Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Smik_4.6285.425ON45844116890.0
YDR363W (ESC2)5.425ON45644112751e-173
Suva_2.5345.425ON45240511391e-153
Skud_4.6315.425ON45835810421e-138
ZYRO0F09812g5.425ON4162726282e-76
KAFR0E038705.425ON3962896053e-73
SAKL0G02266g5.425ON4842745023e-57
NDAI0B056005.425ON4571474961e-56
TBLA0A037105.425ON4612734892e-55
NCAS0F033105.425ON4421454846e-55
Kwal_55.214685.425ON4652774482e-49
KLTH0F16280g5.425ON4731513737e-39
Kpol_1027.265.425ON4431333225e-32
Ecym_55245.425ON4152753207e-32
TPHA0E018105.425ON4531283219e-32
TDEL0E020005.425ON4361192943e-28
AER251W5.425ON4072722924e-28
CAGL0A02706g5.425ON3691282862e-27
KNAG0C049805.425ON3451302603e-24
KLLA0E21275g5.425ON3922812155e-18
KLTH0E00682g5.718ON40772820.14
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Smik_4.628
         (458 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Smik_4.628 Chr4 (1125627..1127003) [1377 bp, 458 aa] {ON} YDR363...   655   0.0  
YDR363W Chr4 (1199183..1200553) [1371 bp, 456 aa] {ON}  ESC2Sumo...   495   e-173
Suva_2.534 Chr2 (956062..957420) [1359 bp, 452 aa] {ON} YDR363W ...   443   e-153
Skud_4.631 Chr4 (1128086..1129462) [1377 bp, 458 aa] {ON} YDR363...   405   e-138
ZYRO0F09812g Chr6 (797169..798419) [1251 bp, 416 aa] {ON} weakly...   246   2e-76
KAFR0E03870 Chr5 (768042..769232) [1191 bp, 396 aa] {ON} Anc_5.4...   237   3e-73
SAKL0G02266g Chr7 (190967..192421) [1455 bp, 484 aa] {ON} some s...   197   3e-57
NDAI0B05600 Chr2 (1369512..1370885) [1374 bp, 457 aa] {ON} Anc_5...   195   1e-56
TBLA0A03710 Chr1 (928023..929408) [1386 bp, 461 aa] {ON} Anc_5.4...   192   2e-55
NCAS0F03310 Chr6 (670533..671861) [1329 bp, 442 aa] {ON} Anc_5.4...   191   6e-55
Kwal_55.21468 s55 complement(851687..853084) [1398 bp, 465 aa] {...   177   2e-49
KLTH0F16280g Chr6 complement(1321305..1322726) [1422 bp, 473 aa]...   148   7e-39
Kpol_1027.26 s1027 complement(53549..54880) [1332 bp, 443 aa] {O...   128   5e-32
Ecym_5524 Chr5 (1062240..1063487) [1248 bp, 415 aa] {ON} similar...   127   7e-32
TPHA0E01810 Chr5 complement(364173..365534) [1362 bp, 453 aa] {O...   128   9e-32
TDEL0E02000 Chr5 complement(379082..380392) [1311 bp, 436 aa] {O...   117   3e-28
AER251W Chr5 (1099999..1101222) [1224 bp, 407 aa] {ON} Syntenic ...   117   4e-28
CAGL0A02706g Chr1 (290595..291704) [1110 bp, 369 aa] {ON} simila...   114   2e-27
KNAG0C04980 Chr3 complement(958989..960026) [1038 bp, 345 aa] {O...   104   3e-24
KLLA0E21275g Chr5 complement(1900927..1902105) [1179 bp, 392 aa]...    87   5e-18
KLTH0E00682g Chr5 complement(67775..68998) [1224 bp, 407 aa] {ON...    36   0.14 

>Smik_4.628 Chr4 (1125627..1127003) [1377 bp, 458 aa] {ON} YDR363W
           (REAL)
          Length = 458

 Score =  655 bits (1689), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 340/441 (77%), Positives = 340/441 (77%)

Query: 1   MTRSSKSIGELPINLXXXXXXXXXXXXXXXXXXXXXXEDEIDDNDGSKRRSVIVDSKVXX 60
           MTRSSKSIGELPINL                      EDEIDDNDGSKRRSVIVDSKV  
Sbjct: 1   MTRSSKSIGELPINLNSDSTSFTDDSSDNFFMDNSFDEDEIDDNDGSKRRSVIVDSKVSN 60

Query: 61  XXXXXXXXXXXXXXXEKNVASQANILPDRSSTENVNAEHTTKPKLDLPSGRTRGRSTMKE 120
                          EKNVASQANILPDRSSTENVNAEHTTKPKLDLPSGRTRGRSTMKE
Sbjct: 61  FPSDCLSSPSSSLDNEKNVASQANILPDRSSTENVNAEHTTKPKLDLPSGRTRGRSTMKE 120

Query: 121 SVVEINPRESKSIDDEKLHXXXXXXXXXXXXXXPTGKYKRQKSSLLYAYDENDDFFKELA 180
           SVVEINPRESKSIDDEKLH              PTGKYKRQKSSLLYAYDENDDFFKELA
Sbjct: 121 SVVEINPRESKSIDDEKLHRSRSRSRSSIRSLSPTGKYKRQKSSLLYAYDENDDFFKELA 180

Query: 181 KEAKKTTSVSKESTPDQRKRVYNIKFLSKLEGTINKAVQVKVLGKYEFSRILPAALDGLT 240
           KEAKKTTSVSKESTPDQRKRVYNIKFLSKLEGTINKAVQVKVLGKYEFSRILPAALDGLT
Sbjct: 181 KEAKKTTSVSKESTPDQRKRVYNIKFLSKLEGTINKAVQVKVLGKYEFSRILPAALDGLT 240

Query: 241 KSYKIPKVMKDIYKVENVTLYWKNAKLLDFMTCNSLHIPQDFENEVSDIDVTIVSKEYEK 300
           KSYKIPKVMKDIYKVENVTLYWKNAKLLDFMTCNSLHIPQDFENEVSDIDVTIVSKEYEK
Sbjct: 241 KSYKIPKVMKDIYKVENVTLYWKNAKLLDFMTCNSLHIPQDFENEVSDIDVTIVSKEYEK 300

Query: 301 NFXXXXXXXXXXXXXXXXXXXXXXIERKLERKRNXXXXXXXXXXXXXLRNVKEKQERTEN 360
           NF                      IERKLERKRN             LRNVKEKQERTEN
Sbjct: 301 NFEASLESKLKEEEAALLVKEHEEIERKLERKRNEQEESEYREFEFELRNVKEKQERTEN 360

