Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Smik_4.5765.348ON41541521980.0
YDR317W (HIM1)5.348ON41441517200.0
Skud_4.5835.348ON41541516990.0
Suva_2.4865.348ON41541016690.0
TDEL0E027905.348ON4114226223e-76
ZYRO0F00550g5.348ON4153866051e-73
Kpol_1051.45.348ON4264265006e-58
CAGL0H07161g5.348ON4244164841e-55
Kwal_34.159895.348ON5064584024e-43
Ecym_81855.348ON4714003934e-42
AGR348W5.348ON5422333738e-39
SAKL0G08910g5.348ON5054243472e-35
KLTH0H14784g5.348ON5144523437e-35
TPHA0D020605.348ON4964793392e-34
KAFR0C018805.348ON3453053023e-30
TBLA0A031005.348ON3723502912e-28
KLLA0B10120g5.348ON3482102612e-24
KNAG0L00930singletonON2291551122e-05
YER004W (FMP52)7.148ON2311221042e-04
Smik_5.1187.148ON231127950.002
TBLA0A105007.148ON237178930.004
TBLA0F033107.148ON161174910.004
Ecym_44797.148ON224104930.004
Suva_5.917.148ON22975910.006
TDEL0H031107.148ON224122880.018
Skud_5.1037.148ON227128870.022
Kwal_47.188627.148ON22471840.052
KNAG0L00925singletonON228152830.078
KAFR0E040205.413ON377192840.083
NCAS0E020907.148ON225122820.087
NCAS0E02080singletonON225122810.12
KLTH0H00264g7.148ON22275750.61
KAFR0G038001.125ON648116770.65
SAKL0D11286g1.463ON116246751.1
SAKL0F04686g7.148ON223129721.7
Skud_16.2378.493ON798176704.4
KLLA0D13684g7.148ON224214677.8
NCAS0A01140singletonON336100678.1
Ecym_21976.219ON50467679.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Smik_4.576
         (415 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Smik_4.576 Chr4 (1028647..1029894) [1248 bp, 415 aa] {ON} YDR317...   851   0.0  
YDR317W Chr4 (1102184..1103428) [1245 bp, 414 aa] {ON}  HIM1Prot...   667   0.0  
Skud_4.583 Chr4 (1038472..1039719) [1248 bp, 415 aa] {ON} YDR317...   659   0.0  
Suva_2.486 Chr2 (859579..860826) [1248 bp, 415 aa] {ON} YDR317W ...   647   0.0  
TDEL0E02790 Chr5 complement(536193..537428) [1236 bp, 411 aa] {O...   244   3e-76
ZYRO0F00550g Chr6 complement(51742..52989) [1248 bp, 415 aa] {ON...   237   1e-73
Kpol_1051.4 s1051 (8692..9972) [1281 bp, 426 aa] {ON} (8692..997...   197   6e-58
CAGL0H07161g Chr8 complement(704823..706097) [1275 bp, 424 aa] {...   191   1e-55
Kwal_34.15989 s34 complement(147085..148605) [1521 bp, 506 aa] {...   159   4e-43
Ecym_8185 Chr8 complement(383906..385321) [1416 bp, 471 aa] {ON}...   155   4e-42
AGR348W Chr7 (1377726..1379354) [1629 bp, 542 aa] {ON} Syntenic ...   148   8e-39
SAKL0G08910g Chr7 complement(761626..763143) [1518 bp, 505 aa] {...   138   2e-35
KLTH0H14784g Chr8 (1283834..1285378) [1545 bp, 514 aa] {ON} weak...   136   7e-35
TPHA0D02060 Chr4 (424797..426287) [1491 bp, 496 aa] {ON} Anc_5.3...   135   2e-34
KAFR0C01880 Chr3 complement(374180..375217) [1038 bp, 345 aa] {O...   120   3e-30
TBLA0A03100 Chr1 (739771..740889) [1119 bp, 372 aa] {ON} Anc_5.3...   116   2e-28
KLLA0B10120g Chr2 (886187..887233) [1047 bp, 348 aa] {ON} some s...   105   2e-24
KNAG0L00930 Chr12 (170496..171185) [690 bp, 229 aa] {ON}               48   2e-05
YER004W Chr5 (159580..160275) [696 bp, 231 aa] {ON}  FMP52Protei...    45   2e-04
Smik_5.118 Chr5 (163900..164595) [696 bp, 231 aa] {ON} YER004W (...    41   0.002
TBLA0A10500 Chr1 (2585576..2586289) [714 bp, 237 aa] {ON} Anc_7....    40   0.004
TBLA0F03310 Chr6 complement(814437..814922) [486 bp, 161 aa] {ON...    40   0.004
Ecym_4479 Chr4 complement(973594..974268) [675 bp, 224 aa] {ON} ...    40   0.004
Suva_5.91 Chr5 (135337..136023) [687 bp, 229 aa] {ON} YER004W (R...    40   0.006
TDEL0H03110 Chr8 (512079..512753) [675 bp, 224 aa] {ON} Anc_7.14...    39   0.018
Skud_5.103 Chr5 (156788..157471) [684 bp, 227 aa] {ON} YER004W (...    38   0.022
Kwal_47.18862 s47 complement(1003035..1003709) [675 bp, 224 aa] ...    37   0.052
KNAG0L00925 Chr12 (169763..170449) [687 bp, 228 aa] {ON}               37   0.078
KAFR0E04020 Chr5 complement(796412..797545) [1134 bp, 377 aa] {O...    37   0.083
NCAS0E02090 Chr5 complement(400057..400734) [678 bp, 225 aa] {ON}      36   0.087
NCAS0E02080 Chr5 complement(399088..399765) [678 bp, 225 aa] {ON}      36   0.12 
KLTH0H00264g Chr8 complement(23047..23715) [669 bp, 222 aa] {ON}...    33   0.61 
KAFR0G03800 Chr7 complement(784007..785953) [1947 bp, 648 aa] {O...    34   0.65 
SAKL0D11286g Chr4 (938289..941777) [3489 bp, 1162 aa] {ON} some ...    33   1.1  
SAKL0F04686g Chr6 complement(377594..378265) [672 bp, 223 aa] {O...    32   1.7  
Skud_16.237 Chr16 (431230..433626) [2397 bp, 798 aa] {ON} YPL045...    32   4.4  
KLLA0D13684g Chr4 complement(1180483..1181157) [675 bp, 224 aa] ...    30   7.8  
NCAS0A01140 Chr1 complement(224034..225044) [1011 bp, 336 aa] {O...    30   8.1  
Ecym_2197 Chr2 (388255..389769) [1515 bp, 504 aa] {ON} similar t...    30   9.5  

>Smik_4.576 Chr4 (1028647..1029894) [1248 bp, 415 aa] {ON} YDR317W
           (REAL)
          Length = 415

 Score =  851 bits (2198), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 415/415 (100%), Positives = 415/415 (100%)

Query: 1   MNYRINAFTDYILLFGSSGLAGKGTLENMLDINFYIKNVSDLQDKLNSLTEIKGDVVLNK 60
           MNYRINAFTDYILLFGSSGLAGKGTLENMLDINFYIKNVSDLQDKLNSLTEIKGDVVLNK
Sbjct: 1   MNYRINAFTDYILLFGSSGLAGKGTLENMLDINFYIKNVSDLQDKLNSLTEIKGDVVLNK 60

Query: 61  HVFCINRRSITEEKSFMKSIDYINMKSITWKRGRYYLRSRNENETKKIPSNPDTFCYDAF 120
           HVFCINRRSITEEKSFMKSIDYINMKSITWKRGRYYLRSRNENETKKIPSNPDTFCYDAF
Sbjct: 61  HVFCINRRSITEEKSFMKSIDYINMKSITWKRGRYYLRSRNENETKKIPSNPDTFCYDAF 120

Query: 121 EEGFIKKTTDENGKDNFCIPYNQKRFSYALYYASGKKEGFEIIYKFTVTQLIIPRSENWS 180
           EEGFIKKTTDENGKDNFCIPYNQKRFSYALYYASGKKEGFEIIYKFTVTQLIIPRSENWS
Sbjct: 121 EEGFIKKTTDENGKDNFCIPYNQKRFSYALYYASGKKEGFEIIYKFTVTQLIIPRSENWS 180

Query: 181 RLLSYIFSGTQKLEKFDANNKTYVAGKSLPNLRDISTMVCTLGSTSARVRRTQVPNSFVD 240
           RLLSYIFSGTQKLEKFDANNKTYVAGKSLPNLRDISTMVCTLGSTSARVRRTQVPNSFVD
Sbjct: 181 RLLSYIFSGTQKLEKFDANNKTYVAGKSLPNLRDISTMVCTLGSTSARVRRTQVPNSFVD 240

Query: 241 YSLPFSLAQEFTNTTDKRLVIITSFNNKFLSTTFEYFRIKAKLENDLEEVLPNKPKELII 300
           YSLPFSLAQEFTNTTDKRLVIITSFNNKFLSTTFEYFRIKAKLENDLEEVLPNKPKELII
Sbjct: 241 YSLPFSLAQEFTNTTDKRLVIITSFNNKFLSTTFEYFRIKAKLENDLEEVLPNKPKELII 300

Query: 301 LRPGPMCGQHGNSIKVELDVQENLTFSDKILYYPRYLLMYKKQYISEVRKIGLRTKLSEL 360
           LRPGPMCGQHGNSIKVELDVQENLTFSDKILYYPRYLLMYKKQYISEVRKIGLRTKLSEL
Sbjct: 301 LRPGPMCGQHGNSIKVELDVQENLTFSDKILYYPRYLLMYKKQYISEVRKIGLRTKLSEL 360

Query: 361 IASSTYRMPGSALLGYSVPVSKVSYVASLMAIERKSKEAGPKMEVINSYQIDMIA 415
           IASSTYRMPGSALLGYSVPVSKVSYVASLMAIERKSKEAGPKMEVINSYQIDMIA
Sbjct: 361 IASSTYRMPGSALLGYSVPVSKVSYVASLMAIERKSKEAGPKMEVINSYQIDMIA 415

>YDR317W Chr4 (1102184..1103428) [1245 bp, 414 aa] {ON}  HIM1Protein
           of unknown function involved in DNA repair
          Length = 414

 Score =  667 bits (1720), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 320/415 (77%), Positives = 364/415 (87%), Gaps = 1/415 (0%)

Query: 1   MNYRINAFTDYILLFGSSGLAGKGTLENMLDINFYIKNVSDLQDKLNSLTEIKGDVVLNK 60
           M+Y +N FTDY+LLFGSS L GKG LEN+LDIN YIKNVSDLQ KL+SL+EIKG+VVLNK
Sbjct: 1   MSYSVNTFTDYVLLFGSSSLVGKGILENLLDINLYIKNVSDLQGKLDSLSEIKGNVVLNK 60

