Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Smik_4.5785.350ON27427414450.0
YDR319C5.350ON27427412381e-173
Skud_4.5855.350ON27427412371e-173
Suva_2.4885.350ON27427412031e-168
Kpol_339.115.350ON2582616033e-77
ZYRO0D10142g5.350ON2552645684e-72
KLTH0H14828g5.350ON2512505623e-71
KAFR0C018605.350ON2592515572e-70
TDEL0E027705.350ON2582535546e-70
Kwal_34.159845.350ON2512565381e-67
NCAS0F028605.350ON2532515276e-66
NDAI0C043105.350ON2592585164e-64
TBLA0A031105.350ON2752314992e-61
SAKL0G08866g5.350ON2552634954e-61
TPHA0E011305.350ON2772584774e-58
KLLA0B10153g5.350ON2672584633e-56
CAGL0H07117g5.350ON2602554625e-56
Ecym_81835.350ON2652574401e-52
KNAG0C055105.350ON2642714201e-49
AGR350C5.350ON2612664148e-49
KAFR0A046406.117ON2371531144e-06
Skud_7.1466.117ON3161021022e-04
KNAG0F025106.117ON24679950.001
TBLA0F025006.117ON327104900.007
CAGL0I00330g6.117ON371150840.040
TPHA0J018106.117ON39056830.050
SAKL0A07062g6.117ON42939830.057
TDEL0G035306.117ON36847820.077
AAR165W6.117ON36270800.12
Smik_7.1456.117ON38041760.38
YGL126W (SCS3)6.117ON38041760.39
Ecym_30686.117ON36739730.93
NDAI0I017506.117ON38140711.6
ZYRO0A09240g6.117ON37240701.8
Kpol_461.26.117ON39741702.1
KLLA0F09526g6.117ON33740692.8
Kwal_14.17966.117ON36355684.1
Kpol_2001.755.702ON100667667.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Smik_4.578
         (274 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Smik_4.578 Chr4 complement(1031477..1032301) [825 bp, 274 aa] {O...   561   0.0  
YDR319C Chr4 complement(1105003..1105827) [825 bp, 274 aa] {ON} ...   481   e-173
Skud_4.585 Chr4 complement(1041303..1042127) [825 bp, 274 aa] {O...   481   e-173
Suva_2.488 Chr2 complement(862400..863221) [822 bp, 274 aa] {ON}...   468   e-168
Kpol_339.11 s339 complement(17930..18706) [777 bp, 258 aa] {ON} ...   236   3e-77
ZYRO0D10142g Chr4 complement(853192..853959) [768 bp, 255 aa] {O...   223   4e-72
KLTH0H14828g Chr8 complement(1286533..1287288) [756 bp, 251 aa] ...   221   3e-71
KAFR0C01860 Chr3 (371806..372585) [780 bp, 259 aa] {ON} Anc_5.35...   219   2e-70
TDEL0E02770 Chr5 (534173..534949) [777 bp, 258 aa] {ON} Anc_5.35...   218   6e-70
Kwal_34.15984 s34 (145158..145913) [756 bp, 251 aa] {ON} YDR319C...   211   1e-67
NCAS0F02860 Chr6 complement(572100..572861) [762 bp, 253 aa] {ON...   207   6e-66
NDAI0C04310 Chr3 complement(982580..983359) [780 bp, 259 aa] {ON...   203   4e-64
TBLA0A03110 Chr1 complement(741449..742276) [828 bp, 275 aa] {ON...   196   2e-61
SAKL0G08866g Chr7 (759588..760355) [768 bp, 255 aa] {ON} weakly ...   195   4e-61
TPHA0E01130 Chr5 (232942..233775) [834 bp, 277 aa] {ON} Anc_5.35...   188   4e-58
KLLA0B10153g Chr2 complement(888468..889271) [804 bp, 267 aa] {O...   182   3e-56
CAGL0H07117g Chr8 (702520..703302) [783 bp, 260 aa] {ON} similar...   182   5e-56
Ecym_8183 Chr8 (381845..382642) [798 bp, 265 aa] {ON} similar to...   174   1e-52
KNAG0C05510 Chr3 (1071528..1072322) [795 bp, 264 aa] {ON} Anc_5....   166   1e-49
AGR350C Chr7 complement(1380552..1381337) [786 bp, 261 aa] {ON} ...   164   8e-49
KAFR0A04640 Chr1 complement(920274..920987) [714 bp, 237 aa] {ON...    49   4e-06
Skud_7.146 Chr7 (275376..276326) [951 bp, 316 aa] {ON} YGL126W (...    44   2e-04
KNAG0F02510 Chr6 complement(472542..473282) [741 bp, 246 aa] {ON...    41   0.001
TBLA0F02500 Chr6 (606934..607917) [984 bp, 327 aa] {ON} Anc_6.11...    39   0.007
CAGL0I00330g Chr9 (24968..26083) [1116 bp, 371 aa] {ON} weakly s...    37   0.040
TPHA0J01810 Chr10 (415838..417010) [1173 bp, 390 aa] {ON} Anc_6....    37   0.050
SAKL0A07062g Chr1 complement(628851..630140) [1290 bp, 429 aa] {...    37   0.057
TDEL0G03530 Chr7 complement(652945..654051) [1107 bp, 368 aa] {O...    36   0.077
AAR165W Chr1 (639331..640419) [1089 bp, 362 aa] {ON} Syntenic ho...    35   0.12 
Smik_7.145 Chr7 (264891..265812,265963..266183) [1143 bp, 380 aa...    34   0.38 
YGL126W Chr7 (270997..272139) [1143 bp, 380 aa] {ON}  SCS3Protei...    34   0.39 
Ecym_3068 Chr3 complement(130025..131128) [1104 bp, 367 aa] {ON}...    33   0.93 
NDAI0I01750 Chr9 (412262..413407) [1146 bp, 381 aa] {ON} Anc_6.1...    32   1.6  
ZYRO0A09240g Chr1 complement(741195..742313) [1119 bp, 372 aa] {...    32   1.8  
Kpol_461.2 s461 complement(1735..2928) [1194 bp, 397 aa] {ON} co...    32   2.1  
KLLA0F09526g Chr6 (875250..876263) [1014 bp, 337 aa] {ON} simila...    31   2.8  
Kwal_14.1796 s14 complement(473935..475026) [1092 bp, 363 aa] {O...    31   4.1  
Kpol_2001.75 s2001 (206286..209306) [3021 bp, 1006 aa] {ON} (206...    30   7.9  

>Smik_4.578 Chr4 complement(1031477..1032301) [825 bp, 274 aa] {ON}
           YDR319C (REAL)
          Length = 274

 Score =  561 bits (1445), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 274/274 (100%), Positives = 274/274 (100%)

Query: 1   MIRQLSYWSRKAYLIYPFQVLVGALISILVSPKTLDHQKKTHVLLKSSNLFNTIFAYKAN 60
           MIRQLSYWSRKAYLIYPFQVLVGALISILVSPKTLDHQKKTHVLLKSSNLFNTIFAYKAN
Sbjct: 1   MIRQLSYWSRKAYLIYPFQVLVGALISILVSPKTLDHQKKTHVLLKSSNLFNTIFAYKAN 60

Query: 61  QLWPILFFSLAFLQVYFHYLARMDVLPLPISSSQTRPSYLTYPNRWLLLKNRVTIIMIAQ 120
           QLWPILFFSLAFLQVYFHYLARMDVLPLPISSSQTRPSYLTYPNRWLLLKNRVTIIMIAQ
Sbjct: 61  QLWPILFFSLAFLQVYFHYLARMDVLPLPISSSQTRPSYLTYPNRWLLLKNRVTIIMIAQ 120

Query: 121 YACKFILKYMLLFLSFQFIDHVFIWTGGECSSGSGTRSAEKCRLENGKWHGGFDISGHFC 180
           YACKFILKYMLLFLSFQFIDHVFIWTGGECSSGSGTRSAEKCRLENGKWHGGFDISGHFC
Sbjct: 121 YACKFILKYMLLFLSFQFIDHVFIWTGGECSSGSGTRSAEKCRLENGKWHGGFDISGHFC 180

Query: 181 FLVNISMILWMELHMFCRFIQSEDMVWVVNKWVRACLAVICTVLIIWICILWVTAIYYHT 240
           FLVNISMILWMELHMFCRFIQSEDMVWVVNKWVRACLAVICTVLIIWICILWVTAIYYHT
Sbjct: 181 FLVNISMILWMELHMFCRFIQSEDMVWVVNKWVRACLAVICTVLIIWICILWVTAIYYHT 240