Query: 361 ETVINIKNLQXXXXXXXXXXXXXKVMKIALRGQDNKKIYVNVRRSTPFSKVAEYYRIQKQ 420
           ETVINIKNLQ             KVMKIALRGQDNKKIYVNVRRSTPFSKVAEYYRIQKQ
Sbjct: 361 ETVINIKNLQEDDNLLENNSDSEKVMKIALRGQDNKKIYVNVRRSTPFSKVAEYYRIQKQ 420

Query: 421 LPQKARIKLLFDHDKLDMHEC 441
           LPQKARIKLLFDHDKLDMHEC
Sbjct: 421 LPQKARIKLLFDHDKLDMHEC 441

>YDR363W Chr4 (1199183..1200553) [1371 bp, 456 aa] {ON}
           ESC2Sumo-like domain protein; prevents accumulation of
           toxic intermediates during replication-associated
           recombinational repair; roles in silencing, lifespan,
           chromatid cohesion and the intra-S-phase DNA damage
           checkpoint; RENi family member
          Length = 456

 Score =  495 bits (1275), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 269/441 (60%), Positives = 297/441 (67%), Gaps = 2/441 (0%)

Query: 1   MTRSSKSIGELPINLXXXXXXXXXXXXXXXXXXXXXXEDEIDDNDGSKRRSVIVDSKVXX 60
           MT  S+SI E  INL                       DEID +D S R+SVIVDSKV  
Sbjct: 1   MTGDSRSISEPSINLDPDNTSFSDENSDDFFMDNSYDIDEIDHSDESNRQSVIVDSKVTV 60

Query: 61  XXXXXXXXXXXXXXXEKNVASQANILPDRSSTENVNAEHTTKPKLDLPSGRTRGRSTMKE 120
                          E + A + +    RSS++NVN E  T+PK D PSGRTRGRS MKE
Sbjct: 61  PPSKHSTLTLSDS--EDSDAKEQHQSLSRSSSKNVNIEDITEPKPDKPSGRTRGRSVMKE 118

Query: 121 SVVEINPRESKSIDDEKLHXXXXXXXXXXXXXXPTGKYKRQKSSLLYAYDENDDFFKELA 180
           SVVEIN  ES   +D+                 P GKYKRQKSSLLY YDENDDFFKELA
Sbjct: 119 SVVEINSSESDLDEDKNFPRSRSRSRSSIRSISPAGKYKRQKSSLLYTYDENDDFFKELA 178

Query: 181 KEAKKTTSVSKESTPDQRKRVYNIKFLSKLEGTINKAVQVKVLGKYEFSRILPAALDGLT 240
           KEAKK+T++SKESTPDQRKRVYNIKFLSKLEGTINKAVQVKVLGKYEFS+ILPAALDGL 
Sbjct: 179 KEAKKSTTISKESTPDQRKRVYNIKFLSKLEGTINKAVQVKVLGKYEFSKILPAALDGLM 238

Query: 241 KSYKIPKVMKDIYKVENVTLYWKNAKLLDFMTCNSLHIPQDFENEVSDIDVTIVSKEYEK 300
           KSYKIPKVMKDIYKVENVTLYW NAKLL FMTCNSLHIPQDFENEVSDIDVTIVSKEYEK
Sbjct: 239 KSYKIPKVMKDIYKVENVTLYWNNAKLLTFMTCNSLHIPQDFENEVSDIDVTIVSKEYEK 298

Query: 301 NFXXXXXXXXXXXXXXXXXXXXXXIERKLERKRNXXXXXXXXXXXXXLRNVKEKQERTEN 360
           NF                      +ERKLE+KRN             L+NV+E QE  EN
Sbjct: 299 NFEATLESKLKEEEAALLIKERQEMERKLEKKRNEQEESEYREFESELKNVEETQEIKEN 358

Query: 361 ETVINIKNLQXXXXXXXXXXXXXKVMKIALRGQDNKKIYVNVRRSTPFSKVAEYYRIQKQ 420
           +TV+N K LQ             +VM+IAL GQDNKKIYV+VRRSTPFSK+AEYYRIQKQ
Sbjct: 359 DTVMNTKLLQEGGSLSGNSSSMEEVMRIALMGQDNKKIYVHVRRSTPFSKIAEYYRIQKQ 418

Query: 421 LPQKARIKLLFDHDKLDMHEC 441
           LPQK R+KLLFDHD+LDM+EC
Sbjct: 419 LPQKTRVKLLFDHDELDMNEC 439

>Suva_2.534 Chr2 (956062..957420) [1359 bp, 452 aa] {ON} YDR363W
           (REAL)
          Length = 452

 Score =  443 bits (1139), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 246/405 (60%), Positives = 277/405 (68%), Gaps = 8/405 (1%)

Query: 39  DEIDDN--DGSKRRSVIVDSKVXXXXXXXXXXXXXXXXXEKNVASQANILPDRSSTENVN 96
           DEID+N  D S  R+VIV+SK+                 +KN++ ++    + +S+ N+ 
Sbjct: 37  DEIDNNQSDDSNERNVIVESKITDSQPFHLSLPSSEDE-DKNISQRSLSDSESASSANI- 94

Query: 97  AEHTTKPKLDLPSGRTRGRSTMKESVVEINPRESKSIDDEKLHXXXXXXXXXXXXXXPTG 156
                KPK D PSGRTRGRS +KESVVEI+  ESK+   E  H              P  
Sbjct: 95  ----VKPKSDKPSGRTRGRSVIKESVVEIDSSESKTKKKEYPHRSRSRSKSSVRSISPEQ 150

Query: 157 KYKRQKSSLLYAYDENDDFFKELAKEAKKTTSVSKESTPDQRKRVYNIKFLSKLEGTINK 216
           KYKRQK+SLL  YDENDDFFKELAKEAKKTTS+SKESTPDQ KRVYNIKF SKLEGTINK
Sbjct: 151 KYKRQKNSLLNTYDENDDFFKELAKEAKKTTSISKESTPDQPKRVYNIKFFSKLEGTINK 210

Query: 217 AVQVKVLGKYEFSRILPAALDGLTKSYKIPKVMKDIYKVENVTLYWKNAKLLDFMTCNSL 276
           AVQVKVLGKYEFSRILPAALDGL KSYKIPKVMKDIYK ENVTLYW NAKLL FMTCNSL
Sbjct: 211 AVQVKVLGKYEFSRILPAALDGLMKSYKIPKVMKDIYKEENVTLYWNNAKLLKFMTCNSL 270

