ L +    K 
Sbjct: 119 LSGPR-------------RRLETYQAMQEAVDDGIVKSIGVSNYGKQHIEELYKWDKLKH 165

Query: 188 VPAANQIEIHPLLPQNELIAFCKEKGIVVEAYSPFGSVNAPLLEEQAIIDMAKKHGVAPA 247
            P ANQIEI P   + +L ++C+ KG++VEA+SP    +   L+E  ++ +AKK G    
Sbjct: 166 KPVANQIEISPWCMREDLTSWCQSKGLIVEAFSPL--THGYKLKEPGLVSLAKKLGRDTG 223

Query: 248 QLIISWSIQRGYVVLAKSVNPERIVSNFKIFTL---PED 283
           Q++I WS+QRG + L K+ NP R+ SN +++     PED
Sbjct: 224 QVLIRWSLQRGLLPLPKTQNPARLSSNLEVYDFELTPED 262

>Kwal_47.18219 s47 (737925..738806) [882 bp, 293 aa] {ON} YJR096W -
           Hypothetical ORF [contig 197] FULL
          Length = 293

 Score =  145 bits (366), Expect = 8e-41,   Method: Compositional matrix adjust.
 Identities = 92/277 (33%), Positives = 145/277 (52%), Gaps = 37/277 (13%)

Query: 11  SLKLNTGASIPVLGFGTWRSVENNGYHSVIAALKAGYRHIDAAAIYLNEEEVGRAIKD-- 68
           + KL++G  +P +G GT+          V  ALK+GYRH+D A +Y NE EVG+ I+   
Sbjct: 16  AYKLSSGYILPSIGLGTYDIPRAETSEVVYQALKSGYRHLDTAVLYGNEHEVGQGIQKWL 75

Query: 69  ----SGVPREDIFITTKLWGTEQ--RDPEAALNESLKRLG-LDYVDLYLMHWPVPLKTET 121
                   R+D+F TTKLW ++    + + A+ E ++++  L Y+DL L+H P+      
Sbjct: 76  EEDPEHNKRQDVFYTTKLWNSQNGYSNAKRAIKECMEKVSPLGYIDLLLIHSPL------ 129

Query: 122 ITDGNVLCIPTLDDGTVDVDTREWNFIKTWDLMQELPKTGKTKAVGVSNFSINNIKALLE 181
                         GT          ++T+  MQE    G  +++GVSN+  ++I  LL 
Sbjct: 130 -------------SGTR-------RRLETYKAMQEAVDEGIVRSIGVSNYGKHHIDELLT 169

Query: 182 SPSNKLVPAANQIEIHPLLPQNELIAFCKEKGIVVEAYSPFGSVNAPLLEEQAIIDMAKK 241
               K  P  NQIEI P + + +L  +CK KG+VVEA+SP    +   L+   ++ +AK+
Sbjct: 170 WKELKHKPVVNQIEISPWIMRQDLADYCKSKGLVVEAFSPL--THGYKLKHPDVLLVAKE 227

Query: 242 HGVAPAQLIISWSIQRGYVVLAKSVNPERIVSNFKIF 278
            G    +++I WS+Q GYV L KS + ER+  N K +
Sbjct: 228 TGTDAGRVLIRWSLQHGYVPLPKSRSVERLKGNVKAY 264

>YJR096W Chr10 (611195..612043) [849 bp, 282 aa] {ON} Putative
           xylose and arabinose reductase; member of the aldo-keto
           reductase (AKR) family; GFP-fusion protein is induced in
           response to the DNA-damaging agent MMS
          Length = 282

 Score =  145 bits (365), Expect = 8e-41,   Method: Compositional matrix adjust.
 Identities = 96/289 (33%), Positives = 146/289 (50%), Gaps = 39/289 (13%)

Query: 13  KLNTGASIPVLGFGTWRSVENNGYHSVIAALKAGYRHIDAAAIYLNEEEVGRAI-----K 67
           KL+ G  IP +  GT+    +     V   +K GYRH D A +Y NE+EVG  I     +
Sbjct: 7   KLSNGFKIPSIALGTYDIPRSQTAEIVYEGVKCGYRHFDTAVLYGNEKEVGDGIIKWLNE 66

Query: 68  DSG-VPREDIFITTKLWGTEQ--RDPEAALNESLKRL-GLDYVDLYLMHWPVPLKTETIT 123
           D G   RE+IF TTKLW ++   +  +AA+ + L  + GL Y+DL L+H P+        
Sbjct: 67  DPGNHKREEIFYTTKLWNSQNGYKRAKAAIRQCLNEVSGLQYIDLLLIHSPL-------- 118

Query: 124 DGNVLCIPTLDDGTVDVDTREWNFIKTWDLMQELPKTGKTKAVGVSNFSINNIKALLESP 183
           +G+ L                   ++TW  MQE    G  K++GVSN+   +I  LL  P
Sbjct: 119 EGSKL------------------RLETWRAMQEAVDEGLVKSIGVSNYGKKHIDELLNWP 160

Query: 184 SNKLVPAANQIEIHPLLPQNELIAFCKEKGIVVEAYSPFGSVNAPLLEEQAIIDMAKKHG 243
             K  P  NQIEI P + + EL  +CK KG+VVEA++P    +   +    ++ + K+  
Sbjct: 161 ELKHKPVVNQIEISPWIMRQELADYCKSKGLVVEAFAPL--CHGYKMTNPDLLKVCKEVD 218

Query: 244 VAPAQLIISWSIQRGYVVLAKSVNPERIVSNFKI--FTLPEDDFKIISN 290
             P Q++I WS+Q GY+ L K+   +R+  N     F L ++  K + +
Sbjct: 219 RNPGQVLIRWSLQHGYLPLPKTKTVKRLEGNLAAYNFELSDEQMKFLDH 267

>KLLA0F05775g Chr6 (560270..561199) [930 bp, 309 aa] {ON} highly
           similar to uniprot|Q07551 Saccharomyces cerevisiae
           YDL124W NADPH-dependent alpha-keto amide reductase
           reduces aromatic alpha-keto amides aliphatic alpha-keto
           esters and aromatic alpha-keto esters
          Length = 309

 Score =  145 bits (366), Expect = 9e-41,   Method: Compositional matrix adjust.
 Identities = 106/313 (33%), Positives = 165/313 (52%), Gaps = 53/313 (16%)

Query: 14  LNTGASIP---VLGFGT--WRSVENNGYHS--VIAALKA------GYRHIDAAAIYLNEE 60
           L+ G  IP   ++G GT  ++S E +   S  ++  +K       G  HIDAA IY    
Sbjct: 9   LSNGNKIPAVAIVGTGTAWYKSEETDATFSQPLVDIVKKTLDTVPGVVHIDAAEIYRTYP 68

Query: 61  EVGRAIKDSGVPREDIFITTKLWGTEQ--RDPEAALNESLKRLGLDYVDLYLMHWPVPLK 118
           E+G A+KD+  PR++IFIT K    +Q   +P+ AL  SLK+LG+DYVDLYL+H P+   
Sbjct: 69  ELGAALKDTKKPRDEIFITDKYSTLKQLSENPKVALETSLKKLGVDYVDLYLLHSPI--- 125

Query: 119 TETITDGNVLCIPTLDDGTVDVDTREWNFIKTWDLMQELPKTGKTKAVGVSNFSINNIKA 178
                         + +  +DV+         W  ++EL K+GK K +GVSNF++ +++ 
Sbjct: 126 --------------IKESKLDVEA-------NWKYLEELYKSGKAKNIGVSNFAVKDLEK 164

Query: 179 LLESPSNKLVPAANQIEIHPLLPQNE---LIAFCKEKGIVVEAYSPFGSVNA------PL 229
           LL     K  P  NQIE  P L QN+   ++ F ++ GI++EAYSP G +         L
Sbjct: 165 LLAVAEVK--PQVNQIEFSPFL-QNQTPGIVEFSQKNGILLEAYSPLGPLQRRPEDADKL 221

Query: 230 LEEQAIIDMAKKHGVAPAQLIISWSIQRGYVVLAKSVNPERIVSNFKI--FTLPEDDFKI 287
              Q I +++KK+  + AQ+++SW  +RG + +  S   ERI     I  F+L  ++ + 
Sbjct: 222 PFYQYIAELSKKYNKSEAQILLSWVYERGILPVTTSSKIERIQQAQDIFSFSLANEEVQK 281

Query: 288 ISNLSKVHGEKRV 300
           I+ L   H   R+
Sbjct: 282 ITQLGLQHPALRL 294

>KAFR0G00920 Chr7 complement(215664..216524) [861 bp, 286 aa] {ON}
           Anc_7.468 YJR096W
          Length = 286

 Score =  144 bits (363), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 102/294 (34%), Positives = 148/294 (50%), Gaps = 44/294 (14%)

Query: 11  SLKLNTGASIPVLGFGTWRSVENNGYHSVIAALKAGYRHIDAAAIYLNEEEVGRA----- 65
           + KL++   IP +  GT+    +     V  AL  GYRH D A +Y NEEEV +      
Sbjct: 8   TYKLSSNYYIPTVALGTYDLPSSETTEIVENALDVGYRHFDTAVLYDNEEEVAQGISNWL 67

Query: 66  IKDSGVPREDIFITTKLWGTE--QRDPEAALNESLKRL-GLDYVDLYLMHWPVPLKTETI 122
           I+     R++IF TTKLW ++   ++ + A+ E + ++  L Y+DL LMH P+       
Sbjct: 68  IRHPETKRDEIFYTTKLWNSQFGYQNAKRAIRECVDKVQDLKYIDLLLMHSPI------- 120

Query: 123 TDGNVLCIPTLDDGTVDVDTREWNFIKTWDLMQELPKTGKTKAVGVSNFSINNIKALLES 182
                        G   +  RE    +TW  MQE    G  K++GVSNF I ++K L + 
Sbjct: 121 -------------GGPQI--RE----ETWRAMQEAVDEGIVKSIGVSNFGIKHLKELFQW 161

Query: 183 PSNKLVPAANQIEIHPLLPQNELIAFCKEKGIVVEAYSPFG---SVNAP-LLEEQAIIDM 238
              K  P  NQIEI P L + EL  FCK +G+VVEAY+P      +N P L++    ++ 
Sbjct: 162 DGLKYRPVVNQIEISPWLMRQELADFCKMEGLVVEAYAPLTHGYKINHPDLIKISNELNN 221

Query: 239 AKKHGVAPAQLIISWSIQRGYVVLAKSVNPERIVSNFKI--FTLPEDDFKIISN 290
            K  G    Q++I WS+Q GYV L K+    R+ SN  +  F L ED  K + +
Sbjct: 222 TKNTG----QILIRWSLQHGYVPLPKTKTIGRLESNLDVYDFELTEDQMKFLDH 271

>KLTH0G05786g Chr7 complement(460135..460995) [861 bp, 286 aa] {ON}
           highly similar to uniprot|P47137 Saccharomyces
           cerevisiae YJR096W
          Length = 286

 Score =  144 bits (362), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 91/277 (32%), Positives = 143/277 (51%), Gaps = 37/277 (13%)

Query: 11  SLKLNTGASIPVLGFGTWRSVENNGYHSVIAALKAGYRHIDAAAIYLNEEEVGRAIKD-- 68
           + KL++G  +P LG GT+          V  ALKAGYRH+D A +Y NE EVG  ++   
Sbjct: 9   AYKLSSGYVLPSLGLGTYDIPRAETAEVVYQALKAGYRHLDTAVLYGNEREVGEGVEKWL 68

Query: 69  ----SGVPREDIFITTKLWGTEQ--RDPEAALNESLKRLG-LDYVDLYLMHWPVPLKTET 121
                   R D+F TTKLW ++    + + A+ E L ++  L Y+D+ L+H P+      
Sbjct: 69  KEDPKNHRRHDVFYTTKLWNSQNGYSNAKRAIQECLDKVRPLGYIDMLLIHSPL------ 122

Query: 122 ITDGNVLCIPTLDDGTVDVDTREWNFIKTWDLMQELPKTGKTKAVGVSNFSINNIKALLE 181
                         GT          ++T+  MQE    G  +++GVSN+  ++I  LL 
Sbjct: 123 -------------SGTR-------RRLETYKAMQEAVDAGIVRSIGVSNYGKHHIDELLA 162

Query: 182 SPSNKLVPAANQIEIHPLLPQNELIAFCKEKGIVVEAYSPFGSVNAPLLEEQAIIDMAKK 241
               K  P  NQIEI P + + +L  +CK KG+VVEA+SP    +   ++   ++ +A++
Sbjct: 163 WEELKHKPVVNQIEISPWVMRQDLADYCKSKGLVVEAFSPL--THGYKIKHPNVVRVAEE 220

Query: 242 HGVAPAQLIISWSIQRGYVVLAKSVNPERIVSNFKIF 278
            G    Q++I WS+Q GYV L KS + ER+  N +++
Sbjct: 221 VGRNTGQVLIRWSLQHGYVPLPKSRSVERLKGNLEVY 257

>NCAS0H00560 Chr8 complement(96020..96874) [855 bp, 284 aa] {ON}
           Anc_7.468
          Length = 284

 Score =  143 bits (361), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 89/288 (30%), Positives = 146/288 (50%), Gaps = 39/288 (13%)

Query: 14  LNTGASIPVLGFGTWRSVENNGYHSVIAALKAGYRHIDAAAIYLNEEEVGRAIKD----- 68
            N G  IP +  GT+   ++     V  ALKAGYRH D A +Y NE +VG  I       
Sbjct: 10  FNNGNQIPSIALGTYDIPQSITAKIVYEALKAGYRHFDTAVLYGNEHQVGEGILQWIQED 69

Query: 69  -SGVPREDIFITTKLWGTEQ--RDPEAALNESLKRL-GLDYVDLYLMHWPVPLKTETITD 124
                R D+F TTKLW ++      + A+ E L ++ GL Y+D+ L+H P+  +T+ +  
Sbjct: 70  PQQNKRSDVFYTTKLWNSQNGYHQAQTAIKECLAKVHGLQYIDMLLIHSPLEGRTKRL-- 127

Query: 125 GNVLCIPTLDDGTVDVDTREWNFIKTWDLMQELPKTGKTKAVGVSNFSINNIKALLESPS 184
                                   +TW  MQE  ++G  K +GVSN+   +++ LL+   
Sbjct: 128 ------------------------ETWRAMQEAVESGLVKNIGVSNYGRQHVEELLQWER 163

Query: 185 NKLVPAANQIEIHPLLPQNELIAFCKEKGIVVEAYSPFGSVNAPLLEEQAIIDMAKKHGV 244
             + P  NQIEI P + ++EL  +CK  G+VVEA++P    +   L +  ++ ++K+ G 
Sbjct: 164 LTIKPVVNQIEISPWVMRSELADYCKSVGLVVEAFAPL--THGYKLHDADLVRVSKEVGR 221

Query: 245 APAQLIISWSIQRGYVVLAKSVNPERIVSNFKI--FTLPEDDFKIISN 290
           +  Q++I WS+Q GY+ L K+   +R+  N +   F L  +  ++I +
Sbjct: 222 STVQVLIRWSLQHGYLPLPKTKTVKRLEENLEAYNFQLTTEQMQLIDH 269