Query: 61  HVFCINRRSITEEKSFMKSIDYINMKSITWKRGRYYLRSRNENETKKIPSNPDTFCYDAF 120
           HVFC+NRR I EEKSFMK+IDYINM+S+TW+ GRYYLRSR E +T+K+PS+P+TFCYD F
Sbjct: 61  HVFCVNRRCINEEKSFMKTIDYINMRSVTWQGGRYYLRSRKEKDTEKVPSSPNTFCYDNF 120

Query: 121 EEGFIKKTTDENGKDNFCIPYNQKRFSYALYYASGKKEGFEIIYKFTVTQLIIPRSENWS 180
           EEGFIK T +E GKD +   YNQK+FSY L+YA GK++G EII  FTVTQLIIPRSE W 
Sbjct: 121 EEGFIKNTPEERGKDGYSFVYNQKQFSYTLHYACGKEKGIEIICNFTVTQLIIPRSETWP 180

Query: 181 RLLSYIFSGTQKLEKFDANNKTYVAGKSLPNLRDISTMVCTLGSTSARVRRTQVPNSFVD 240
           +LL  IFSGTQKLEKFD +NK YV G+SLP+L DISTMVC+LGSTSARVRRTQVP+SF D
Sbjct: 181 KLLPRIFSGTQKLEKFDIDNKNYVPGRSLPSLCDISTMVCSLGSTSARVRRTQVPSSFAD 240

Query: 241 YSLPFSLAQEFTNTTDKRLVIITSFNNKFLSTTFEYFRIKAKLENDLEEVLPNKPKELII 300
           Y LPF+LAQEFTNTT+KRLV+ T+FNN FLS TFEYFRIKAKLENDL+E LPNK KEL+I
Sbjct: 241 YYLPFNLAQEFTNTTNKRLVVTTAFNNDFLSKTFEYFRIKAKLENDLDEALPNKLKELVI 300

Query: 301 LRPGPMCGQHGNSIKVELDVQENLTFSDKILYYPRYLLMYKKQYISEVRKIGLRTKLSEL 360
           LRPGPMCGQHGN I VEL  +EN TF +KI YYP YLL+YKK+YISE R+IGLRTKLSE+
Sbjct: 301 LRPGPMCGQHGNPINVELG-KENSTFLEKIFYYPHYLLVYKKKYISEARRIGLRTKLSEI 359

Query: 361 IASSTYRMPGSALLGYSVPVSKVSYVASLMAIERKSKEAGPKMEVINSYQIDMIA 415
           IASS YRMPGSALLGY+VPVSKVSYVASLMAIERKSKEAGPK+EVI+SYQIDMI 
Sbjct: 360 IASSIYRMPGSALLGYAVPVSKVSYVASLMAIERKSKEAGPKLEVISSYQIDMIV 414

>Skud_4.583 Chr4 (1038472..1039719) [1248 bp, 415 aa] {ON} YDR317W
           (REAL)
          Length = 415

 Score =  659 bits (1699), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 322/415 (77%), Positives = 359/415 (86%)

Query: 1   MNYRINAFTDYILLFGSSGLAGKGTLENMLDINFYIKNVSDLQDKLNSLTEIKGDVVLNK 60
           M+  I+ FTDYILLFGSSGLAG+GTLEN+LDINFYIKNVSDLQDKL+SL EIK DVVLNK
Sbjct: 1   MSDNISVFTDYILLFGSSGLAGRGTLENLLDINFYIKNVSDLQDKLDSLKEIKEDVVLNK 60

Query: 61  HVFCINRRSITEEKSFMKSIDYINMKSITWKRGRYYLRSRNENETKKIPSNPDTFCYDAF 120
           HVFCINRR++TE+KSF+K+IDY+NMKSITWK GRYYLRSR  N+  +  S+ DTF YD F
Sbjct: 61  HVFCINRRNVTEQKSFLKTIDYVNMKSITWKGGRYYLRSRTANDNGRETSSTDTFFYDNF 120

Query: 121 EEGFIKKTTDENGKDNFCIPYNQKRFSYALYYASGKKEGFEIIYKFTVTQLIIPRSENWS 180
           EEGFI+    E  K NF   YNQK+FSY+L+YA  K+E F I Y FTVTQLIIP SE+W 
Sbjct: 121 EEGFIRGAAYEGQKGNFSFAYNQKQFSYSLHYACRKEESFGIKYNFTVTQLIIPPSESWP 180

Query: 181 RLLSYIFSGTQKLEKFDANNKTYVAGKSLPNLRDISTMVCTLGSTSARVRRTQVPNSFVD 240
           RLLS IFS  QKLEKFD +NKTYVA KSLP+LRDI TMVCTLGSTSARVRRTQVPNSFVD
Sbjct: 181 RLLSRIFSKEQKLEKFDIDNKTYVADKSLPSLRDIGTMVCTLGSTSARVRRTQVPNSFVD 240

Query: 241 YSLPFSLAQEFTNTTDKRLVIITSFNNKFLSTTFEYFRIKAKLENDLEEVLPNKPKELII 300
           Y L FSLAQEF NTT+KRLV++TSFNN  L  TFEYFRIKAKLENDLEE LPNK KEL+I
Sbjct: 241 YHLVFSLAQEFANTTNKRLVVVTSFNNDLLMRTFEYFRIKAKLENDLEEALPNKLKELVI 300

Query: 301 LRPGPMCGQHGNSIKVELDVQENLTFSDKILYYPRYLLMYKKQYISEVRKIGLRTKLSEL 360
           LRPGPMCGQHG+ + V+LDVQEN TFS++ILYYPRY+L YKKQYISE RK+GLRTKLSEL
Sbjct: 301 LRPGPMCGQHGDPVNVKLDVQENPTFSERILYYPRYVLKYKKQYISEARKVGLRTKLSEL 360

Query: 361 IASSTYRMPGSALLGYSVPVSKVSYVASLMAIERKSKEAGPKMEVINSYQIDMIA 415
           IASS YRMPGSALLGYSVPVSKVSYV SL AIE++SKEAGPK+E+INSYQIDMIA
Sbjct: 361 IASSIYRMPGSALLGYSVPVSKVSYVTSLKAIEKRSKEAGPKVEMINSYQIDMIA 415

>Suva_2.486 Chr2 (859579..860826) [1248 bp, 415 aa] {ON} YDR317W
           (REAL)
          Length = 415

 Score =  647 bits (1669), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 307/410 (74%), Positives = 356/410 (86%)

Query: 6   NAFTDYILLFGSSGLAGKGTLENMLDINFYIKNVSDLQDKLNSLTEIKGDVVLNKHVFCI 65
           NAFTD ILLFGSSGLAGKGTLEN+LDINFYIKNVSDLQDKL+SLTEI  +VVLNKH+FCI
Sbjct: 6   NAFTDSILLFGSSGLAGKGTLENLLDINFYIKNVSDLQDKLDSLTEINENVVLNKHIFCI 65

Query: 66  NRRSITEEKSFMKSIDYINMKSITWKRGRYYLRSRNENETKKIPSNPDTFCYDAFEEGFI 125
           NR+S+TE+KSF+K+IDY+NMKSI WK GRYYLRSR ENETK+   N +TFCYD FEEG I
Sbjct: 66  NRKSVTEQKSFIKTIDYVNMKSIIWKGGRYYLRSRGENETKRETCNSNTFCYDDFEEGII 125

Query: 126 KKTTDENGKDNFCIPYNQKRFSYALYYASGKKEGFEIIYKFTVTQLIIPRSENWSRLLSY 185
           + + D++ K  F   YN+K+FSYAL+YA GK E F I Y F VTQL+IP+S +W +LL  
Sbjct: 126 RNSMDKDKKGTFSFAYNRKQFSYALHYACGKDESFGIKYNFIVTQLVIPQSTSWPKLLPE 185

Query: 186 IFSGTQKLEKFDANNKTYVAGKSLPNLRDISTMVCTLGSTSARVRRTQVPNSFVDYSLPF 245
           +FSGTQKLE+FD +++ YV+ KSLP L  I TMVC LGS++ARVR++QVPNSFVDY L F
Sbjct: 186 VFSGTQKLERFDVDSRDYVSDKSLPALNSIGTMVCALGSSAARVRKSQVPNSFVDYHLSF 245

Query: 246 SLAQEFTNTTDKRLVIITSFNNKFLSTTFEYFRIKAKLENDLEEVLPNKPKELIILRPGP 305
           +LAQEFTNTTDK+LV+ITSFNN FLS TFEYFRIKAKLENDLEE LPNK KELIILRPGP
Sbjct: 246 NLAQEFTNTTDKKLVVITSFNNDFLSRTFEYFRIKAKLENDLEEALPNKLKELIILRPGP 305

Query: 306 MCGQHGNSIKVELDVQENLTFSDKILYYPRYLLMYKKQYISEVRKIGLRTKLSELIASST 365
           MCGQHGN + VE+D+Q+N T S++  YYPRY+L YK+Q ISEVRK+GLRT+LSE+IASS 
Sbjct: 306 MCGQHGNPVHVEMDIQQNPTLSERFFYYPRYILKYKQQCISEVRKVGLRTRLSEVIASSI 365

Query: 366 YRMPGSALLGYSVPVSKVSYVASLMAIERKSKEAGPKMEVINSYQIDMIA 415
           YRMPGSALLGYSVPVSKVSYVASLMAIE+KSKEAGPK+EVINSYQIDMIA
Sbjct: 366 YRMPGSALLGYSVPVSKVSYVASLMAIEKKSKEAGPKVEVINSYQIDMIA 415

>TDEL0E02790 Chr5 complement(536193..537428) [1236 bp, 411 aa] {ON}
           Anc_5.348 YDR317W
          Length = 411

 Score =  244 bits (622), Expect = 3e-76,   Method: Compositional matrix adjust.
 Identities = 147/422 (34%), Positives = 218/422 (51%), Gaps = 27/422 (6%)

Query: 5   INAFTDYILLFGSSGLAGKGTLENMLDINFYIKNVSDLQDKLNSLTEIK-GDVVLNKHVF 63
           I  + D+ L FGSSGL G  TL+ +L  + Y+ N  ++Q +LN+   +   +   NK ++
Sbjct: 4   IQQYNDHFLFFGSSGLIGSLTLKELLKADLYLGNPENIQKRLNTCEHLNLSNFRFNKLIY 63

Query: 64  CINRRSITEEKSFMKSIDYIN---MKSITWKRGRYYLRSRNENETKKIPSNPDTFCYDAF 120
           CINR+ I  +   + +  Y+    +  I++ +  Y    R E  T   PS          
Sbjct: 64  CINRK-IGYKNILLDNEQYLKADKLAPISFNKADY----RFEKITSICPS-----VKKHS 113