Query: 277 HIPQDFENEVSDIDVTIVSKEYEKNFXXXXXXXXXXXXXXXXXXXXXXIERKLERKRNXX 336
           HIPQDFENE+SDID+TIVSKEYEKNF                      +E KLE+KRN  
Sbjct: 271 HIPQDFENEISDIDITIVSKEYEKNFEATLESKLKEEETALFAKERQEMEMKLEKKRNER 330

Query: 337 XXXXXXXXXXXLRNVKEKQERTENETVINIKNLQXXXXXXXXXXXXXKVMKIALRGQDNK 396
                      LRNV+E +E   NET +N  +L+             KVMKIAL GQDNK
Sbjct: 331 EESEFREFEFELRNVEETEELKANETFMNEHSLREGNSVKENNGGNEKVMKIALMGQDNK 390

Query: 397 KIYVNVRRSTPFSKVAEYYRIQKQLPQKARIKLLFDHDKLDMHEC 441
           KIYVNVR STPF KVAEYYRIQKQLPQKARIKLLFDHD+L+++EC
Sbjct: 391 KIYVNVRNSTPFFKVAEYYRIQKQLPQKARIKLLFDHDELNLNEC 435

>Skud_4.631 Chr4 (1128086..1129462) [1377 bp, 458 aa] {ON} YDR363W
           (REAL)
          Length = 458

 Score =  405 bits (1042), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 219/358 (61%), Positives = 249/358 (69%), Gaps = 5/358 (1%)

Query: 88  DRSSTENVNAEHTTKPKLDLPSGRTRGRSTMKESVVEINPRESKSIDDEKLH----XXXX 143
           +RSS+E+++     K + + PS RTRGRS  K+S VE +  ES + + ++LH        
Sbjct: 85  NRSSSESLDGRKLIKCRPEKPSDRTRGRSMTKDSAVETSAPESTN-EAKRLHGFRSRSRS 143

Query: 144 XXXXXXXXXXPTGKYKRQKSSLLYAYDENDDFFKELAKEAKKTTSVSKESTPDQRKRVYN 203
                     P  K+KRQK SL+  YDENDDFFKELAKEAKK T++SKE TP+Q KRVYN
Sbjct: 144 RSRSSIRSVSPERKHKRQKCSLVDIYDENDDFFKELAKEAKKITTISKEPTPEQPKRVYN 203

Query: 204 IKFLSKLEGTINKAVQVKVLGKYEFSRILPAALDGLTKSYKIPKVMKDIYKVENVTLYWK 263
           IKFLSKLEGTINKAVQVKVLGKYEFSRILPAALDGL KSYKIPKVM  IYKV NVTLYW 
Sbjct: 204 IKFLSKLEGTINKAVQVKVLGKYEFSRILPAALDGLVKSYKIPKVMISIYKVGNVTLYWN 263

Query: 264 NAKLLDFMTCNSLHIPQDFENEVSDIDVTIVSKEYEKNFXXXXXXXXXXXXXXXXXXXXX 323
           NAKLL+FMTCNSL+I QDFENE+SDIDVTIVSKEYEKNF                     
Sbjct: 264 NAKLLNFMTCNSLNISQDFENEISDIDVTIVSKEYEKNFEATLESKLKEDEAALLVKQRQ 323

Query: 324 XIERKLERKRNXXXXXXXXXXXXXLRNVKEKQERTENETVINIKNLQXXXXXXXXXXXXX 383
            IERKLE+KRN             LRNVKE QE  ENE +IN K LQ             
Sbjct: 324 EIERKLEKKRNEQEESEYREFEFELRNVKETQELEENEIIINTKPLQGNNSLKGNNGDTE 383

Query: 384 KVMKIALRGQDNKKIYVNVRRSTPFSKVAEYYRIQKQLPQKARIKLLFDHDKLDMHEC 441
           KV+K+AL GQDNKKI+VNVR STP  KVAEYYRIQK+LPQKARI+LLFDHD+L+M EC
Sbjct: 384 KVIKLALMGQDNKKIHVNVRNSTPLFKVAEYYRIQKRLPQKARIRLLFDHDELNMSEC 441

>ZYRO0F09812g Chr6 (797169..798419) [1251 bp, 416 aa] {ON} weakly
           similar to uniprot|Q06340 YDR363W Saccharomyces
           cerevisiae ESC2 Protein involved in mating- type locus
           silencing interacts with Sir2p
          Length = 416

 Score =  246 bits (628), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 125/272 (45%), Positives = 175/272 (64%), Gaps = 22/272 (8%)

Query: 170 DENDDFFKELAKEAKKTTSVSKESTPDQRKRVYNIKFLSKLEGTINKAVQVKVLGKYEFS 229
           DEND+FFK++AK+   T   ++E+TP+Q +R+YN++FLSKL+G+I+KAVQ+KVLGKY+F+
Sbjct: 150 DENDEFFKQIAKDFNHTPLGTRETTPEQPRRIYNVRFLSKLDGSIDKAVQIKVLGKYDFA 209

Query: 230 RILPAALDGLTKSYKIPKVMKDIYKVENVTLYWKNAKLLDFMTCNSLHIPQDFENEVSDI 289
            +LP+ L+G  + YKIP VMK IY  ENVTLYWK AKLL+FMTCNSL IPQ FENE+SDI
Sbjct: 210 SMLPSVLNGFIREYKIPNVMKKIYSQENVTLYWKTAKLLNFMTCNSLKIPQAFENEISDI 269

Query: 290 DVTIVSKEYEKNFXXXXXXXXXXXXXXXXXXXXXXIERKLERKRNXXXXXXXXXXXXXLR 349
           D+T++ KE E  F                        R LE ++N             + 
Sbjct: 270 DITVIPKEKENEFEQMINS------------------RLLEDEQNPPDTAETGNLDARVE 311

Query: 350 NVKEKQERTENETVINIKNLQXXXXXXXXXXXXXKVMKIALRGQDNKKIYVNVRRSTPFS 409
             +++ +  +N T     N +              +MKIAL G+DNKKI+VNVR +T  +
Sbjct: 312 EFEKELKNVDNSTT----NHETTELIDLEDEGDTDLMKIALVGEDNKKIFVNVRNTTILT 367

Query: 410 KVAEYYRIQKQLPQKARIKLLFDHDKLDMHEC 441
           KVAEYYRI+K+LP+   IKL+FDH++L+++E 
Sbjct: 368 KVAEYYRIKKKLPKDINIKLIFDHEELNLNES 399

>KAFR0E03870 Chr5 (768042..769232) [1191 bp, 396 aa] {ON} Anc_5.425
           YDR363W
          Length = 396