Query: 241 ILEKILGCLMGYICPIFIYHILPKIELLHNYIHI 274
           ILEKILGCLMGYICPIFIYHILPKIELLHNYIHI
Sbjct: 241 ILEKILGCLMGYICPIFIYHILPKIELLHNYIHI 274

>YDR319C Chr4 complement(1105003..1105827) [825 bp, 274 aa] {ON}
           Putative protein of unknown function, identified as an
           ortholog of the highly conserved FIT family of proteins
           involved in triglyceride droplet biosynthesis; interacts
           with Sst2p and Hsp82p in high-throughput two-hybrid
           screens
          Length = 274

 Score =  481 bits (1238), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 224/274 (81%), Positives = 253/274 (92%)

Query: 1   MIRQLSYWSRKAYLIYPFQVLVGALISILVSPKTLDHQKKTHVLLKSSNLFNTIFAYKAN 60
           MIRQL+YWSRKAYLIYPFQV VGAL+SI+VS +TL+HQK+T  LLKSSN+FN IFAYKAN
Sbjct: 1   MIRQLNYWSRKAYLIYPFQVFVGALLSIVVSSETLNHQKETCALLKSSNIFNVIFAYKAN 60

Query: 61  QLWPILFFSLAFLQVYFHYLARMDVLPLPISSSQTRPSYLTYPNRWLLLKNRVTIIMIAQ 120
           QLWP LFFSLAFLQ+YFHYLARMD+LPLPISS++T  SYLTY N W LLKNR+  IMI Q
Sbjct: 61  QLWPFLFFSLAFLQIYFHYLARMDILPLPISSTETSSSYLTYTNHWPLLKNRIISIMITQ 120

Query: 121 YACKFILKYMLLFLSFQFIDHVFIWTGGECSSGSGTRSAEKCRLENGKWHGGFDISGHFC 180
           YACKF+LKY+LLFL+FQFIDHVFIWTGGECSSGS T SAEKCRLENGKW GGFDISGHFC
Sbjct: 121 YACKFVLKYLLLFLNFQFIDHVFIWTGGECSSGSKTTSAEKCRLENGKWDGGFDISGHFC 180

Query: 181 FLVNISMILWMELHMFCRFIQSEDMVWVVNKWVRACLAVICTVLIIWICILWVTAIYYHT 240
           FLV+ISMILWMELH+F RF+Q+EDM WVVNKWVRACLA++C VL+IWICILWVTAIYYHT
Sbjct: 181 FLVSISMILWMELHLFSRFVQAEDMFWVVNKWVRACLAIVCAVLVIWICILWVTAIYYHT 240

Query: 241 ILEKILGCLMGYICPIFIYHILPKIELLHNYIHI 274
           ILEK+LGCLMG+ICP+FIYHILPKI +LHNY+++
Sbjct: 241 ILEKVLGCLMGFICPVFIYHILPKIGILHNYLYL 274

>Skud_4.585 Chr4 complement(1041303..1042127) [825 bp, 274 aa] {ON}
           YDR319C (REAL)
          Length = 274

 Score =  481 bits (1237), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 228/274 (83%), Positives = 251/274 (91%)

Query: 1   MIRQLSYWSRKAYLIYPFQVLVGALISILVSPKTLDHQKKTHVLLKSSNLFNTIFAYKAN 60
           MIRQL YWSRKAYLIYPFQVLVGA+ISILVS +TL HQKKT+ LLKSSNLFN +FAYKAN
Sbjct: 1   MIRQLGYWSRKAYLIYPFQVLVGAIISILVSSETLGHQKKTYALLKSSNLFNILFAYKAN 60

Query: 61  QLWPILFFSLAFLQVYFHYLARMDVLPLPISSSQTRPSYLTYPNRWLLLKNRVTIIMIAQ 120
           QLWP LFFSLAFLQ+YFHYLARMDVLPLPISSS+T P+Y +Y NRW LLK+RV  IM AQ
Sbjct: 61  QLWPFLFFSLAFLQIYFHYLARMDVLPLPISSSETGPTYSSYINRWPLLKDRVIGIMFAQ 120

Query: 121 YACKFILKYMLLFLSFQFIDHVFIWTGGECSSGSGTRSAEKCRLENGKWHGGFDISGHFC 180
           YACKFILK +LL++ FQFIDHVFIWTGGECSSGSGT SAEKCRLENGKW GGFDISGHFC
Sbjct: 121 YACKFILKSLLLYVCFQFIDHVFIWTGGECSSGSGTTSAEKCRLENGKWQGGFDISGHFC 180

Query: 181 FLVNISMILWMELHMFCRFIQSEDMVWVVNKWVRACLAVICTVLIIWICILWVTAIYYHT 240
           FLVNISMILWMELH+F +F+Q+EDM WV NKWVRACLAVI ++L+IWICILWVTAIYYHT
Sbjct: 181 FLVNISMILWMELHLFSKFVQAEDMFWVANKWVRACLAVISSILVIWICILWVTAIYYHT 240

Query: 241 ILEKILGCLMGYICPIFIYHILPKIELLHNYIHI 274
           +LEKILGC MGYICPIFIYH+LPKI LLH+YI+I
Sbjct: 241 VLEKILGCFMGYICPIFIYHVLPKIGLLHDYIYI 274

>Suva_2.488 Chr2 complement(862400..863221) [822 bp, 274 aa] {ON}
           YDR319C (REAL)
          Length = 274

 Score =  468 bits (1203), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 220/274 (80%), Positives = 249/274 (90%)

Query: 1   MIRQLSYWSRKAYLIYPFQVLVGALISILVSPKTLDHQKKTHVLLKSSNLFNTIFAYKAN 60
           MIRQLSYWSRKAYL+YP QVLVGA+ISILVS +TL+HQKKT+ LLKSSNL N IFAYKAN
Sbjct: 1   MIRQLSYWSRKAYLVYPIQVLVGAVISILVSEETLNHQKKTYTLLKSSNLLNIIFAYKAN 60

Query: 61  QLWPILFFSLAFLQVYFHYLARMDVLPLPISSSQTRPSYLTYPNRWLLLKNRVTIIMIAQ 120
           ++WPI FFSLA LQ+YFHYLAR+DVLPLPISSS T  +YL+Y NR  LLK+RV   M AQ
Sbjct: 61  KIWPIFFFSLALLQIYFHYLARLDVLPLPISSSDTGSTYLSYGNRRPLLKDRVITTMAAQ 120

Query: 121 YACKFILKYMLLFLSFQFIDHVFIWTGGECSSGSGTRSAEKCRLENGKWHGGFDISGHFC 180
           YACKF+LK +LLFLSFQFIDHVF+WTGG+CSSGSGT SAEKCRLE GKW+GGFDISGHFC
Sbjct: 121 YACKFVLKNLLLFLSFQFIDHVFVWTGGQCSSGSGTTSAEKCRLEKGKWYGGFDISGHFC 180

Query: 181 FLVNISMILWMELHMFCRFIQSEDMVWVVNKWVRACLAVICTVLIIWICILWVTAIYYHT 240
           FLVNISMILWMELH+F RF+Q+EDM+WVVNKWVRACL +I  VL+IWI ILWVTAIYYHT
Sbjct: 181 FLVNISMILWMELHLFSRFVQAEDMLWVVNKWVRACLVIISVVLLIWIGILWVTAIYYHT 240

Query: 241 ILEKILGCLMGYICPIFIYHILPKIELLHNYIHI 274
           ILEK+LGCLMGYICP+FIYHILP+IELLH+Y++I
Sbjct: 241 ILEKMLGCLMGYICPVFIYHILPRIELLHDYLYI 274

>Kpol_339.11 s339 complement(17930..18706) [777 bp, 258 aa] {ON}
           complement(17930..18706) [777 nt, 259 aa]
          Length = 258

 Score =  236 bits (603), Expect = 3e-77,   Method: Compositional matrix adjust.
 Identities = 120/261 (45%), Positives = 170/261 (65%), Gaps = 13/261 (4%)

Query: 10  RKAYLIYPFQVLVGALISILVSPKTLDHQKKTHVLLKSSNLFNTIFAYKANQLWPILFFS 69
           R   LIYPF+VL+G  +S ++    L+ Q+    +L+SSN+ N +FAY  NQ+W +LF  
Sbjct: 7   RVVSLIYPFEVLIGWALSKIIGDLKLESQRNNFYILRSSNIVNELFAYHGNQVWLVLFIF 66