Query: 121 EEGFIKKTTDENG-------KDNFCIPYNQKRFSYALYYASGKKEGFEIIYKFTVTQLII 173
            +  +   +DE+G            + Y++   +Y + Y S   +   I + F + Q+  
Sbjct: 114 NQSLVNNVSDESGTLYIHNNSAGNVLKYHRSMQTYQVEYKSENSKKLLITFNFVILQIAC 173

Query: 174 PRSENWSRLLSYIFSGTQKLEKFDANNKTYVAGKSLPNLRDISTMVCTLGSTSARVRRTQ 233
           P S  W  LL  IFSG   L      + T      LP L +I TM+CTLG+ S   R+++
Sbjct: 174 PDSSKWCELLPDIFSGCVALRSEAEPDGT---TNKLPPLDEIPTMICTLGAGS---RQSK 227

Query: 234 VPNSFVDYSLPFSLAQEFTNTTDKRLVIITSFNNKFLSTTFEYFRIKAKLENDLEEVLPN 293
               +VDY L F LAQ F N   KRLVI+T+FNN  +     YFR K+KLENDL+  L  
Sbjct: 228 AKRHYVDYELTFKLAQSFNNCEGKRLVIVTTFNNILIRHLLPYFRTKSKLENDLQHKLKP 287

Query: 294 KPKELIILRPGPMCGQHGNSIKVELDVQENLTFSDKILYYPRYLLMYKKQYISEVRKIGL 353
           +  +L++LRPGP+ G+HG  +   L +  +     +ILYY  Y    K     E R+IG 
Sbjct: 288 RLGKLVVLRPGPLVGEHGRPLTKSLTIGHSTNMLKQILYYKEYCFQCKLALFKEFRRIGF 347

Query: 354 RTKLSELIASSTYRMPGSALLGYSVPVSKVSYVASLMAIERKSKEAGPKMEVINSYQIDM 413
           RT+ SELIA + YR PGS +LGY +P +K +YVA+  A +  S EA   +E+I S Q+D 
Sbjct: 348 RTRASELIARTMYRKPGSWMLGYCIPATKAAYVAASKATDEASDEASDPVEIITSEQMDH 407

Query: 414 IA 415
           IA
Sbjct: 408 IA 409

>ZYRO0F00550g Chr6 complement(51742..52989) [1248 bp, 415 aa] {ON}
           similar to uniprot|Q06674 Saccharomyces cerevisiae
           YDR317W Hypothetical ORF
          Length = 415

 Score =  237 bits (605), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 142/386 (36%), Positives = 212/386 (54%), Gaps = 21/386 (5%)

Query: 7   AFTDYILLFGSSGLAGKGTLENMLDINFYIKNVSDLQDKLNSLTEIKGDV---VLNKHVF 63
           +F D+ILLFGS+GL G  TLE +L +  Y+   +DLQ KL  L E   D+    LNK  +
Sbjct: 12  SFQDHILLFGSTGLIGSLTLEELLKVELYLDAGNDLQSKL-ELYE-NSDINHFTLNKFFY 69

Query: 64  CINRRSITEEKSFMKS--IDYINMKSITWKRGRYYLRSRNENETKKIP-----SNPDTFC 116
           C+NR+   E++S      ++      + ++   YYL     N T   P     SNP +  
Sbjct: 70  CVNRKLNNEKRSPGNEYLMERCKATPLVFRGQDYYLH----NNTSATPPASQSSNP-SLG 124

Query: 117 YDAFEEGFIKKTTDENGKDNFCIPYNQKRFSYALYYASGKKEGFEIIYKFTVTQLIIPRS 176
            + FEE    + T      +  + + Q R SY L Y S   +   I + FT+ QL+   S
Sbjct: 125 NNVFEEDGTIQLTKTVDNRSVTLRFRQTRKSYQLEYISKDLKNLLITFHFTIVQLVFEDS 184

Query: 177 ENWSRLLSYIFSGTQKLEKFDANNKTYVAGKSLPNLRDISTMVCTLGSTSARVRRTQVPN 236
             W+ LL  IFSG  +L   ++N+        LP+L  + TM+CTLG  S+  + +    
Sbjct: 185 TRWADLLPSIFSGEVELVPEESNH----TSPRLPHLDQVKTMICTLGPNSSSTKHSHYDR 240

Query: 237 SFVDYSLPFSLAQEFTNTTDKRLVIITSFNNKFLSTTFEYFRIKAKLENDLEEVLPNKPK 296
            FV+Y L F + Q F +  DKRLVI+TSFNN  +S  F YF+ K +LENDL+  +     
Sbjct: 241 YFVEYQLTFQIVQNFASCEDKRLVIMTSFNNSLVSHIFPYFKAKYQLENDLQNKVAPALA 300

Query: 297 ELIILRPGPMCGQHGNSIKVELDVQENLTFSDKILYYPRYLLMYKKQYISEVRKIGLRTK 356
           +L++LRPGP+ G H N    +L ++ + +  +++ +Y  +   YKK ++ E+RKIG +TK
Sbjct: 301 QLVVLRPGPIVGNHVNLNDRDLRLRYSPSLCEQLKHYKEWCWEYKKSFVKEIRKIGFKTK 360

Query: 357 LSELIASSTYRMPGSALLGYSVPVSK 382
            SEL+A + YR PGS++LGY VP SK
Sbjct: 361 ASELVAKAMYRKPGSSVLGYCVPASK 386

>Kpol_1051.4 s1051 (8692..9972) [1281 bp, 426 aa] {ON} (8692..9972)
           [1281 nt, 427 aa]
          Length = 426

 Score =  197 bits (500), Expect = 6e-58,   Method: Compositional matrix adjust.
 Identities = 136/426 (31%), Positives = 227/426 (53%), Gaps = 38/426 (8%)

Query: 8   FTDYILLFGSSGLAGKGTLENMLDINFYIKNVSDLQDKLNSLTEIK--------GDVVLN 59
           F++ I + GS+GL  K  L ++LDINFY+ N ++++ KLN  ++I+          + + 
Sbjct: 15  FSEKIPIVGSTGLEEKWPLVSLLDINFYLLNSNEIKQKLNPRSDIEIPSNHQKMNTIKIV 74

Query: 60  KHVFCINRRSITEEKSFMKSIDYINMKSITWKRGRYYLRSRNENETKKIPSNPDTFCYDA 119
           K++FCINRRS T +     +++ + +  I +K   Y L  +   ET             +
Sbjct: 75  KNIFCINRRSQTLDLFNKDALESVKVGRIKFKDLEYRL-DKTPGET-------------S 120

Query: 120 FEEGFIKKTTDENGKDNFCIPYNQKRFSYALYYASGK-----KEG--FEIIYKFTVTQLI 172
           +E  ++     E+GK NF   +     S+ L     +     KEG   +I ++ +V  +I
Sbjct: 121 YESSYLTNEI-ESGKINFDCEHPFSPLSFELQKKRAQLTYKAKEGNMLQIQFEISVYHII 179

Query: 173 IPRSENWSRLLSYIFSGTQKLEKF-DANNKTYVAGKSLPNLRDISTMVCTLGSTSARVRR 231
           IP S  W  LL  IF+    +EK  D  N     G  LP+L++I TM+ +LG    +   
Sbjct: 180 IPTSNQWPTLLPRIFNPATVIEKVEDKENSILPTG--LPDLKNIPTMISSLGLNHRQQIT 237

Query: 232 TQVPNSFVDYSLPFSLAQEFTNTTDKRLVIITSFNNKFLSTTFEYFRIKAKLENDLEEVL 291
            +     +D+ L   L Q F N  +K+LV+IT+FNNK +S  F YF  K K+E  L+  L
Sbjct: 238 REKSYRAIDFDLTLKLTQTFANNNNKKLVVITTFNNKVVSKMFRYFHFKFKIEEALQNEL 297

Query: 292 PNKPKELIILRPGPMCG-QHGNSIKVELD--VQENLTFSDKILYYPRYLLMYKKQYISEV 348
             K  +L+ILRPGP+ G    ++I  E +  ++++    ++ +   +YLL YK   + + 
Sbjct: 298 NPKLSQLVILRPGPIVGVPMTDAINPEFNPILKKSDNLVEQSILLKKYLLDYKLATLKKY 357

Query: 349 RKIGLRTKLSELIASSTYRMPGSALLGYSVPVSKVSYVASLMAIER--KSKEAGPKMEVI 406
           R  G+  +L++++A + YR PG+++LGY +P +KV+ VA+L AIE    S  + P +++I
Sbjct: 358 RSTGIAPRLTDILAKTMYRKPGTSVLGYCIPATKVAKVAALKAIEPTIASTYSKPDVQII 417

Query: 407 NSYQID 412
            S QID
Sbjct: 418 TSRQID 423

>CAGL0H07161g Chr8 complement(704823..706097) [1275 bp, 424 aa] {ON}
           similar to uniprot|Q06674 Saccharomyces cerevisiae
           YDR317w
          Length = 424

 Score =  191 bits (484), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 128/416 (30%), Positives = 213/416 (51%), Gaps = 16/416 (3%)

Query: 4   RINAFTDYILLFGSSGLAGKGTLENMLDINFYIKNVSDLQDKL-NSLTEIKGDVVLNKHV 62
           R   F   ILLFGS+GL G    E +LD  FY+ +  +L++ L  ++ E   +V +   +
Sbjct: 15  REKTFEKNILLFGSTGLTGSLVFEYLLDPCFYLNSAVELRELLLEAIEEGLENVTIKTCL 74

Query: 63  FCINRRSITEEKSFMKSIDYINMKSITWKRGRYYLRSRNENETKKIPSNPDT---FCYDA 119
           +C NR+       ++KS    +     +   +Y+      N+   +P + D       DA
Sbjct: 75  YCFNRKIGEPLDKYLKSPSANSFGPFCFNGSQYHY-----NKGTCVPLDIDQDIETSNDA 129

Query: 120 FEEGFI---KKTTDENGKDNFCIPYNQKRFSYALYYASGKKEGFEIIYKFTVTQLIIPRS 176
             +GF+    K  +  GK+     Y  K + Y L Y S +    ++ + F   QLII  S
Sbjct: 130 TFDGFLYYKDKGKNVTGKNPISGEYYGKEYMYYLEYMSAEGNLLKLNFIFNHIQLIIKNS 189

Query: 177 ENWSRLLSYIFSGTQKLEKFDANNKTYVAGKSLPNLRDISTMVCTLGSTSARVRRTQVPN 236
            +W  ++  IFS   ++E      K  +  +  P L DI TM+ T+G+T+ R + +    
Sbjct: 190 FSWPSVIPIIFS--DEVEAISFREKMPLK-RYFPLLSDIKTMISTIGTTTNRNKISNTTY 246