 Score =  237 bits (605), Expect = 3e-73,   Method: Compositional matrix adjust.
 Identities = 132/289 (45%), Positives = 175/289 (60%), Gaps = 31/289 (10%)

Query: 159 KRQKSSLLYAY---DENDDFFKELAKEAKKTTSVSKESTPDQRKRVYNIKFLSKLEGTIN 215
           KRQKS +       DENDDFFKELA  A+K +    ES   + KR+YNI+F+SKL+G+IN
Sbjct: 116 KRQKSFISETAEDSDENDDFFKELATVAQKKSVTGTESAAKRPKRIYNIRFISKLDGSIN 175

Query: 216 KAVQVKVLGKYEFSRILPAALDGLTKSYKIPKVMKDIYKVENVTLYWKNAKLLDFMTCNS 275
           K+V+VKVLGK+ FS+ILPAAL GL  +YKIP +M +IY VENV LYW NAKLL+FMTC+S
Sbjct: 176 KSVKVKVLGKFPFSKILPAALKGLIDAYKIPSIMSEIYDVENVGLYWNNAKLLNFMTCDS 235

Query: 276 LHIPQDFENEVSDIDVTIVSKEYEKNFXXXXXXXXXXXXXXXXXXXXXXIERKLERKRNX 335
           L IP  FENE+S++D+ IVSKE+ +                         E KLER+   
Sbjct: 236 LSIPLAFENEISNVDILIVSKEFGEKLEKLDQMKTLQE------------EAKLERQEE- 282

Query: 336 XXXXXXXXXXXXLRNVKEKQERTENETVINIKNL---QXXXXXXXXXXXXXKVMKIALRG 392
                       +++V E  +    E    ++++                  +MK+AL G
Sbjct: 283 ------------IKDVDEGDDFVLKEFEAELRDVAPSNANLSLDTDGEDSEPLMKLALMG 330

Query: 393 QDNKKIYVNVRRSTPFSKVAEYYRIQKQLPQKARIKLLFDHDKLDMHEC 441
           QDNKKIYVNVR ST  SK+ EYY+ QK L +  ++KLLFDHD+LD++E 
Sbjct: 331 QDNKKIYVNVRSSTQISKLVEYYKKQKNLARNVKVKLLFDHDELDLNET 379

>SAKL0G02266g Chr7 (190967..192421) [1455 bp, 484 aa] {ON} some
           similarities with uniprot|Q06340 YDR363W Saccharomyces
           cerevisiae ESC2 Protein involved in mating- type locus
           silencing interacts with Sir2p
          Length = 484

 Score =  197 bits (502), Expect = 3e-57,   Method: Compositional matrix adjust.
 Identities = 103/274 (37%), Positives = 162/274 (59%), Gaps = 31/274 (11%)

Query: 170 DENDDFFKELAKEAKKTTSVSKESTPDQRKRVYNIKFLSKLEGTINKAVQVKVLGKYEFS 229
           D+ D FF E+ + A +T++V +ES+P+  KR Y I F+SKL+G+I+K ++VK  GK  F+
Sbjct: 221 DDTDAFFTEITRNANRTSTVIRESSPELDKRTYKISFISKLKGSIDKKIEVKAWGKSPFT 280

Query: 230 RILPAALDGLTKSYKIPKVMKDIYKVENVTLYWKNAKLLDFMTCNSLHIPQDFENEVSDI 289
           +ILP+ LD + K+Y+IPK ++++YK++NVTLYW  AK+L+FMTCNSL IPQ++ +E++D+
Sbjct: 281 KILPSTLDAIVKAYRIPKAIQNVYKMDNVTLYWNGAKILNFMTCNSLRIPQNYGDEITDV 340

Query: 290 DVTIVSKEYEKNFXXXXXXXXXXXXXXXXXXXXXXIERKLERKRNXXXXXXXXXXXXXLR 349
           D+T+VSKEYE  +                      +E +L                  ++
Sbjct: 341 DITLVSKEYEMKY---------------EAEFKEMVENEL------------SGSSVDVK 373

Query: 350 NVKEKQERTENETVINIKNLQXXXXXXXXXXXXXK---VMKIALRGQDNKKIYVNVRRST 406
           NVK K +   NE  + ++  +             +    +K+AL GQDNKK++V  R ST
Sbjct: 374 NVK-KDDFATNEYELQLEKSESAEPSLLKSSENIRDGSFIKLALVGQDNKKMFVKARSST 432

Query: 407 PFSKVAEYYRIQKQLPQKARIKLLFDHDKLDMHE 440
            F K+A+YY+  K LP   ++KL FDH  L + +
Sbjct: 433 LFKKIADYYKDVKNLPSFTKLKLTFDHVNLSLED 466

>NDAI0B05600 Chr2 (1369512..1370885) [1374 bp, 457 aa] {ON}
           Anc_5.425 YDR363W
          Length = 457

 Score =  195 bits (496), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 91/147 (61%), Positives = 120/147 (81%), Gaps = 1/147 (0%)

Query: 154 PTGKYKRQKSSLLYAYDENDDFFKELAKEAKKTTSVSKESTPDQ-RKRVYNIKFLSKLEG 212
           P  K  +  S+L    DEND+FFKE+AKEAKK  S++KESTPD+  KR+YNI+F+SKL+G
Sbjct: 149 PIRKTPKLSSTLQMEPDENDEFFKEIAKEAKKIPSLTKESTPDKLPKRIYNIRFISKLDG 208

Query: 213 TINKAVQVKVLGKYEFSRILPAALDGLTKSYKIPKVMKDIYKVENVTLYWKNAKLLDFMT 272
           T+NK VQVKVLGK++F +ILPAAL GL K+Y IP V++  Y V+NV+LYW +AKLLDFMT
Sbjct: 209 TMNKCVQVKVLGKFQFQKILPAALTGLIKAYSIPSVLQKYYSVDNVSLYWNHAKLLDFMT 268

Query: 273 CNSLHIPQDFENEVSDIDVTIVSKEYE 299
           CNSL+IPQ FENEV+++D+ ++SK+ E
Sbjct: 269 CNSLNIPQAFENEVTNVDIELISKDDE 295

 Score = 98.2 bits (243), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 44/57 (77%), Positives = 52/57 (91%)

Query: 385 VMKIALRGQDNKKIYVNVRRSTPFSKVAEYYRIQKQLPQKARIKLLFDHDKLDMHEC 441
           VMKIAL GQDNKKI+VNVR +TPFSKVAEYYRIQKQLPQ A+IKL+FDH++L ++E 
Sbjct: 384 VMKIALVGQDNKKIHVNVRGTTPFSKVAEYYRIQKQLPQNAKIKLVFDHEELSLYET 440