>Suva_12.184 Chr12 (289608..290456) [849 bp, 282 aa] {ON} YJR096W
           (REAL)
          Length = 282

 Score =  142 bits (359), Expect = 6e-40,   Method: Compositional matrix adjust.
 Identities = 91/289 (31%), Positives = 142/289 (49%), Gaps = 39/289 (13%)

Query: 13  KLNTGASIPVLGFGTWRSVENNGYHSVIAALKAGYRHIDAAAIYLNEEEVGRAIKD---- 68
           K + G  +P +  GT+    +     V   +K GYRH D A +Y NE+EVG  I      
Sbjct: 7   KFSNGYKVPSIALGTYDIPRSQTAEIVYEGIKCGYRHFDTAVLYGNEKEVGDGITKWLHE 66

Query: 69  --SGVPREDIFITTKLWGTEQ--RDPEAALNESLKRL-GLDYVDLYLMHWPVPLKTETIT 123
                 RED+F TTKLW ++   +  + A+ + L  + GL Y+DL L+H P+        
Sbjct: 67  DPENNKREDVFYTTKLWNSQNGYKRAKVAIQQCLNEVSGLKYIDLLLIHSPL-------- 118

Query: 124 DGNVLCIPTLDDGTVDVDTREWNFIKTWDLMQELPKTGKTKAVGVSNFSINNIKALLESP 183
           +G+ L                   ++TW  MQE    G  K++GVSN+   ++  LL   
Sbjct: 119 EGSKL------------------RLETWQAMQEAVDEGMVKSIGVSNYGKKHVDELLNWS 160

Query: 184 SNKLVPAANQIEIHPLLPQNELIAFCKEKGIVVEAYSPFGSVNAPLLEEQAIIDMAKKHG 243
             K  P  NQIEI P + + EL  +CK K +VVEA++P    +   + +  ++ + K+  
Sbjct: 161 QLKHKPVVNQIEISPWIMRQELADYCKSKNLVVEAFAPL--CHGYKMTDPDLLKVCKEVD 218

Query: 244 VAPAQLIISWSIQRGYVVLAKSVNPERIVSNFKI--FTLPEDDFKIISN 290
             P Q++I WS+Q GY+ L K+   +R+ SN     F L +D  KI+ +
Sbjct: 219 RNPGQVLIRWSLQHGYLPLPKTKTVKRLESNLAAYNFELSDDQMKILDH 267

>Smik_10.384 Chr10 (600097..600945) [849 bp, 282 aa] {ON} YJR096W
           (REAL)
          Length = 282

 Score =  142 bits (358), Expect = 9e-40,   Method: Compositional matrix adjust.
 Identities = 90/281 (32%), Positives = 138/281 (49%), Gaps = 37/281 (13%)

Query: 13  KLNTGASIPVLGFGTWRSVENNGYHSVIAALKAGYRHIDAAAIYLNEEEVGRAIKD---- 68
           KL+ G  IP +  GT+    +     V   +K GYRH D A +Y NE+EVG  I      
Sbjct: 7   KLSNGIKIPSIALGTYEIPRSQTAEIVYEGIKCGYRHFDTAVLYGNEKEVGDGITRWLNE 66

Query: 69  --SGVPREDIFITTKLWGTEQ--RDPEAALNESLKRL-GLDYVDLYLMHWPVPLKTETIT 123
                 R DIF TTKLW ++   R  +AA+ + L  + GL+Y+DL L+H P+        
Sbjct: 67  DPKNNKRTDIFYTTKLWNSQNGYRKAKAAIQQCLNEVSGLEYIDLLLIHSPL-------- 118

Query: 124 DGNVLCIPTLDDGTVDVDTREWNFIKTWDLMQELPKTGKTKAVGVSNFSINNIKALLESP 183
           +G+ L                   ++TW  MQE    G  K++GVSN+   +I  LL   
Sbjct: 119 EGSKL------------------RLETWRAMQEAVDAGVVKSIGVSNYGRKHIDELLNWS 160

Query: 184 SNKLVPAANQIEIHPLLPQNELIAFCKEKGIVVEAYSPFGSVNAPLLEEQAIIDMAKKHG 243
             +  P  NQIEI P + + EL  +CK KG++VEA++P    +   +    ++ + K+  
Sbjct: 161 ELRHYPVVNQIEISPWIMRQELADYCKSKGLIVEAFAPL--CHGYKMTNPDLLIVCKEVD 218

Query: 244 VAPAQLIISWSIQRGYVVLAKSVNPERIVSNFKIFTLPEDD 284
             P Q++I WS+Q GY+ L K+   +R+  N   ++    D
Sbjct: 219 RNPGQVLIRWSLQHGYLPLPKTRTVKRLEGNLAAYSFELSD 259

>ZYRO0E09614g Chr5 complement(765913..766839) [927 bp, 308 aa] {ON}
           similar to uniprot|Q07551 Saccharomyces cerevisiae
           YDL124W NADPH-dependent alpha-keto amide reductase
           reduces aromatic alpha-keto amides aliphatic alpha-keto
           esters and aromatic alpha-keto esters
          Length = 308

 Score =  141 bits (355), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 104/309 (33%), Positives = 153/309 (49%), Gaps = 55/309 (17%)

Query: 15  NTGASIPVLGFGT---WRSVENNG----------YHSVIAALKAGYRHIDAAAIYLNEEE 61
            T   IPVLGFGT   WR  +  G             ++ A+  G+ HID A  YL  EE
Sbjct: 13  ETHTHIPVLGFGTGTQWRIAKREGETKGQFIDKLVDQLVTAVDLGFNHIDTAEFYLTHEE 72

Query: 62  VGRAIKDSGVPREDIFITTKL----W-GTEQRDPEAALNESLKRLGLDYVDLYLMHWPVP 116
           VG A++ S +PR+ +FIT K     W G +   P  A  + L+ LG+ Y DLY++H P  
Sbjct: 73  VGEALRRSQLPRDKLFITDKYNQGAWTGLDCSGPIQAAKKGLEALGIKYFDLYMLHRP-- 130

Query: 117 LKTETITDGNVLCIPTLDDGTVDVDTREWNFIKTWDLMQELPKTGKTKAVGVSNFSINNI 176
                IT  N             +D +E      W  ++EL + G  KA+GVSNF +  +
Sbjct: 131 ----DITKEN-----------AGIDLQE-----AWRQVEELYEAGIAKAIGVSNFPLETL 170

Query: 177 KALLESPSNKLVPAANQIEIHPLLPQNE---LIAFCKEKGIVVEAYSP----FGSVNAPL 229
           K +      + +P  +Q+E HP L QN+   ++ +C+ K IVVEAYSP    F +   PL
Sbjct: 171 KQM--ESYCRYLPMVHQVEFHPYL-QNQSPGVVEWCQNKHIVVEAYSPLAPLFRARPGPL 227

Query: 230 LEEQAIIDMAKKHGVAPAQLIISWSIQRGYVVLAKSVNPERIVSNFKI--FTLPEDDFKI 287
             +  + ++ KK+G +  Q+++ W I RG V L  S   ERI        F L + D ++
Sbjct: 228 --DDILPNLMKKYGKSETQIVLRWVIDRGIVALTTSSKEERIHEILGTLDFELEKSDVEL 285

Query: 288 ISNL-SKVH 295
           I+ + SK H
Sbjct: 286 INEVGSKKH 294

>Skud_10.318 Chr10 (568560..569408) [849 bp, 282 aa] {ON} YJR096W
           (REAL)
          Length = 282

 Score =  140 bits (352), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 91/290 (31%), Positives = 141/290 (48%), Gaps = 42/290 (14%)

Query: 14  LNTGASIPVLGFGTWRSVENNGYHSVIAALKAGYRHIDAAAIYLNEEEVGRAI------K 67
           L+ G  IP +  GT+    +     V   +K GYRH D A +Y NE+EVG  I       
Sbjct: 8   LSNGYRIPSIALGTYDIPRSQTAEIVYEGIKCGYRHFDTAVLYGNEKEVGDGIIKWLNEN 67

Query: 68  DSGVPREDIFITTKLWGTEQ--RDPEAALNESLKRL-GLDYVDLYLMHWPVPLKTETITD 124
                RE IF TTKLW ++   +  +AA+ + L  + GL Y+DL L+H P+        +
Sbjct: 68  PESNKREKIFYTTKLWNSQNGYKRAKAAIQQCLNEVSGLKYIDLLLIHSPL--------E 119

Query: 125 GNVLCIPTLDDGTVDVDTREWNFIKTWDLMQELPKTGKTKAVGVSNFSINNIKALLESPS 184
           G+ L                   ++TW  MQE    G  K++GVSN+   +I  LL  P 
Sbjct: 120 GSKL------------------RLETWQAMQEAVDEGVVKSIGVSNYGKKHIDELLTWPD 161

Query: 185 NKLVPAANQIEIHPLLPQNELIAFCKEKGIVVEAYSPFGSVNAPLLEEQAIIDMAKKHGV 244
               P  NQIEI P + + EL  +CK KG++VEA++P    +   +    ++ + K+   
Sbjct: 162 LTYKPVVNQIEISPWVMRQELADYCKSKGLIVEAFAPL--CHGYKMTNPDLLKVCKEVDR 219

Query: 245 APAQLIISWSIQRGYVVLAKSVNPERIVSNFKIFTLPEDDFKIISNLSKV 294
            P Q++I WS+Q GY+ L K+   +R+  N   +     DF+++    K+
Sbjct: 220 NPGQVLIRWSLQHGYLPLPKTKTVKRLEGNLAAY-----DFELLDKQMKI 264

>TDEL0C03320 Chr3 (591171..592022) [852 bp, 283 aa] {ON} Anc_7.468
           YJR096W
          Length = 283

 Score =  140 bits (352), Expect = 6e-39,   Method: Compositional matrix adjust.
 Identities = 90/283 (31%), Positives = 143/283 (50%), Gaps = 42/283 (14%)

Query: 14  LNTGASIPVLGFGTWRSVENNGYHSVIAALKAGYRHIDAAAIYLNEEEVGRAIKD----- 68
           L+ G  IP L  GT+   ++   + V  ALK GYRH D A +Y NE +VG  I       
Sbjct: 9   LSNGVKIPSLALGTYDLPKSTTANIVYEALKCGYRHFDTAVLYNNERKVGEGIYQWLQED 68

Query: 69  -SGVPREDIFITTKLWGTEQ--RDPEAALNESLKRL-GLDYVDLYLMHWPVPLKTETITD 124
                RED+F TTKLW ++   +  + A+ E L+++  L Y+DL L+H P+    + +  
Sbjct: 69  PKNNKREDVFYTTKLWNSQNGYQPAKQAIKECLQKVEKLGYIDLLLIHSPLSGSRKRL-- 126

Query: 125 GNVLCIPTLDDGTVDVDTREWNFIKTWDLMQELPKTGKTKAVGVSNFSINNIKALLESPS 184
                                   +T+  MQE    G  K++GVSN+  ++++ LL    
Sbjct: 127 ------------------------ETYKAMQEAVDEGIVKSIGVSNYGQHHLEELLSWEG 162

Query: 185 NKLVPAANQIEIHPLLPQNELIAFCKEKGIVVEAYSPFGSVNAPLLEEQAIIDMAKKHGV 244
            K  P  NQIEI P   + EL  +C+ +GIVVE Y+P    +   L++  ++ +A++ G 
Sbjct: 163 LKYKPVVNQIEISPWCMRQELAQWCQSQGIVVEDYAPL--THGYKLKDPQLVKVAEEVGK 220

Query: 245 APAQLIISWSIQRGYVVLAKSVNPERIVSNFKIFTLPEDDFKI 287
              Q++I WS+Q GY+ L K+ N +R+  N  ++     DFK+
Sbjct: 221 NTGQVLIRWSLQHGYLPLPKTSNVDRLPGNLDVY-----DFKL 258

>CAGL0J09394g Chr10 (925839..926774) [936 bp, 311 aa] {ON} similar
           to uniprot|Q07551 Saccharomyces cerevisiae YDL124w
          Length = 311

 Score =  140 bits (353), Expect = 8e-39,   Method: Compositional matrix adjust.
 Identities = 102/313 (32%), Positives = 155/313 (49%), Gaps = 58/313 (18%)

Query: 12  LKLNTGASIP---VLGFGT-WRSV---ENNGYHSVIAALKA-----GYRHIDAAAIYLNE 59
            KLN G  +P   ++G GT W  V   + N   +++  LK      G  H+DAA  Y+  
Sbjct: 7   FKLNNGHEMPGVAIVGTGTKWHKVNETDENFSQTLVDQLKYALSLPGVVHLDAAEFYMTY 66

Query: 60  EEVGRAIKDSGVPREDIFITTKLWGTEQ--RDPEAALNESLKRLGLDYVDLYLMHWPVPL 117
            EVGRA+ ++  PR++IFIT K W   +   +P   L   LKRLGL+YVDLYL+H P   
Sbjct: 67  REVGRALAETSKPRDEIFITDKYWTLSKVTENPIVGLETGLKRLGLEYVDLYLLHSPF-- 124

Query: 118 KTETITDGNVLCIPTLDDGTVDVDTREWNFIKTWDLMQELPKTGKTKAVGVSNFSINNIK 177
                               +  +T  ++  + W +M+EL  +GK K +GVSNF+  +++
Sbjct: 125 --------------------ISKETNGFSLEEAWGMMEELYHSGKAKNIGVSNFAKEDLE 164

Query: 178 ALLESPSNKLVPAANQIEIHPLLPQNE---LIAFCKEKGIVVEAYSPFGSVNAPLLEEQA 234
            +L+    K+ P  NQIE +  L QN+   +  FCK+  I + AYSP G    PL ++ A
Sbjct: 165 RVLKVC--KVKPQVNQIEFNAFL-QNQTPGIYNFCKQNDIQLAAYSPLG----PLQKKPA 217

Query: 235 ----------IIDMAKKHGVAPAQLIISWSIQRGYVVLAKSVNPERIVSNFKIFT--LPE 282
                     I  +A+ +   P Q+++ W  +RG V +  S   ERI    +IF   L +
Sbjct: 218 DGNSQPFYSYINKLAQHYNKTPGQVLLRWVTKRGVVAVTTSEKKERIKQAQEIFEFDLKD 277

Query: 283 DDFKIISNLSKVH 295
           D+   I+ L   H
Sbjct: 278 DEVTEITKLGLDH 290

>Kwal_47.19278 s47 complement(1169418..1170362) [945 bp, 314 aa]
           {ON} YDL124W - Hypothetical ORF [contig 344] FULL
          Length = 314

 Score =  140 bits (353), Expect = 9e-39,   Method: Compositional matrix adjust.
 Identities = 98/310 (31%), Positives = 158/310 (50%), Gaps = 53/310 (17%)

