Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Smik_6.120singletonON36361739e-19
Smik_11.2singletonON36361739e-19
Smik_4.571singletonON36361739e-19
Smik_4.416singletonON36361739e-19
Smik_6.119singletonON36361739e-19
Smik_6.121singletonON36361609e-17
Smik_7.186singletonON77361584e-16
Smik_6.95singletonON65361341e-12
Smik_1.61singletonON94321213e-10
Smik_3.128singletonON74361194e-10
Smik_5.355singletonON43361164e-10
Smik_10.318singletonON57361132e-09
Smik_4.820singletonON58361123e-09
Smik_11.122singletonON90361143e-09
Smik_7.112singletonON58361113e-09
Smik_4.210singletonON49351095e-09
Smik_12.520singletonON59321081e-08
Smik_4.615singletonON92361092e-08
Smik_10.261singletonON38331052e-08
Smik_4.329singletonON38331043e-08
YDR366CsingletonOFF132361093e-08
YOL106WsingletonOFF117361075e-08
YCR018C-AsingletonOFF84361056e-08
Smik_1.87singletonON54361002e-07
Smik_7.177singletonON61361002e-07
Smik_6.244singletonON4236992e-07
Smik_12.563singletonON6033992e-07
Smik_10.263singletonON4533941e-06
Smik_8.57singletonON3323912e-06
Smik_16.239singletonON5429923e-06
Smik_8.76singletonON2323904e-06
Smik_8.205singletonON2323904e-06
Smik_12.508singletonOFF8136925e-06
Smik_12.380singletonON5933915e-06
Smik_6.464singletonON7423915e-06
Smik_4.527singletonON12036945e-06
Skud_41.4singletonON7332908e-06
Smik_15.529singletonON5430881e-05
Smik_10.273singletonON4836862e-05
Smik_13.365singletonON3532852e-05
Smik_8.147singletonON3323843e-05
Smik_10.207singletonON2121833e-05
Smik_4.693singletonON3423834e-05
Smik_15.49singletonON5623845e-05
Smik_16.270singletonON4430836e-05
Smik_10.199singletonON2923818e-05
Smik_3.63singletonON2323819e-05
Smik_3.92singletonON4437811e-04
Smik_6.285singletonON5727821e-04
Smik_13.227singletonON9436841e-04
Smik_11.26singletonON9433831e-04
Smik_11.219singletonON5532802e-04
Smik_4.181singletonON3933792e-04
Smik_12.178singletonON6136802e-04
Smik_14.285singletonON2626774e-04
Smik_3.62singletonON2323765e-04
Smik_5.361singletonON9436796e-04
Smik_13.112singletonON10033796e-04
Smik_16.413singletonON3132757e-04
YER181CsingletonOFF10736760.002
Smik_7.231singletonON2323720.002
Smik_3.89singletonON5330740.002
Smik_3.56singletonON3023720.002
Smik_27.3singletonON5725730.002
Skud_7.386singletonON8232740.003
Smik_5.214singletonON7436730.003
Smik_7.67singletonON6127730.003
Smik_12.412singletonON2319710.003
Smik_9.162singletonON7430730.003
Smik_16.122singletonON4223710.003
YOL013W-BsingletonOFF9634730.004
Smik_7.261singletonON2323690.006
Smik_5.291singletonON7035700.007
Smik_8.228singletonON5929700.008
Smik_13.71singletonON2521680.008
Skud_4.609singletonON7232700.008
Smik_5.97singletonON9232700.011
Smik_12.329singletonON2319660.014
YPR002C-AsingletonOFF6521680.014
Smik_6.122singletonON6136680.015
Smik_5.114singletonON7836680.017