Query: 70  LAFLQVYFHYLARMDVLPLPISSSQTRPSYLTYPNRWLLLKNRVTIIMIAQYACKFILKY 129
           L  +Q+Y+    R     L ISS        ++  R  L+       ++ QY CK ILK 
Sbjct: 67  LCLVQIYY----RSKRFSLLISSE-------SFNGRDQLIARGKP--LVKQYICKLILKN 113

Query: 130 MLLFLSFQFIDHVFIWTGGECSSGSGTRSAEKCRLENGKWHGGFDISGHFCFLVNISMIL 189
           ++L L F  ID+VFI++GGEC+SGSGTRS+++CR ENG W GGFDISGHFCFLV ISMIL
Sbjct: 114 LMLILVFSVIDNVFIFSGGECTSGSGTRSSQRCRHENGHWEGGFDISGHFCFLVTISMIL 173

Query: 190 WMELHMFCRFIQSEDMVWVVNKWVRACLAVICTVLIIWICILWVTAIYYHTILEKILGCL 249
           W+ELH F + +  E +   ++ + +  L  + TVL IW+ IL++T++YYHT +EK+LGC 
Sbjct: 174 WIELHQFKKHVDLEGLSGQLSLYSKIILMTVFTVLCIWVFILFITSVYYHTFMEKVLGCA 233

Query: 250 MGYICPIFIYHILPKIELLHN 270
           MGYI P  +YHI+P  E L++
Sbjct: 234 MGYITPYVMYHIIPNNEFLYS 254

>ZYRO0D10142g Chr4 complement(853192..853959) [768 bp, 255 aa] {ON}
           similar to uniprot|Q06676 Saccharomyces cerevisiae
           YDR319C Hypothetical ORF
          Length = 255

 Score =  223 bits (568), Expect = 4e-72,   Method: Compositional matrix adjust.
 Identities = 117/264 (44%), Positives = 160/264 (60%), Gaps = 17/264 (6%)

Query: 10  RKAYLIYPFQVLVGALISILVSPKTLDHQKKTHVLLKSSNLFNTIFAYKANQLWPILFFS 69
           +KA ++YP +++VG  ++ L+  + L+ Q+K H  L  +N  N IFAY+ NQ+W ILF  
Sbjct: 9   KKAAIVYPIELVVGCTLAFLMGHERLESQRKEHYFLNPNNFINQIFAYRGNQIWTILFCG 68

Query: 70  LAFLQVYFHYLARMDVLPLPISSSQTRPSYLTYPNRWLLLKNRVTIIMIAQYACKFILKY 129
           LA LQVY       DV+P    +   +P                   ++ +YA K ILK 
Sbjct: 69  LAGLQVYMKTHVP-DVIPRDARTIVRKP----------------MTSLLKEYAVKIILKN 111

Query: 130 MLLFLSFQFIDHVFIWTGGECSSGSGTRSAEKCRLENGKWHGGFDISGHFCFLVNISMIL 189
           +LL + F FID++FI TGG CS  SGT SAEKC    G W GGFDISGHFCFLV+ISMIL
Sbjct: 112 LLLAIIFLFIDNIFILTGGSCSDHSGTHSAEKCSKNGGYWEGGFDISGHFCFLVSISMIL 171

Query: 190 WMELHMFCRFIQSEDMVWVVNKWVRACLAVICTVLIIWICILWVTAIYYHTILEKILGCL 249
           W+EL     ++  EDMV  +N W +  + +    L  W  IL VT+IYYHT+LEKILGC 
Sbjct: 172 WLELQHLESWLIEEDMVKRLNVWGKTIIGITVFTLATWCFILMVTSIYYHTLLEKILGCA 231

Query: 250 MGYICPIFIYHILPKIELLHNYIH 273
           MGYICPI +Y ++P  +++   ++
Sbjct: 232 MGYICPIIMYWLIPNHDIVRKVLY 255

>KLTH0H14828g Chr8 complement(1286533..1287288) [756 bp, 251 aa]
           {ON} similar to uniprot|Q06676 Saccharomyces cerevisiae
           YDR319C Hypothetical ORF
          Length = 251

 Score =  221 bits (562), Expect = 3e-71,   Method: Compositional matrix adjust.
 Identities = 119/250 (47%), Positives = 159/250 (63%), Gaps = 20/250 (8%)

Query: 15  IYPFQVLVGALISILVSPKTLDHQKKTHVLLKSSNLFNTIFAYKANQLWPILFFSLAFLQ 74
           +YP  ++ G ++ +L +  TL HQK T+ LL  +N+ N +FAYK N +W ILF SLA  Q
Sbjct: 13  VYPVVLICGLVVHLLANGSTLQHQKDTYYLLSPNNVINLVFAYKGNLIWTILFVSLAAYQ 72

Query: 75  VYFHYLARMDVLPLPISSSQTRPSYLTYPNRWLLLKNRVTIIMIAQYACKFILKYMLLFL 134
           +    ++R D+LP        R +  TYP RW  L          +YA K ILK +LL++
Sbjct: 73  IKIR-VSRSDLLP--------RDARTTYPARWHRLGK--------EYAVKIILKNLLLYV 115

Query: 135 SFQFIDHVFIWTGGECSSGSGTRSAEKCRLENGKWHGGFDISGHFCFLVNISMILWMELH 194
            F  ID VF+WTGG CSS S T+SAE+CR E GKW  GFDISGHFCFL N+S+ILW+EL 
Sbjct: 116 IFFVIDCVFVWTGGSCSS-SATKSAERCRKEGGKWENGFDISGHFCFLTNVSLILWLELS 174

Query: 195 MFCRFIQSEDMVWVVNKWVRACLAVICTVLIIWICILWVTAIYYHTILEKILGCLMGYIC 254
              +++ S++     +K  R  L    +VL+IW  +L VTAIYYHT LEKILG LMGYIC
Sbjct: 175 SIQKYLNSDER--TPSKLWRVLLYSNVSVLVIWAFVLSVTAIYYHTTLEKILGLLMGYIC 232

Query: 255 PIFIYHILPK 264
           P+ +Y ++P 
Sbjct: 233 PVIMYWLVPS 242

>KAFR0C01860 Chr3 (371806..372585) [780 bp, 259 aa] {ON} Anc_5.350
           YDR319C
          Length = 259

 Score =  219 bits (557), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 113/251 (45%), Positives = 159/251 (63%), Gaps = 15/251 (5%)

Query: 14  LIYPFQVLVGALISILVSPKTLDHQKKTHVLLKSSNLFNTIFAYKANQLWPILFFSLAFL 73
           LIYP  + +G  +S ++S +T  +QK    LL+SSN+ N IFAY  N +W ILF  +A L
Sbjct: 13  LIYPCILFLGLFLSAVISDETKSYQKDRIYLLRSSNIINEIFAYNGNLVWFILFSFVASL 72

Query: 74  QVYFHYLARMDVLPLPISSSQTRPSYLTYPNRWLLLKNRVTIIMIAQYACKFILKYMLLF 133
           Q+Y      + +LP  I    +              K  V   ++ +Y  KF+LK  +LF
Sbjct: 73  QIYIRSHTFI-LLPHDIVDVDS--------------KENVRAKLLKEYMVKFLLKVFILF 117

Query: 134 LSFQFIDHVFIWTGGECSSGSGTRSAEKCRLENGKWHGGFDISGHFCFLVNISMILWMEL 193
           + F  ID++FI TGG C+ G  TRSAE+C+   G W GGFDISGHFCFL NIS+ILW+EL
Sbjct: 118 VCFLIIDNIFILTGGSCAPGGATRSAEQCKALGGDWLGGFDISGHFCFLTNISLILWIEL 177

Query: 194 HMFCRFIQSEDMVWVVNKWVRACLAVICTVLIIWICILWVTAIYYHTILEKILGCLMGYI 253
           H + ++ + E++   +NKW++  L V+  VL IW+ +L VT+IYYHTILEKILGC+MGY 
Sbjct: 178 HHYSKYTEEEELQSRINKWIKRSLIVVEVVLYIWMFLLLVTSIYYHTILEKILGCIMGYA 237