>TBLA0A03710 Chr1 (928023..929408) [1386 bp, 461 aa] {ON} Anc_5.425
           YDR363W
          Length = 461

 Score =  192 bits (489), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 110/273 (40%), Positives = 161/273 (58%), Gaps = 19/273 (6%)

Query: 175 FFKELAKEAKKTTSVSKES----TPDQR--KRVYNIKFLSKLEGTINKAVQVKVLGKYEF 228
           FFK L   +    S + +S    T DQ   KR+YN++F+SK+EGT++K VQVKVLGK+ F
Sbjct: 185 FFKALKHSSSVPPSSTMKSDIKTTKDQGNPKRIYNVRFISKIEGTLDKKVQVKVLGKFPF 244

Query: 229 SRILPAALDGLTKSYKIPKVMKDIYKVENVTLYWKNAKLLDFMTCNSLHIPQDFENEVSD 288
           S+ILP AL   ++ YKIP V+K  Y+V NVTLYW ++KLL+FMTCNSL+IPQ +ENE+SD
Sbjct: 245 SKILPPALKAFSEEYKIPNVLKQYYRVNNVTLYWNDSKLLNFMTCNSLNIPQIYENEISD 304

Query: 289 IDVTIVSKEYEKNFXXXXXXXXXXXXXXXXXXXXXXIERKLERKRNXXXXXXXXXXXXXL 348
           +++ +++K  EK++                      IE+ L +K N              
Sbjct: 305 VEIIVITKTNEKSY-----------EDKINMSLKQNIEQNLAQKSNEIKELRKLKVESFE 353

Query: 349 RNVKEKQERTENETVINIKNLQXXXXXXXXXXXXXKVMKIALRGQDNKKIYVNVRRSTPF 408
            N  ++ E+   E  ++   +                +KIAL  QDNKK+YV VR STPF
Sbjct: 354 HNSIQEFEKELKE--LSQDGVDTKQTANIDDIPNESHIKIALLTQDNKKLYVKVRNSTPF 411

Query: 409 SKVAEYYRIQKQLPQKARIKLLFDHDKLDMHEC 441
           S++  Y+R QKQL +  +IKL+FD+++LD++E 
Sbjct: 412 SELVNYFREQKQLGETQQIKLIFDNEELDLNET 444

>NCAS0F03310 Chr6 (670533..671861) [1329 bp, 442 aa] {ON} Anc_5.425
           YDR363W
          Length = 442

 Score =  191 bits (484), Expect = 6e-55,   Method: Compositional matrix adjust.
 Identities = 94/145 (64%), Positives = 117/145 (80%), Gaps = 8/145 (5%)

Query: 159 KRQKSS----LLYAYDENDDFFKELAKEAKKTTSV---SKESTPD-QRKRVYNIKFLSKL 210
           KRQKS+    L    DEND+FFKE+AKEAKK  S+   SKE+TPD Q KRVY+I+FLS+L
Sbjct: 133 KRQKSTSTPILSLGPDENDEFFKEIAKEAKKLPSITDRSKEATPDKQPKRVYSIRFLSQL 192

Query: 211 EGTINKAVQVKVLGKYEFSRILPAALDGLTKSYKIPKVMKDIYKVENVTLYWKNAKLLDF 270
           +GTINK VQVKVLGK++F +ILP  L+GL KSY IP V++  YKV+NVTLYW N KLL+F
Sbjct: 193 DGTINKTVQVKVLGKFQFVKILPPTLEGLIKSYSIPTVLQKFYKVDNVTLYWNNTKLLNF 252

Query: 271 MTCNSLHIPQDFENEVSDIDVTIVS 295
           MTCNSL+IPQ FENEV+++D+ I+S
Sbjct: 253 MTCNSLNIPQAFENEVTNVDIVIMS 277

 Score = 98.2 bits (243), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 42/57 (73%), Positives = 51/57 (89%)

Query: 385 VMKIALRGQDNKKIYVNVRRSTPFSKVAEYYRIQKQLPQKARIKLLFDHDKLDMHEC 441
           +MKIAL G DNKKIYVNVR STPFSK+AEYYR+QKQLPQ A+I+L+FDHD+L++ E 
Sbjct: 369 IMKIALVGHDNKKIYVNVRNSTPFSKLAEYYRLQKQLPQAAKIQLMFDHDELNLEET 425

>Kwal_55.21468 s55 complement(851687..853084) [1398 bp, 465 aa] {ON}
           YDR363W (ESC2) - establishes silent chromatin [contig
           130] FULL
          Length = 465

 Score =  177 bits (448), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 105/277 (37%), Positives = 150/277 (54%), Gaps = 28/277 (10%)

Query: 164 SLLYAYDENDDFFKELAKEAKKTTSVSKESTPDQRKRVYNIKFLSKLEGTINKAVQVKVL 223
           SL    +E++ FF+EL +EA +TTS  KE +P   KRVYNIKFLS LEG++N  + VKV 
Sbjct: 195 SLAAEDNEDEKFFEELQREAGRTTSTLKEGSPATAKRVYNIKFLSNLEGSLNDKINVKVK 254

Query: 224 GKYEFSRILPAALDGLTKSYKIPKVMKDIYKVENVTLYWKNAKLLDFMTCNSLHIPQDFE 283
           GK+ FS ILP AL  L K YK+ K +K  Y+ ENV+LY    K+L+FM CNSLHIP ++E
Sbjct: 255 GKHAFSEILPIALKTLIKEYKVSKDLKPFYQPENVSLYRNGLKILNFMNCNSLHIPLNYE 314

Query: 284 NEVSDIDVTIVSKEYEKNFXXXXXXXXXXXXXXXXXXXXXXIERKLERKRNXXXXXXXXX 343
            EVSD+ +T+VS++ E+ +                        + LE+ R+         
Sbjct: 315 GEVSDVSMTLVSRDREQEYV-----------------------KTLEQSRHATPDLSREE 351

Query: 344 XXXXLR--NVKEKQERTENETVINIKNLQXXXXXXXXXXXXXKVMKIALRGQDNKKIYVN 401
               +   +++E ++  E        NL              K+   AL  QDNKKIYVN
Sbjct: 352 TSPKIPGFSIEEFEKDLEGFESGESNNLLEDTPQTENNHGTIKI---ALMAQDNKKIYVN 408

Query: 402 VRRSTPFSKVAEYYRIQKQLPQKARIKLLFDHDKLDM 438
           VR++T  + + E+YR  K L    R K +FD++ L +
Sbjct: 409 VRQTTTIAMLGEHYRTTKNLSSIERFKFVFDNEDLQL 445