Skud_16.21singletonON6728670.023
Smik_5.2singletonON8426670.033
Smik_11.174singletonON1717630.040
Skud_11.100singletonON7232650.046
Skud_12.327singletonON3532620.069
Smik_10.234singletonON4937630.070
Smik_9.102singletonON4636610.13
Smik_6.238singletonON2623600.15
Smik_10.266singletonON7432610.21
Smik_5.128singletonON5126580.38
Smik_7.339singletonON2929560.64
YLR334CsingletonOFF12620580.80
SAKL0E04686gsingletonON8836551.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Smik_4.571
         (36 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Smik_6.120 Chr6 complement(198065..198172) [108 bp, 36 aa] {ON} ...    71   9e-19
Smik_11.2 Chr11 (1296..1403) [108 bp, 36 aa] {ON}  YOL106W (REPEAT)    71   9e-19
Smik_4.571 Chr4 complement(1027481..1027588) [108 bp, 36 aa] {ON...    71   9e-19
Smik_4.416 Chr4 (761141..761248) [108 bp, 36 aa] {ON}  YOL106W (...    71   9e-19
Smik_6.119 Chr6 complement(197767..197874) [108 bp, 36 aa] {ON} ...    71   9e-19
Smik_6.121 Chr6 complement(198363..198470) [108 bp, 36 aa] {ON} ...    66   9e-17
Smik_7.186 Chr7 complement(322627..322692,322699..322707,322711....    65   4e-16
Smik_6.95 Chr6 complement(171372..171566) [195 bp, 65 aa] {ON} Y...    56   1e-12
Smik_1.61 Chr1 (121688..121969) [282 bp, 94 aa] {ON} YOL106W (RE...    51   3e-10
Smik_3.128 Chr3 (167733..167738,167742..167852,167856..167894,16...    50   4e-10
Smik_5.355 Chr5 (551204..551314,551318..551335) [129 bp, 43 aa] ...    49   4e-10
Smik_10.318 Chr10 complement(503529..503594,503601..503636,50364...    48   2e-09
Smik_4.820 Chr4 complement(1437887..1437952,1437956..1437994,143...    48   3e-09
Smik_11.122 Chr11 complement(206340..206501,206505..206543,20654...    49   3e-09
Smik_7.112 Chr7 (198899..198967,198971..199009,199013..199078) [...    47   3e-09
Smik_4.210 Chr4 (390131..390244,390248..390280) [147 bp, 49 aa] ...    47   5e-09
Smik_12.520 Chr12 (909372..909548) [177 bp, 59 aa] {ON} YCR018C-...    46   1e-08
Smik_4.615 Chr4 (1101523..1101591,1101595..1101633,1101637..1101...    47   2e-08
Smik_10.261 Chr10 (411825..411938) [114 bp, 38 aa] {ON} YOL106W ...    45   2e-08
Smik_4.329 Chr4 (586928..586936,586940..586999,587003..587047) [...    45   3e-08
YDR366C Chr4 complement(1212438..1212836) [399 bp, 132 aa] {OFF}...    47   3e-08
YOL106W Chr15 (113226..113579) [354 bp, 117 aa] {OFF} Dubious op...    46   5e-08
YCR018C-A Chr3 complement(151608..151862) [255 bp, 84 aa] {OFF} ...    45   6e-08
Smik_1.87 Chr1 complement(158862..158903,158907..158945,158949.....    43   2e-07
Smik_7.177 Chr7 complement(313993..314118,314122..314178) [183 b...    43   2e-07
Smik_6.244 Chr6 complement(397202..397249,397253..397330) [126 b...    43   2e-07
Smik_12.563 Chr12 complement(990482..990661) [180 bp, 60 aa] {ON...    43   2e-07