Query: 237 SFVDYSLPFSLAQEFTNTTDKRLVIITSFNNKFLSTTFEYFRIKAKLENDLEEVLPNKPK 296
           + +DY L   L + F+NT DK ++I+TSFNN  +ST   YF+IK KLE+ L   +    K
Sbjct: 247 NDIDYQLNVDLVKAFSNTDDKSVIIVTSFNNTIISTVSPYFKIKMKLESTLANAITPPLK 306

Query: 297 ELIILRPGPMCGQHGNSIKVELDVQENLTFSDKILYYPRYLLMYKKQYISEVRKIGLRTK 356
            L ILRPGP+ G+H +       + +N +  ++ L + +  L   + ++ ++R  G+  K
Sbjct: 307 TLTILRPGPLVGRHSDIYPTNDSILKNSSLFERALLHKKAFLQNMECFVDDIRTGGMSIK 366

Query: 357 LSELIASSTYRMPGSALLGYSVPVSKVSYVASLMAIERKSKEAGPKMEVINSYQID 412
            SE++A + YR+PGS LLGY +P  KV+Y  S+ A+++   E  P   V+ S ++D
Sbjct: 367 ASEIVARTFYRIPGSKLLGYCIPAQKVAYAISIAAVDKYLHEE-PLTRVVTSEEMD 421

>Kwal_34.15989 s34 complement(147085..148605) [1521 bp, 506 aa] {ON}
           YDR317W - Hypothetical ORF [contig 272] FULL
          Length = 506

 Score =  159 bits (402), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 131/458 (28%), Positives = 213/458 (46%), Gaps = 62/458 (13%)

Query: 1   MNYRINAFTDYILLFGSSGLAGKGTLENMLDINFYIKNVSDLQDKLNSLTEI-------- 52
           +N   N   D  L+FG +GL G     N+     Y+   +DLQ K++SL           
Sbjct: 68  LNVPSNRTVDSTLIFGITGLTGGLIAANLAQPWVYLNATNDLQRKISSLFPFSDQLEKHH 127

Query: 53  ----------------KGDVVLNKHVFCINRRSITEEKSFMKSIDYINMKSITWKRGRYY 96
                           +  V + K++FC  RRS+T E+  +  +D     SI +K     
Sbjct: 128 HFMRRTRSPLCNLLTKEKSVEVTKNLFCFTRRSVTLEQICLDGLDASWEHSIDYK----- 182

Query: 97  LRSRNENETKKIPSNPDTFCYDAFEEGFIKKTT-----DENGKDNFCIPYNQKRFSYALY 151
                   +K + S  +  C    EE F+K+ T     D +      +    ++F+Y L 
Sbjct: 183 -------GSKMVCSKENLSC----EEPFVKRGTTTFFQDASDAPAVTLTIQLQKFTYHLN 231

Query: 152 YASGK-------KEGFEIIYKFTVTQLIIPRSENWSRLLSYIFSGTQKLEKFDANNKTYV 204
           Y + +       +    I  +  +  ++   S+ W  LL+ IF            +    
Sbjct: 232 YDNSRDVHGETCRHTLMIQLRVNIILIVEEDSQKWPMLLTRIFGKHASKRPLIVKDTEEP 291

Query: 205 AGKSLPNLRDISTMVCTLGSTSARVRRTQVPNSFVDYSLPFSLAQEF----TNTTDKRLV 260
              + P L  I+TMV +LGS S   ++ ++   F DY L   LA  F    T   +K++V
Sbjct: 292 ILWTAPPLTQINTMVSSLGSKSFEKKKPKISRHFADYELNMLLAHAFCKDKTRGLEKKIV 351

Query: 261 IITSFNNKFLSTTFEYFRIKAKLENDLEEVLPNKPKELIILRPGPMCGQHGNSIKVELDV 320
           IITSFNN FLS+T +YF+ K  LE DL   +    K L++LRPGP+ G H + ++    +
Sbjct: 352 IITSFNNLFLSSTSDYFQSKLMLEQDLVTKVQALDK-LVLLRPGPLVGNHTHQLQSPSII 410

Query: 321 QEN---LTFSDKILYYPRYLLMYKKQYISEVRKIGLRTKLSELIASSTYRMPGSALLGYS 377
            +     T   K+L + +  +  K Q + E+ ++G+RTKLSEL+A   Y+   S LLG+ 
Sbjct: 411 DKPSFIPTAMFKVLKFKKNCIERKLQLLREISQVGIRTKLSELMARLAYQRSCSPLLGHV 470

Query: 378 VPVSKVSYVASLMAIERKSKEAGPKMEVINSYQIDMIA 415
           VP  KV++VAS+ A+   S ++   +E+I S +I+ +A
Sbjct: 471 VPAYKVAFVASIRAV--FSPDSASFVELIKSDEIEKMA 506

>Ecym_8185 Chr8 complement(383906..385321) [1416 bp, 471 aa] {ON}
           similar to Ashbya gossypii AGR348W
          Length = 471

 Score =  155 bits (393), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 123/400 (30%), Positives = 198/400 (49%), Gaps = 62/400 (15%)

Query: 4   RINAFTDYILLFGSSGLAGKGTLENMLDINFYIKNVSDLQDKLNSLTEIKGDVVLNKHVF 63
           ++N   D +++ GS+GL G   L+  +                   + +  D+ L K+++
Sbjct: 94  KVNEKGDNVIILGSTGLTGSQVLKGCM---------------APWTSGVLYDLKLTKNIW 138

Query: 64  CINRRSITEEKSFMKSIDY-INMKSITWKRGRYYLRSRNENETKKIPSNPDTFCYDAFEE 122
           C NRR        +K++D+ I+    TW     Y      +  +K         YD    
Sbjct: 139 CFNRR--------LKTVDFSISKLPPTWTAVVNY--GGEPHIIRK---------YDLK-- 177

Query: 123 GFIKKTTDENGK-DNFCIPYNQKRFSYALYYASGKKEGFEIIYKFTVTQLIIPRSENWSR 181
             IK+   E GK D     ++Q  F + L   + + +   +     V Q+I   S+ W +
Sbjct: 178 --IKQHITEIGKLDGLEFQWDQ--FDWELKLPTDEVKNVTV----NVFQIIQNDSKKWDK 229

Query: 182 LLSYIFSGTQKLEKFDANNKTYVAGKSLPNLRDISTMVCTLGSTSARVRRTQVPNSFVDY 241
             S +F+G +K      N++  V    LP++  + T++ TLGS+S   R+ + P SFVDY
Sbjct: 230 TFSELFTGNRK----PLNDRIEVY---LPSIDQVETLISTLGSSSWESRKMKTPRSFVDY 282

Query: 242 SLPFSLAQEFTNTTDKRL----VIITSFNNKFLSTTFEYFRIKAKLENDLEEVLPNKPKE 297
           +L   +A+ F     K L    VI+TSFNN  L     YFR K KLENDL   +P     
Sbjct: 283 TLNMDMAKVFAPDQKKSLIKHMVIVTSFNNLALGVLSPYFRTKQKLENDLTYDVPGL-TH 341

Query: 298 LIILRPGPMCGQHGNSIKV--ELDVQENLTFSDKILYYPRYLLMYKKQYISEVRKIGLRT 355
           L ILRPGP+ GQHG  I +  +L V   + +  K   + R LL  K  ++S+V+ +G   
Sbjct: 342 LTILRPGPLIGQHGKQIILAPQLPVGSGVLY--KCYAWKRSLLKAKLHWLSQVKDVGPSK 399

Query: 356 KLSELIASSTYRMPGSALLGYSVPVSKVSYVASLMAIERK 395
           K++ELIA +TY +PG+ ++GYS+P SKV+ +A+  A+ ++
Sbjct: 400 KVTELIAKATYHLPGNWIVGYSIPSSKVARIAAKEAMTKR 439

>AGR348W Chr7 (1377726..1379354) [1629 bp, 542 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR317W
          Length = 542

 Score =  148 bits (373), Expect = 8e-39,   Method: Compositional matrix adjust.
 Identities = 77/233 (33%), Positives = 138/233 (59%), Gaps = 12/233 (5%)

Query: 168 VTQLIIPRSENWSRLLSYIFSGTQKLEKFDANNKTYVAGKSLPNLRDISTMVCTLGSTSA 227
           V Q++ P S  W  L + +F+G   +  F+A ++ Y     +P + +I T++ TLGSTS 
Sbjct: 286 VVQVVQPDSRRWPDLFNKMFTG--GVRTFNAYSEIY-----MPAVTEIETLISTLGSTSW 338

Query: 228 RVRRTQVPNSFVDYSLPFSLAQEFT----NTTDKRLVIITSFNNKFLSTTFEYFRIKAKL 283
             R+++ P +FVDY+L   +A+ F       T K +VI+TSFN+  L    +YFR K +L
Sbjct: 339 EARKSKAPRAFVDYTLNMQMAKTFAPDPKKGTVKHMVIVTSFNHLALGMVSQYFRTKQRL 398

Query: 284 ENDLEEVLPNKPKELIILRPGPMCGQHGNSIKVELDVQENLTFSDKILYYPRYLLMYKKQ 343
           ENDL   +P     L ILRPGP+ G+HG+   +     +      +   Y + ++  +  
Sbjct: 399 ENDLTYDVPGL-THLTILRPGPLLGEHGSKPVISPTNPDTGNMLTRCYTYKKNVMRTQFN 457

Query: 344 YISEVRKIGLRTKLSELIASSTYRMPGSALLGYSVPVSKVSYVASLMAIERKS 396
           ++++V+++G  TK++EL+A +TY +PG+ ++GYS+P  +V+ +A+  A+ +++
Sbjct: 458 WLAQVKEVGPTTKVTELVAKATYHLPGNWIVGYSIPAGRVAQIAAQEALVKRN 510

>SAKL0G08910g Chr7 complement(761626..763143) [1518 bp, 505 aa] {ON}
           weakly similar to uniprot|Q06674 Saccharomyces
           cerevisiae YDR317W Hypothetical ORF
          Length = 505

 Score =  138 bits (347), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 117/424 (27%), Positives = 204/424 (48%), Gaps = 58/424 (13%)

Query: 34  FYIKNVSDLQDKLNSLTE--------------------IKGD--VVLNKHVFCINRR-SI 70
            Y+   +D+QDK+  + E                    ++G+  + + K++FC NR+ ++
Sbjct: 98  LYLGTTNDVQDKIQMMFEAGDLSSESNPPNVKRTFGQILRGEKSIEITKNLFCFNRKLAL 157

Query: 71  TEEKSFMKSIDYINMKSITWKRGRYYLRSRNENETKKIPSNPDTFCYDAFEEGFIKKTTD 130
            E  S  + I+     SI +K  +Y+  S+  N +  +P    T  +           T+
Sbjct: 158 LEIPSTPEYINDYWEYSIDYKGTKYH--SKKNNISFGVP----TLKFGKLVNSNENSITN 211