Query: 11  SLKL-NTGASIPVLGFGT---WRSVENNGYH----------SVIAALKAGYRHIDAAAIY 56
           +L+L  +G  IP++GFG+   WR  + +G             V +A+ AG+ HIDAA  Y
Sbjct: 7   TLRLKGSGDEIPIIGFGSGTKWRIAKASGEKKDQFITELADQVTSAINAGFNHIDAAEAY 66

Query: 57  LNEEEVGRAIKDSGVPREDIFITTKL--WGTEQRD---PEAALNESLKRLGLDYVDLYLM 111
               EVGR +K+SGVPR+ ++IT K   W  + R    P  +L+ SL+++ + YVDLYL+
Sbjct: 67  KTHPEVGRGVKNSGVPRDKLWITDKYTPWSWDWRKGTGPLESLSLSLEKMQMSYVDLYLL 126

Query: 112 HWPVPLKTETITDGNVLCIPTLDDGTVDVDTREWNFIKTWDLMQELPKTGKTKAVGVSNF 171
           H                 +P +   T  +D +E      W  M+E+   G  K +GVSNF
Sbjct: 127 H-----------------VPFITVQTAGIDLKE-----AWRQMEEIYDRGLAKNIGVSNF 164

Query: 172 SINNIKALLESPSNKLVPAANQIEIHPLLPQNE--LIAFCKEKGIVVEAYSPFGSVN--- 226
            + +++ +  +   K +P  NQIE +  L Q    +IA+CK+  IVVE YSP   +    
Sbjct: 165 DVESLEYI--TKIGKYLPVVNQIEFNAYLQQQSPGIIAYCKDHDIVVEGYSPLVPLTKGR 222

Query: 227 -APLLEEQAIIDMAKKHGVAPAQLIISWSIQRGYVVLAKSVNPERIVSNFKI--FTLPED 283
             PL  ++ +  +A+K+  +  Q+++ W  Q G VV+  S    R+  +  I  F L  +
Sbjct: 223 PGPL--DKLLPALAEKYHKSELQILLRWVTQNGVVVITTSAQQARVKESVNIFDFELTAE 280

Query: 284 DFKIISNLSK 293
           DF  I+ + +
Sbjct: 281 DFDSITKIGR 290

>ABL209C Chr2 complement(11410..12342) [933 bp, 310 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YJR096W
          Length = 310

 Score =  139 bits (350), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 87/275 (31%), Positives = 139/275 (50%), Gaps = 38/275 (13%)

Query: 13  KLNTGASIPVLGFGTWRSVENNGYHSVIAALKAGYRHIDAAAIYLNEEEVGRAI-----K 67
           +L+ G  IP +G G ++  E      V  AL+ GYR  D+A  Y NE+ V R I      
Sbjct: 14  RLSDGTQIPSVGLGVYQVSEQTVQDLVYEALEVGYRLFDSAQAYHNEDGVARGIAAWLKH 73

Query: 68  DSGVPREDIFITTKLWGTEQRDPEA---ALNESLKRLG-LDYVDLYLMHWPVPLKTETIT 123
             G  RED++ TTK+  T+    EA   +L +SL   G L Y+DL L+H P+  +T  + 
Sbjct: 74  APGRRREDVYFTTKI-NTQNHGYEATKKSLEKSLHAAGPLGYIDLVLVHAPMSDRTRRLG 132

Query: 124 DGNVLCIPTLDDGTVDVDTREWNFIKTWDLMQELPKTGKTKAVGVSNFSINNIKALLESP 183
                                     TW  ++E    G+ +++GVSN+   ++  LL   
Sbjct: 133 --------------------------TWQALEEAVVEGQVRSIGVSNYGQQHLSELLGWE 166

Query: 184 SNKLVPAANQIEIHPLLPQNELIAFCKEKGIVVEAYSPFGSVNAPLLEEQAIIDMAKKHG 243
             K+ P  NQ+EI+P L + EL+ +C+E  I V+A+SP   +    L++  +  +A ++ 
Sbjct: 167 GLKIRPVVNQVEINPWLCRQELVQYCRENNIAVQAFSPL--MRGKRLDDPILQKVAHQYD 224

Query: 244 VAPAQLIISWSIQRGYVVLAKSVNPERIVSNFKIF 278
              AQ+++ WSIQ G++VL K+   ER+  NF I+
Sbjct: 225 KGVAQILVRWSIQMGFIVLPKAAKKERLAPNFDIW 259

>KLTH0G00638g Chr7 (43280..44221) [942 bp, 313 aa] {ON} similar to
           uniprot|Q07551 Saccharomyces cerevisiae YDL124W
           NADPH-dependent alpha-keto amide reductase reduces
           aromatic alpha-keto amides aliphatic alpha-keto esters
           and aromatic alpha-keto esters
          Length = 313

 Score =  137 bits (344), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 95/306 (31%), Positives = 148/306 (48%), Gaps = 52/306 (16%)

Query: 15  NTGASIPVLGFGT---WRSVENNGYH----------SVIAALKAGYRHIDAAAIYLNEEE 61
            +G  +PV+GFG+   WR  +  G             V  A+KAG+ HIDAA  Y    E
Sbjct: 12  GSGDKLPVIGFGSGTKWRIAKAEGEKKDQFIQELADQVSNAIKAGFNHIDAAEAYKTHPE 71

Query: 62  VGRAIKDSGVPREDIFITTKL--WG---TEQRDPEAALNESLKRLGLDYVDLYLMHWPVP 116
           VG  I +SGVPRE +++T K   W     + + P  +L  SL ++ + YVDLYL+H    
Sbjct: 72  VGAGIANSGVPREKLWVTDKYTPWSWTWRKGKGPLESLELSLGKMQMQYVDLYLVH---- 127

Query: 117 LKTETITDGNVLCIPTLDDGTVDVDTREWNFIKTWDLMQELPKTGKTKAVGVSNFSINNI 176
                        +P ++  T  +D +E      W  M+E+   G  K +GVSNF + ++
Sbjct: 128 -------------VPFINPETAGIDLKE-----AWRQMEEIYDRGWAKNIGVSNFDVESL 169

Query: 177 KALLESPSNKLVPAANQIEIHPLLPQNE--LIAFCKEKGIVVEAYSPFGSVN----APLL 230
           + +      K  P  NQIE    + Q    +I++CK+ GI +E YSP   +      PL 
Sbjct: 170 EYI--RTIGKYQPVVNQIEFSAYMQQQSPGIISYCKKHGIAIEGYSPLVPLTKGKPGPL- 226

Query: 231 EEQAIIDMAKKHGVAPAQLIISWSIQRGYVVLAKSVNPERIVSNFKI--FTLPEDDFKII 288
            +  +  MAKK+G +  Q+++ W +Q G + +  S   +RI  +  I  F L  +DF  I
Sbjct: 227 -DDILPLMAKKYGKSELQILLRWVVQNGVIAITTSAQQKRIDESLDIFDFELSSEDFTSI 285

Query: 289 SNLSKV 294
           + + K 
Sbjct: 286 TEVGKT 291

>NCAS0A13740 Chr1 complement(2699208..2700137) [930 bp, 309 aa] {ON}
           Anc_7.285
          Length = 309

 Score =  136 bits (343), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 101/291 (34%), Positives = 152/291 (52%), Gaps = 53/291 (18%)

Query: 14  LNTGASIP---VLGFGT--WRSVENNGYHS--VIAALKA-----GYRHIDAAAIYLNEEE 61
           LN G  IP   V+G GT  +++ E +   S  ++  LK      G  HIDAA IY    E
Sbjct: 10  LNNGNKIPAIAVIGTGTRWFKTEETDATFSQQLVDELKVALTLPGIVHIDAAEIYRTYPE 69

Query: 62  VGRAIKDSGVPREDIFITTKLWGTEQR---DPEAALNESLKRLGLDYVDLYLMHWPVPLK 118
           V  A+++S  PR++IFIT K + T+ +   DP A LN SLK LGLDYVDLYL+H P    
Sbjct: 70  VAAALRESNRPRDEIFITDK-YSTQLKLSDDPIAGLNISLKTLGLDYVDLYLLHSPF--- 125

Query: 119 TETITDGNVLCIPTLDDGTVDVDTREWNFIKTWDLMQELPKTGKTKAVGVSNFSINNIKA 178
              I +G+ L                    + W  M++L K+GK K +GVSNF + +++ 
Sbjct: 126 ---IKNGSTLE-------------------ECWKQMEKLYKSGKAKNIGVSNFRVEDLEK 163

Query: 179 LLESPSNKLVPAANQIEIHPLLPQNE---LIAFCKEKGIVVEAYSPFGSVNAPLLEEQA- 234
           +L+  + K  P  NQIE +  L QN+   ++ FCKE  I +EAY+P G         +A 
Sbjct: 164 ILKIATIK--PQINQIEFNAAL-QNQSPGIVKFCKENNIQLEAYTPLGPFQRIQDTPEAK 220

Query: 235 -----IIDMAKKHGVAPAQLIISWSIQRGYVVLAKSVNPERIVSNFKIFTL 280
                I +++KK+    AQ+++ W  +RG + +  S  P+R+     +F+ 
Sbjct: 221 PFYDYIAELSKKYNKTEAQILLRWVTKRGILPVTTSSKPQRLHDAQNLFSF 271

>Kpol_1020.13 s1020 (27790..28731) [942 bp, 313 aa] {ON}
           (27790..28731) [942 nt, 314 aa]
          Length = 313

 Score =  134 bits (338), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 107/323 (33%), Positives = 164/323 (50%), Gaps = 54/323 (16%)

Query: 12  LKLNTGASIP---VLGFGT-WR---SVENNGYHSVIAALK-----AGYRHIDAAAIYLNE 59
             LN G  IP   ++G GT W      E+     ++  +K      G  HIDAA  Y   
Sbjct: 8   FDLNNGNQIPSISIIGTGTRWFKRPGSEHTFSDELVEQIKYALSLPGIIHIDAAECYGTY 67

Query: 60  EEVGRAIKDSGVPREDIFITTKLWGTEQR---DPEAALNESLKRLGLDYVDLYLMHWPVP 116
            E+ +A+K+S  PR +IFIT K + T+ +   DP   LN  LK LGLDYVDLYL+H P  
Sbjct: 68  PELAKALKESSKPRSEIFITDK-YSTQTKFTNDPIEGLNTGLKTLGLDYVDLYLIHSP-- 124

Query: 117 LKTETITDGNVLCIPTLDDGTVDVDTREWNFIKTWDLMQELPKTGKTKAVGVSNFSINNI 176
                         P    G++ ++       K W  M+ L K GK K++GVSNFS+ NI
Sbjct: 125 -----------FFDPEF-KGSLTLE-------KVWKDMETLYKEGKAKSIGVSNFSVKNI 165

Query: 177 KALLESPSNKLVPAANQIEIHPLLPQNE---LIAFCKEKGIVVEAYSPFGSV-----NAP 228
           + +L+    K  P  NQIE +  L QN+   ++ +C++  I +EAYSP G +     N+ 
Sbjct: 166 EEILKIAGIK--PQVNQIEFNAFL-QNQTPGIVNYCQKNNIQLEAYSPLGPLQKRPENSN 222

Query: 229 LLEEQAIID-MAKKHGVAPAQLIISWSIQRGYVVLAKSVNPERIV--SNFKIFTLPEDDF 285
            L     ID +A K+G   +Q++++W   RG + +  S   +RI+   N   F L +D+ 
Sbjct: 223 ELPFYNYIDELASKYGKTDSQILLNWVYNRGILPITTSSKTQRIIDAQNIFSFNLTKDE- 281

Query: 286 KIISNLSKVHGEKRVVDMKWSSF 308
             +  L+K+  E+  + + W++F
Sbjct: 282 --VDTLTKLGLEQPALRIYWTNF 302

>Skud_4.131 Chr4 (235946..236884) [939 bp, 312 aa] {ON} YDL124W
           (REAL)
          Length = 312

 Score =  134 bits (336), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 98/313 (31%), Positives = 160/313 (51%), Gaps = 52/313 (16%)

Query: 14  LNTGASIP---VLGFGT--WRSVENNGYHS------VIAALK-AGYRHIDAAAIYLNEEE 61
           LN G  IP   ++G GT  +++VE +   S      ++ AL+  G  HIDAA IY    E
Sbjct: 10  LNNGNKIPAIAIIGTGTRWFKNVETDATFSNSLVEQIMYALELPGIVHIDAAEIYRTYPE 69

Query: 62  VGRAIKDSGVPREDIFITTKLWGTEQR---DPEAALNESLKRLGLDYVDLYLMHWPVPLK 118
           VG+A+  +  PR++IF+T K + T+ +    P A L  SLK++G DYVDLYL+H P    
Sbjct: 70  VGKALSLTKKPRDEIFLTDK-YSTQIKVSDSPAAGLEVSLKKMGTDYVDLYLLHSPF--- 125

Query: 119 TETITDGNVLCIPTLDDGTVDVDTREWNFIKTWDLMQELPKTGKTKAVGVSNFSINNIKA 178
                              V  +   +   + W  M++L K GK K +GVSNF++ +++ 
Sbjct: 126 -------------------VSKEANGFTLEEAWKDMEQLYKAGKAKNIGVSNFAVKDLEK 166

Query: 179 LLESPSNKLVPAANQIEIHPLLPQNE---LIAFCKEKGIVVEAYSPFGSVNAPLLEEQA- 234
           +L+    K  P  NQIE  P L QN+   +  FC++  I++EAYSP   +     ++ + 
Sbjct: 167 ILKIAEVK--PQVNQIEFSPFL-QNQTPGIYKFCQDNNILLEAYSPLAPLQKKTAQDDSK 223

Query: 235 -----IIDMAKKHGVAPAQLIISWSIQRGYVVLAKSVNPERI--VSNFKIFTLPEDDFKI 287
                + ++++K+  + AQ+I+ W  +RG + +  S  P+RI    N   F L +++   
Sbjct: 224 PFFEYVKELSEKYFKSEAQIILRWVSKRGVLPVTTSSKPQRISDAQNLFSFDLTDEEVDE 283

Query: 288 ISNLSKVHGEKRV 300
           I+ L   H   R+
Sbjct: 284 ITELGLAHEPLRL 296

>Smik_4.113 Chr4 (216885..217823) [939 bp, 312 aa] {ON} YDL124W
           (REAL)
          Length = 312

 Score =  133 bits (335), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 97/315 (30%), Positives = 160/315 (50%), Gaps = 52/315 (16%)

Query: 12  LKLNTGASIP---VLGFGT-WRSVE-------NNGYHSVIAALK-AGYRHIDAAAIYLNE 59
           + LN G  IP   ++G GT W   E       N+    ++ ALK  G  HIDAA IY   
Sbjct: 8   ITLNNGNKIPAIAIIGTGTRWYKEEETDATFSNSLVEQIVYALKLPGIIHIDAAEIYRTY 67

Query: 60  EEVGRAIKDSGVPREDIFITTKLWGTE---QRDPEAALNESLKRLGLDYVDLYLMHWPVP 116
            EVG+A+  +  PR +IF+T K + T+      P   L+ +LK++G DYVDLYL+H P  
Sbjct: 68  PEVGKALSLTEKPRNEIFLTDK-YSTQIKVSESPAVGLDIALKKMGTDYVDLYLLHSPF- 125