Query: 254 CPIFIYHILPK 264
           CP+ +Y ++P 
Sbjct: 238 CPLVMYWLIPN 248

>TDEL0E02770 Chr5 (534173..534949) [777 bp, 258 aa] {ON} Anc_5.350
           YDR319C
          Length = 258

 Score =  218 bits (554), Expect = 6e-70,   Method: Compositional matrix adjust.
 Identities = 110/253 (43%), Positives = 163/253 (64%), Gaps = 17/253 (6%)

Query: 12  AYLIYPFQVLVGALISILVSPKTLDHQKKTHVLLKSSNLFNTIFAYKANQLWPILFFSLA 71
           A  IYP ++++G +I+ ++    L+ Q++T+ LL+S N+ N IFAYK N +W + F  LA
Sbjct: 13  AASIYPLELVLGCVIAWILGEDRLELQRRTYYLLESKNIINGIFAYKGNLVWTVDFVCLA 72

Query: 72  FLQVYFHYLARMDVLPLPISSSQTRPSYLTYPNRWLLLKNRVTIIMIAQYACKFILKYML 131
            +Q+Y        +LP    ++ + P           LK+     ++ QY  K ILK +L
Sbjct: 73  LVQIYVK-CRNHALLPRDARTNSSGP-----------LKS-----LLKQYTSKIILKNVL 115

Query: 132 LFLSFQFIDHVFIWTGGECSSGSGTRSAEKCRLENGKWHGGFDISGHFCFLVNISMILWM 191
           L ++F  ID +F+ TGG C +G  TRSAE+CR+  G+W GGFDISGHFCFLVNISMILW+
Sbjct: 116 LAITFFIIDSIFVLTGGSCLNGDVTRSAERCRISGGQWQGGFDISGHFCFLVNISMILWL 175

Query: 192 ELHMFCRFIQSEDMVWVVNKWVRACLAVICTVLIIWICILWVTAIYYHTILEKILGCLMG 251
           EL  F  +++ E +V+ V+K V   L V   VL IW+ +L VTA+YYHT+LEK+LGC +G
Sbjct: 176 ELSQFRSYMERESVVFPVSKVVNGVLVVSSGVLGIWVLMLMVTAVYYHTVLEKVLGCALG 235

Query: 252 YICPIFIYHILPK 264
           Y+C + +Y ++P+
Sbjct: 236 YVCVLVMYWLIPR 248

>Kwal_34.15984 s34 (145158..145913) [756 bp, 251 aa] {ON} YDR319C -
           Hypothetical ORF [contig 272] FULL
          Length = 251

 Score =  211 bits (538), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 116/256 (45%), Positives = 154/256 (60%), Gaps = 30/256 (11%)

Query: 14  LIYPFQVLVGALISILVSPKTLDHQKKTHVLLKSSNLFNTIFAYKANQLWPILFFSLAFL 73
           L+YP  +  G+LI++LV    L+ Q+ ++ LL S N+ N +FAY+ N  W ILF  LA  
Sbjct: 12  LVYPSILAYGSLINLLVDASRLERQRSSYYLLSSGNIVNKLFAYRGNLTWTILFTLLAVF 71

Query: 74  QVYFHYLARMDVLPLPISSSQTRPSYLTYPNRWLLLKNRVTIIMIA-QYACKFILKYMLL 132
           QV+ H   + D+LP    S                   RV  + +A QY  K ILK +LL
Sbjct: 72  QVWLH-AEQSDLLPRDARSVH-----------------RVGGVRLAKQYTVKLILKNVLL 113

Query: 133 FLSFQFIDHVFIWTGGECSSGSGTRSAEKCRLENGKWHGGFDISGHFCFLVNISMILWME 192
           +L+F FID++F+WTGG CS+ S TRSAE+CR E G W  GFDISGHFCFL NIS+ILW E
Sbjct: 114 YLAFLFIDNLFVWTGGSCSTSS-TRSAERCRKEGGSWDNGFDISGHFCFLTNISLILWYE 172

Query: 193 LHMFCRFIQSEDM----VWVVNKWVRACLAVICTVLIIWICILWVTAIYYHTILEKILGC 248
           L    + I S+D+     W+V +W          VLI W  IL VTA+YYHT+LEK+LG 
Sbjct: 173 LRSIQKKISSDDISPTKTWIVLRW------STLIVLITWSFILSVTAVYYHTLLEKVLGL 226

Query: 249 LMGYICPIFIYHILPK 264
            MGY+CP  +Y ++P 
Sbjct: 227 TMGYLCPTIMYLVIPN 242

>NCAS0F02860 Chr6 complement(572100..572861) [762 bp, 253 aa] {ON}
           Anc_5.350 YDR319C
          Length = 253

 Score =  207 bits (527), Expect = 6e-66,   Method: Compositional matrix adjust.
 Identities = 108/251 (43%), Positives = 164/251 (65%), Gaps = 19/251 (7%)

Query: 14  LIYPFQVLVGALISILVSPKTLDHQKKTHVLLKSSNLFNTIFAYKANQLWPILFFSLAFL 73
           L+YP  +++G +I+ +V  +TLD QK  + +L S N+ N +FAY  N +W +LF  +A+ 
Sbjct: 12  LVYPTILVLGTIINTIVREETLDRQKHEYYILSSKNILNRVFAYNGNLIWAMLFGMMAYF 71

Query: 74  QVYFHYLARMDVLPLPISSSQTRPSYLTYPNRWLLLKNRVTIIMIAQYACKFILKYMLLF 133
           QV+   +   D+LP        R + +   NR  L +      +I QY  KF+LKY+LLF
Sbjct: 72  QVWIR-IRTQDLLP--------RDAQII--NRQRLQR------LIKQYIVKFVLKYLLLF 114

Query: 134 LSFQFIDHVFIWTGGECSSGSGTRSAEKCRLENGKWHGGFDISGHFCFLVNISMILWMEL 193
           ++F FID +F++TGG+C+ G G  SAEKC+ E G W GGFDISGHFCFL+N+S+ILW EL
Sbjct: 115 ITFLFIDGLFLFTGGQCTYGLGIWSAEKCKNEGGHWEGGFDISGHFCFLMNVSLILWCEL 174

Query: 194 HMFCRFIQSEDMVWVVNKWVRACLAVICTVLIIWICILWVTAIYYHTILEKILGCLMGYI 253
            +  R+++ E++   +   +     ++  +L +W+ +L VTAIYYHT+LEKILGCL+GY 
Sbjct: 175 SILERYLRDEEL--EMETIITNYSVLLKCILYLWMSMLCVTAIYYHTLLEKILGCLLGYC 232

Query: 254 CPIFIYHILPK 264
           CP+ +Y ++P 
Sbjct: 233 CPLIMYWLIPN 243

>NDAI0C04310 Chr3 complement(982580..983359) [780 bp, 259 aa] {ON}
           Anc_5.350 YDR319C
          Length = 259

 Score =  203 bits (516), Expect = 4e-64,   Method: Compositional matrix adjust.
 Identities = 102/258 (39%), Positives = 158/258 (61%), Gaps = 17/258 (6%)

Query: 8   WSRKAYLIYPFQVLVGALISILVSPKTLDHQKKTHVLLKSSNLFNTIFAYKANQLWPILF 67
           W +  Y IYP  + +G LI+ L+  +TL   K  + +L S N+FN + AY  N++W ILF
Sbjct: 8   WPQICY-IYPTILFIGVLINSLLPNETLQSHKSNYYVLNSKNIFNQVMAYNGNKVWSILF 66

Query: 68  FSLAFLQVYFHYLARMDVLPLPISSSQTRPSYLTYPNRWLLLKNRVTIIMIAQYACKFIL 127
             L+ +Q+       +++LP  + S+ ++  ++                +I QY  KF+L
Sbjct: 67  ILLSVIQIRLQS-TNINLLPRHVDSAASKRRHVNS--------------LIKQYVIKFVL 111

Query: 128 KYMLLFLSFQFIDHVFIWTGGECSSGSGTRSAEKCRLENGKWHGGFDISGHFCFLVNISM 187
           K +LL   F  ID +FI TGGEC+      SAE C+ + G+W GGFDISGHFCFL+NIS+
Sbjct: 112 KNVLLAFLFLIIDSLFILTGGECNLIEDIWSAEHCKAKGGRWEGGFDISGHFCFLINISL 171