Smik_10.263 Chr10 complement(412543..412677) [135 bp, 45 aa] {ON...    41   1e-06
Smik_8.57 Chr8 (95346..95372,95379..95450) [99 bp, 33 aa] {ON}  ...    40   2e-06
Smik_16.239 Chr16 (437266..437292,437296..437406,437410..437433)...    40   3e-06
Smik_8.76 Chr8 (113465..113533) [69 bp, 23 aa] {ON}  YOL106W (RE...    39   4e-06
Smik_8.205 Chr8 complement(335066..335134) [69 bp, 23 aa] {ON}  ...    39   4e-06
Smik_12.508 Chr12 (895841..895867,895871..895885,895889..895972,...    40   5e-06
Smik_12.380 Chr12 complement(669961..670068,670072..670140) [177...    40   5e-06
Smik_6.464 Chr6 (767126..767194,767198..767203,767207..767353) [...    40   5e-06
Smik_4.527 Chr4 complement(950709..951071) [363 bp, 120 aa] {ON}...    41   5e-06
Skud_41.4 Chr41 (1247..1414,1418..1468) [219 bp, 73 aa] {ON} YCR...    39   8e-06
Smik_15.529 Chr15 complement(925250..925360,925364..925414) [162...    39   1e-05
Smik_10.273 Chr10 complement(420927..421070) [144 bp, 48 aa] {ON...    38   2e-05
Smik_13.365 Chr13 (570650..570658,570662..570721,570725..570760)...    37   2e-05
Smik_8.147 Chr8 complement(214508..214585,214589..214609) [99 bp...    37   3e-05
Smik_10.207 Chr10 (348819..348881) [63 bp, 21 aa] {ON}  YOL106W ...    37   3e-05
Smik_4.693 Chr4 complement(1226937..1227038) [102 bp, 34 aa] {ON...    37   4e-05
Smik_15.49 Chr15 (82181..82348) [168 bp, 56 aa] {ON} YOL106W (RE...    37   5e-05
Smik_16.270 Chr16 complement(498736..498867) [132 bp, 44 aa] {ON...    37   6e-05
Smik_10.199 Chr10 (346712..346798) [87 bp, 29 aa] {ON}  YDR366C ...    36   8e-05
Smik_3.63 Chr3 (88885..88953) [69 bp, 23 aa] {ON}  YOL106W (REPEAT)    36   9e-05
Smik_3.92 Chr3 complement(126975..127106) [132 bp, 44 aa] {ON}  ...    36   1e-04
Smik_6.285 Chr6 complement(453139..453228,453232..453270,453274....    36   1e-04
Smik_13.227 Chr13 complement(361490..361576,361580..361657,36166...    37   1e-04
Smik_11.26 Chr11 (58522..58596,58600..58638,58642..58809) [282 b...    37   1e-04
Smik_11.219 Chr11 complement(366097..366162,366166..366204,36620...    35   2e-04
Smik_4.181 Chr4 complement(336248..336355,336359..336367) [117 b...    35   2e-04
Smik_12.178 Chr12 complement(355239..355298,355302..355340,35534...    35   2e-04
Smik_14.285 Chr14 (520719..520796) [78 bp, 26 aa] {ON}  YOL106W ...    34   4e-04
Smik_3.62 Chr3 complement(88736..88804) [69 bp, 23 aa] {ON}  YOL...    34   5e-04
Smik_5.361 Chr5 complement(559269..559463,559467..559553) [282 b...    35   6e-04
Smik_13.112 Chr13 complement(190877..191179) [303 bp, 100 aa] {O...    35   6e-04
Smik_16.413 Chr16 (720870..720926,720930..720965) [93 bp, 31 aa]...    33   7e-04
YER181C Chr5 complement(551473..551796) [324 bp, 107 aa] {OFF} D...    34   0.002