>KLTH0F16280g Chr6 complement(1321305..1322726) [1422 bp, 473 aa]
           {ON} some similarities with uniprot|Q06340 YDR363W
           Saccharomyces cerevisiae ESC2 Protein involved in
           mating- type locus silencing interacts with Sir2p
          Length = 473

 Score =  148 bits (373), Expect = 7e-39,   Method: Compositional matrix adjust.
 Identities = 72/151 (47%), Positives = 101/151 (66%), Gaps = 2/151 (1%)

Query: 154 PTGKYKRQKSSLLYAY--DENDDFFKELAKEAKKTTSVSKESTPDQRKRVYNIKFLSKLE 211
           P G  +  +++ L  +  DE+D FF+EL +EA +T S  KES+P   +R+YNIKF+S LE
Sbjct: 188 PRGSSRAVRTNSLPQHEKDEDDKFFEELEREASRTASTVKESSPAVAQRIYNIKFISDLE 247

Query: 212 GTINKAVQVKVLGKYEFSRILPAALDGLTKSYKIPKVMKDIYKVENVTLYWKNAKLLDFM 271
           G+  + + VKV GK  F +ILP AL  + K YKIP  +  IY+ + VTLY    K+L+FM
Sbjct: 248 GSAGRRINVKVKGKQSFDQILPVALKTIIKEYKIPDALHPIYETDKVTLYRDGVKILNFM 307

Query: 272 TCNSLHIPQDFENEVSDIDVTIVSKEYEKNF 302
            CNSL IP +F+ EVSD+ +TI+SK  E+NF
Sbjct: 308 NCNSLQIPLEFKGEVSDVCLTIISKGQEQNF 338

 Score = 49.7 bits (117), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 22/53 (41%), Positives = 35/53 (66%)

Query: 386 MKIALRGQDNKKIYVNVRRSTPFSKVAEYYRIQKQLPQKARIKLLFDHDKLDM 438
           ++IAL  QDNKKI V  R  T F+ +AE+Y+    LP + ++ L FD+++L +
Sbjct: 399 IRIALMSQDNKKIIVTARPETTFAALAEHYQKLTSLPPQQQVLLFFDNEELHL 451

>Kpol_1027.26 s1027 complement(53549..54880) [1332 bp, 443 aa] {ON}
           complement(53549..54880) [1332 nt, 444 aa]
          Length = 443

 Score =  128 bits (322), Expect = 5e-32,   Method: Compositional matrix adjust.
 Identities = 63/133 (47%), Positives = 91/133 (68%)

Query: 170 DENDDFFKELAKEAKKTTSVSKESTPDQRKRVYNIKFLSKLEGTINKAVQVKVLGKYEFS 229
           +ENDDF K +   +   T+V   ++     R+YNI F SKL+G+++K +Q +VLGK +FS
Sbjct: 148 EENDDFSKAIRMNSNTLTNVPSPTSDMAPNRIYNITFTSKLDGSVDKKLQARVLGKQQFS 207

Query: 230 RILPAALDGLTKSYKIPKVMKDIYKVENVTLYWKNAKLLDFMTCNSLHIPQDFENEVSDI 289
            I+   LD  +K YK+ +V K  YK + VT+YW  AKLL FMTCNSL IP +F++E+S I
Sbjct: 208 EIMQPILDSYSKIYKVSRVKKRNYKTDLVTVYWDRAKLLPFMTCNSLKIPLEFQSEISHI 267

Query: 290 DVTIVSKEYEKNF 302
           ++TI+SKE E+ F
Sbjct: 268 ELTIISKENEQQF 280

 Score = 66.2 bits (160), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 26/54 (48%), Positives = 43/54 (79%)

Query: 385 VMKIALRGQDNKKIYVNVRRSTPFSKVAEYYRIQKQLPQKARIKLLFDHDKLDM 438
           ++K+AL G DNKKI+VN R +T F K+AEYY + ++LP+  ++KL+FD +++D+
Sbjct: 369 IVKLALVGNDNKKIFVNARETTRFFKLAEYYILHRKLPKSTKVKLIFDDEQIDL 422

>Ecym_5524 Chr5 (1062240..1063487) [1248 bp, 415 aa] {ON} similar to
           Ashbya gossypii AER251W
          Length = 415

 Score =  127 bits (320), Expect = 7e-32,   Method: Compositional matrix adjust.
 Identities = 83/275 (30%), Positives = 135/275 (49%), Gaps = 28/275 (10%)

Query: 175 FFKELAKEAKKTTSVS-----KESTPDQRK---RVYNIKFLSKLEGTINKAVQVKVLGKY 226
           F  E+ +EA++ +S+      K  + + ++    +YN+ F+SKLEG+ NK + V++ GK 
Sbjct: 136 FLAEIEQEAERASSLHNNGSLKNGSSNNKEIGTNIYNVGFISKLEGSTNKRINVRITGKK 195

Query: 227 EFSRILPAALDGLTKSYKIPKVMKDIYKVENVTLYWKNAKLLDFMTCNSLHIPQDFENEV 286
           +FS  LP AL    K YKI   + D Y+++NV +Y +  ++  FMTC+S +I + + +  
Sbjct: 196 KFSAFLPIALKTFVKEYKIAASLHDKYQIDNVKIYREGVEIFKFMTCDSFNIAEAYASSS 255

Query: 287 SDIDVTIVSKEYEKNFXXXXXXXXXXXXXXXXXXXXXXIERKLERKRNXXXXXXXXXXXX 346
            DI+V IV  E    F                      IE K++R               
Sbjct: 256 IDIEVYIVPNELASEF---------------EIQWKQKIETKMKRVSISASPVDLDSDGI 300

Query: 347 XLRN----VKEKQERTENETVINIKNLQXXXXXXXXXXXXXKVMKIALRGQDNKKIYVNV 402
              N    V E ++   N   ++   +Q             +++K+ L G DNKK+YVNV
Sbjct: 301 EFGNDDFRVNEYEKDLANARSLDETEIQ-YSNQISKPDDGNELIKVVLLGSDNKKVYVNV 359

Query: 403 RRSTPFSKVAEYYRIQKQLPQKARIKLLFDHDKLD 437
           + +T F K+AE+YR  K+LP   ++ L FDHD +D
Sbjct: 360 KPTTTFEKLAEHYRRIKKLPPTTKLILSFDHDDID 394

>TPHA0E01810 Chr5 complement(364173..365534) [1362 bp, 453 aa] {ON}
           Anc_5.425 YDR363W
          Length = 453