Query: 117 LKTETITDGNVLCIPTLDDGTVDVDTREWNFIKTWDLMQELPKTGKTKAVGVSNFSINNI 176
                                V  +T  +   + W  M++L ++GK K +GVSNF++ ++
Sbjct: 126 ---------------------VSKETNGFTLEEAWKDMEQLYRSGKAKNIGVSNFAMKDL 164

Query: 177 KALLESPSNKLVPAANQIEIHPLLPQNE---LIAFCKEKGIVVEAYSPFGSVNAPLLEEQ 233
           + +L+    ++ P  NQIE  P L QN+   +  FC+E  I++EAYSP G +     +++
Sbjct: 165 ERILKVA--EIRPQVNQIEFSPFL-QNQTPGIYKFCQENDILLEAYSPLGPLQKRTTKDE 221

Query: 234 A------IIDMAKKHGVAPAQLIISWSIQRGYVVLAKSVNPERI--VSNFKIFTLPEDDF 285
           +      + ++++K+  + AQ+ + W  +RG + +  S  P+RI    N   F L +++ 
Sbjct: 222 SLPFFEYVKELSEKYIKSEAQITLRWVTRRGVLPVTTSSKPQRISDAQNLFSFDLTDEEV 281

Query: 286 KIISNLSKVHGEKRV 300
             I+ L   H   R+
Sbjct: 282 NQITELGLEHEPLRL 296

>KNAG0C04110 Chr3 (806389..807324) [936 bp, 311 aa] {ON} Anc_7.285
           YDL124W
          Length = 311

 Score =  130 bits (327), Expect = 6e-35,   Method: Compositional matrix adjust.
 Identities = 100/316 (31%), Positives = 153/316 (48%), Gaps = 50/316 (15%)

Query: 5   LKNSSASLKLNTGASIP---VLGFGT-WRSVENNGY---HSVIAALK-----AGYRHIDA 52
           + ++ A + LN G  +P   ++G GT W   +   +   H +I  L+      G  HIDA
Sbjct: 1   MSHNQAFVTLNNGHKMPAVAIIGTGTHWHHKKEKDHALSHELIEQLEFALSLPGVVHIDA 60

Query: 53  AAIYLNEEEVGRAIKDSGVPREDIFITTK--LWGTEQRDPEAALNESLKRLGLDYVDLYL 110
           A +Y    E+  A++ +  PR +IFIT K  L     +DP A L +SLK   LDYVDLYL
Sbjct: 61  AEMYGTYPELSAALRMTEKPRSEIFITDKHALHAAMSKDPIAGLEDSLKANNLDYVDLYL 120

Query: 111 MHWPVPLKTETITDGNVLCIPTLDDGTVDVDTREWNFIKTWDLMQELPKTGKTKAVGVSN 170
           +H P   K +          P L                 W  M++L K GK K +GVSN
Sbjct: 121 LHSPFVAKEK----------PGL------------TLEGAWRQMEQLYKDGKAKNIGVSN 158

Query: 171 FSINNIKALLESPSNKLVPAANQIEIHPLLPQNE---LIAFCKEKGIVVEAYSPFGSVNA 227
           FS+ ++K +L     K  P  NQIE HP L QN+   ++ FC+++ I +EA++P G +  
Sbjct: 159 FSVEDLKRVLSVAEIK--PQVNQIEFHPFL-QNQTPGILKFCQDENIELEAFTPLGPLQV 215

Query: 228 PLLEEQ------AIIDMAKKHGVAPAQLIISWSIQRGYVVLAKSVNPERI--VSNFKIFT 279
              E++       I  ++ K+    AQ+I+ W  +RG + +  S   +RI    N   F 
Sbjct: 216 KTQEDENDEFFKYISSLSGKYQKTEAQIILRWVTKRGVIPVTTSRRHDRIADAQNLFEFD 275

Query: 280 LPEDDFKIISNLSKVH 295
           L +++   I+ L   H
Sbjct: 276 LEDEEVTKITRLGLQH 291

>NDAI0A02300 Chr1 (516594..517535) [942 bp, 313 aa] {ON} Anc_7.285
          Length = 313

 Score =  130 bits (326), Expect = 7e-35,   Method: Compositional matrix adjust.
 Identities = 102/319 (31%), Positives = 156/319 (48%), Gaps = 51/319 (15%)

Query: 8   SSASLKLNTGASIP---VLGFGT-WR--SVENNGYHSVI------AALKAGYRHIDAAAI 55
           S     LN G  IP   ++G GT W    +E+  +   +      A    G  HIDAA +
Sbjct: 4   SQEFFTLNNGNKIPAISIIGTGTKWHHGKLESGKFSDELVDQLQYALTLPGIIHIDAAEM 63

Query: 56  YLNEEEVGRAIKDSGVPREDIFITTKLWGTEQR---DPEAALNESLKRLGLDYVDLYLMH 112
           Y    EV +A+K +   R++IFIT K +    +   +P A L +SLK L LDYVDLYL+H
Sbjct: 64  YNTYPEVNKALKSTSKVRDEIFITDKYYSGSPKLTENPIAGLTKSLKELELDYVDLYLLH 123

Query: 113 WPVPLKTETITDGNVLCIPTLDDGTVDVDTREWNFIKTWDLMQELPKTGKTKAVGVSNFS 172
            P   K          C  T+++               W  M++L K GK K +GVSNFS
Sbjct: 124 SPFITKES--------CGYTMEEA--------------WKQMEKLYKDGKAKNIGVSNFS 161

Query: 173 INNIKALLESPSNKLVPAANQIEIHPLLPQNE---LIAFCKEKGIVVEAYSPFGSVNAPL 229
           ++++K +L+    K  P  NQIE +  L QN+   ++ FC++  I+VEAYSP G +    
Sbjct: 162 VDDLKRILKICEIK--PQINQIEFNAFL-QNQTPGIVKFCQDHDILVEAYSPLGPLRKKP 218

Query: 230 LEE------QAIIDMAKKHGVAPAQLIISWSIQRGYVVLAKSVNPERI--VSNFKIFTLP 281
            +       Q I ++AKK+G +  Q+++ W  +R  + +  S   ERI    +   F L 
Sbjct: 219 TDRDPGPFYQYIEELAKKYGKSEGQVLLRWVTKRKILPITTSGKEERIKDAQDLFSFDLT 278

Query: 282 EDDFKIISNLSKVHGEKRV 300
            ++ + I+ L   H   R+
Sbjct: 279 SEEVEKITKLGLAHEPSRL 297

>SAKL0F00704g Chr6 (60941..61888) [948 bp, 315 aa] {ON} similar to
           uniprot|Q07551 Saccharomyces cerevisiae YDL124W
           NADPH-dependent alpha-keto amide reductase reduces
           aromatic alpha-keto amides aliphatic alpha-keto esters
           and aromatic alpha-keto esters
          Length = 315

 Score =  129 bits (325), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 91/304 (29%), Positives = 147/304 (48%), Gaps = 52/304 (17%)

Query: 16  TGASIPVLGFGT---WRSVENNG----------YHSVIAALKAGYRHIDAAAIYLNEEEV 62
           +G  +P +GFG+   WR  +++G             V  A++ G+ HID A  Y   +EV
Sbjct: 14  SGDLLPSIGFGSGTKWRIAKSSGKTKGVYIDALADQVTNAIQCGFNHIDTAEAYKTYKEV 73

Query: 63  GRAIKDSGVPREDIFITTKL--WGTEQRD---PEAALNESLKRLGLDYVDLYLMHWPVPL 117
           G  I ++ VPRE ++IT K   W  E R    P  +L  SLK + LDYVDLY++H     
Sbjct: 74  GTGISNAQVPRETLWITDKYTPWSWEWRKGSGPLESLTLSLKEMNLDYVDLYMIH----- 128

Query: 118 KTETITDGNVLCIPTLDDGTVDVDTREWNFIKTWDLMQELPKTGKTKAVGVSNFSINNIK 177
                       +P +   T  +D +E      W  M+E+      + +GVSNF + +++
Sbjct: 129 ------------VPNITTKTAGIDLKE-----AWLQMEEIYTRKMARNIGVSNFDVESLE 171

Query: 178 ALLESPSNKLVPAANQIEIHPLLPQNE--LIAFCKEKGIVVEAYSPFGSVN----APLLE 231
            +      K  P  NQIE    + Q    ++ +C+E  IVVE YSP   +      PL  
Sbjct: 172 YI--KSFAKYQPVVNQIEFSAYMQQQSPGILKYCRENNIVVEGYSPLVPLTKGKPGPL-- 227

Query: 232 EQAIIDMAKKHGVAPAQLIISWSIQRGYVVLAKSVNPERIVSNFKI--FTLPEDDFKIIS 289
           ++ +  +A K+G +  Q+++ W  Q G VV+  +   ER+  +  I  F L ++DF  I+
Sbjct: 228 DEILPGIAAKYGKSQLQVLLRWVTQNGIVVITTTGKKERLNESLNIFDFELSKEDFDQIT 287

Query: 290 NLSK 293
           N+ +
Sbjct: 288 NVGR 291

>YDL124W Chr4 (240259..241197) [939 bp, 312 aa] {ON} NADPH-dependent
           alpha-keto amide reductase; reduces aromatic alpha-keto
           amides, aliphatic alpha-keto esters, and aromatic
           alpha-keto esters; member of the aldo-keto reductase
           (AKR) family
          Length = 312

 Score =  129 bits (324), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 99/312 (31%), Positives = 153/312 (49%), Gaps = 50/312 (16%)

Query: 14  LNTGASIP---VLGFGT-WRSVE-------NNGYHSVIAALK-AGYRHIDAAAIYLNEEE 61
           LN G  IP   ++G GT W   E       N+    ++ ALK  G  HIDAA IY    E
Sbjct: 10  LNNGNKIPAIAIIGTGTRWYKNEETDATFSNSLVEQIVYALKLPGIIHIDAAEIYRTYPE 69

Query: 62  VGRAIKDSGVPREDIFITTKLWGTEQR--DPEAALNESLKRLGLDYVDLYLMHWPVPLKT 119
           VG+A+  +  PR  IF+T K     +    P   L+ +LK++G DYVDLYL+H P     
Sbjct: 70  VGKALSLTEKPRNAIFLTDKYSPQIKMSDSPADGLDLALKKMGTDYVDLYLLHSPF---- 125

Query: 120 ETITDGNVLCIPTLDDGTVDVDTREWNFIKTWDLMQELPKTGKTKAVGVSNFSINNIKAL 179
                             V  +    +  + W  M++L K+GK K +GVSNF++ +++ +
Sbjct: 126 ------------------VSKEVNGLSLEEAWKDMEQLYKSGKAKNIGVSNFAVEDLQRI 167

Query: 180 LESPSNKLVPAANQIEIHPLLPQNE---LIAFCKEKGIVVEAYSPFGSVNAPLLEEQA-- 234
           L+    K  P  NQIE  P L QN+   +  FC+E  I+VEAYSP G +     ++ +  
Sbjct: 168 LKVAEVK--PQVNQIEFSPFL-QNQTPGIYKFCQEHDILVEAYSPLGPLQKKTAQDDSQP 224

Query: 235 ----IIDMAKKHGVAPAQLIISWSIQRGYVVLAKSVNPERI--VSNFKIFTLPEDDFKII 288
               + ++++K+  + AQ+I+ W  +RG + +  S  P+RI    N   F L  ++   I
Sbjct: 225 FFEYVKELSEKYIKSEAQIILRWVTKRGVLPVTTSSKPQRISDAQNLFSFDLTAEEVDKI 284

Query: 289 SNLSKVHGEKRV 300
           + L   H   R+
Sbjct: 285 TELGLEHEPLRL 296

>KAFR0B01200 Chr2 (224411..225358) [948 bp, 315 aa] {ON} Anc_7.285
           YDL124W
          Length = 315

 Score =  125 bits (313), Expect = 7e-33,   Method: Compositional matrix adjust.
 Identities = 99/321 (30%), Positives = 160/321 (49%), Gaps = 57/321 (17%)

Query: 14  LNTGASIP---VLGFGT-WRSVENN---GYHSVIAALKA-----GYRHIDAAAIYLNEEE 61
           LN G  +P   ++G GT W   E         ++  +K      G  HIDAA +Y    E
Sbjct: 11  LNNGNKMPSIAIIGTGTAWYKTEETPETFSQELVDQIKYALTLPGIVHIDAAEVYRTYPE 70

Query: 62  VGRAIKDSG--VPREDIFITTKLWGTEQR---DPEAALNESLKRLGLDYVDLYLMHWPVP 116
           VG+A+++S    PR++IFIT K + T+ +   +P   L   LK+LGLDYVDLYL+H P  
Sbjct: 71  VGKALRESHNVKPRDEIFITDK-YSTQLKISENPMVGLTNGLKKLGLDYVDLYLLHSPF- 128

Query: 117 LKTETITDGNVLCIPTLDDGTVDVDTREWNFIKTWDLMQELPKTGKTKAVGVSNFSINNI 176
                                +  +   +   + W  M++L K GK K +GVSNFS+ ++
Sbjct: 129 ---------------------ISKEKNGFTMEEAWKYMEDLYKAGKVKNIGVSNFSMADL 167

Query: 177 KALLESPSNKLVPAANQIEIHPLLPQNE---LIAFCKEKGIVVEAYSPFGSVN--APLLE 231
           + +L+S   K  P  NQIE +  L QN+   ++ FC+E  I V AY+P G +   +   E
Sbjct: 168 QRILKSCEVK--PQVNQIEFNAFL-QNQTPGIVNFCRENDIQVVAYTPLGPLQRKSKNFE 224

Query: 232 EQA----IIDMAKKHGVAPAQLIISWSIQRGYVVLAKSVNPERIVSNFKIFT--LPEDDF 285
           ++     +  +A+K+  + AQ+++ W  +RG + +  S   +RI     +FT  L + + 
Sbjct: 225 QENFHKFVKQLAEKYDKSEAQILLRWVSKRGIIPVTTSSKEKRIKDAQYLFTFDLTDSEV 284

Query: 286 KIISNLSKVHGEKRVVDMKWS 306
           + I+ L   H  +R   M W+
Sbjct: 285 EKITQLGLKHEPQR---MYWN 302

>SAKL0F09746g Chr6 complement(746292..747230) [939 bp, 312 aa] {ON}
           highly similar to uniprot|Q07551 Saccharomyces
           cerevisiae YDL124W NADPH-dependent alpha-keto amide
           reductase reduces aromatic alpha-keto amides aliphatic
           alpha-keto esters and aromatic alpha-keto esters
          Length = 312

 Score =  124 bits (311), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 98/291 (33%), Positives = 145/291 (49%), Gaps = 50/291 (17%)

Query: 14  LNTGASIP---VLGFGT-WRSVENNGYH-------SVIAALK-AGYRHIDAAAIYLNEEE 61
           LN G  IP   V+G GT W   E N           V  AL   G  HIDAA IY    E
Sbjct: 10  LNNGNKIPAVAVIGTGTKWFKTEENASKFSDELVDQVKYALTLPGVVHIDAAEIYRTYPE 69