Smik_7.231 Chr7 complement(396783..396851) [69 bp, 23 aa] {ON}  ...    32   0.002
Smik_3.89 Chr3 (123152..123211,123215..123244,123248..123316) [1...    33   0.002
Smik_3.56 Chr3 (83840..83929) [90 bp, 30 aa] {ON}  YDR366C (REPEAT)    32   0.002
Smik_27.3 Chr27 complement(1694..1864) [171 bp, 57 aa] {ON} YDR3...    33   0.002
Skud_7.386 Chr7 (645551..645589,645593..645757,645761..645802) [...    33   0.003
Smik_5.214 Chr5 complement(320782..320838,320842..321006) [222 b...    33   0.003
Smik_7.67 Chr7 complement(109941..110054,110058..110126) [183 bp...    33   0.003
Smik_12.412 Chr12 (722297..722305,722309..722368) [69 bp, 23 aa]...    32   0.003
Smik_9.162 Chr9 (275247..275366,275376..275477) [222 bp, 74 aa] ...    33   0.003
Smik_16.122 Chr16 complement(220698..220823) [126 bp, 42 aa] {ON...    32   0.003
YOL013W-B Chr15 (300690..300980) [291 bp, 96 aa] {OFF} Dubious o...    33   0.004
Smik_7.261 Chr7 complement(432507..432575) [69 bp, 23 aa] {ON}  ...    31   0.006
Smik_5.291 Chr5 (448351..448482,448489..448566) [210 bp, 70 aa] ...    32   0.007
Smik_8.228 Chr8 (366280..366369,366373..366459) [177 bp, 59 aa] ...    32   0.008
Smik_13.71 Chr13 (129995..130069) [75 bp, 25 aa] {ON}  YCR018C-A...    31   0.008
Skud_4.609 Chr4 complement(1087174..1087224,1087228..1087335,108...    32   0.008
Smik_5.97 Chr5 (137480..137698,137702..137758) [276 bp, 92 aa] {...    32   0.011
Smik_12.329 Chr12 (595891..595959) [69 bp, 23 aa] {ON}  YOL106W ...    30   0.014
YPR002C-A Chr16 complement(560569..560766) [198 bp, 65 aa] {OFF}...    31   0.014
Smik_6.122 Chr6 (199157..199228,199232..199270,199274..199345) [...    31   0.015
Smik_5.114 Chr5 complement(156357..156467,156471..156518,156522....    31   0.017
Skud_16.21 Chr16 (35466..35510,35514..35603,35607..35621,35625.....    30   0.023
Smik_5.2 Chr5 (796..1047) [252 bp, 84 aa] {ON} YER181C (REPEAT)        30   0.033
Smik_11.174 Chr11 (294261..294311) [51 bp, 17 aa] {ON}  YDR366C ...    29   0.040
Skud_11.100 Chr11 complement(189059..189109,189113..189220,18922...    30   0.046
Skud_12.327 Chr12 complement(575005..575052,575056..575112) [105...    28   0.069
Smik_10.234 Chr10 (374037..374183) [147 bp, 49 aa] {ON} YOL106W ...    29   0.070
Smik_9.102 Chr9 (184132..184173,184177..184260,184264..184275) [...    28   0.13 
Smik_6.238 Chr6 (392222..392299) [78 bp, 26 aa] {ON}  YDR366C (R...    28   0.15 
Smik_10.266 Chr10 (417416..417637) [222 bp, 74 aa] {ON} YCR018C-...    28   0.21 
Smik_5.128 Chr5 (180826..180864,180868..180906,180910..180984) [...    27   0.38 
Smik_7.339 Chr7 (567980..568066) [87 bp, 29 aa] {ON}  YDR366C (R...    26   0.64 
YLR334C Chr12 complement(796698..797078) [381 bp, 126 aa] {OFF} ...    27   0.80 
SAKL0E04686g Chr5 (379624..379890) [267 bp, 88 aa] {ON} some sim...    26   1.6  