Query: 188 ILWMELHMFCRFIQS-EDMVWVVNKWVRACLAVICTVLIIWICILWVTAIYYHTILEKIL 246
           ILW EL +  + ++  E+    ++KW+   + +I   L +W+ IL+VTA+YYHT+LEKIL
Sbjct: 172 ILWSELSLLNKVLEDREETFTKIDKWMEGVIVIILGCLYLWMGILFVTAVYYHTLLEKIL 231

Query: 247 GCLMGYICPIFIYHILPK 264
           GC++G++CPI +Y+ +P 
Sbjct: 232 GCILGFVCPIVMYYFIPN 249

>TBLA0A03110 Chr1 complement(741449..742276) [828 bp, 275 aa] {ON}
           Anc_5.350 YDR319C
          Length = 275

 Score =  196 bits (499), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 105/231 (45%), Positives = 148/231 (64%), Gaps = 12/231 (5%)

Query: 44  LLKSSNLFNTIFAYKANQLWPILFFSLAFLQVYFHYLARMDV-LPLPISSSQTRPSYLTY 102
           L++S++ FN +FAY  N ++  LF  +  LQVYF   +R D  L LPI         +  
Sbjct: 55  LIRSNSWFNQLFAYNGNTVFLGLFLIIVSLQVYF---SREDARLSLPIE--------IRT 103

Query: 103 PNRWLLLKNRVTIIMIAQYACKFILKYMLLFLSFQFIDHVFIWTGGECSSGSGTRSAEKC 162
            +R    + +  + +  +Y CK ILKY  L+L F FIDH+F+ TGG C++GSGTR A  C
Sbjct: 104 ISRIKQFQTKHYLRIAKEYICKLILKYFFLYLEFLFIDHLFVLTGGYCTNGSGTRDAMIC 163

Query: 163 RLENGKWHGGFDISGHFCFLVNISMILWMELHMFCRFIQSEDMVWVVNKWVRACLAVICT 222
           R  NG+W GGFDISGHFCFLV +S+I+W+EL     FI+S D+   V   V   +  I +
Sbjct: 164 RSGNGEWVGGFDISGHFCFLVTLSLIIWLELFKLEEFIRSRDLKSNVTNEVIFMVFFIVS 223

Query: 223 VLIIWICILWVTAIYYHTILEKILGCLMGYICPIFIYHILPKIELLHNYIH 273
           +LI+WI +L VT++YYHT +EK+LGC+MGYICPI +Y +LP+  +   YI+
Sbjct: 224 ILILWIVMLCVTSLYYHTFVEKLLGCIMGYICPIVMYRVLPRNTIFTRYIY 274

>SAKL0G08866g Chr7 (759588..760355) [768 bp, 255 aa] {ON} weakly
           similar to uniprot|Q06676 Saccharomyces cerevisiae
           YDR319C Hypothetical ORF
          Length = 255

 Score =  195 bits (495), Expect = 4e-61,   Method: Compositional matrix adjust.
 Identities = 116/263 (44%), Positives = 160/263 (60%), Gaps = 22/263 (8%)

Query: 9   SRKAYLIYPFQVLVGALISILVSPKTLDHQKKTHVLLKSSNLFNTIFAYKANQLWPILFF 68
           SR     YP  +L+G L+++LVS + LD QK  + LL S N+ N +FAY+ NQ++ I F 
Sbjct: 11  SRSFVWFYPLVLLLGLLVNLLVSAQELDRQKHEYYLLSSRNVINKVFAYQGNQIFLITFI 70

Query: 69  SLAFLQVYFHYLARMDVLPLPISSS-QTRPSYLTYPNRWLLLKNRVTIIMIAQYACKFIL 127
            LA LQ++ H     D+LP   SSS +T  + L                   QYA KF+L
Sbjct: 71  LLAALQIHIHS-KNQDLLPRNSSSSPRTEAAGLA-----------------RQYAIKFLL 112

Query: 128 KYMLLFLSFQFIDHVFIWTGGECSSGSGTRSAEKCRLENGKWHGGFDISGHFCFLVNISM 187
           K +LL++ F  IDHVFIWTGG CS  S TRSAE+CR+  G W GGFDISGHFCFL N+S+
Sbjct: 113 KQLLLYVVFYIIDHVFIWTGGVCSI-SKTRSAERCRVLGGSWEGGFDISGHFCFLTNVSL 171

Query: 188 ILWMELHMFCRFIQSEDMVWVVNKWVRACLAVICTVLIIWICILWVTAIYYHTILEKILG 247
           ILW EL+ + ++I   ++   VN+       +   VL++W+ +L VTA YYHT+ EK+LG
Sbjct: 172 ILWYELYHYQKYISDNEL--RVNRKFAWIKYLTLFVLVVWLFVLSVTATYYHTVGEKVLG 229

Query: 248 CLMGYICPIFIYHILPKIELLHN 270
            +MGY CP  +Y ++P    L+ 
Sbjct: 230 LVMGYTCPTVMYILIPSTTKLNK 252

>TPHA0E01130 Chr5 (232942..233775) [834 bp, 277 aa] {ON} Anc_5.350
           YDR319C
          Length = 277

 Score =  188 bits (477), Expect = 4e-58,   Method: Compositional matrix adjust.
 Identities = 96/258 (37%), Positives = 150/258 (58%), Gaps = 6/258 (2%)

Query: 16  YPFQVLVGALISILVSPKTLDHQKKTHVLLKSSNLFNTIFAYKANQLWPILFFSLAFLQV 75
           Y F +L G  + +++  +TL++ K +   L S N  N IFAY  N +W +LF  + +L +
Sbjct: 25  YIFVLLFGEFLHLILGTETLEYHKTSFYFLNSKNTINQIFAYNGNLVWFLLFCLVFYLHL 84

Query: 76  YFHYLARMDVLPLPISSSQTRPSYLTYPNRWLLLKNRVTIIMIAQYACKFILKYMLLFLS 135
           +F  +   ++LP    +S   P  L   +R      R    +  QY  K+ +K   LF+ 
Sbjct: 85  HFETVNSKELLP----TSADVPVGL--HSRVCQYTQRANYYLFKQYFFKYCVKSASLFVI 138

Query: 136 FQFIDHVFIWTGGECSSGSGTRSAEKCRLENGKWHGGFDISGHFCFLVNISMILWMELHM 195
           F  ID +F+ +GG C  GSGT  +E CR   GKW GGFDISGHFCFL+ IS+ILW EL+ 
Sbjct: 139 FFAIDTLFVLSGGSCDDGSGTTFSETCRSNKGKWEGGFDISGHFCFLITISLILWCELYK 198

Query: 196 FCRFIQSEDMVWVVNKWVRACLAVICTVLIIWICILWVTAIYYHTILEKILGCLMGYICP 255
             + ++SE     +N      + +I  V+++W  +LW+TAIYYHT  EK+LGC++G++ P
Sbjct: 199 LHKRMESESFEVELNVVFTVMIGLIVGVIMVWFGLLWITAIYYHTFFEKVLGCMLGFVTP 258

Query: 256 IFIYHILPKIELLHNYIH 273
           + +Y+ +P  E L+  ++
Sbjct: 259 LLMYYTIPSNEFLNGLLY 276

>KLLA0B10153g Chr2 complement(888468..889271) [804 bp, 267 aa] {ON}
           similar to uniprot|Q06676 Saccharomyces cerevisiae
           YDR319C
          Length = 267

 Score =  182 bits (463), Expect = 3e-56,   Method: Compositional matrix adjust.
 Identities = 106/258 (41%), Positives = 151/258 (58%), Gaps = 13/258 (5%)

Query: 15  IYPFQVLVGALISILVSPKTLDHQKKTHVLLKSSNLFNTIFAYKANQLWPILFFSLAFLQ 74
           IYP  V+ G  IS+L+    L+ ++K    +   N+ N +FAYK   ++ +LF  L  LQ
Sbjct: 21  IYPALVIFGYFISVLIGEDELERERKEWYWIGGRNVVNHLFAYKGIYIFDVLFGLLIGLQ 80

Query: 75  VYFHYLARMDVLPLPISSSQTRPSYLTYPNRWLLLKNRVTIIMIAQYACKFILKYMLLFL 134
           VY        +LP   +  Q R S    P+   LLK    ++ +  Y+ KF+L Y++L+ 
Sbjct: 81  VYVRMKHEESLLPTS-NGEQDRNS----PD---LLKQVGKVLKV--YSIKFVLVYLVLWA 130