Query: 62  VGRAIKDSGVPREDIFITTKLWGTEQR---DPEAALNESLKRLGLDYVDLYLMHWPVPLK 118
           +G+A++++  PR +I+IT K + T  +   +P       LK LG+DY+DLYL+H P    
Sbjct: 70  LGKALRETKKPRNEIWITDK-YSTSLKLSDNPIVGFENGLKELGVDYIDLYLLHSPF--- 125

Query: 119 TETITDGNVLCIPTLDDGTVDVDTREWNFIKTWDLMQELPKTGKTKAVGVSNFSINNIKA 178
              IT+G         +G        +   + W  ++EL K+GK K +GVSNF+  +++ 
Sbjct: 126 ---ITEGR--------NG--------FTLEQAWKYLEELYKSGKAKNIGVSNFAKEDLER 166

Query: 179 LLESPSNKLVPAANQIEIHPLLPQNE---LIAFCKEKGIVVEAYSPFGSVNAPLLEEQA- 234
           +L+    K  P  NQIE    L QN+   +  F KE  I++EAYSP G +     E  + 
Sbjct: 167 ILKIAEIK--PQVNQIEYSAFL-QNQTPGIYNFAKENDILLEAYSPLGPLQRRPEEADSL 223

Query: 235 -----IIDMAKKHGVAPAQLIISWSIQRGYVVLAKSVNPERIVSNFKIFTL 280
                I ++A+K+G + AQ+++ W  +RG + +  S  P R+     IFT 
Sbjct: 224 PFYKYINELAEKYGKSEAQVLLRWVSKRGVLPVTTSSKPHRVHDAQHIFTF 274

>ZYRO0C09196g Chr3 complement(698826..699764) [939 bp, 312 aa] {ON}
           highly similar to uniprot|Q07551 Saccharomyces
           cerevisiae YDL124W NADPH-dependent alpha-keto amide
           reductase reduces aromatic alpha-keto amides aliphatic
           alpha-keto esters and aromatic alpha-keto esters
          Length = 312

 Score =  123 bits (309), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 96/307 (31%), Positives = 147/307 (47%), Gaps = 50/307 (16%)

Query: 14  LNTGASIP---VLGFGT-WRSVEN---NGYHSVIAALK-----AGYRHIDAAAIYLNEEE 61
           LN G  IP   V+G GT W   E    N  H+++  ++      G  H+D A +Y    E
Sbjct: 10  LNNGNKIPAVAVIGTGTRWYKKEETDANFSHALVKQIEYALTLPGVVHVDHAEVYRTYPE 69

Query: 62  VGRAIKDSGVPREDIFITTKLWGTEQ--RDPEAALNESLKRLGLDYVDLYLMHWPVPLKT 119
              A+K++  PR +IF+T K    E+   DP   L+  LKR GL+YVDLYL+H P   K 
Sbjct: 70  FSEALKNTKKPRNEIFVTDKYSVQEKITNDPREGLDTGLKRTGLEYVDLYLLHSPFASK- 128

Query: 120 ETITDGNVLCIPTLDDGTVDVDTREWNFIKTWDLMQELPKTGKTKAVGVSNFSINNIKAL 179
               + N   I                  + W  ++EL   GK K +GVSNF + +++ +
Sbjct: 129 ----EKNGFTIE-----------------EAWAQLEELYHEGKAKNIGVSNFRVEDLEKI 167

Query: 180 LESPSNKLVPAANQIEIHPLLPQNE---LIAFCKEKGIVVEAYSPFGSVNAPLLEEQA-- 234
           L+    K+ P  NQIE    L QN+   ++ F ++  I +EAY+P G ++     EQA  
Sbjct: 168 LKVA--KVKPQVNQIEFSAFL-QNQTPGVVKFSQDHDIQLEAYAPLGPLSKRDESEQAKP 224

Query: 235 ----IIDMAKKHGVAPAQLIISWSIQRGYVVLAKSVNPERI--VSNFKIFTLPEDDFKII 288
               I  + +K+    AQ+++ W  +RG + +  S  P+RI    N   F L +D+   I
Sbjct: 225 FYDYIKKLTEKYSKTEAQILLRWVSKRGILPVTTSGQPKRIEDAQNLFGFDLTKDEVDEI 284

Query: 289 SNLSKVH 295
           + L   H
Sbjct: 285 TKLGLAH 291

>TBLA0F01980 Chr6 (493378..494286) [909 bp, 302 aa] {ON} Anc_7.285
           YDL124W
          Length = 302

 Score =  122 bits (306), Expect = 5e-32,   Method: Compositional matrix adjust.
 Identities = 93/313 (29%), Positives = 155/313 (49%), Gaps = 46/313 (14%)

Query: 8   SSASLKLNTGASIP---VLGFGT--WRSVENNGYHSVIA-----ALK-AGYRHIDAAAIY 56
            ++ + LN G  IP   ++G GT  ++    + Y   +      AL+  G  HID A +Y
Sbjct: 4   QTSLITLNNGNKIPGISIIGTGTRWYKYNPEDKYSDALVKQIENALELPGMLHIDCAEMY 63

Query: 57  LNEEEVGRAIKDSGVPREDIFITTKLWGTEQ--RDPEAALNESLKRLGLDYVDLYLMHWP 114
               EVG A+++S  PR++IFIT K     +   +P+  L  +L+++GL+YVDLYL+H+P
Sbjct: 64  QTHAEVGEALRNSKKPRDEIFITDKYAIPRKFSSNPKEGLKLALEKMGLEYVDLYLLHFP 123

Query: 115 VPLKTETITDGNVLCIPTLDDGTVDVDTREWNFIKTWDLMQELPKTGKTKAVGVSNFSIN 174
           +               P L D T++         + W +M++L   G  K +GVSNF + 
Sbjct: 124 I-------------IDPKLYDFTLE---------EAWKMMEDLYNEGLAKNIGVSNFRVE 161

Query: 175 NIKALLESPSNKLVPAANQIEIHPLLPQNE---LIAFCKEKGIVVEAYS---PFGSVNAP 228
           +++ L  S S  + P  NQIE +  L QN+   +  +C +  I +EA+    P   VN  
Sbjct: 162 DLEQL--SKSWVIKPQINQIEFNAYL-QNQTPGIYDYCIKNNIQLEAFCPLVPLREVNEK 218

Query: 229 LLEEQAIIDMAKKHGVAPAQLIISWSIQRGYVVLAKSVNPERIVSNFKIFT--LPEDDFK 286
            L    +  +A+K+     Q+++ W  QR  + +  S  PER+   + IF+  L +D+ +
Sbjct: 219 DLLPLYVKQLAQKYSKTENQIMLRWVSQRKVIPVTTSSRPERVRDAYDIFSFELTQDEVE 278

Query: 287 IISNLSKVHGEKR 299
            I+ L   H   R
Sbjct: 279 FITKLGSQHDTIR 291

>TDEL0D02790 Chr4 complement(533517..534506) [990 bp, 329 aa] {ON} 
          Length = 329

 Score =  122 bits (306), Expect = 9e-32,   Method: Compositional matrix adjust.
 Identities = 95/314 (30%), Positives = 159/314 (50%), Gaps = 56/314 (17%)

Query: 14  LNTGASIP---VLGFGT-W---RSVENNGYHSVIAALKA-----GYRHIDAAAIYLNEEE 61
           LN G  IP   V+G GT W      E+N    ++  +K      G  H+DAA  Y   +E
Sbjct: 29  LNNGNKIPAVAVVGTGTTWFKNEETESNFSKELVEQIKYALTLPGIVHLDAAECYNTYQE 88

Query: 62  VGRAIKDSGVPREDIFITTKLWGTEQRDPEA--ALNESLKRLGLDYVDLYLMHWPVPLKT 119
           +G+A+++S  PR++IFIT K   T +            +K++G+DYVDLYL+H P+  K 
Sbjct: 89  LGQALRESPKPRDEIFITDKFSPTPKNHGGVLERFESGIKKMGVDYVDLYLIHSPLIEKE 148

Query: 120 ETITDGNVLCIPTLDDGTVDVDTREWNFIKTWDLMQELPKTGKTKAVGVSNFSINNIKAL 179
           +           TL++               W  +++L + GK K +GVSNF + +++ +
Sbjct: 149 KNGV--------TLEE--------------VWKDLEKLYEAGKAKNIGVSNFRVEDLQRI 186

Query: 180 LESPSNKLVPAANQIEIHPLLPQNE---LIAFCKEKGIVVEAYSPFGSVNAPLLEEQA-- 234
           L+    K+ P  NQIE H  L QN+   ++ F ++  I +EAY+P G    PL  +Q+  
Sbjct: 187 LKVA--KVKPQVNQIEFHVFL-QNQTPGIVKFSQDNNIQLEAYTPLG----PLQRKQSDA 239

Query: 235 ------IIDMAKKHGVAPAQLIISWSIQRGYVVLAKSVNPERIVSNFKIFT--LPEDDFK 286
                 + ++AKK+G   AQ+++ W  +R  + +  S  P+RI +   +F+  L +++ K
Sbjct: 240 GDFYNYVEELAKKYGKTEAQVLLRWVTRRHVLPITTSSKPQRIQAAQDLFSFDLTDEEVK 299

Query: 287 IISNLSKVHGEKRV 300
            I+ L   H   R+
Sbjct: 300 KITELGLKHKPLRL 313

>Kpol_381.8 s381 complement(20844..21359,21366..21695,21698..21781)
           [930 bp, 309 aa] {ON}
           complement(20844..21359,21366..21695,21698..21781) [930
           nt, 310 aa]
          Length = 309

 Score =  119 bits (299), Expect = 5e-31,   Method: Compositional matrix adjust.
 Identities = 85/278 (30%), Positives = 142/278 (51%), Gaps = 47/278 (16%)

Query: 46  GYRHIDAAAIYLNEEEVGRAIKDSGVPREDIFITTKLWGTEQ--RDPEAALNESLKRLGL 103
           G  H+DAA  Y    E+ +A+K+S  PR +IFIT K     +   +P  ALN +L  LGL
Sbjct: 53  GIVHVDAAEYYRTYPELNKALKESSKPRNEIFITDKFSTLLKITANPIEALNTALDSLGL 112

Query: 104 DYVDLYLMHWPVPLKTETITDGNVLCIPTLDDGTVDVDTREWNFIKTWDLMQELPKTGKT 163
           DYVDLY++H+P                        D + ++ +    W  M+ L K GK 
Sbjct: 113 DYVDLYVLHFP----------------------EFDPEYKDLSIETAW--MELLYKEGKA 148

Query: 164 KAVGVSNFSINNIKALLESPSNKLVPAANQIEIHPLLPQNE---LIAFCKEKGIVVEAYS 220
           K +GVSNFSI +++ +++    K  P  NQIE +  L QN+   ++ +C++ G  +EAYS
Sbjct: 149 KNIGVSNFSIEHLERVMKIADVK--PQVNQIEFNAFL-QNQTPGIVKYCQQNGFQLEAYS 205

Query: 221 PFGSVNAPLLEE----------QAIIDMAKKHGVAPAQLIISWSIQRGYVVLAKSVNPER 270
           P     APL  +          + I +++ K+G   +++++ W  +RG V +  S   ER
Sbjct: 206 PL----APLQRKPKNFNELPFYKYIDEVSAKYGKTDSEILLRWVTKRGIVPITTSSRHER 261

Query: 271 IVSNFKIFTLPEDDFKIISNLSKVHGEKRVVDMKWSSF 308
           IV+   +F+    D + +  ++K+  E+  + + W+ F
Sbjct: 262 IVNAQNLFSFDLTD-EEVDKITKLGLEQPALRLYWNEF 298

>Ecym_3264 Chr3 complement(503010..503945) [936 bp, 311 aa] {ON}
           similar to Saccharomyces cerevisiae YDL124W
          Length = 311

 Score =  102 bits (255), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 92/310 (29%), Positives = 141/310 (45%), Gaps = 50/310 (16%)

Query: 14  LNTGASIPVL---GFGT-WRSVE--NNGYHSVIAALKA-----GYRHIDAAAIYLNEEEV 62
           LN G SIP +   G G  W  +    +G  +++  LK      G+ HI  A  Y N   +
Sbjct: 11  LNNGNSIPAITTVGVGNKWTKIYGIRDGAKNLMEYLKEILALPGFLHIMTAEFYPNNGLL 70

Query: 63  GRAIKDSGVPREDIFITTKLWGTEQ--RDPEAALNESLKRLGLDYVDLYLMHWPVPLKTE 120
             A+K S  PR +I+IT K     +    P  AL  SL RLG DYVDLYL+H P      
Sbjct: 71  SAALKASQKPRHEIWITDKYCSQCKLSSSPIEALERSLDRLGFDYVDLYLIHNP------ 124

Query: 121 TITDGNVLCIPTLDDGTVDVDTREWNFIKTWDLMQELPKTGKTKAVGVSNFSINNIKALL 180
                   C+ +  +G         +  K W  M+ L KTGK K +GVSNF I +++ L 
Sbjct: 125 --------CLDSSPNGI--------SLEKAWKQMELLYKTGKVKNIGVSNFRIEDLERLK 168

Query: 181 ESPSNKLVPAANQIEIHPLLPQNE---LIAFCKEKGIVVEAYSPFGSVNAPLLE------ 231
           ++   ++ P  N+IE H  L QN+   +  + K   +++  YSP   +     +      
Sbjct: 169 DA---EIKPQVNEIEFHAFL-QNQTPNIYEYAKTHDLLLCGYSPLFPLETKTEDFMDFPF 224

Query: 232 EQAIIDMAKKHGVAPAQLIISWSIQRGY--VVLAKSVNPERIVSNFKIFTLPEDDFKIIS 289
            + II +A+K+    AQ+++ W    G   V+    V   +  S+   F L  ++  +I+
Sbjct: 225 YRYIIGLAEKYNKTEAQILLHWMNCLGVLPVITNTKVKWYKEASDIISFELTSEELDMIT 284

Query: 290 NLSKVHGEKR 299
            L K H   R
Sbjct: 285 ELGKKHKPHR 294

>Kwal_33.13274 s33 (151643..151969) [327 bp, 108 aa] {ON} YJR096W -
           Hypothetical ORF [contig 119] FULL
          Length = 108

 Score = 73.2 bits (178), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 37/96 (38%), Positives = 57/96 (59%), Gaps = 6/96 (6%)

Query: 7   NSSASLKLNTGASIPVLGFGTWRSVENNGYHSVIAALKAGYRHIDAAAIYLNEEEVGRAI 66
           N     KLN G  IPV+GFG +   + +    V +ALK GYRHID A +Y N++E  + +
Sbjct: 8   NRETRYKLNNGQQIPVIGFGVYEIPKEDTADRVYSALKDGYRHIDTAVLYRNQKEAAQGV 67

Query: 67  K----DSGVPREDIFITTKLWGTE--QRDPEAALNE 96
           +    ++G  RE+I+ TTKLW ++  + + + AL E
Sbjct: 68  RKYLDETGEARENIWFTTKLWDSQFGREETKKALQE 103