 Score =  128 bits (321), Expect = 9e-32,   Method: Compositional matrix adjust.
 Identities = 55/128 (42%), Positives = 89/128 (69%)

Query: 168 AYDENDDFFKELAKEAKKTTSVSKESTPDQRKRVYNIKFLSKLEGTINKAVQVKVLGKYE 227
             D +D+FFK + + +K+ +++S   TP+   R YNI ++SKL G+  + +Q KVLG   
Sbjct: 150 GIDADDEFFKAIREASKRPSTLSNSGTPEILNRKYNIMYISKLNGSEERRIQAKVLGTQT 209

Query: 228 FSRILPAALDGLTKSYKIPKVMKDIYKVENVTLYWKNAKLLDFMTCNSLHIPQDFENEVS 287
           F+++LP  L+ L K  KIP  ++ +YK ENVTLYW  +KLL+FM C+SL IPQ ++NE+S
Sbjct: 210 FAKVLPPILNTLLKVNKIPSKLRSLYKAENVTLYWNKSKLLNFMNCDSLKIPQTYQNEIS 269

Query: 288 DIDVTIVS 295
           ++++ ++S
Sbjct: 270 ELEIILIS 277

 Score = 59.7 bits (143), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 27/54 (50%), Positives = 37/54 (68%)

Query: 385 VMKIALRGQDNKKIYVNVRRSTPFSKVAEYYRIQKQLPQKARIKLLFDHDKLDM 438
           V+KI+L   DNKKI+VNVR ST   K+ +Y++  K L    RIK++FDHD L +
Sbjct: 380 VIKISLMSNDNKKIFVNVRSSTKIQKLVDYFKKCKNLTSNQRIKVIFDHDVLSL 433

>TDEL0E02000 Chr5 complement(379082..380392) [1311 bp, 436 aa] {ON}
           Anc_5.425 YDR363W
          Length = 436

 Score =  117 bits (294), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 55/119 (46%), Positives = 84/119 (70%)

Query: 178 ELAKEAKKTTSVSKESTPDQRKRVYNIKFLSKLEGTINKAVQVKVLGKYEFSRILPAALD 237
           E  +E ++ ++ S       R++++N+ FLSKLEGT+++A+Q+KVLGKY+F+ IL + L+
Sbjct: 167 EPVEETRQMSTSSPAKGTKARQKIFNLMFLSKLEGTVDRAIQLKVLGKYDFASILESVLE 226

Query: 238 GLTKSYKIPKVMKDIYKVENVTLYWKNAKLLDFMTCNSLHIPQDFENEVSDIDVTIVSK 296
            + + +KIP  +   Y V+NVTLYW   KLL FMTC+SL I     NEV++I+VT+VSK
Sbjct: 227 RVVEEFKIPYPVMHQYTVDNVTLYWNGGKLLKFMTCDSLKISNIDNNEVTEIEVTMVSK 285

 Score = 86.7 bits (213), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 36/57 (63%), Positives = 49/57 (85%)

Query: 384 KVMKIALRGQDNKKIYVNVRRSTPFSKVAEYYRIQKQLPQKARIKLLFDHDKLDMHE 440
           +V+K+AL GQDN ++YVNVRRSTPFSKVAEYY++ K LP + ++ L FDH+KLD++E
Sbjct: 363 EVIKLALVGQDNARLYVNVRRSTPFSKVAEYYKLHKPLPMEVKLNLYFDHEKLDLNE 419

>AER251W Chr5 (1099999..1101222) [1224 bp, 407 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR363W (ESC2)
          Length = 407

 Score =  117 bits (292), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 76/272 (27%), Positives = 129/272 (47%), Gaps = 37/272 (13%)

Query: 178 ELAKEAKKTTSVSKESTPDQRKRVYNIKFLSKLEGTINKAVQVKVLGKYEFSRILPAALD 237
           EL+       + + +   D   RVYN+ F+S++EG+ N+ V VKV G+ +F+  L  AL 
Sbjct: 142 ELSAGPGGGETATGKGGRDTDARVYNVGFISRIEGSRNRRVNVKVTGQKQFATFLAIALA 201

Query: 238 GLTKSYKIPKVMKDIYKVENVTLYWKNAKLLDFMTCNSLHIPQDFENEVSDIDVTIVSKE 297
             +K + I K +K  Y+ + V +Y +  ++  FMTC+S +I + +    +DI+V IV  +
Sbjct: 202 AFSKQHNIRKSLKPKYQADQVKIYREGVEVFKFMTCDSFNIEEPYNASATDIEVYIVPVD 261

Query: 298 YEKNFXXXXXXXXXXXXXXXXXXXXXXIERKLERKRNXXXXXX--------XXXXXXXLR 349
               F                       +RK E +                       L 
Sbjct: 262 EATAF-------------------EQEWKRKFEERVRMLSNSSFLEVMDDIEDDNDDFLV 302

Query: 350 NVKEKQ---ERTENETVINIKNLQXXXXXXXXXXXXXKVMKIALRGQDNKKIYVNVRRST 406
           N  EK     R+ NET + ++                +++KI L G DNKK++++VR +T
Sbjct: 303 NEYEKALVNARSLNETELAVRE-------GTPADESSQLLKIVLLGSDNKKVFIHVRPTT 355

Query: 407 PFSKVAEYYRIQKQLPQKARIKLLFDHDKLDM 438
              KVAE+YR+ K+LP   ++ L+FDH+++D+
Sbjct: 356 TLLKVAEHYRVAKELPPTVQLSLMFDHEEIDL 387

>CAGL0A02706g Chr1 (290595..291704) [1110 bp, 369 aa] {ON} similar
           to uniprot|Q06340 Saccharomyces cerevisiae YDR363w ESC2
          Length = 369

 Score =  114 bits (286), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 51/128 (39%), Positives = 88/128 (68%), Gaps = 1/128 (0%)

Query: 170 DENDDFFKELAKEAKKTTSVSKESTPDQRKRVYNIKFLSKLEGTINKAVQVKVLGKYEFS 229
           DEND FF+ +AK ++ +  V   S   ++ +VY ++F+S ++GT  K+VQVK LG + FS
Sbjct: 122 DENDLFFQSIAKRSQ-SLPVQDGSGAVRQDKVYYVQFISHVDGTKGKSVQVKALGSHPFS 180