Query: 135 SFQFIDHVFIWTGGECSSGSGTRSAEKCRLENGKWHGGFDISGHFCFLVNISMILWMELH 194
            F FIDH+F+WTGG C   S T+SAEKCR   G W GGFDISGHFCFL NIS+ LW EL 
Sbjct: 131 CFLFIDHLFVWTGGNCDL-SDTKSAEKCRSLGGSWVGGFDISGHFCFLTNISLTLWQELK 189

Query: 195 MFCRFIQSEDMVWVVNKWVRACLAVICTVLIIWICILWVTAIYYHTILEKILGCLMGYIC 254
           +  ++     + W  N        ++  VL IWI +L +T+IYYHT  EK+LGC  GY C
Sbjct: 190 LLLQYANQHTISW--NSPSSKYQWIVLLVLCIWINVLTITSIYYHTFPEKVLGCAFGYSC 247

Query: 255 PIFIYHILPKIELLHNYI 272
            + IY+ILP+I+ ++ ++
Sbjct: 248 LLVIYYILPRIKHVNKFL 265

>CAGL0H07117g Chr8 (702520..703302) [783 bp, 260 aa] {ON} similar to
           uniprot|Q06676 Saccharomyces cerevisiae YDR319c
          Length = 260

 Score =  182 bits (462), Expect = 5e-56,   Method: Compositional matrix adjust.
 Identities = 106/255 (41%), Positives = 150/255 (58%), Gaps = 15/255 (5%)

Query: 10  RKAYLIYPFQVLVGALISILVSPKTLDHQKKTHVLLKSSNLFNTIFAYKANQLWPILFFS 69
           ++  L YP  +++G  +S+L+S +   +Q+  + LL S N+FN I AYK N +W  LF  
Sbjct: 7   KQVSLAYPVILILGCFLSVLLSEEAKINQRANYYLLNSKNVFNQILAYKGNWVWLFLFMG 66

Query: 70  LAFLQVYFHYLARMDVLPLPISSSQTRPSYLTYPNRWLLLKNRVTIIMIAQYACKFILKY 129
           +A +Q    Y  R        + SQ   S L    R L++ N+  + +I +Y CK+ LK 
Sbjct: 67  VAAVQ----YNLR--------TKSQ---SLLPTDTRALVVSNKTKLQIIKEYFCKYFLKL 111

Query: 130 MLLFLSFQFIDHVFIWTGGECSSGSGTRSAEKCRLENGKWHGGFDISGHFCFLVNISMIL 189
            +L + F  ID VFI TGG C+  + + SAE C+   GKW GGFDISGHFCFLVNISMIL
Sbjct: 112 FILDVIFLVIDGVFIMTGGSCTVPNRSISAELCKSLGGKWIGGFDISGHFCFLVNISMIL 171

Query: 190 WMELHMFCRFIQSEDMVWVVNKWVRACLAVICTVLIIWICILWVTAIYYHTILEKILGCL 249
           WMEL      +   D V  ++   +  + V   VL+ W+ +L VTA YYHTI EK++GC+
Sbjct: 172 WMELIAIAEHVCGYDTVISLSSLQKHVITVAVVVLVAWMGMLLVTATYYHTIAEKLIGCV 231

Query: 250 MGYICPIFIYHILPK 264
            GYICP  +Y ++P 
Sbjct: 232 FGYICPFVMYGLIPN 246

>Ecym_8183 Chr8 (381845..382642) [798 bp, 265 aa] {ON} similar to
           Ashbya gossypii AGR350C
          Length = 265

 Score =  174 bits (440), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 96/257 (37%), Positives = 150/257 (58%), Gaps = 18/257 (7%)

Query: 9   SRKAYLIYPFQVLVGALISILVSPKTLDHQKKTHVLLKSSNLFNTIFAYKANQLWPILFF 68
           +++  L+YP  V  GA++ +L   + L+  +K+  LL   N+ N +F    N +W +L+ 
Sbjct: 15  NQRYILVYPSLVFGGAVMRLLAGSERLESVRKSWYLLTEGNMVNYLFVINGNNVWLVLYI 74

Query: 69  SLAFLQVYFHYLARMDVLPL--PISSSQTRPSYLTYPNRWLLLKNRVTIIMIAQYACKFI 126
            +A +Q Y       D LPL   +  S +R  Y  +            + ++ Q+  K  
Sbjct: 75  LMAGVQCYIR-TKESDSLPLGGSVPGSSSRERYTIF------------LCLVKQFIVKLA 121

Query: 127 LKYMLLFLSFQFIDHVFIWTGGECSSGSGTRSAEKCRLENGKWHGGFDISGHFCFLVNIS 186
           LK +LL   F  IDHVFIWTGG C+  S T+S+ +C   +GKW GGFDISGHFCF+ N+S
Sbjct: 122 LKMVLLDRIFWLIDHVFIWTGGRCTV-SDTKSSMECYRLHGKWVGGFDISGHFCFVTNLS 180

Query: 187 MILWMELHMFCRFIQSEDMVWVVNKWVRACLAVICTVLIIWICILWVTAIYYHTILEKIL 246
           +ILW EL    +++ + ++   + K +     +I   L+ WI ILWVTA++YHT+LEK+L
Sbjct: 181 LILWCELFSLEQYLSANEIR--LRKRLIWIKYMILLALVTWIFILWVTALFYHTLLEKVL 238

Query: 247 GCLMGYICPIFIYHILP 263
           G ++GY+CP+ +Y I+P
Sbjct: 239 GLILGYVCPVVMYAIIP 255

>KNAG0C05510 Chr3 (1071528..1072322) [795 bp, 264 aa] {ON} Anc_5.350
           YDR319C
          Length = 264

 Score =  166 bits (420), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 104/271 (38%), Positives = 150/271 (55%), Gaps = 31/271 (11%)

Query: 14  LIYPFQVLVGALISILVSPKTLDHQKKTHV-LLKSSNLFNTIFAYKANQLWPILFFSLAF 72
           L+YPF + +G ++ +LV P+ +  Q K HV    S N+ N +FAYK N +W +LF  +A 
Sbjct: 13  LLYPFVLSIGLILHVLV-PEQVQDQLKQHVYFFNSKNVLNQVFAYKGNLVWTVLFLYIAV 71

Query: 73  LQVYFHYLARMDVLPLPISSSQTRPSYLTYPNRWLLLKNRVTIIMIAQYACKFILKYMLL 132
           L  +   ++R D L       Q                  V   ++ QY  K +LK  LL
Sbjct: 72  LSYFIKTMSR-DPLEQRAGGRQ------------------VDWQIVRQYCWKLLLKNGLL 112

Query: 133 FLSFQFIDHVFIWTGGECSSGSGT----RSAEKCRLENGKWHGGFDISGHFCFLVNISMI 188
           +L F  ID VFI TGG C++  G     RSAE C+   G+W  GFDISGHFCFL+NIS+I
Sbjct: 113 YLCFLVIDGVFIATGGVCTTMGGEMRKIRSAESCKWNGGQWENGFDISGHFCFLMNISLI 172

Query: 189 LWMELHMFCRFIQSEDMV------WVVNKWVRACLAVICTVLIIWICILWVTAIYYHTIL 242
           LW EL +    I+ E++       W+  KW+R  L  +   L IW+ +L+VTA +YHT  
Sbjct: 173 LWAELQLLQDAIRREELGEEELNLWICYKWLRHGLTAVKITLYIWLFLLFVTASFYHTSS 232

Query: 243 EKILGCLMGYICPIFIYHILPKIELLHNYIH 273
           EK++GC  GY+CP  +YH++P    L+ + +
Sbjct: 233 EKLIGCAFGYVCPFVMYHLIPTSPRLNEFFY 263

>AGR350C Chr7 complement(1380552..1381337) [786 bp, 261 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR319C
          Length = 261

 Score =  164 bits (414), Expect = 8e-49,   Method: Compositional matrix adjust.
 Identities = 88/266 (33%), Positives = 147/266 (55%), Gaps = 24/266 (9%)

Query: 6   SYWSRKAY-LIYPFQVLVGALISILVSPKTLDHQKKTHVLLKSSNLFNTIFAYKANQLWP 64
            Y S + Y  +YP  +L G +I +++  +T++H +KT  LL   N  N +F +    LW 
Sbjct: 9   EYISERRYCYLYPALLLGGEVIKLILGEETIEHDRKTWYLLNGGNFVNQLFVHHGVLLWT 68