>Suva_12.272 Chr12 complement(441543..442262,442266..442340) [795
           bp, 265 aa] {ON} YDL124W (REAL)
          Length = 265

 Score = 53.1 bits (126), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 57/209 (27%), Positives = 90/209 (43%), Gaps = 40/209 (19%)

Query: 22  VLGFGTWRSVENNGYHSVIAALKAGYRHIDAAAIYLNEEEVGRAIKDSGVPREDIFITTK 81
           + G  T+  + N   + ++  LKAG + ID A IY + E   +AI +  +P +   I TK
Sbjct: 4   IYGGYTFSLLSNQNSNEIVTVLKAGVKDIDTARIYPDNE---KAIGELQLP-DRFTIHTK 59

Query: 82  LWGTE----QRDP-EAALNESLKRLGLDYVDLYLMHWPVPLKTETITDGNVLCIPTLDDG 136
             G       RD    ++ ESL  LG+  V+ +L+H P P                    
Sbjct: 60  ASGFSGGCLTRDNINKSIEESLSLLGVPSVETFLLHSPDP-------------------- 99

Query: 137 TVDVDTREWNFIKTWDLMQELPKTGKTKAVGVSNFSINNIKALLESPSNK--LVPAANQI 194
                  E    +T D +  L + GK +  G+SNFS  ++K + +   +K  ++P   Q 
Sbjct: 100 -------EIPLEETLDAINSLYEQGKFEKFGLSNFSTEDVKRIYDYAKSKDYVLPTVYQG 152

Query: 195 EIHPLLPQ--NELIAFCKEKGIVVEAYSP 221
             + L     N+L    KE  I + AYSP
Sbjct: 153 NYNALSRAIVNDLFPLLKELHISLYAYSP 181

>Suva_4.122 Chr4 (228898..228945,228942..229163,229167..229517) [621
           bp, 206 aa] {ON} YDL124W (REAL)
          Length = 206

 Score = 44.7 bits (104), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 47/195 (24%), Positives = 85/195 (43%), Gaps = 43/195 (22%)

Query: 46  GYRHIDAAAIYLNE-EEVGRAIKDSGVPREDIFITTKLWGTEQRDPEAAL----NESLKR 100
           G   I A+ IY     EVG A+  +  P+ +IF+T K   + Q +  A L    + +LK+
Sbjct: 5   GVIDIAASEIYKQTYPEVGEALSLTKKPKTEIFLTDK--SSTQTEVSATLAMRPDMALKK 62

Query: 101 LGLDYVDLYLMHWPVPLKTETITDGNVLCIPTLDDGTVDVDTREWNFIKTWDLMQ--ELP 158
           + ++YVD++ +H P   K                         + N +   D M    L 
Sbjct: 63  ISVEYVDMHFLHSPFVFK-------------------------QANVLNLKDAMHTDHLR 97

Query: 159 KTGKTKAVGVSNFSINNIKALLESPSNKLVPAANQIEIHPLLPQNE---LIAFCKEKGIV 215
           ++ K    G S+ ++  ++ +L++   +  P  NQI++   L +N+   +   C+E  I+
Sbjct: 98  RSNKANNRGASSVNVEELRRVLKTEDEE--PQVNQIKLRSSL-RNQTPGISKLCQENDIL 154

Query: 216 VEAYS---PFGSVNA 227
           +  YS   P    NA
Sbjct: 155 MAVYSTLDPLQRKNA 169

>TDEL0A08000 Chr1 (1399350..1400309) [960 bp, 319 aa] {ON} 
          Length = 319

 Score = 43.5 bits (101), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 53/218 (24%), Positives = 93/218 (42%), Gaps = 47/218 (21%)

Query: 18  ASIPVLGFGTW--RSVENNGYHSVIAALKA-GYRHIDAAAIYLNEEEVGRAIKDSGVPRE 74
           A +P + +G +   ++  + +  + + L+  G    D A IY   E   ++I D G+  +
Sbjct: 2   AELPKIVYGAYPITALPKDEFSKLYSLLRENGVTEWDTARIYPGSE---KSIGDLGIA-D 57

Query: 75  DIFITTKLWGTEQ----RDP-EAALNESLKRLGLDYVDLYLMHWPVPLK--TETITDGNV 127
           D+ I TK    E+    RD    ++ +S   L +D V++Y +H P P+    ETI     
Sbjct: 58  DLVIDTKARSFEEGALTRDGIFESIKQSFDELKVDSVEIYYLHAPDPITPIEETI----- 112

Query: 128 LCIPTLDDGTVDVDTREWNFIKTWDLMQELPKTGKTKAVGVSNFSINNIKALLE--SPSN 185
                                   D + EL K GK K  G+SN++ +++K + E     N
Sbjct: 113 ------------------------DAINELYKQGKFKKFGLSNYTPDDVKKIYEYAKSKN 148

Query: 186 KLVPAANQIEIHPLLP--QNELIAFCKEKGIVVEAYSP 221
            ++P   Q   +      + +L    ++ GI   AYSP
Sbjct: 149 YVLPTVFQGNYNAFSRSIEKDLFPVLRKYGISFYAYSP 186

>Kwal_33.13275 s33 (152348..152551) [204 bp, 67 aa] {OFF} [contig
           119] FULL
          Length = 67

 Score = 37.7 bits (86), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 16/35 (45%), Positives = 22/35 (62%)

Query: 253 WSIQRGYVVLAKSVNPERIVSNFKIFTLPEDDFKI 287
           WS  +G+VVL KS NPERI  N  +    +D +K+
Sbjct: 2   WSFLQGFVVLVKSSNPERIRQNLAVLPSKDDSWKV 36

>Suva_9.17 Chr9 (18179..19105) [927 bp, 308 aa] {ON} YNL331C (REAL)
          Length = 308

 Score = 39.7 bits (91), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 49/207 (23%), Positives = 81/207 (39%), Gaps = 40/207 (19%)

Query: 44  KAGYRHIDAAAIYLNEEEVGRAIKDSGVPREDIFITTKLWGTE-----QRDPEAALNESL 98
           KAG + ID A IY + E++   I +  +P     I TK  G       + +   ++ ESL
Sbjct: 31  KAGVKDIDTARIYPDSEKI---IGELQLPNR-FTIHTKASGFSGGCLTKDNINKSIEESL 86

Query: 99  KRLGLDYVDLYLMHWPVPLKTETITDGNVLCIPTLDDGTVDVDTREWNFIKTWDLMQELP 158
             LG+  V+ + +H P P                           E    +T   +  L 
Sbjct: 87  SLLGVPSVETFFLHSPDP---------------------------ETPIEETLGAINSLY 119

Query: 159 KTGKTKAVGVSNFSINNIKALLESPSNK--LVPAANQIEIHPLLP--QNELIAFCKEKGI 214
           + GK K  G+SNF+  ++K + E   +K  ++P   Q   +      +N+L    +E   
Sbjct: 120 EQGKFKKFGLSNFATEDVKRIYEYAKSKNFVLPTVYQGSYNAFSRAIENDLFPLLRELHF 179

Query: 215 VVEAYSPFGSVNAPLLEEQAIIDMAKK 241
              AYSP          EQ + D + +
Sbjct: 180 SFYAYSPIAGGFLAKTPEQVLGDKSGR 206

>KLTH0E01474g Chr5 complement(143734..144675) [942 bp, 313 aa] {ON}
           conserved hypothetical protein
          Length = 313

 Score = 38.1 bits (87), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 46/182 (25%), Positives = 73/182 (40%), Gaps = 38/182 (20%)

Query: 48  RHIDAAAIYLNEEEVGRAIKDSGVPREDIFITTKLWGTEQRDPEAALNESLKR----LGL 103
             +D A IY   EE   AI    +P+  I  T      E    + ++NES++     LG+
Sbjct: 35  EELDTARIYPGSEE---AIGKFELPKSFIIDTKARGFGEGTLTKESINESIEESFGLLGV 91

Query: 104 DYVDLYLMHWPVPLKTETITDGNVLCIPTLDDGTVDVDTREWNFIKTWDLMQELPKTGKT 163
           + V+++ +H P P              P  +               T D +  L K GK 
Sbjct: 92  ESVEIFYLHCPDP------------ATPLEE---------------TLDAIDALYKEGKF 124

Query: 164 KAVGVSNFSINNIKALLESPSNK--LVPAANQIEIHPLLPQNE--LIAFCKEKGIVVEAY 219
           K  GVSNFS  +++ +      K  ++P   Q   + +  + E  L    +E G+   AY
Sbjct: 125 KKFGVSNFSPEDVRKIYSYNKEKGYVLPTVYQGNYNAVGRKIETSLFPVLRELGLSFYAY 184

Query: 220 SP 221
           SP
Sbjct: 185 SP 186

>Kpol_400.9 s400 complement(19154..20179) [1026 bp, 341 aa] {ON}
           complement(19154..20179) [1026 nt, 342 aa]
          Length = 341

 Score = 37.4 bits (85), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 68/306 (22%), Positives = 109/306 (35%), Gaps = 95/306 (31%)

Query: 20  IPVLGFGT--WRSVENNGYHSVIAALKAGY----RHIDAAAIYLNEEE---VGRAIKDSG 70
           I  + FG+  W     +    +   LK  Y    R  D A +Y N E    +G  +K+  
Sbjct: 21  IGCMSFGSKKWSEWVEDDREKIFKILKYAYDKGLRTYDTANVYSNGESEIILGEFLKNYK 80

Query: 71  VPREDIFITTKLWGTEQRD---------PEAALN-----------------ESLKRLGLD 104
           +PRE + I TKL+     +         PEA LN                 +S++RLG  
Sbjct: 81  IPRETVIIMTKLYFPTNDNADYDIFSMTPEAILNNVNITGLSRKNIINSARDSVRRLGT- 139

Query: 105 YVDLYLMHWPVPLKTETITDGNVLCIPTLDDGTVDVDTREWNFIKTWDLMQELPKTGKTK 164
           Y D+  +H                          D DT    F +T   + ++   G T+
Sbjct: 140 YADIIQIH------------------------RADPDT---PFEETMRALNDIVVDGLTR 172

Query: 165 AVGVSN-FSINNIKALLESPSNKLVPAANQIEIHPLL---PQNELIAFCKEKGIVVEAYS 220
            +G S+  +   ++    +  N      N    + LL    + ELI F K   I +  +S
Sbjct: 173 YIGASSMLATEFVEMQFIAEKNDWFKFINSQSCYNLLYREDERELIPFAKRHNIALTPWS 232

Query: 221 PF--GSVNAPLLE----------------------EQAII----DMAKKHGVAPAQLIIS 252
           P   G +  P+ E                      ++ II    ++AKK     A + + 
Sbjct: 233 PLQRGVLCRPVGETSTRFEKDQFMSIGNIKDINSSDEEIITRVEEIAKKRNTKMATVALY 292

Query: 253 WSIQRG 258
           W IQ+G
Sbjct: 293 WVIQKG 298

>NCAS0C02450 Chr3 complement(455582..456613) [1032 bp, 343 aa] {ON} 
          Length = 343

 Score = 37.0 bits (84), Expect = 0.045,   Method: Compositional matrix adjust.
 Identities = 61/273 (22%), Positives = 111/273 (40%), Gaps = 59/273 (21%)

Query: 46  GYRHIDAAAIYLN---EEEVGRAIKDSGVPREDIFITTKLWGTEQRDPEAALNESL---- 98
           G R  D A +Y N   E  +G  +K   + RE + I +K++          ++ESL    
Sbjct: 53  GLRTFDTADVYSNGTSERILGEFLKRFNIKRETVVIMSKIF--------FPVDESLDLHQ 104

Query: 99  -KRLGLDYVDLYLMHWPVPLKTETITDGNVLCIPTLDDGTVDVDTREWNFIKTWDLMQEL 157
             ++  +Y+DL L  +   L  + I  G    +  L  GT  +D  + + +     M+E+
Sbjct: 105 GSKVDQEYIDLQL-SFQQGLNRKHIMAGVANSVERL--GTY-IDILQIHRLDKEASMEEI 160

Query: 158 PKT-------GKTKAVGVSNFSINNIKAL-LESPSNKLVPAANQIEIHPLL---PQNELI 206
            ++       G+ + +G S+        L   +  N      N    + +L    +NELI
Sbjct: 161 MRSLNDVVVSGQVRYIGASSMLATEFAELQFIAKQNGWFQFINVQSYYNVLNREDENELI 220

Query: 207 AFCKEKGIVVEAYSP--FGSVNAP-------LLEEQAIIDM------------------- 238
            FCK+ G+ +  +SP   G +  P       +L +   I M                   
Sbjct: 221 PFCKKHGVGLTVWSPNARGVLTRPADKTGTRMLSDPTFIKMGLDKLDESDKEIIGVVEAI 280

Query: 239 AKKHGVAPAQLIISWSIQRGYVVLAKSVNPERI 271
           AKK G++ A + ++W + +G   +A   + ER+
Sbjct: 281 AKKKGISMAMVSMAWILNKGANAIAGLNSIERV 313

>NDAI0C01480 Chr3 (312131..313162) [1032 bp, 343 aa] {ON} 
          Length = 343

 Score = 36.6 bits (83), Expect = 0.056,   Method: Compositional matrix adjust.
 Identities = 64/290 (22%), Positives = 111/290 (38%), Gaps = 48/290 (16%)

Query: 46  GYRHIDAAAIY---LNEEEVGRAIKDSGVPREDIFITTKLWG--TEQRDPEAALNESLKR 100
           G R  D A +Y   L+E  +G  +K   + RE + I TK++    E  D     N + +R
Sbjct: 53  GLRTFDTADVYSNGLSERIIGEFLKKYNIRRETVVILTKIFYPVDETLDLHHG-NSTNER 111

Query: 101 LGLDYVD---LYLMHWPVPLKTETITDGNVLCIPTLDDGTVDVDTREWNFIKTWDLMQEL 157
             LD V+   L   H    +K      G    I  L    +D DT +   ++    + ++
Sbjct: 112 NALDLVNQNGLSRKHIITGVKNSVERLGTY--IDVLQIHRLDHDTPKEEIMRA---LNDV 166

Query: 158 PKTGKTKAVGVSNFSINNIKALLESPSN----KLVPAANQIEIHPLLPQNELIAFCKEKG 213
              G  + +G S+        L  +       K V + +   +     + ELI FCK+ G
Sbjct: 167 IVEGSVRYIGASSMWATEFAELQFTAEKNGWFKFVSSQSYYNLLNREDERELIPFCKKHG 226

Query: 214 IVVEAYSP--FGSVNAPLLEE--------------------------QAIIDMAKKHGVA 245
           + +  +SP   G +  PL ++                          + +  +A K  ++
Sbjct: 227 VGLIPWSPNARGVLTRPLEQQTTRKLTDPTFIRMGLDKLSEDQKEIVRRVEHLAAKKNIS 286