>Smik_6.120 Chr6 complement(198065..198172) [108 bp, 36 aa] {ON}
          YOL106W (REPEAT)
          Length = 36

 Score = 71.2 bits (173), Expect = 9e-19,   Method: Compositional matrix adjust.
 Identities = 36/36 (100%), Positives = 36/36 (100%)

Query: 1  ERLANFEMIVGIPWFIKAILFGIYNILEVLFGDIGI 36
          ERLANFEMIVGIPWFIKAILFGIYNILEVLFGDIGI
Sbjct: 1  ERLANFEMIVGIPWFIKAILFGIYNILEVLFGDIGI 36

>Smik_11.2 Chr11 (1296..1403) [108 bp, 36 aa] {ON}  YOL106W
          (REPEAT)
          Length = 36

 Score = 71.2 bits (173), Expect = 9e-19,   Method: Compositional matrix adjust.
 Identities = 36/36 (100%), Positives = 36/36 (100%)

Query: 1  ERLANFEMIVGIPWFIKAILFGIYNILEVLFGDIGI 36
          ERLANFEMIVGIPWFIKAILFGIYNILEVLFGDIGI
Sbjct: 1  ERLANFEMIVGIPWFIKAILFGIYNILEVLFGDIGI 36

>Smik_4.571 Chr4 complement(1027481..1027588) [108 bp, 36 aa] {ON}
           YOL106W (REPEAT)
          Length = 36

 Score = 71.2 bits (173), Expect = 9e-19,   Method: Compositional matrix adjust.
 Identities = 36/36 (100%), Positives = 36/36 (100%)

Query: 1  ERLANFEMIVGIPWFIKAILFGIYNILEVLFGDIGI 36
          ERLANFEMIVGIPWFIKAILFGIYNILEVLFGDIGI
Sbjct: 1  ERLANFEMIVGIPWFIKAILFGIYNILEVLFGDIGI 36

>Smik_4.416 Chr4 (761141..761248) [108 bp, 36 aa] {ON}  YOL106W
          (REPEAT)
          Length = 36

 Score = 71.2 bits (173), Expect = 9e-19,   Method: Compositional matrix adjust.
 Identities = 36/36 (100%), Positives = 36/36 (100%)

Query: 1  ERLANFEMIVGIPWFIKAILFGIYNILEVLFGDIGI 36
          ERLANFEMIVGIPWFIKAILFGIYNILEVLFGDIGI
Sbjct: 1  ERLANFEMIVGIPWFIKAILFGIYNILEVLFGDIGI 36

>Smik_6.119 Chr6 complement(197767..197874) [108 bp, 36 aa] {ON}
          YOL106W (REPEAT)
          Length = 36

 Score = 71.2 bits (173), Expect = 9e-19,   Method: Compositional matrix adjust.
 Identities = 36/36 (100%), Positives = 36/36 (100%)

Query: 1  ERLANFEMIVGIPWFIKAILFGIYNILEVLFGDIGI 36
          ERLANFEMIVGIPWFIKAILFGIYNILEVLFGDIGI
Sbjct: 1  ERLANFEMIVGIPWFIKAILFGIYNILEVLFGDIGI 36

>Smik_6.121 Chr6 complement(198363..198470) [108 bp, 36 aa] {ON}
          YOL106W (REPEAT)
          Length = 36

 Score = 66.2 bits (160), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 34/36 (94%), Positives = 34/36 (94%)

Query: 1  ERLANFEMIVGIPWFIKAILFGIYNILEVLFGDIGI 36
          ERLANFEMIVGIP  IKAILFGIYNILEVLFGDIGI
Sbjct: 1  ERLANFEMIVGIPLLIKAILFGIYNILEVLFGDIGI 36

>Smik_7.186 Chr7
          complement(322627..322692,322699..322707,
          322711..322743,322747..322869) [231 bp, 77 aa] {ON}
          YOL106W (REPEAT)
          Length = 77

 Score = 65.5 bits (158), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 33/36 (91%), Positives = 33/36 (91%)

Query: 1  ERLANFEMIVGIPWFIKAILFGIYNILEVLFGDIGI 36
          E   NFEMIVGIPWFIKAILFGIYNILEVLFGDIGI
Sbjct: 2  EIWVNFEMIVGIPWFIKAILFGIYNILEVLFGDIGI 37

>Smik_6.95 Chr6 complement(171372..171566) [195 bp, 65 aa] {ON}
          YOL106W (REPEAT)
          Length = 65

 Score = 56.2 bits (134), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 29/36 (80%), Positives = 30/36 (83%)

Query: 1  ERLANFEMIVGIPWFIKAILFGIYNILEVLFGDIGI 36
          E+  NFEMIVGIP  IKAILFGIYNILEVL  DIGI
Sbjct: 6  EKWVNFEMIVGIPLLIKAILFGIYNILEVLLEDIGI 41

>Smik_1.61 Chr1 (121688..121969) [282 bp, 94 aa] {ON} YOL106W
          (REPEAT)
          Length = 94

 Score = 51.2 bits (121), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 25/32 (78%), Positives = 28/32 (87%)