Query: 65  ILFFSLAFLQVYFHYLARMDVLPLPISSSQTRPSYLTYPNRWLLLKNRVTIIMIAQYACK 124
           +L   +  LQ   +++   +  PLP+ + +  P              R  + M+   A +
Sbjct: 69  LLMGLVLALQ---YHVRTTEFDPLPLDARELGPV------------KRHPLKMLGSMAVQ 113

Query: 125 FILKYMLLFLSFQ----FIDHVFIWTGGECSSGSGTRSAEKCRLENGKWHGGFDISGHFC 180
            ++K +L+    Q    F+DH+F+WTGG C+  S T+ +  CR   G+W GGFDISGHFC
Sbjct: 114 TVIKVLLVVTVLQALFWFMDHLFVWTGGRCTV-SDTKDSVACRRLGGEWVGGFDISGHFC 172

Query: 181 FLVNISMILWMELHMFCRFIQSEDMVWVVNKWVRACLAVICTVLIIWICILWVTAIYYHT 240
            ++N+S++LW+EL    R++ S+++      W R     +   L +W+ +L +TAIYYHT
Sbjct: 173 LVMNLSLVLWLELTELQRYMHSQEIQLRKFAWARTT---VLGALGVWLALLAITAIYYHT 229

Query: 241 ILEKILGCLMGYICPIFIYHILPKIE 266
            +EK+LG + GY   + IY++LP+I 
Sbjct: 230 FVEKLLGTIFGYSTSLVIYYVLPRIN 255

>KAFR0A04640 Chr1 complement(920274..920987) [714 bp, 237 aa] {ON}
           Anc_6.117 YGL126W
          Length = 237

 Score = 48.5 bits (114), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 38/153 (24%), Positives = 69/153 (45%), Gaps = 20/153 (13%)

Query: 132 LFLSFQFIDHVFIWTGGECSSGSGTRSAE----KCRLENGKWHGGFDISGHFCFLVNISM 187
           +F +   +D +F+WTGG+C  GS +         C+   G W  G D SGH   L  ++ 
Sbjct: 85  MFSNHAIMDLIFVWTGGKCDGGSTSSKLLKSSKHCKKIGGNWINGHDPSGHIFLLSIMTT 144

Query: 188 ILWMELHMFCRFIQSE------DMVWVVNKWV---------RACLAVICTVLIIWICILW 232
            +  E     R   ++      +  W +++ +            + ++ + +++W   L 
Sbjct: 145 FMINEFSKIRRVSMTQLRQDFVETDWNLDRQLPVKIILFISNNPVIIMLSFILLWWHSLV 204

Query: 233 VTAI-YYHTILEKILGCLMGYICPIFIYHILPK 264
           +T+I YYHT+ E++ G L  YI    +Y  LP 
Sbjct: 205 ITSINYYHTLSEQLSGLLFAYIIMGPLYLFLPS 237

>Skud_7.146 Chr7 (275376..276326) [951 bp, 316 aa] {ON} YGL126W
           (REAL)
          Length = 316

 Score = 43.9 bits (102), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 30/102 (29%), Positives = 45/102 (44%), Gaps = 8/102 (7%)

Query: 158 SAEKCRLENGKWHGGFDISGHFCFLVNISMILWMELHMFCRFIQSEDMVWVVNKWVRACL 217
           ++ +CR   G W GG D SGH      + M L  EL +F R   +        KW     
Sbjct: 213 TSAQCRRFGGHWAGGHDPSGHVFLTTLMCMFLLGELRVFGRRALAH---LYAQKW----- 264

Query: 218 AVICTVLIIWICILWVTAIYYHTILEKILGCLMGYICPIFIY 259
            ++  V  +W  +L   A ++HT+ E I G L  Y+    +Y
Sbjct: 265 HLLGMVTWLWQLLLTAVASHFHTVREHISGLLAAYLVTGVVY 306

>KNAG0F02510 Chr6 complement(472542..473282) [741 bp, 246 aa] {ON}
           Anc_6.117 YGL126W
          Length = 246

 Score = 41.2 bits (95), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 27/79 (34%), Positives = 35/79 (44%), Gaps = 11/79 (13%)

Query: 107 LLLKNRVTIIMIAQYACKFILKYMLLFLSFQFIDHVFIWTGGEC----SSGSGT---RSA 159
           L L  R TI   A Y    +    L       +D VF+W+GG C    ++  GT    ++
Sbjct: 80  LPLLRRYTITTAAWY----VFTQQLWLNVPPLMDLVFVWSGGSCLLDPATTPGTLWLSTS 135

Query: 160 EKCRLENGKWHGGFDISGH 178
             CR   G W GG D SGH
Sbjct: 136 AACRRHGGLWQGGHDPSGH 154

>TBLA0F02500 Chr6 (606934..607917) [984 bp, 327 aa] {ON} Anc_6.117
           YGL126W
          Length = 327

 Score = 39.3 bits (90), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 28/104 (26%), Positives = 52/104 (50%), Gaps = 15/104 (14%)

Query: 157 RSAEKCRLENGKWHGGFDISGHFCFLVNISMILWMELHMFCRFIQSEDMVWVVNKWVRAC 216
            S++KCR   G W GG D SGH  FL+ + ++ ++ +      I  ++ ++V  + + A 
Sbjct: 235 NSSQKCRKIGGAWSGGHDPSGHM-FLLTLMIMTFLTIS-----ISKDNYLFV--RLIAAM 286

Query: 217 LAVICTVLIIWICILWVTAIYYHTILEKILGCLMGYI-CPIFIY 259
             ++ +   +      VT   +HT  E+I G +  YI   ++IY
Sbjct: 287 FGLMSSYSFM------VTIFNFHTFAEQITGFMAAYIPAGLYIY 324

>CAGL0I00330g Chr9 (24968..26083) [1116 bp, 371 aa] {ON} weakly
           similar to uniprot|P53012 Saccharomyces cerevisiae
           YGL126w SCS3 inositol phospholipid synthesis protein
          Length = 371

 Score = 37.0 bits (84), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 34/150 (22%), Positives = 55/150 (36%), Gaps = 36/150 (24%)

Query: 147 GGECSSGSGTRSAEKCRLENGKWHGGFDISGHFCFLVNISMILWMELHMFC-----RFIQ 201
           G    + S   ++  CRL  G W GG D SGH   L  + + L  E   F      R + 
Sbjct: 220 GNSSGANSTLDNSFACRLNGGYWQGGHDPSGHIFLLTLMILFLVGESKQFIVGAVMRVVD 279

Query: 202 SEDMVW---------------VVNKWVRA---CLAVICTVLI-------------IWICI 230
           +   V                V  + VR    CL+   + ++             IW+  
Sbjct: 280 TRKYVMDKIKKICNEPMANASVYERRVRKLMRCLSFSASYILWENPVILLLLLLAIWVWN 339

Query: 231 LWVTAIYYHTILEKILGCLMGYICPIFIYH 260
             +T I +HT+ E++ G    Y+    +Y+
Sbjct: 340 FVITVIVFHTLTEQLSGLFFAYVVGALLYY 369

>TPHA0J01810 Chr10 (415838..417010) [1173 bp, 390 aa] {ON} Anc_6.117
           YGL126W
          Length = 390

 Score = 36.6 bits (83), Expect = 0.050,   Method: Compositional matrix adjust.
 Identities = 18/56 (32%), Positives = 30/56 (53%), Gaps = 1/56 (1%)

Query: 159 AEKCRLENGKWHGGFDISGHFCFLVNISMILWMELHMFCRFIQSEDMVWVVNKWVR 214
           + KC+   G W GG D SGH   L  + M++  EL    R I+ ++M++  +  +R
Sbjct: 222 SSKCKRNGGHWVGGHDPSGHIFLLTLMMMMIIAELPKINR-IRKQNMIYQKDSKIR 276

>SAKL0A07062g Chr1 complement(628851..630140) [1290 bp, 429 aa] {ON}
           similar to uniprot|P53012 Saccharomyces cerevisiae
           YGL126W SCS3 Protein required for inositol prototrophy
          Length = 429

 Score = 36.6 bits (83), Expect = 0.057,   Method: Compositional matrix adjust.
 Identities = 17/39 (43%), Positives = 22/39 (56%)

Query: 158 SAEKCRLENGKWHGGFDISGHFCFLVNISMILWMELHMF 196
           S++KC+   G W GG D SGH   +  + M L  EL MF
Sbjct: 266 SSQKCKSLGGHWSGGHDPSGHIFLITLMCMFLLGELQMF 304