Query: 246 PAQLIISWSIQRGYVVLAKSVNPERIVSNFKIF--TLPEDDFKIISNLSK 293
            A L I+W++ +G   +    + ER+    K     L EDD K +    K
Sbjct: 287 MAMLSIAWTLHKGANPIVGLNSIERVDEAIKAIDVELTEDDIKYLEETYK 336

>Suva_5.207 Chr5 complement(314580..316883) [2304 bp, 767 aa] {ON}
           YER091C (REAL)
          Length = 767

 Score = 36.2 bits (82), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 45/194 (23%), Positives = 76/194 (39%), Gaps = 16/194 (8%)

Query: 39  VIAALKAGYRHIDAAAIYLNEEEVGRAIKDSGVPREDIFITTKLWGTEQRDPEAALNESL 98
           VI  L     H+D A      ++V  AI D       I     +W  + +   A +N+++
Sbjct: 262 VIKGLPVSALHVDFARAPQQFDDVIAAIGDKQTLSVGIVDGRNIWKNDFKKSSAFVNKAI 321

Query: 99  KRLGLDYVDL----YLMHWPVPLKTETITDGNVLCIPTLDDGTVDVDTREWNFIKTWDLM 154
           ++LG D V +     L+H PV L  ET  D  +    +     +D        +   D+ 
Sbjct: 322 EKLGADRVVVATSSSLLHTPVDLTNETKLDAEIKGFFSFATQKLDEVVVITKNVSGQDVA 381

Query: 155 QELPKT-------GKTKAVGVSNF-----SINNIKALLESPSNKLVPAANQIEIHPLLPQ 202
             L          GK+K +  S+      SI+   +   SP  + +P   +I   PL P 
Sbjct: 382 AALEANAKSVESRGKSKLIHDSSVKARVASIDQKMSTRASPFEQRLPEQKKIFNLPLFPT 441

Query: 203 NELIAFCKEKGIVV 216
             + +F + K I +
Sbjct: 442 TTIGSFPQTKDIRI 455

>Ecym_2296 Chr2 complement(574287..575309) [1023 bp, 340 aa] {ON}
           similar to Ashbya gossypii ABR094W
          Length = 340

 Score = 35.8 bits (81), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 42/181 (23%), Positives = 79/181 (43%), Gaps = 51/181 (28%)

Query: 42  ALKAGYRHIDAAAIYLNEEEV-GRAIKD--SGVPREDIFITTKL-------WGTEQRDPE 91
           A+  G   ID +  Y   E + G+A+++     PRE+ FI TK+       +   + +  
Sbjct: 50  AMSRGINAIDTSPYYGPSEIIYGKALQEIKDEFPREEYFICTKVGRVGRAEFNYSKENVR 109

Query: 92  AALNESLKRLGLDYVDLYLMHWPVPLKTETITDGNVLCIPTLDDGTVDVDTREWNFIKTW 151
            ++  S +RL  DY+DL  +H                          D++  E++  K W
Sbjct: 110 FSVKRSCERLHTDYLDLVYLH--------------------------DIEYVEYD--KIW 141

Query: 152 DLMQELPK---TGKTKAVGVSNFSINNIKALLESPSNKLVPAANQIEIHPLLPQNELIAF 208
           + ++EL K    G  + +G+S + ++ +  L  S +   VP     EI PL   + ++++
Sbjct: 142 EALRELRKLKDEGVIRHIGISGYPVDLL--LYVSKTCCGVP-----EIGPL---DAVLSY 191

Query: 209 C 209
           C
Sbjct: 192 C 192

>NCAS0C01990 Chr3 (365857..366888) [1032 bp, 343 aa] {ON} Anc_8.565
          Length = 343

 Score = 35.0 bits (79), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 64/291 (21%), Positives = 118/291 (40%), Gaps = 59/291 (20%)

Query: 46  GYRHIDAAAIYLN---EEEVGRAIKDSGVPREDIFITTKLWGTEQRDPEAALNESLKRLG 102
           G R  D A +Y N   E  VG  +K   + RE + I TK++          ++ESL    
Sbjct: 53  GLRTFDTADVYSNGISERLVGEFLKKYNIKRETVVIMTKIF--------FPVDESLDLHH 104

Query: 103 LDYVDLYLMHWPVPLKT----ETITDGNVLCIPTLDDGTVDVDTREWNFIKTWDLMQELP 158
              V+   M   + L+     + I DG    +  L  GT  +D  + + +     M+E+ 
Sbjct: 105 GSNVNQEAMELQLTLQRGLSRKHIIDGVANSVERL--GTY-IDVLQIHRLDEETSMEEIM 161

Query: 159 KT-------GKTKAVGVSNFSINNIKAL-LESPSN---KLVPAANQIEIHPLLPQNELIA 207
           ++       G+ + +G S+        L   +  N   K + A +   +     + ELI 
Sbjct: 162 RSLNDVVMSGQVRYIGASSMLATEFAELQFIAEKNGWFKFISAQSYYNLINREDERELIP 221

Query: 208 FCKEKGIVVEAYSP--FGSVNAPLLE--EQAIID------------------------MA 239
           FCK+ G+ +  +SP   G +  P+ +  E+ + D                        +A
Sbjct: 222 FCKKHGVGLIPWSPNARGVLTRPVEKNTERMLTDPTFNRMRLNELGDDEKEIVRRIQMVA 281

Query: 240 KKHGVAPAQLIISWSIQRGYVVLAKSVNPERIVSNFKI--FTLPEDDFKII 288
           ++  V  A + ++W++ +G   +    + ER+    K   FTL ED+ K++
Sbjct: 282 ERRSVTMAIISMAWTLHKGCNPIVGLNSVERVDEAVKAIEFTLTEDEIKLL 332

>Kpol_1050.55 s1050 complement(123375..124733) [1359 bp, 452 aa]
           {ON} complement(123375..124733) [1359 nt, 453 aa]
          Length = 452

 Score = 34.7 bits (78), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 40/160 (25%), Positives = 65/160 (40%), Gaps = 26/160 (16%)

Query: 165 AVGVSNFSINNIKALLESPSN----KLVPAA------NQIEIHPLLPQNELIAFCKEKGI 214
           A  V    I N+  L  S SN    +L+P +      + I +  L PQ  ++A C  +G 
Sbjct: 187 ARSVGQVHITNLSQLKHSDSNPSGTRLLPTSIIKAHKSAIRMLRLNPQGTMVATCSVQGT 246

Query: 215 VVEAYSPFGSVNAPLLEE-------QAIIDMAKKHGVAPAQLIISWSIQRGYVVLAKS-- 265
           ++  +S   ++N  LL E         I DMA  HG     ++        + VL+ +  
Sbjct: 247 LIRIFS---TLNGSLLREFRRGLDRADIYDMAFSHGGTKLAVVSDKQTLHIFQVLSSTHP 303

Query: 266 VNPERIVSNFKIFTLPEDDFKIISNLSKVHGEKRVVDMKW 305
            N E  ++N K    P  +       +KVH  + V+   W
Sbjct: 304 QNNESTITNNK----PNMNDSFDHGKNKVHALRDVIPNVW 339

>KAFR0C04240 Chr3 (842806..843837) [1032 bp, 343 aa] {ON} 
          Length = 343

 Score = 34.3 bits (77), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 23/71 (32%), Positives = 38/71 (53%), Gaps = 5/71 (7%)

Query: 231 EEQAIIDMAKKHGVAPAQLIISWSIQ-RGYVVLAKSVNPERIVSNFKIFTLPEDDFKIIS 289
           +E+ +I  AKKH +A    +I WS   RG +     V+ +R   + ++  LPE D +II 
Sbjct: 217 DEREVIPFAKKHNIA----LIPWSPNARGILTRPNGVDSDRSSIDPRLQNLPEQDKQIID 272

Query: 290 NLSKVHGEKRV 300
            + KV  ++ V
Sbjct: 273 RVEKVARDRGV 283

>KLLA0B09658g Chr2 complement(837873..838901) [1029 bp, 342 aa] {ON}
           similar to uniprot|Q06494 Saccharomyces cerevisiae
           YPR127W
          Length = 342

 Score = 33.9 bits (76), Expect = 0.51,   Method: Compositional matrix adjust.
 Identities = 20/76 (26%), Positives = 37/76 (48%), Gaps = 1/76 (1%)

Query: 149 KTWDLMQELPKTGKTKAVGVSNFSINNIKALLESPSNKLVPAANQIEIHPL-LPQNELIA 207
           +T+D + E  K GK   + +S  +   I+A+ +     LV    ++ +    +  N ++ 
Sbjct: 145 ETFDTIVEYVKKGKIGGISLSEVTAEQIRAIHKEYGEYLVCVEVELSMFSAEILSNGIVD 204

Query: 208 FCKEKGIVVEAYSPFG 223
            C E G+ + AYSP G
Sbjct: 205 TCNELGLPIVAYSPLG 220

>NDAI0J00730 Chr10 complement(155561..156592) [1032 bp, 343 aa] {ON}
           
          Length = 343

 Score = 33.5 bits (75), Expect = 0.58,   Method: Compositional matrix adjust.
 Identities = 67/297 (22%), Positives = 110/297 (37%), Gaps = 62/297 (20%)

Query: 46  GYRHIDAAAIYLN---EEEVGRAIKDSGVPREDIFITTKLWGTEQRDPEAALNESL---- 98
           G R  D A +Y N   E  +G  +K   + RE + I TK++         A++E+L    
Sbjct: 53  GLRTYDTADVYSNGVSERLIGEFLKKYNIKRETVVIFTKIF--------YAVDETLDLPR 104

Query: 99  -----KRLGLDYVD---LYLMHWPVPLKTETITDGNVLCIPTLDDGTVDVDTREWNFIKT 150
                +R  LD  +   L   H    +K      G    I  L    +D DT +   ++ 
Sbjct: 105 SNVPNERNDLDLANQGGLSRKHIITGVKNSVERLGTY--IDVLQIHRLDHDTPKEEIMRA 162

Query: 151 WDLMQELPKTGKTKAVGVSNFSINNIKALLESPSN----KLVPAANQIEIHPLLPQNELI 206
              + ++   G  + +G S+        L  +       K V + +   +     + ELI
Sbjct: 163 ---LNDVIVEGSVRYIGASSMWATEFAELQFTAEKNGWFKFVSSQSYYNLLNREDERELI 219

Query: 207 AFCKEKGIVVEAYSP--FGSVNAPL-------LEEQAIIDM------------------- 238
            FCK  G+ +  +SP   G +  PL       L +  I +M                   
Sbjct: 220 PFCKRHGVGLIPWSPNARGILTRPLEQQSTRKLSDPTITNMGLDNLADDQKEIVKRVEHL 279

Query: 239 AKKHGVAPAQLIISWSIQRGYVVLAKSVNPERIVSNFKIF--TLPEDDFKIISNLSK 293
           A K  ++ A L ISW++ +G   +    + ER+    K     L EDD K +    K
Sbjct: 280 ATKKNISMAMLSISWALHKGANPIVGLNSIERVDEAIKAIDVKLTEDDIKYLEETYK 336

>TBLA0G01120 Chr7 complement(285827..286858) [1032 bp, 343 aa] {ON} 
          Length = 343

 Score = 33.5 bits (75), Expect = 0.64,   Method: Compositional matrix adjust.
 Identities = 27/112 (24%), Positives = 45/112 (40%), Gaps = 32/112 (28%)

Query: 32  ENNGYHSVIAALKAGYRHIDAAAIYLNEEE---VGRAIKDSGVPREDIFITTKLW----- 83
           +N  +  +  A  +G R  D A  Y N +    +G  +K+  +PRE + I TK+W     
Sbjct: 39  KNEVFKILKTAYDSGLRTFDTADGYSNGQSEILLGEFLKEYEIPRETVIIMTKVWAPVDS 98

Query: 84  -----------------------GTEQRDPEAALNESLKRLGLDYVDLYLMH 112
                                  G  ++    A   S++RLG  Y+D+Y +H
Sbjct: 99  SLEGFQRTGPMNEDQKVHFANQQGLSRKHIIEACKNSVRRLGT-YIDVYQIH 149

>NCAS0A12950 Chr1 complement(2551851..2552822) [972 bp, 323 aa] {ON}
           Anc_2.604 YMR041C
          Length = 323

 Score = 33.1 bits (74), Expect = 0.79,   Method: Compositional matrix adjust.
 Identities = 24/81 (29%), Positives = 38/81 (46%), Gaps = 10/81 (12%)

Query: 42  ALKAGYRHIDAAAIYLNEE-EVGRAIKDSG--VPREDIFITTKL-------WGTEQRDPE 91
           A + G   ID +  Y N E  +G+A+ + G   PR+   I TK+       +     +  
Sbjct: 33  AFENGINCIDTSPYYGNSEILIGKALHNLGDKFPRDSYLICTKVGRLSLDSFDYSADNVR 92

Query: 92  AALNESLKRLGLDYVDLYLMH 112
            ++  S KRL  DY+DL  +H
Sbjct: 93  RSVVRSCKRLNSDYLDLVYLH 113

>KLTH0E16852g Chr5 complement(1496072..1497199) [1128 bp, 375 aa]
           {ON} highly similar to uniprot|P42884 Saccharomyces
           cerevisiae YNL331C
          Length = 375

 Score = 32.7 bits (73), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 25/93 (26%), Positives = 41/93 (44%), Gaps = 21/93 (22%)

Query: 41  AALKAGYRHIDAAAIYLN---EEEVGRAIKDSGVPREDIFITTK---------------- 81
           A  +AG   ID A  Y N   EE +G  +    + R+ I I TK                
Sbjct: 61  AFYEAGGNFIDTANNYQNGQSEEWIGEWMSSRKI-RDQIVIATKYTSDYKAYQIGKNKSA 119

Query: 82  -LWGTEQRDPEAALNESLKRLGLDYVDLYLMHW 113
              G  +R  + ++ +SL++L  D++D+  +HW
Sbjct: 120 NFSGNHRRSLQLSVRDSLRKLQTDWIDILYVHW 152

>YNL331C Chr14 complement(16118..17248) [1131 bp, 376 aa] {ON}
           AAD14Putative aryl-alcohol dehydrogenase; similar to P.
           chrysosporium aryl-alcohol dehydrogenase; mutational
           analysis has not yet revealed a physiological role
          Length = 376

 Score = 32.7 bits (73), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 25/93 (26%), Positives = 40/93 (43%), Gaps = 21/93 (22%)

Query: 41  AALKAGYRHIDAAAIYLNEEE---VGRAIKDSGVPREDIFITTKL--------------- 82
           A  +AG   ID A  Y NEE    +G  +    + R+ I I TK                
Sbjct: 61  AFYEAGGNCIDTANSYQNEESEIWIGEWMASRKL-RDQIVIATKFTGDYKKYEVGGGKSA 119

Query: 83  --WGTEQRDPEAALNESLKRLGLDYVDLYLMHW 113
              G  +R    ++ +SL++L  D++D+  +HW
Sbjct: 120 NYCGNHKRSLHVSVRDSLRKLQTDWIDILYIHW 152