Query: 230 RILPAALDGLTKSYKIPKVMKDIYKVENVTLYWKNAKLLDFMTCNSLHIPQDFENEVSDI 289
           +++ AAL GL +++++P VM+ +Y+ E+V  YW  AK+L FMTC++L +PQ + ++  +I
Sbjct: 181 KLVAAALSGLMRAHRLPSVMRPLYQPESVVSYWNRAKVLGFMTCDTLRVPQRYGSDYLEI 240

Query: 290 DVTIVSKE 297
            +  V +E
Sbjct: 241 QLVPVKEE 248

 Score = 72.0 bits (175), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 30/56 (53%), Positives = 44/56 (78%)

Query: 384 KVMKIALRGQDNKKIYVNVRRSTPFSKVAEYYRIQKQLPQKARIKLLFDHDKLDMH 439
           +V+++AL+GQDNKK+YVNV+ +T F+++ EYYR QKQLP+  +I L  D + LD H
Sbjct: 295 EVLRVALQGQDNKKVYVNVKPTTTFARMIEYYRTQKQLPRSTQITLALDDEPLDPH 350

>KNAG0C04980 Chr3 complement(958989..960026) [1038 bp, 345 aa] {ON}
           Anc_5.425 YDR363W
          Length = 345

 Score =  104 bits (260), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 49/130 (37%), Positives = 79/130 (60%), Gaps = 11/130 (8%)

Query: 170 DENDDFFKELAK------EAKKTTSVSKESTPDQRKRVYNIKFLSKLEGTINKAVQVKVL 223
           D+ + FF+EL +      E  +T + S   +P     VY ++F S+LEGT+ K+VQVKV+
Sbjct: 99  DDEEQFFQELLRARTQSVEPAETATTSTVPSP-----VYRVRFQSQLEGTLGKSVQVKVI 153

Query: 224 GKYEFSRILPAALDGLTKSYKIPKVMKDIYKVENVTLYWKNAKLLDFMTCNSLHIPQDFE 283
           G      +LP+ L  L ++ ++P+V++  Y    V +Y   A++L FM CNSL + Q+FE
Sbjct: 154 GTRPLGTVLPSVLSALVRACRVPQVLQGGYTEGAVGMYRGGARVLPFMNCNSLGVVQEFE 213

Query: 284 NEVSDIDVTI 293
           NEV ++DV +
Sbjct: 214 NEVLEVDVVL 223

 Score = 55.1 bits (131), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 22/52 (42%), Positives = 36/52 (69%)

Query: 385 VMKIALRGQDNKKIYVNVRRSTPFSKVAEYYRIQKQLPQKARIKLLFDHDKL 436
           +MKIAL   DN+++YV V   TP S++ EYYR+++ LP  A ++L  D +++
Sbjct: 273 LMKIALLSADNRRLYVKVHGGTPCSRLLEYYRMERGLPAGAPLQLRLDDEQV 324

>KLLA0E21275g Chr5 complement(1900927..1902105) [1179 bp, 392 aa]
           {ON} some similarities with uniprot|Q06340 YDR363W
           Saccharomyces cerevisiae ESC2 Protein involved in
           mating- type locus silencing interacts with Sir2p
          Length = 392

 Score = 87.4 bits (215), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 69/281 (24%), Positives = 122/281 (43%), Gaps = 16/281 (5%)

Query: 157 KYKRQKSSLLYAYDENDDFFKELAKEAKKTTSVSKESTPDQRKRVYNIKFLSKLEGTINK 216
           ++K  ++  +   DE  DF KE+   AK              KR+YNI F+S LEG+ +K
Sbjct: 107 RFKEDQTPSINTQDEMFDFLKEVTSNAKNHADTHNNGK--VTKRIYNINFISTLEGSQDK 164

Query: 217 AVQVKVLGKYEFSRILPAALDGLTKSYKIPKVMKDIYKVENVTLYWKNAKLLDFMTCNSL 276
            V VKV G   F  ILP  +    +SYKIP+ ++  Y    + L+    ++L F  C+SL
Sbjct: 165 RVNVKVTGNKTFESILPITIRTFIQSYKIPRRLRIFYTPAELVLFRAGVEVLPFSNCDSL 224

Query: 277 HIPQDFENEVSDIDVTIVSKEYEKNFXXXXXXXXXXXXXXXXXXXXXXIERKLERKRNXX 336
            IP+      + +D+ IV      N+                       +  LE+     
Sbjct: 225 RIPKTVSEYETTVDLVIVHSADANNYKTEYKRIRESRLQSFLDESNIEEQDPLEQP---A 281

Query: 337 XXXXXXXXXXXLRNVKEKQERTENETVINIKNLQXXXXXXXXXXXXXKVMKIALRGQDNK 396
                      L +  +  ERT++  VI++ +                 +++ L  + NK
Sbjct: 282 RDEKFKLFEKELESAPKLAERTDD--VIDLLD---------SDIESSNSIRLTLIDKANK 330

Query: 397 KIYVNVRRSTPFSKVAEYYRIQKQLPQKARIKLLFDHDKLD 437
           +  ++V  +T F+++A  Y+    L + A + L+FD+++L+
Sbjct: 331 RTSISVWPNTTFTEIANRYKTISSLSEDANVLLIFDNEELN 371

>KLTH0E00682g Chr5 complement(67775..68998) [1224 bp, 407 aa] {ON}
           highly similar to uniprot|P27796 Saccharomyces
           cerevisiae YIL160C POT1 3-ketoacyl-CoA thiolase with
           broad chain length specificity cleaves 3-ketoacyl-CoA
           into acyl- CoA and acetyl-CoA during beta-oxidation of
           fatty acids
          Length = 407

 Score = 36.2 bits (82), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 22/72 (30%), Positives = 40/72 (55%), Gaps = 5/72 (6%)

Query: 213 TINKAVQVKVLGKYEFSRIL--PAALDGLTKSYKIPKVMKDI-YKVENVTLYWKNAKLLD 269
           +I +++++ +LGKY   +++  P  + G+  +Y IPKV+KD    +E V ++  N     
Sbjct: 279 SIAESMELPILGKYVACQVIGVPPEIMGVGPAYAIPKVLKDCGLAIEKVDVFEINEAFAG 338

Query: 270 -FMTC-NSLHIP 279
             + C N L IP
Sbjct: 339 QALYCINKLQIP 350

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.312    0.129    0.350 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 35,892,389
Number of extensions: 1327455
Number of successful extensions: 3830
Number of sequences better than 10.0: 30
Number of HSP's gapped: 3911
Number of HSP's successfully gapped: 45
Length of query: 458
Length of database: 53,481,399
Length adjustment: 113
Effective length of query: 345
Effective length of database: 40,524,141
Effective search space: 13980828645
Effective search space used: 13980828645
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 67 (30.4 bits)