Query: 5  NFEMIVGIPWFIKAILFGIYNILEVLFGDIGI 36
          NFEM+VGIP  IKAILFGI NILEVL G++GI
Sbjct: 5  NFEMLVGIPLLIKAILFGIENILEVLLGNLGI 36

>Smik_3.128 Chr3
          (167733..167738,167742..167852,167856..167894,
          167898..167963) [222 bp, 74 aa] {ON} YDR366C (REPEAT)
          Length = 74

 Score = 50.4 bits (119), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 29/36 (80%), Positives = 29/36 (80%), Gaps = 1/36 (2%)

Query: 1  ERLANFEMIVGIPWFIKAILFGIYNILEVLFGDIGI 36
          E L NFEMIVGIP  IKAILFGI NILEVL  DIGI
Sbjct: 17 EILVNFEMIVGIPLLIKAILFGI-NILEVLLEDIGI 51

>Smik_5.355 Chr5 (551204..551314,551318..551335) [129 bp, 43 aa]
          {ON} YOL106W (REPEAT)
          Length = 43

 Score = 49.3 bits (116), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 26/36 (72%), Positives = 28/36 (77%)

Query: 1  ERLANFEMIVGIPWFIKAILFGIYNILEVLFGDIGI 36
          E+  NFEMIVGIP  I AILFGI NI+EVL  DIGI
Sbjct: 1  EKWVNFEMIVGIPLLISAILFGIENIIEVLHEDIGI 36

>Smik_10.318 Chr10
          complement(503529..503594,503601..503636,
          503640..503708) [171 bp, 57 aa] {ON} YOL106W (REPEAT)
          Length = 57

 Score = 48.1 bits (113), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 28/36 (77%), Positives = 29/36 (80%), Gaps = 1/36 (2%)

Query: 1  ERLANFEMIVGIPWFIKAILFGIYNILEVLFGDIGI 36
          ER  NFE+IVGIP  IKAILFGI NILEVL  DIGI
Sbjct: 1  ERWVNFEIIVGIPLLIKAILFGI-NILEVLLEDIGI 35

>Smik_4.820 Chr4
          complement(1437887..1437952,1437956..1437994,
          1437998..1438066) [174 bp, 58 aa] {ON} YOL106W (REPEAT)
          Length = 58

 Score = 47.8 bits (112), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 27/36 (75%), Positives = 29/36 (80%), Gaps = 1/36 (2%)

Query: 1  ERLANFEMIVGIPWFIKAILFGIYNILEVLFGDIGI 36
          E+  NFEMIVGIP  IKAILFGI NIL+VL  DIGI
Sbjct: 1  EKWVNFEMIVGIPLLIKAILFGI-NILKVLLEDIGI 35

>Smik_11.122 Chr11
          complement(206340..206501,206505..206543,
          206547..206615) [270 bp, 90 aa] {ON} YOL106W (REPEAT)
          Length = 90

 Score = 48.5 bits (114), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 27/36 (75%), Positives = 28/36 (77%), Gaps = 1/36 (2%)

Query: 1  ERLANFEMIVGIPWFIKAILFGIYNILEVLFGDIGI 36
          E+  NFEM VGIP  IKAILFGI NILEVL  DIGI
Sbjct: 1  EKWMNFEMTVGIPLLIKAILFGI-NILEVLLEDIGI 35

>Smik_7.112 Chr7 (198899..198967,198971..199009,199013..199078)
          [174 bp, 58 aa] {ON} YOL106W (REPEAT)
          Length = 58

 Score = 47.4 bits (111), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 25/36 (69%), Positives = 29/36 (80%), Gaps = 1/36 (2%)

Query: 1  ERLANFEMIVGIPWFIKAILFGIYNILEVLFGDIGI 36
          E+  NFEMIVGIP  +KA+LFGI N+LEVL  DIGI
Sbjct: 1  EKWVNFEMIVGIPLLVKAVLFGI-NLLEVLLEDIGI 35

>Smik_4.210 Chr4 (390131..390244,390248..390280) [147 bp, 49 aa]
          {ON} YDR366C (REPEAT)
          Length = 49