>KLLA0E24421g Chr5 (2171139..2172245) [1107 bp, 368 aa] {ON} similar
           to gnl|GLV|CAGL0K04015g Candida glabrata CAGL0K04015g
           and weakly similar to YGR031W uniprot|P53219
           Saccharomyces cerevisiae YGR031W Hypothetical ORF
          Length = 368

 Score = 32.7 bits (73), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 23/48 (47%), Gaps = 6/48 (12%)

Query: 129 CIPTLDDGTVDVDTREWNFIKTWDLMQELPKTGKTKAVGVSNFSINNI 176
           C+  LD G V VD + W    +  L + LP        GV N+ +NNI
Sbjct: 184 CVKLLDQGKVRVDDKLWRHKASESLKRYLPNA------GVRNYVLNNI 225

>Smik_14.1 Chr14 complement(607..1737) [1131 bp, 376 aa] {ON}
           YNL331C (REAL)
          Length = 376

 Score = 32.7 bits (73), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 25/93 (26%), Positives = 41/93 (44%), Gaps = 21/93 (22%)

Query: 41  AALKAGYRHIDAAAIYLNEEE---VGRAIKDSGVPREDIFITTKL--------------- 82
           A  +AG   +D A  Y NE+    +G  +K   V R+ I I TK                
Sbjct: 61  AFYEAGGNCVDTANSYQNEQSETWIGEWMKLRKV-RDQIVICTKYTGDYKKYEAGDGKSA 119

Query: 83  --WGTEQRDPEAALNESLKRLGLDYVDLYLMHW 113
              G  +R    ++ +SL++L  D++D+  +HW
Sbjct: 120 NYCGNHRRSLHVSVRDSLRKLQTDWIDILYIHW 152

>YDL243C Chr4 complement(17577..18566) [990 bp, 329 aa] {ON}
           AAD4Putative aryl-alcohol dehydrogenase; involved in
           oxidative stress response; similar to P. chrysosporium
           aryl-alcohol dehydrogenase; expression induced in cells
           treated with the mycotoxin patulin
          Length = 329

 Score = 32.3 bits (72), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 25/93 (26%), Positives = 40/93 (43%), Gaps = 21/93 (22%)

Query: 41  AALKAGYRHIDAAAIYLNEEE---VGRAIKDSGVPREDIFITTKL--------------- 82
           A  +AG   ID A  Y NEE    +G  +K   + R+ I I TK                
Sbjct: 15  AFYEAGGNCIDTANSYQNEESEIWIGEWMKSRKL-RDQIVIATKFTGDYKKYEVGGGKSA 73

Query: 83  --WGTEQRDPEAALNESLKRLGLDYVDLYLMHW 113
              G  +     ++ +SL++L  D++D+  +HW
Sbjct: 74  NYCGNHKHSLHVSVRDSLRKLQTDWIDILYVHW 106

>TPHA0J01470 Chr10 complement(340233..342580,342945..343212) [2616
           bp, 871 aa] {ON} 
          Length = 871

 Score = 32.7 bits (73), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 32/97 (32%), Positives = 45/97 (46%), Gaps = 24/97 (24%)

Query: 93  ALNESLKRLGLDYVDLYLMHWPV----------PLKTETITDGNVLCIPTLDDGTVDVDT 142
           +L E LK L  + +D      PV           LKTE+I   NV  +P+ D+       
Sbjct: 215 SLAEKLKALKQNKLDAKKESKPVNKNIKSGNSEELKTESIDPNNVSQVPSSDNV------ 268

Query: 143 REWNFIKTWDLMQELPKT----GKTKAVGVSNFSINN 175
             WNFI+T++  +EL  T    G T  + +SNF I N
Sbjct: 269 --WNFIQTFN--KELKITPYLKGLTSDLAISNFIIGN 301

>TBLA0B10110 Chr2 complement(2432572..2433609) [1038 bp, 345 aa]
           {ON} 
          Length = 345

 Score = 32.3 bits (72), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 36/142 (25%), Positives = 52/142 (36%), Gaps = 45/142 (31%)

Query: 15  NTGASIPVLGFGT----------WRSVE-NNGYHSVIAALKAGYRHIDAAAIY---LNEE 60
           NTG  I    FGT          W   E  + Y  +  A   G R  D A  Y   L+E 
Sbjct: 11  NTGLKISPFIFGTMTFGNKKNMQWAIEEMEDAYKILKYAYDRGIRTFDTADAYANGLSET 70

Query: 61  EVGRAIKDSGVPREDIFITTKLW------------------------------GTEQRDP 90
            +G  +K   +PRE + I TK++                              G  ++  
Sbjct: 71  ILGSFLKHYNIPRETVVIMTKVFYRVDDTIELNPTDLLFGNNEELNLRLVNQKGLSRKHI 130

Query: 91  EAALNESLKRLGLDYVDLYLMH 112
             A   S++RLG  Y+D+Y +H
Sbjct: 131 LEAAKNSVRRLG-TYIDVYQIH 151

>YER091C Chr5 complement(339864..342167) [2304 bp, 767 aa] {ON}
           MET6Cobalamin-independent methionine synthase, involved
           in methionine biosynthesis and regeneration; requires a
           minimum of two glutamates on the methyltetrahydrofolate
           substrate, similar to bacterial metE homologs
          Length = 767

 Score = 32.7 bits (73), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 41/193 (21%), Positives = 74/193 (38%), Gaps = 16/193 (8%)

Query: 40  IAALKAGYRHIDAAAIYLNEEEVGRAIKDSGVPREDIFITTKLWGTEQRDPEAALNESLK 99
           I  L     H+D        +EV  AI +       I     +W  + +   A +N++++
Sbjct: 263 IKGLPVAALHVDFVRAPEQFDEVVAAIGNKQTLSVGIVDGRNIWKNDFKKSSAIVNKAIE 322

Query: 100 RLGLDYVDL----YLMHWPVPLKTETITDGNVLCIPTLDDGTVDVDTREWNFIKTWDLMQ 155
           +LG D V +     L+H PV L  ET  D  +    +     +D        +   D+  
Sbjct: 323 KLGADRVVVATSSSLLHTPVDLNNETKLDAEIKGFFSFATQKLDEVVVITKNVSGQDVAA 382

Query: 156 ELPKTGKT-KAVGVSNF-----------SINNIKALLESPSNKLVPAANQIEIHPLLPQN 203
            L    K+ ++ G S F           SI+   +   +P  + +P   ++   PL P  
Sbjct: 383 ALEANAKSVESRGKSKFIHDAAVKARVASIDEKMSTRAAPFEQRLPEQQKVFNLPLFPTT 442

Query: 204 ELIAFCKEKGIVV 216
            + +F + K I +
Sbjct: 443 TIGSFPQTKDIRI 455

>Suva_14.10 Chr14 complement(10349..11479) [1131 bp, 376 aa] {ON}
           YNL331C (REAL)
          Length = 376

 Score = 32.0 bits (71), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 24/93 (25%), Positives = 41/93 (44%), Gaps = 21/93 (22%)

Query: 41  AALKAGYRHIDAAAIYLNEEE---VGRAIKDSGVPREDIFITTKL-----W--------- 83
           A  +AG   ID A  Y NE+    +G  ++   + R+ I I TK      W         
Sbjct: 61  AFYEAGGNFIDTANTYQNEQSEAWIGEWMESRKL-RDQIVIATKFSTDYKWYDVGKNRSA 119

Query: 84  ---GTEQRDPEAALNESLKRLGLDYVDLYLMHW 113
              G  +     ++ +SL++L  D++D+  +HW
Sbjct: 120 NFCGNSKHSLHVSVRDSLRKLQTDWIDILYIHW 152

>YCR107W Chr3 (313890..314981) [1092 bp, 363 aa] {ON}  AAD3Putative
           aryl-alcohol dehydrogenase; similar to P. chrysosporium
           aryl-alcohol dehydrogenase; mutational analysis has not
           yet revealed a physiological role
          Length = 363

 Score = 31.6 bits (70), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 25/102 (24%), Positives = 44/102 (43%), Gaps = 21/102 (20%)

Query: 32  ENNGYHSVIAALKAGYRHIDAAAIYLNEEE---VGRAIKDSGVPREDIFITTKL------ 82
           +N  +  +    +AG   IDAA    NE+    +G  I+   + R+ I I TK       
Sbjct: 49  KNRAFELLDTFYEAGGNFIDAANNCQNEQSEEWIGEWIQSRRL-RDQIVIATKFIKSDKK 107

Query: 83  -----------WGTEQRDPEAALNESLKRLGLDYVDLYLMHW 113
                       G  +R    ++ +SL++L  D++D+  +HW
Sbjct: 108 YKAGESNTANYCGNHKRSLHVSVRDSLRKLQTDWIDILYVHW 149

>YFL056C Chr6 complement(14793..15431) [639 bp, 212 aa] {ON}
           AAD6Putative aryl-alcohol dehydrogenase; involved in
           oxidative stress response; similar to P. chrysosporium
           aryl-alcohol dehydrogenase; expression induced in cells
           treated with the mycotoxin patulin
          Length = 212

 Score = 31.2 bits (69), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 24/93 (25%), Positives = 40/93 (43%), Gaps = 21/93 (22%)

Query: 41  AALKAGYRHIDAAAIYLNEEE---VGRAIKDSGVPREDIFITTKL--------------- 82
           A  +AG   ID A  Y NE+    +G  +    + R+ I I TK                
Sbjct: 61  AFYEAGGNFIDTANNYQNEQSEAWIGEWMVSRKL-RDQIVIATKFTTDYKKYDVGGGKSA 119

Query: 83  --WGTEQRDPEAALNESLKRLGLDYVDLYLMHW 113
              G  +R    ++ +SL++L  D++D+  +HW
Sbjct: 120 NYCGNHKRSLHVSVRDSLRKLQTDWIDILYVHW 152

>TPHA0E02340 Chr5 (494049..499073) [5025 bp, 1674 aa] {ON} Anc_5.261
           YJL039C
          Length = 1674

 Score = 31.6 bits (70), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 24/76 (31%), Positives = 34/76 (44%), Gaps = 2/76 (2%)

Query: 37  HSVIAALKAGYRHIDAAAIYLNEEEVGRAIKDSGVPREDIFITTKLWGTEQRDPEAA--L 94
           H    +L+ G   I+     LN+E +  AIK S     D    TKL    Q DP+ +   
Sbjct: 45  HQSRTSLEKGTLEINGTTYKLNKEFIFAAIKISDDLNLDELAITKLLINSQNDPQKSNNT 104

Query: 95  NESLKRLGLDYVDLYL 110
           N+S+  + L  V  YL
Sbjct: 105 NDSISLINLGKVQYYL 120

>KNAG0M02340 Chr13 complement(431237..432166) [930 bp, 309 aa] {ON}
           Anc_2.604 YMR041C
          Length = 309

 Score = 31.2 bits (69), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 29/145 (20%), Positives = 66/145 (45%), Gaps = 31/145 (21%)

Query: 44  KAGYRHIDAAAIYLNEEE-VGRAIKDSGVPREDIFITTKL-------WGTEQRDPEAALN 95
           +  +  +D +  Y + E  VG+A+++  +PR +I++ TK+       +   + +   ++ 
Sbjct: 38  RRCFNAVDTSPYYGDSELLVGQALRELQIPRGEIYVCTKVGRVGVSEFDYSRENVRMSVM 97

Query: 96  ESLKRLGLDYVDLYLMHWPVPLKTETITDGNVLCIPTLDDGTVDVDTREWNFIKTWDLMQ 155
            S++RL                    + +G  L +  L D  V+   +E   +   D +Q
Sbjct: 98  RSVERL--------------------VGEGGYLDVVYLHD--VEFQPQE-ACLAALDELQ 134

Query: 156 ELPKTGKTKAVGVSNFSINNIKALL 180
           +L + G  + VGVS + ++ + +L+
Sbjct: 135 KLKRAGIVRNVGVSGYPLSKLYSLV 159

>NDAI0B00930 Chr2 (215394..218216) [2823 bp, 940 aa] {ON} Anc_5.76
           YGR250C
          Length = 940

 Score = 31.6 bits (70), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 26/108 (24%), Positives = 44/108 (40%), Gaps = 18/108 (16%)

Query: 151 WDLMQELPKTGKTKAVGVSNFSINNIKALLESPSNKLVPAANQI---------------E 195
           W+ ++E    GK K + + NF INN+K       NK     N+                E
Sbjct: 291 WNQLRENNDDGKFKCIFIGNFPINNMKQESGETENKDKSITNEFNYRITPEIIIEKIKSE 350

Query: 196 IHPLLPQNELIAFCK---EKGIVVEAYSPFGSVNAPLLEEQAIIDMAK 240
           + PL+P  E++++     +    V       +VNA + E   + D+ K
Sbjct: 351 LLPLIPDFEILSYYFPRIQNNHDVTYIKNQSTVNAKVFESDNVNDLTK 398

>Ecym_2026 Chr2 (42179..43534) [1356 bp, 451 aa] {ON} similar to
           Ashbya gossypii ADL184W
          Length = 451

 Score = 31.2 bits (69), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 22/99 (22%), Positives = 41/99 (41%), Gaps = 4/99 (4%)

Query: 200 LPQNELIAFCKEKGIVVEAYSPFGSVNAPLLEEQAIIDMAKKHGVAPAQL----IISWSI 255
           +P +  I +  EK +   AYSP G + A   +++ I   A+   V P         +  +
Sbjct: 328 VPSSHTITYAHEKSVTSLAYSPVGHILASAAKDRTIRFWARSRPVDPNAFDDPTYNNKKV 387

Query: 256 QRGYVVLAKSVNPERIVSNFKIFTLPEDDFKIISNLSKV 294
              Y  +  ++N  R  +   I   P  D  + +NL+ +
Sbjct: 388 NAWYFGINNNINAVRTKTEHGIALPPATDGSMTTNLTSM 426

>KAFR0D03980 Chr4 (783660..784709) [1050 bp, 349 aa] {ON} Anc_1.75
           YNL274C
          Length = 349

 Score = 30.8 bits (68), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 29/97 (29%), Positives = 42/97 (43%), Gaps = 10/97 (10%)

Query: 102 GLDYVDLY-------LMHWPVPLKTETITDGNVLCIPTLDDGTVDVDTREWNFIKTWDLM 154
           G ++VD         ++   VPL +ET    N      + DG V V+T     I   DL+
Sbjct: 208 GAEFVDFETLLKESDIISISVPLNSETRHLFNKETFAKMKDGVVIVNTARGPVINESDLI 267

Query: 155 QELPKTGKTKAVGVSNFSINNI--KALLESPSNKLVP 189
             L KT K +A G+  F    I  + LL+ P    +P
Sbjct: 268 DAL-KTCKVRAAGLDVFEFEPIVPQELLDMPQVVTIP 303

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.134    0.398 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 34,187,549
Number of extensions: 1495483
Number of successful extensions: 4431
Number of sequences better than 10.0: 163
Number of HSP's gapped: 4195
Number of HSP's successfully gapped: 175
Length of query: 312
Length of database: 53,481,399
Length adjustment: 109
Effective length of query: 203
Effective length of database: 40,982,805
Effective search space: 8319509415
Effective search space used: 8319509415
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 65 (29.6 bits)