Query: 131 ENGKDNFCIPYNQKRFSYALYYASGKKEGFEIIYKFTVTQLIIPRSENWSRLLSYIFSGT 190
           +     F   +  +R   ++     + +   I  K  V Q++ P S+ W  LL   F  T
Sbjct: 212 QCQLQQFDYKFEFQREDPSMQNLRTRAQTLIISLKINVIQILEPNSKLWPLLLHSTFGDT 271

Query: 191 QKLEKFDANNKTYVAGKS-----LPNLRDISTMVCTLGSTSARVRRTQVPNSFVDYSLPF 245
                 D N   +V G+       P+L  ++T+V  LGST+   +++ V   FVDY L F
Sbjct: 272 ------DTNVALHVQGQVPTPMIFPSLSKVNTLVSALGSTTFEQKKSHVSRDFVDYDLNF 325

Query: 246 SLAQEFTNTTD-----KRLVIITSFNNKFLSTTFEYFRIKAKLENDLEEVLPNKPKELII 300
            +A+EFT  +      K++V+ITSFNN  LS+T  YF  K KLE DL   +P    EL+I
Sbjct: 326 KMAEEFTTNSSEHGIKKKVVVITSFNNFALSSTSPYFHTKLKLEQDLATRIPEL-DELVI 384

Query: 301 LRPGPMCGQH------GNSIKVELDVQENLTFSDKILYYPRYLLMYKKQYISEVRKIGLR 354
           LRPGP+ G H      G+  K    + + L+    + YY +    +K+ ++  V ++GL+
Sbjct: 385 LRPGPLIGSHTPEFIPGDPPKSTNGLLKPLS---TVCYYKKACYDHKRHFLQSVTQVGLK 441

Query: 355 TKLSELIASSTYRMPGSALLGYSV---PVSKVSYVASLMAIERKSKEAGPKMEVINSYQI 411
           TK++E+ A   YR   S + GYSV    V+ V+ + ++  I+   +  G ++++I S ++
Sbjct: 442 TKMTEVFARLIYRSSCSWMFGYSVPVAKVAVVAAIRTIQKIQNDPESGGIRVQLIKSDEL 501

Query: 412 DMIA 415
           D++ 
Sbjct: 502 DVMV 505

>KLTH0H14784g Chr8 (1283834..1285378) [1545 bp, 514 aa] {ON} weakly
           similar to uniprot|Q06674 Saccharomyces cerevisiae
           YDR317W Hypothetical ORF
          Length = 514

 Score =  136 bits (343), Expect = 7e-35,   Method: Compositional matrix adjust.
 Identities = 122/452 (26%), Positives = 206/452 (45%), Gaps = 63/452 (13%)

Query: 9   TDYILLFGSSGLAGKGTLENMLDINFYIKNVSDLQDKLNSLTEI---------------- 52
           TD +L+ G++GL G   L N+     Y+   +DLQ K++SL                   
Sbjct: 80  TDNVLILGATGLTGSLILANLAQPWIYLNATNDLQSKVDSLYPADLERFTKHNIFVKKPK 139

Query: 53  ---------KGDVVLNKHVFCINRRSITEEKSFMKSIDYINMKSITWKRGRYYLRSRNEN 103
                    +  + + K+++C+ RR I  E   +  +D     ++  K   + L      
Sbjct: 140 SPLCNILVRRKSIEVTKNLYCLARRPIAVEGMPLDGLDASWEHTVRCKG--FDLICGKGG 197

Query: 104 ETKKIPSNPDTFCYDAFEEGFIKKTTDENGKDNFCIPYNQKRFSYALYY-----ASGKKE 158
            ++      +   Y+      +  T +  G++   I    + FS+ L Y       G   
Sbjct: 198 ISRDCTLERNAAMYE------LASTHNCPGRE---IILQLQSFSFKLVYENSRDPHGDTC 248

Query: 159 GFEIIYKFTVTQLII--PRSENWSRLLSYIFSGTQKLEKFDANNKTYVAGKS---LPNLR 213
           G  ++ K  +  + +    S+ W  LL+ +F G Q +++        + G S    P+L 
Sbjct: 249 GHALMVKLNINVICVIDTDSQRWPALLTDVF-GEQPMKRGLIPQGQGLEGISHWEFPSLG 307

Query: 214 DISTMVCTLGSTSARVRRTQVPNSFVDYSLPFSLAQEFTN----TTDKRLVIITSFNNKF 269
           D+ T+V  LGST  + R++ +P  +VDY L  +LAQEF       T K++V++TSFN+  
Sbjct: 308 DVGTLVSALGSTRHQERKSSIPRHYVDYELNLTLAQEFCQRKARGTRKKIVVVTSFNSSL 367

Query: 270 LSTTFEYFRIKAKLENDLEEVLPNKPKELIILRPGPMCGQHGNSIKVELDVQENLTFSDK 329
           LST   YF+ K KLE DL   + +    L++LRPGP+ G H    +         TF   
Sbjct: 368 LSTVSNYFQTKLKLEQDLYTKV-HGMDNLVLLRPGPLVGNHTPHAQTP-PATNKFTFLPA 425

Query: 330 ILYYPRYLLMYKKQYISEVR------KIGLRTKLSELIASSTYRMPGSALLGYSVPVSKV 383
            L++   L++ K+ +  +VR      K+GLR KLSEL A   Y+ P   L+       KV
Sbjct: 426 ALFH--ILVLKKRCFDRKVRLLRDLMKVGLRAKLSELGARLAYQHPCLQLVSSVNAAHKV 483

Query: 384 SYVASLMAIERKSKEAGPKMEVINSYQIDMIA 415
           ++ A+  AI   S ++   +E+I S +I+ +A
Sbjct: 484 AFFAASRAI--YSPDSASFVELIKSDEIEKMA 513

>TPHA0D02060 Chr4 (424797..426287) [1491 bp, 496 aa] {ON} Anc_5.348
           YDR317W
          Length = 496

 Score =  135 bits (339), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 120/479 (25%), Positives = 213/479 (44%), Gaps = 81/479 (16%)

Query: 5   INAFTDYILLFGSSGLAGKGTLENMLDINFYIKNVSDLQ-----DKLNSLTEIKGDVVLN 59
           I+ F+D IL+ GS+GL G+  L++  D + YIK+  +L+      + +S T IK +V + 
Sbjct: 28  IDRFSDNILVVGSTGLIGRNVLKSFFDTDLYIKHSQELKRLIASSEYDSTTRIK-EVTIK 86

Query: 60  KHVFCINRRSITEE---------------------------------------KSFMKSI 80
           K  + + R+  + E                                       +SF+KS+
Sbjct: 87  KTAYSLTRKRQSVELFKNKTIVGQKLKEVELDGKTFYLQFDLLKQINDSGEPKESFLKSL 146

Query: 81  DYINM-KSITWKRGRYYLRSRNENETKKIPSNPDTFC------------YDAFEEGFIKK 127
               M +++T  +G     +  EN+   + +   +              Y+  E   I +
Sbjct: 147 TTKKMLEALTHGKGVKVTSNSKENQGISVRNEESSILKKDKSLLFSVINYNESEGNVILQ 206

Query: 128 TTDENGKDNFCIPYNQKRFSYALYYASGKKEGFEIIYKFTVTQLIIPRSENWSRLLSYIF 187
             + +  + +   +N +++  +L +AS   +  +I +   +  L    S  W  LL  +F
Sbjct: 207 PQEYSNVECY---FNLQQYDSSLIFASSSGDILKINFDLKLYHLSAVDSTIWPSLLPVLF 263

Query: 188 SGTQKL-------EKFDANNKTYVAGKSLPNLRDISTMVCTLGSTSARVRRTQVPNSFVD 240
               KL       E  D  N+       LP L ++  M+ +LGS S   +     N  +D
Sbjct: 264 DSNTKLVPNKGLIENIDLTNE------KLPLLSEVKVMLNSLGSRSHSPKNETFKN--ID 315

Query: 241 YSLPFSLAQEFTNTTDKRLVIITSFNNKFLSTTFEYFRIKAKLENDLEEVLPNKPKELII 300
           Y L  SL   F NT+DK+++IITS N K  +    Y   K  LE DL+  L NK  EL+I
Sbjct: 316 YKLNLSLINSFNNTSDKKVIIITSVNKKIYTFFSRYLNYKMVLEEDLKTNLDNKINELVI 375

Query: 301 LRPGPMCGQHGNSIKV---ELDVQENLTFSDKILYYPRYLLMYKKQYISEVRKIGLRTKL 357
           LRPGP+ G    +  +      ++ N +   +++ Y R+   YK   +  ++  G     
Sbjct: 376 LRPGPLVGTPMTTKLIPGLTAHLKRNDSSLKQLINYKRFAFDYKVALLRRIKYTGFEPTC 435

Query: 358 SELIASSTYRMPGSALLGYSVPVSKVSYVASL--MAIERKSKEAGPKMEVINSYQIDMI 414
           + ++A + YR PG++LLGY++P SKV+ V     + +  ++     K+E++ S  ID++
Sbjct: 436 TNILAKTFYRRPGTSLLGYTIPASKVAEVMVFKGLCVGLENVHKDTKVEILESKTIDLL 494

>KAFR0C01880 Chr3 complement(374180..375217) [1038 bp, 345 aa] {ON}
           Anc_5.348 YDR317W
          Length = 345

 Score =  120 bits (302), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 94/305 (30%), Positives = 161/305 (52%), Gaps = 20/305 (6%)

Query: 10  DYILLFGSSGLAGKGTLENMLDINFYIKN-VSDLQDKLNSLTEIKG--DVVLNKHVFCIN 66
           ++IL FGSSGL G G+L N+L+ NF + N  ++  D + S + + G  D+  +K ++C N
Sbjct: 7   EHILFFGSSGLVGSGSLSNLLNPNFLLCNKQNNFYDVIES-SIVSGVYDIAFDKIIYCFN 65

Query: 67  RRSITEEKSFMKSIDYINMKSITWKRGRYYLRSRNENETKKIPSNPDTFCYDAFEEGFIK 126
           R    +   +    D+       +   +Y L +  E      P+N       +FE     
Sbjct: 66  R--TPQNIRYKYHSDFEKNSQFDFGGTKYTLSNNPE------PNN-------SFESKGQL 110

Query: 127 KTTDENGKDNFCIPYNQKRFSYALYYASGKKEGFEIIYKFTVTQLIIPRSENWSRLLSYI 186
           +    + ++   I Y    +S    +++ +++   + Y     Q++   SE W  LL  +
Sbjct: 111 QFAINDVEERIKIKYQVMPYSKEFGFSAEEEQQLNVTYNVFHVQIVYNESEKWPDLLPIL 170