>TDEL0G03530 Chr7 complement(652945..654051) [1107 bp, 368 aa] {ON}
           Anc_6.117 YGL126W
          Length = 368

 Score = 36.2 bits (82), Expect = 0.077,   Method: Compositional matrix adjust.
 Identities = 19/47 (40%), Positives = 24/47 (51%)

Query: 152 SGSGTRSAEKCRLENGKWHGGFDISGHFCFLVNISMILWMELHMFCR 198
           SG    S+  CR   G W GG D SGH   +  + M L  ELH+F +
Sbjct: 195 SGVTRNSSAVCRTLGGYWVGGHDPSGHIFLITLMIMYLLGELHIFGK 241

>AAR165W Chr1 (639331..640419) [1089 bp, 362 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGL126W (SCS3)
          Length = 362

 Score = 35.4 bits (80), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 21/70 (30%), Positives = 28/70 (40%), Gaps = 17/70 (24%)

Query: 146 TGGECS-----------------SGSGTRSAEKCRLENGKWHGGFDISGHFCFLVNISMI 188
           TGG+C                  + S  RS+  C    G W GG D SGH   +  + M 
Sbjct: 173 TGGQCENTGLDPTELNSYIQDSVTASAIRSSHACSRLGGHWMGGHDPSGHVFLITLMCMF 232

Query: 189 LWMELHMFCR 198
           +  EL +F R
Sbjct: 233 MLGELQVFGR 242

>Smik_7.145 Chr7 (264891..265812,265963..266183) [1143 bp, 380 aa]
           {ON} YGL126W (REAL)
          Length = 380

 Score = 33.9 bits (76), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 16/41 (39%), Positives = 21/41 (51%)

Query: 158 SAEKCRLENGKWHGGFDISGHFCFLVNISMILWMELHMFCR 198
           ++ +CR   G W GG D SGH      + M L  EL +F R
Sbjct: 215 TSAQCRRFGGHWAGGHDPSGHVFLATLMCMFLLGELRVFGR 255

>YGL126W Chr7 (270997..272139) [1143 bp, 380 aa] {ON}  SCS3Protein
           required for inositol prototrophy, identified as an
           ortholog of the FIT family of proteins involved in
           triglyceride droplet biosynthesis; disputed role in the
           synthesis of inositol phospholipids from inositol
          Length = 380

 Score = 33.9 bits (76), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 16/41 (39%), Positives = 21/41 (51%)

Query: 158 SAEKCRLENGKWHGGFDISGHFCFLVNISMILWMELHMFCR 198
           ++ +CR   G W GG D SGH      + M L  EL +F R
Sbjct: 215 TSAQCRRFGGHWAGGHDPSGHVFLATLMCMFLLGELRVFGR 255

>Ecym_3068 Chr3 complement(130025..131128) [1104 bp, 367 aa] {ON}
           similar to Ashbya gossypii AAR165W
          Length = 367

 Score = 32.7 bits (73), Expect = 0.93,   Method: Compositional matrix adjust.
 Identities = 15/39 (38%), Positives = 21/39 (53%)

Query: 158 SAEKCRLENGKWHGGFDISGHFCFLVNISMILWMELHMF 196
           + + CR   G W GG D SGH   +  ++M L  EL +F
Sbjct: 204 NGQMCRKLGGYWTGGHDPSGHVFLITLMTMFLIGELRLF 242

>NDAI0I01750 Chr9 (412262..413407) [1146 bp, 381 aa] {ON} Anc_6.117
           YGL126W
          Length = 381

 Score = 32.0 bits (71), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 15/40 (37%), Positives = 20/40 (50%)

Query: 158 SAEKCRLENGKWHGGFDISGHFCFLVNISMILWMELHMFC 197
           ++ +CR+  G W  G D SGH   L  + M L  EL  F 
Sbjct: 220 TSAQCRMHGGYWTKGHDPSGHIFLLTLMVMFLSGELSTFA 259

>ZYRO0A09240g Chr1 complement(741195..742313) [1119 bp, 372 aa] {ON}
           weakly similar to uniprot|P53012 Saccharomyces
           cerevisiae YGL126W SCS3 Protein required for inositol
           prototrophy
          Length = 372

 Score = 31.6 bits (70), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 15/40 (37%), Positives = 18/40 (45%)

Query: 158 SAEKCRLENGKWHGGFDISGHFCFLVNISMILWMELHMFC 197
           ++  CR   G W GG D SGH      + M L  EL  F 
Sbjct: 204 TSAACRATGGHWKGGHDPSGHIFLNTLMIMFLLGELDFFA 243

>Kpol_461.2 s461 complement(1735..2928) [1194 bp, 397 aa] {ON}
           complement(1735..2928) [1194 nt, 398 aa]
          Length = 397

 Score = 31.6 bits (70), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 14/41 (34%), Positives = 20/41 (48%)

Query: 159 AEKCRLENGKWHGGFDISGHFCFLVNISMILWMELHMFCRF 199
           +  CR   G W GG D SGH   L  + M++  E+    +F
Sbjct: 230 SSNCRAHGGHWVGGHDPSGHMFILTLMIMLISSEIPRIIKF 270

 Score = 30.0 bits (66), Expect = 7.6,   Method: Compositional matrix adjust.
 Identities = 16/36 (44%), Positives = 19/36 (52%)

Query: 227 WICILWVTAIYYHTILEKILGCLMGYICPIFIYHIL 262
           W     VT I +HTI E+I G L  YI  + IY  L
Sbjct: 362 WAYSFLVTIIVFHTISEQITGFLSAYIMAVIIYKFL 397

>KLLA0F09526g Chr6 (875250..876263) [1014 bp, 337 aa] {ON} similar
           to uniprot|Q75EB2 Ashbya gossypii AAR165W AAR165Wp and
           weakly similar to YGL126W uniprot|P53012 Saccharomyces
           cerevisiae SCS3 Protein required for inositol
           prototrophy
          Length = 337

 Score = 31.2 bits (69), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 13/40 (32%), Positives = 22/40 (55%)

Query: 157 RSAEKCRLENGKWHGGFDISGHFCFLVNISMILWMELHMF 196
           +S+  C    G W GG D SGH   +  + M+++ EL ++
Sbjct: 173 KSSAGCSYAGGHWVGGHDPSGHIFLITLMLMLMFGELSLY 212

>Kwal_14.1796 s14 complement(473935..475026) [1092 bp, 363 aa] {ON}
           YGL126W (SCS3) - involved in inositol biosynthesis
           [contig 237] FULL
          Length = 363

 Score = 30.8 bits (68), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 18/55 (32%), Positives = 25/55 (45%), Gaps = 4/55 (7%)

Query: 157 RSAEKCRLENGKWHGGFDISGHFCFLVNISMILWMELHMFC----RFIQSEDMVW 207
            S+  CR   G W GG D SGH   +  + M L  EL +      R ++S+   W
Sbjct: 201 NSSNLCRSLGGNWVGGHDPSGHIFLITLMCMFLLGELQVLGKRALRVLRSDRKFW 255

>Kpol_2001.75 s2001 (206286..209306) [3021 bp, 1006 aa] {ON}
           (206286..209306) [3021 nt, 1007 aa]
          Length = 1006

 Score = 30.0 bits (66), Expect = 7.9,   Method: Composition-based stats.
 Identities = 19/67 (28%), Positives = 32/67 (47%), Gaps = 4/67 (5%)

Query: 49  NLFNT----IFAYKANQLWPILFFSLAFLQVYFHYLARMDVLPLPISSSQTRPSYLTYPN 104
           NLFN      F  + N     +F +L  + + F+   R D+  LP + S ++   + Y N
Sbjct: 333 NLFNNERIQRFLQEKNLTLTEIFDNLNTVDITFNNFNRSDIKVLPPTESASKEEIINYKN 392

Query: 105 RWLLLKN 111
             +LL+N
Sbjct: 393 EIILLEN 399

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.333    0.144    0.489 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 28,990,391
Number of extensions: 1163180
Number of successful extensions: 4289
Number of sequences better than 10.0: 46
Number of HSP's gapped: 4370
Number of HSP's successfully gapped: 57
Length of query: 274
Length of database: 53,481,399
Length adjustment: 108
Effective length of query: 166
Effective length of database: 41,097,471
Effective search space: 6822180186
Effective search space used: 6822180186
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 39 (21.6 bits)
S2: 65 (29.6 bits)