Query: 187 FSGTQKLE-KFDANNKTYVAGKSLPNLRDISTMVCTLGSTSARVRRTQVPNSFVDYSLPF 245
           F+G  +++      ++ +     L N+ DIST+VCTLG++SA  ++  +  + +DY L +
Sbjct: 171 FTGENEIKIARKRKDRLFPELFKLANINDISTVVCTLGASSATAKKQNMTVNKIDYDLTY 230

Query: 246 SLAQEFTNTTDKRLVIITSFNNKFLSTTFEYFRIKAKLENDLEEVLPNKPKELIILRPGP 305
           +L + FT T +K+++I+TSFNN  +S  F YFR K +LENDL+  L    KEL ILRPGP
Sbjct: 231 NLIRAFTTTENKKVIIVTSFNNALISNIFPYFRTKLRLENDLKTTLEPPIKELYILRPGP 290

Query: 306 MCGQH 310
           + G+H
Sbjct: 291 IKGKH 295

>TBLA0A03100 Chr1 (739771..740889) [1119 bp, 372 aa] {ON} Anc_5.348
           YDR317W
          Length = 372

 Score =  116 bits (291), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 106/350 (30%), Positives = 162/350 (46%), Gaps = 64/350 (18%)

Query: 9   TDYILLFGSSGLAGKGTLENMLDINFYIKNVSDLQDKLNSL--------TEIKGDVVLNK 60
           T+YI  FGS+G+ G  TL N+L+IN Y++   D Q  +++L         +   D+ L K
Sbjct: 5   TNYIF-FGSTGMTGFTTLTNLLNINSYLQ-AKDPQSAIDNLPQDFQWQACDDSLDLYLVK 62

Query: 61  HVFCINRRSITEEKSFMKSIDYINMK------SITWKRGRYYLRSRN-----------EN 103
           ++FCINRR       F  S  Y++ K      SI +K   + L+ ++           +N
Sbjct: 63  NIFCINRR-------FFDSPIYLDEKIISSNISINYKDKTFELQFQSNTNSVSNNITEQN 115

Query: 104 ETKKIPSNPDTFCYDAFEEGFIKK-----------TTDE---NGKDNFC-IPYNQKRFSY 148
           E K    + D   Y   + G I+            TTDE   +     C + + Q   + 
Sbjct: 116 ELKLPLVSTDCLRY-FIDTGNIQLETTPGKENQILTTDEVWYHFNQQLCQLNFKQINLNE 174

Query: 149 ALYYASGKKEGF-EIIYKFTVTQLIIPRSENWSRLLSYIFSGTQKLEKFDANNKTYV--- 204
                   +E F ++ Y   + Q ++P+S+ W  +L  IF  T  L         Y+   
Sbjct: 175 NENDNDNVQEKFIKLNYIINIYQFVLPKSDTWLEVLPNIFKPTTILHSKINCTWNYIDQF 234

Query: 205 ----AGKSLPNLRDISTMVCTLGSTSARVRRTQVPNSFVDYSLPFSLAQEFTNTTDKRLV 260
               +   LP L DI  M+CTLG+     ++       +D+ L F L+  F+N   K+LV
Sbjct: 235 TNEKSNIVLPKLEDIQVMICTLGTNLLCDQKK------IDFDLTFQLSNWFSNRLGKKLV 288

Query: 261 IITSFNNKFLSTTFEYFRIKAKLENDLEEVLPNKPKELIILRPGPMCGQH 310
           I+T+FNN  LS TF YF +K +LE  L+  L     EL+ILRPGP+ G H
Sbjct: 289 IVTAFNNSLLSKTFNYFNVKNQLEKSLKYDLDFPLGELVILRPGPLLGTH 338

>KLLA0B10120g Chr2 (886187..887233) [1047 bp, 348 aa] {ON} some
           similarities with uniprot|Q06674 Saccharomyces
           cerevisiae YDR317W
          Length = 348

 Score =  105 bits (261), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 72/210 (34%), Positives = 116/210 (55%), Gaps = 17/210 (8%)

Query: 214 DISTMVCTLGSTSARVRRTQVPNSFVDYSLPFSLAQEFTNTT--DKRL---VIITSFNNK 268
           D+S + C LGSTSAR +RT V   +VD  L   + +   N     ++L   +I+TSFNN 
Sbjct: 133 DLSVISC-LGSTSARSKRTGVARDWVDKILNLDILKAILNNDILSQKLSQYIIMTSFNNF 191

Query: 269 FLSTTFEYFRIKAKLENDLEEVLPNKPKELIILRPGPMCGQHGNSIKVEL-DVQENLTFS 327
            +S  F YF+ K +LE + + +L N    ++ILRPGP+ G+HG++    + ++ + L  S
Sbjct: 192 AISRMFPYFKAKQELETNTQFLLQNHRASIVILRPGPLIGKHGSTSSFTVPELDDRLLHS 251

Query: 328 DKILYYPRYLLMYKKQYISEVRKIGLRTKLSELIASSTYRMPGSALLGYSVPVSKVSYVA 387
             IL Y + +  +  + ++E + +G+ T+ SEL+A  +Y MPG+  +GY V   KV   A
Sbjct: 252 --ILRYKKAIFHHYVRRMNEWKDVGIATRTSELVAQFSYNMPGAFFVGYPV---KVLDCA 306

Query: 388 SLMAIERKSKEAGP-----KMEVINSYQID 412
            ++  ER      P     K+   +S QID
Sbjct: 307 HVIVTERVKHFKLPSLQPQKVTYFSSQQID 336

>KNAG0L00930 Chr12 (170496..171185) [690 bp, 229 aa] {ON} 
          Length = 229

 Score = 47.8 bits (112), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 43/155 (27%), Positives = 66/155 (42%), Gaps = 14/155 (9%)

Query: 212 LRDI----STMVCTLGSTSARVRRTQVPNSFVDYSLPFSLAQEFTNTTDKRLVIITSFNN 267
           +RDI      ++C LG+T AR    +     VD+ L   LA           V++ S   
Sbjct: 62  MRDIPGNLDVLICALGTTRARSNAEE--QYAVDHDLTLELATVAKREKHAHTVVVVSSTG 119

Query: 268 KFLSTTFEYFRIKAKLENDLEEVLPNKPKELIILRPGPMCGQHGNSIKVELDVQENLTFS 327
               + F Y R+K  +E D+ E+  N     ++LRPG + G+     K  +  ++ L   
Sbjct: 120 AHPESRFFYARMKGDVERDITELQFN---HTVLLRPGILLGE---RYKPHVGYRDFLGTR 173

Query: 328 DKILYYPRYLLMYKKQYI--SEVRKIGLRTKLSEL 360
              L+Y      +    I  SEV K+GL   L EL
Sbjct: 174 FGALFYRSRFQAWALYPIRGSEVAKVGLHLALEEL 208

>YER004W Chr5 (159580..160275) [696 bp, 231 aa] {ON}  FMP52Protein
           of unknown function, localized to the mitochondrial
           outer membrane; induced by treatment with
           8-methoxypsoralen and UVA irradiation
          Length = 231

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 35/122 (28%), Positives = 58/122 (47%), Gaps = 8/122 (6%)

Query: 239 VDYSLPFSLAQEFTNTTDKRLVIITSFNNKFLSTTFEYFRIKAKLENDLEEVLPNKPKEL 298
           +D+ L   LAQ       + +V+++S       + F Y ++K ++E D   V+    K +
Sbjct: 89  IDHDLNLQLAQAAKEKGCETIVLVSS-AGAHPDSRFGYMKMKGEIERD---VIALDFKHI 144

Query: 299 IILRPGPMCGQHGNSIKVELDVQENLTFSDKILYYPRY--LLMYKKQYISEVRKIGLRTK 356
           IILRPGP+ G+  NS +             ++ Y  R+  LL Y   Y  EV K+G+   
Sbjct: 145 IILRPGPLLGERTNSKQSGFGGNLTAALGTRV-YRSRFQRLLGY-PVYGDEVGKVGVHLA 202

Query: 357 LS 358
           L+
Sbjct: 203 LN 204

>Smik_5.118 Chr5 (163900..164595) [696 bp, 231 aa] {ON} YER004W
           (REAL)
          Length = 231

 Score = 41.2 bits (95), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 33/127 (25%), Positives = 56/127 (44%), Gaps = 20/127 (15%)

Query: 239 VDYSLPFSLAQEFTNTTDKRLVIITSFNNKFLSTTFEYFRIKAKLENDLEEVLPNKPKEL 298
           +D+ L   LA+   +   + +V+++S       + F Y ++K ++E D   V+    K  
Sbjct: 89  IDHDLNLQLARAAKDKGCETIVLVSS-AGAHADSRFGYMKMKGEIERD---VIALNFKHT 144

Query: 299 IILRPGPMCGQH--------GNSIKVELDVQENLTFSDKILYYPRYLLMYKKQYISEVRK 350
           IILRPGP+ G+         G ++   L V+   +     L YP         Y  EV K
Sbjct: 145 IILRPGPLLGERENSKQSGFGGNLAAALGVRVYRSRFQSWLGYP--------VYGDEVGK 196

Query: 351 IGLRTKL 357
           +G+   L
Sbjct: 197 VGVHLAL 203

>TBLA0A10500 Chr1 (2585576..2586289) [714 bp, 237 aa] {ON} Anc_7.148
           YER004W
          Length = 237

 Score = 40.4 bits (93), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 39/178 (21%), Positives = 71/178 (39%), Gaps = 40/178 (22%)

Query: 238 FVDYSLPFSLAQEFTNTTDKRLVIITSFNNKFLSTTFEYFRIKAKLENDLEEVLPNKPKE 297
           ++D+ L    A++         V+++S       + F Y ++K ++E DL+ +       
Sbjct: 89  YIDHDLNIDFAKKAKENGCSTFVVVSSAGAS-ADSRFFYLKMKGEIERDLKAI---DFDH 144

Query: 298 LIILRPGPMCGQHGNSIKVELDVQENLTFSDKILYYPRYLLMYKKQYISEVRKIGLRTKL 357
           LIILRPGP+ G+           QENL                           G     
Sbjct: 145 LIILRPGPLLGER----------QENLK--------------------------GFGNST 168

Query: 358 SELIASSTYRMPGSALLGYSVPVSKVSYVASLMAIERKSKEAGPKMEVINSYQIDMIA 415
              + +  YR    AL+G+ V   +V  V   +A++    ++  K++++ S +I  IA
Sbjct: 169 FTTLGNWVYRSRLQALVGHPVFGDEVGQVGVHLALKALKDKSSEKVQIVESNEILCIA 226

>TBLA0F03310 Chr6 complement(814437..814922) [486 bp, 161 aa] {ON}
           Anc_7.148 YER004W possible pseudogene; truncated at 5'
           end
          Length = 161

 Score = 39.7 bits (91), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 37/174 (21%), Positives = 70/174 (40%), Gaps = 42/174 (24%)

Query: 239 VDYSLPFSLAQEFTNTTDKRLVIITS-FNNKFLSTTFEYFRIKAKLENDLEEVLPNKPKE 297
           +D++L   LA++         V+++S   N    + F Y ++K ++E DLE +       
Sbjct: 20  IDHNLNIHLAKKAKENGCSTFVLVSSSLANA--DSRFTYLKMKGEIERDLEAI---GFDH 74

Query: 298 LIILRPGPMCGQHGNSIKVELDVQENLTFSDKILYYPRYLLMYKKQYISEVRKIGLRTKL 357
           LIILRPG + G+  N  K                                    G    +
Sbjct: 75  LIILRPGKLLGERQNDFK------------------------------------GFANSM 98

Query: 358 SELIASSTYRMPGSALLGYSVPVSKVSYVASLMAIERKSKEAGPKMEVINSYQI 411
              + +S YR     +L Y V  ++V  V   +A++    ++ P+++++ S +I
Sbjct: 99  FTALGNSIYRSRLQCVLQYPVFGNEVGQVGVYLALKAIQDKSSPRVQIVESSEI 152

>Ecym_4479 Chr4 complement(973594..974268) [675 bp, 224 aa] {ON}
           similar to Ashbya gossypii ADR005W
          Length = 224

 Score = 40.4 bits (93), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 29/104 (27%), Positives = 53/104 (50%), Gaps = 9/104 (8%)

Query: 208 SLPNLRDISTMVCTLGSTSARVRRTQVPNSF-VDYSLPFSLAQEFTNTTDKRLVIITSFN 266
           S+P+   I+ +   LG+T A      + N + +D+ L  ++A+       K LV+++S  
Sbjct: 59  SIPD--GINVLFSALGTTKAAA--GSIENQYKIDHGLNLAVAKAAKEKGCKTLVLVSSLG 114

Query: 267 NKFLSTTFEYFRIKAKLENDLEEVLPNKPKELIILRPGPMCGQH 310
              + +   YF++K +LE D   VL    +  I+LRPG + G+ 
Sbjct: 115 AS-IESRLPYFKMKGELERD---VLALGFERTILLRPGVLLGER 154

>Suva_5.91 Chr5 (135337..136023) [687 bp, 229 aa] {ON} YER004W
           (REAL)
          Length = 229

 Score = 39.7 bits (91), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 22/75 (29%), Positives = 40/75 (53%), Gaps = 4/75 (5%)

Query: 239 VDYSLPFSLAQEFTNTTDKRLVIITSFNNKFLSTTFEYFRIKAKLENDLEEVLPNKPKEL 298
           +D+ L   LA+   +     +V+++S     + + F Y ++K ++E D   ++    K  
Sbjct: 89  IDHDLNMQLARAAKDRGCDTIVLVSS-AGAHVDSRFGYMKMKGEIERD---IIALNFKHT 144

Query: 299 IILRPGPMCGQHGNS 313
           IILRPGP+ G+  NS
Sbjct: 145 IILRPGPLLGKRTNS 159

>TDEL0H03110 Chr8 (512079..512753) [675 bp, 224 aa] {ON} Anc_7.148
           YER004W
          Length = 224

 Score = 38.5 bits (88), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 34/122 (27%), Positives = 54/122 (44%), Gaps = 8/122 (6%)

Query: 239 VDYSLPFSLAQEFTNTTDKRLVIITSFNNKFLSTTFEYFRIKAKLENDLEEVLPNKPKEL 298
           +D+ L   LA+          V+++S   K   + F Y ++K ++E D   +L       
Sbjct: 86  IDHDLNIELAKVAKEKGCSTFVLVSSGGAK-EDSMFAYMKMKGEIERD---ILALGFDHT 141

Query: 299 IILRPGPMCGQHGNSIKVELDVQENLTFSDKILYYPRY-LLMYKKQYISEVRKIGLRTKL 357
           IILRPGP+ G    S  +  DV   +      +Y  R+ +L     Y  EV K+G+   L
Sbjct: 142 IILRPGPLLGDRLTSKGLITDVFSKI---GSWMYKSRFQVLGGYPVYGDEVGKVGVHLAL 198

Query: 358 SE 359
            E
Sbjct: 199 KE 200

>Skud_5.103 Chr5 (156788..157471) [684 bp, 227 aa] {ON} YER004W
           (REAL)
          Length = 227

 Score = 38.1 bits (87), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 32/128 (25%), Positives = 55/128 (42%), Gaps = 20/128 (15%)

Query: 239 VDYSLPFSLAQEFTNTTDKRLVIITSFNNKFLSTTFEYFRIKAKLENDLEEVLPNKPKEL 298
           +D+ L   LA+       + +V+++S       + F Y ++K ++E D   V+    K  
Sbjct: 89  IDHDLNLQLARAAKEKGCETIVLVSS-AGAHPDSRFGYMKMKGEIERD---VIALNFKHT 144

Query: 299 IILRPGPMCGQH--------GNSIKVELDVQENLTFSDKILYYPRYLLMYKKQYISEVRK 350
           IILRPGP+ G+         G ++   L  +   +     L YP         Y  EV K
Sbjct: 145 IILRPGPLLGERTKSKQSGFGGNLTAALGTRVYRSILQSWLGYP--------VYGDEVGK 196

Query: 351 IGLRTKLS 358
           +G+   L+
Sbjct: 197 VGVHLALN 204

>Kwal_47.18862 s47 complement(1003035..1003709) [675 bp, 224 aa]
           {ON} YER004W - Hypothetical ORF [contig 189] FULL
          Length = 224

 Score = 37.0 bits (84), Expect = 0.052,   Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 38/71 (53%), Gaps = 4/71 (5%)

Query: 238 FVDYSLPFSLAQEFTNTTDKRLVIITSFNNKFLSTTFEYFRIKAKLENDLEEVLPNKPKE 297
           +VD+ L   LAQ+      K  V+++S      S  F YF+ KA++E D   +L    ++
Sbjct: 88  WVDHDLNLQLAQKAKENGCKTFVLVSSAGASEKSPFF-YFKTKAEIERD---ILALNFEK 143

Query: 298 LIILRPGPMCG 308
            IILRPG + G
Sbjct: 144 TIILRPGALFG 154

>KNAG0L00925 Chr12 (169763..170449) [687 bp, 228 aa] {ON}
          Length = 228

 Score = 36.6 bits (83), Expect = 0.078,   Method: Compositional matrix adjust.
 Identities = 35/152 (23%), Positives = 63/152 (41%), Gaps = 22/152 (14%)

Query: 214 DISTMVCTLGSTSARVRRTQVPNSFVDYSLPFSLAQEFTNTTDKRLVIITSFNNKFLSTT 273
           D+  ++  LG+T  R          VD+ L  ++A+   N  + + V + S       + 
Sbjct: 68  DLDVLLSALGTT--RAAAGAEGQYAVDHDLCVAVARAARNDKNCKSVALVSSAGAHTDSR 125

Query: 274 FEYFRIKAKLENDLEEV-LPNKPKELIILRPGPMCGQH-------GNSIKVELDVQENLT 325
           F Y R+K   E D+  +  P+     + LRPG + GQ        GN +  ++      +
Sbjct: 126 FFYTRMKGDTERDIAALAFPHA----VFLRPGILLGQRTTKHTGFGNVLATKVGQWLYRS 181

Query: 326 FSDKILYYPRYLLMYKKQYISEVRKIGLRTKL 357
               +++YP           SEV ++GL+  L
Sbjct: 182 KCQSLIWYP--------VKGSEVAQVGLQLAL 205

>KAFR0E04020 Chr5 complement(796412..797545) [1134 bp, 377 aa] {ON}
           Anc_5.413 YDR354W
          Length = 377

 Score = 37.0 bits (84), Expect = 0.083,   Method: Compositional matrix adjust.
 Identities = 48/192 (25%), Positives = 76/192 (39%), Gaps = 30/192 (15%)

Query: 105 TKKIPSNPDTFCYDAFEEGFIKKTTDENGKD-NFCIPYNQKRFSY-ALYYASGKKEGFEI 162
           TKK+ S P TF  +   +  I      N KD N  +  N K  S+ +   ASG     E 
Sbjct: 10  TKKLISKPPTFTPEDLHDAMIIIMELLNDKDSNATVSVNVKISSFLSCLRASGLDYKAEY 69

Query: 163 IYKFTVTQL----IIPRSENW-----SRLLSYIFSGTQKLEKFDANNKTYVAGKSLPNLR 213
           I +  +  L    ++  S+N        +L  + +G  +   F+ +    +    +PNL+
Sbjct: 70  IAQAALAVLRYSALVKLSQNVIDNTDDLVLDIVGTGGDEQNTFNVSTSAAIVASGIPNLK 129

Query: 214 DI-------------STMVCTLGSTSARVRRTQVPNSFVDYSLPFSLAQEFTNTTD---- 256
            +               ++ TLG  +++V  T VP  + D S  F LA  F +       
Sbjct: 130 VVKHGGKASTSNSGAGDLISTLGCETSKVNATTVPKLWKDNSFLFLLAPYFHDGMGRVAG 189

Query: 257 --KRLVIITSFN 266
             K L I T FN
Sbjct: 190 IRKMLGIPTIFN 201

>NCAS0E02090 Chr5 complement(400057..400734) [678 bp, 225 aa] {ON} 
          Length = 225

 Score = 36.2 bits (82), Expect = 0.087,   Method: Compositional matrix adjust.
 Identities = 33/122 (27%), Positives = 51/122 (41%), Gaps = 5/122 (4%)

Query: 239 VDYSLPFSLAQEFTNTTDKRLVIITSFNNKFLSTTFEYFRIKAKLENDLEEVLPNKPKEL 298
           +D+ L   LA+         +V+++S +   L + F Y R+K ++E D   +L       
Sbjct: 86  IDHDLNVDLAKAAKEKGCSTVVLVSS-SGASLDSRFSYMRMKGEIERD---ILALDFDHT 141

Query: 299 IILRPGPMCGQHGNSIKVELDVQENLTFSDKILYYPRYL-LMYKKQYISEVRKIGLRTKL 357
           IILRPG + G     I  +             LY  R   L+    Y  EV K+G+   L
Sbjct: 142 IILRPGILLGDRDKGINHKGFGNGTAMCIGGWLYRSRVQRLVGYPVYGDEVGKVGVHLAL 201

Query: 358 SE 359
            E
Sbjct: 202 RE 203

>NCAS0E02080 Chr5 complement(399088..399765) [678 bp, 225 aa] {ON} 
          Length = 225

 Score = 35.8 bits (81), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 28/122 (22%), Positives = 54/122 (44%), Gaps = 5/122 (4%)

Query: 239 VDYSLPFSLAQEFTNTTDKRLVIITSFNNKFLSTTFEYFRIKAKLENDLEEVLPNKPKEL 298
           +D+ L   LA+         +V+++S +   L + F Y R+K ++E D   ++       
Sbjct: 86  IDHDLNLELAKAAKAKGCSTIVVVSS-DRASLDSRFSYMRMKGEIERD---IVALDFDHT 141

Query: 299 IILRPGPMCGQHGNSIKVELDVQENLTFSDKILYYPRYLLMYK-KQYISEVRKIGLRTKL 357
           IILRPG + G+       +    + +     + Y  R   + +   Y  EV K+G+   L
Sbjct: 142 IILRPGILLGERDPQTAHKSFTHDAMRMIGGMFYRSRLAWLAEYPIYGDEVGKVGVHLAL 201

Query: 358 SE 359
           ++
Sbjct: 202 NK 203

>KLTH0H00264g Chr8 complement(23047..23715) [669 bp, 222 aa] {ON}
           similar to uniprot|P40008 Saccharomyces cerevisiae
           YER004W FMP52 The authentic non-tagged protein was
           localized to the mitochondria
          Length = 222

 Score = 33.5 bits (75), Expect = 0.61,   Method: Compositional matrix adjust.
 Identities = 22/75 (29%), Positives = 36/75 (48%), Gaps = 4/75 (5%)

Query: 239 VDYSLPFSLAQEFTNTTDKRLVIITSFNNKFLSTTFEYFRIKAKLENDLEEVLPNKPKEL 298
           VD+ +   LA+          V+++S      ++ F Y + K +LE D   +L    +  
Sbjct: 88  VDHDMNLQLARSAKEKGYSTYVVVSSTGADE-NSMFYYMKTKGELERD---ILALGFERT 143

Query: 299 IILRPGPMCGQHGNS 313
           IILRPGP+ G+   S
Sbjct: 144 IILRPGPLLGERTKS 158

>KAFR0G03800 Chr7 complement(784007..785953) [1947 bp, 648 aa] {ON}
           Anc_1.125 YJL209W
          Length = 648

 Score = 34.3 bits (77), Expect = 0.65,   Method: Compositional matrix adjust.
 Identities = 35/116 (30%), Positives = 53/116 (45%), Gaps = 16/116 (13%)

Query: 4   RINAFTDYILLFGSSGLAGKGTL-ENMLDINFYIKNVSDLQD--KLNSLTEIKGDVVLNK 60
           R++A+   I       LAGK  L  N L +   +   +D QD   LNSL  I   + +  
Sbjct: 447 RLSAYATLITKLVEWNLAGKSALSRNHLAVINELLTKADKQDPEHLNSLWNIVASLYIKT 506

Query: 61  HVFCINRRS----ITEEKSFMKSIDYINMKSITWKRGRYYLRSRNENETKKIPSNP 112
            + C N+ S     T+ KS  KS+D   +          +L+S N + TK++ SNP
Sbjct: 507 LLHCTNKSSGKSSNTKIKSSTKSLDLAKL---------IFLKSVNVSNTKEVDSNP 553

>SAKL0D11286g Chr4 (938289..941777) [3489 bp, 1162 aa] {ON} some
            similarities with uniprot|P47107 Saccharomyces cerevisiae
            YJR039W Hypothetical ORF
          Length = 1162

 Score = 33.5 bits (75), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 15/46 (32%), Positives = 30/46 (65%), Gaps = 2/46 (4%)

Query: 50   TEIKGDVVLNKHVFCI--NRRSITEEKSFMKSIDYINMKSITWKRG 93
            +E   ++ L+   +CI  N+R+++  ++F+ ++DY+N  SI  KRG
Sbjct: 1001 SESSQELFLHDGSYCIRNNQRTVSTRQTFVTAVDYLNCISIFCKRG 1046

>SAKL0F04686g Chr6 complement(377594..378265) [672 bp, 223 aa] {ON}
           similar to uniprot|P40008 Saccharomyces cerevisiae
           YER004W FMP52 The authentic non-tagged protein was
           localized to the mitochondria
          Length = 223

 Score = 32.3 bits (72), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 31/129 (24%), Positives = 56/129 (43%), Gaps = 21/129 (16%)

Query: 239 VDYSLPFSLAQEFTNTTDKRLVIITSFNNKFLSTTFEYFRIKAKLENDLEEVLPNKPKEL 298
           +D+ L   LA+          VI++S      ++   Y ++K  +E D   ++    ++ 
Sbjct: 88  IDHDLNIELAKAAKEKGCSTCVIVSS-GGANDNSRIPYLKLKGDIERD---IIALGFEKT 143

Query: 299 IILRPGPMCGQH-------GNSIKVELDVQENLTFSDKILYYPRY-LLMYKKQYISEVRK 350
           IILRPG + G         GNS+ V++           + Y  R+  L+    Y  EV K
Sbjct: 144 IILRPGILLGDRENNHKGFGNSLAVKI---------GNLFYRSRFQWLIGHPVYGDEVAK 194

Query: 351 IGLRTKLSE 359
           +G++  L +
Sbjct: 195 VGVKLALDD 203

>Skud_16.237 Chr16 (431230..433626) [2397 bp, 798 aa] {ON} YPL045W
           (REAL)
          Length = 798

 Score = 31.6 bits (70), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 43/176 (24%), Positives = 77/176 (43%), Gaps = 18/176 (10%)

Query: 233 QVPNSFVDYSLPFSLAQEFTNTTDKRLVIITSFNNKFL--------STTFEYFRIKAKLE 284
           +V NS +  SL  +L+++ TN+   +L+II  FNN           +  ++++R   +  
Sbjct: 528 KVQNSGLTVSLLVALSRKLTNSQLTKLLIIDMFNNPLYLYYMRADKAYLYDFYRQTDQF- 586

Query: 285 NDLEEVLPNKPKELIILRP-----GPMCGQHGNSIKVELDVQENLTFSDKILYYPRYLLM 339
            DL  VL  + KE   L         + G+  NS ++  DV E L   +K+  Y   L  
Sbjct: 587 IDLAHVLLQQGKEQQSLHSFLPQVKDLYGKVQNS-ELANDVMEQLQRQEKLWIYQESL-- 643

Query: 340 YKKQYISEVRKIGLRTKLSELIASSTYRMPGSALLGYSVPVSKVSYVASLMAIERK 395
             K++      + L   LS+LI +   +     +  + V   K+ ++   M +E K
Sbjct: 644 -GKRFGISFTDMTLDQTLSKLIETGQEKQVKEIVKKFKVSEKKLYHLKCKMLVETK 698

>KLLA0D13684g Chr4 complement(1180483..1181157) [675 bp, 224 aa]
           {ON} similar to uniprot|P40008 Saccharomyces cerevisiae
           YER004W FMP52 The authentic non-tagged protein was
           localized to the mitochondria
          Length = 224

 Score = 30.4 bits (67), Expect = 7.8,   Method: Compositional matrix adjust.
 Identities = 47/214 (21%), Positives = 87/214 (40%), Gaps = 54/214 (25%)

Query: 206 GKSLPNLRDISTMVCTLGSTSARVRRTQVPNSF-VDYSLPFSLAQEFTNTTDKRLVIITS 264
           G+ +P   D + ++  L +T  R       N + +D+ +   LA+       K  V+++S
Sbjct: 58  GELIP--EDATVLLTGLATT--RAAAGGFENQYKIDHDMNVELAKVAKAKGYKVCVLVSS 113

Query: 265 FN---NKFLSTTFEYFRIKAKLENDLEEVLPNKPKELIILRPGPMCGQHGNSIKVELDVQ 321
                N FL     Y ++K + E D+  +  +K    IILRPG + G+   + K      
Sbjct: 114 LGANENSFLP----YLKLKGETERDIIALDFDKT---IILRPGGLLGERNGTFK------ 160

Query: 322 ENLTFSDKILYYPRYLLMYKKQYISEVRKIGLRTKLSELIASSTYRMPGSALLGYSVPVS 381
               F DK  Y+ +                         I+S  YR    + LGY +   
Sbjct: 161 ---GFGDK--YFSK-------------------------ISSCFYRSKLQSALGYPIYGD 190

Query: 382 KVSYVASLMAIERKSKEAGPKMEVINSYQIDMIA 415
           +V  V   +A++    E   K+++++S ++  +A
Sbjct: 191 EVGKVGVKLALDSSRTE---KVQIVSSPELLKLA 221

>NCAS0A01140 Chr1 complement(224034..225044) [1011 bp, 336 aa] {ON} 
          Length = 336

 Score = 30.4 bits (67), Expect = 8.1,   Method: Compositional matrix adjust.
 Identities = 28/100 (28%), Positives = 46/100 (46%), Gaps = 14/100 (14%)

Query: 171 LIIPRSENWSRLLSY--IFSGTQKLEKFDANNKTYVAGKSLPNLRDISTMVCTLGSTSAR 228
           LI+  S N S+ L+Y  ++    +LE  + N KT         L DI   + +   T   
Sbjct: 25  LILSNSYNISQYLTYKKVYQLNSRLENSNENVKTVT-------LLDIIFTLISREGTLPN 77

Query: 229 VRRTQVPNSFVDYSLPFSLAQEFTNTTDKRLVIITSFNNK 268
            R+T+ P  +VD  L  SL   F     ++L+++   N+K
Sbjct: 78  SRKTKEPRGYVDAELILSLTNNF-----EKLLVVNWMNHK 112

>Ecym_2197 Chr2 (388255..389769) [1515 bp, 504 aa] {ON} similar to
           Ashbya gossypii AFL098W
          Length = 504

 Score = 30.4 bits (67), Expect = 9.5,   Method: Compositional matrix adjust.
 Identities = 17/67 (25%), Positives = 27/67 (40%), Gaps = 11/67 (16%)

Query: 241 YSLPFSLAQEFTNTTDKRLVIITSFNNKFLSTTFEYFRIKAKLENDLEEVLPNKPKELII 300
           Y +PF L ++FT      +V+ ++F       TF Y R+            PN     + 
Sbjct: 150 YRIPFDLLEQFTMAASDLVVVNSNFTKSIFFKTFRYLRMN-----------PNVVYPCVE 198

Query: 301 LRPGPMC 307
           L   P+C
Sbjct: 199 LASSPIC 205

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.135    0.384 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 46,427,023
Number of extensions: 2177842
Number of successful extensions: 6472
Number of sequences better than 10.0: 47
Number of HSP's gapped: 6644
Number of HSP's successfully gapped: 51
Length of query: 415
Length of database: 53,481,399
Length adjustment: 112
Effective length of query: 303
Effective length of database: 40,638,807
Effective search space: 12313558521
Effective search space used: 12313558521
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 67 (30.4 bits)