 Score = 46.6 bits (109), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 25/35 (71%), Positives = 27/35 (77%), Gaps = 1/35 (2%)

Query: 1  ERLANFEMIVGIPWFIKAILFGIYNILEVLFGDIG 35
          E + NFE+IVGIP  IKAIL GI NILEVL  DIG
Sbjct: 16 ENMVNFEIIVGIPLLIKAILLGI-NILEVLLKDIG 49

>Smik_12.520 Chr12 (909372..909548) [177 bp, 59 aa] {ON} YCR018C-A
          (REPEAT)
          Length = 59

 Score = 46.2 bits (108), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 24/32 (75%), Positives = 24/32 (75%)

Query: 5  NFEMIVGIPWFIKAILFGIYNILEVLFGDIGI 36
          NFEMIVGIP  IKAIL GI NILEVL  D  I
Sbjct: 1  NFEMIVGIPLLIKAILLGIQNILEVLLEDFKI 32

>Smik_4.615 Chr4
          (1101523..1101591,1101595..1101633,1101637..1101804)
          [276 bp, 92 aa] {ON}  YOL106W (REPEAT)
          Length = 92

 Score = 46.6 bits (109), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 26/36 (72%), Positives = 29/36 (80%), Gaps = 1/36 (2%)

Query: 1  ERLANFEMIVGIPWFIKAILFGIYNILEVLFGDIGI 36
          ++  NFE+IVGIP  IKAILFGI NILEVL  DIGI
Sbjct: 1  KKWVNFEIIVGIPLLIKAILFGI-NILEVLLEDIGI 35

>Smik_10.261 Chr10 (411825..411938) [114 bp, 38 aa] {ON} YOL106W
          (REPEAT)
          Length = 38

 Score = 45.1 bits (105), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 24/33 (72%), Positives = 25/33 (75%)

Query: 4  ANFEMIVGIPWFIKAILFGIYNILEVLFGDIGI 36
           NFE+IVGIP  IKAILFGIYNIL VL  D  I
Sbjct: 4  VNFEIIVGIPLLIKAILFGIYNILGVLLQDTKI 36

>Smik_4.329 Chr4 (586928..586936,586940..586999,587003..587047)
          [114 bp, 38 aa] {ON} YOL106W (REPEAT)
          Length = 38

 Score = 44.7 bits (104), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 25/33 (75%), Positives = 26/33 (78%), Gaps = 1/33 (3%)

Query: 4  ANFEMIVGIPWFIKAILFGIYNILEVLFGDIGI 36
           +FEMIVGIP  IK ILFGI NILEVL  DIGI
Sbjct: 4  VDFEMIVGIPLLIKTILFGI-NILEVLLEDIGI 35

>YDR366C Chr4 complement(1212438..1212836) [399 bp, 132 aa] {OFF}
           Putative protein of unknown function
          Length = 132

 Score = 46.6 bits (109), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 23/36 (63%), Positives = 27/36 (75%)

Query: 1   ERLANFEMIVGIPWFIKAILFGIYNILEVLFGDIGI 36
           E+  N E+IVGIP  IKAI+ GI NILEVL  D+GI
Sbjct: 73  EKYVNVEIIVGIPLLIKAIILGIQNILEVLLKDLGI 108

>YOL106W Chr15 (113226..113579) [354 bp, 117 aa] {OFF} Dubious
          open reading frame unlikely to encode a functional
          protein, based on available experimental and
          comparative sequence data
          Length = 117

 Score = 45.8 bits (107), Expect = 5e-08,   Method: Composition-based stats.
 Identities = 24/36 (66%), Positives = 28/36 (77%)

Query: 1  ERLANFEMIVGIPWFIKAILFGIYNILEVLFGDIGI 36
          E+  NFE+IVGIP  IKAI+ GI N+LEVL  DIGI
Sbjct: 24 EKWVNFEIIVGIPSLIKAIILGIQNVLEVLLDDIGI 59

>YCR018C-A Chr3 complement(151608..151862) [255 bp, 84 aa] {OFF}
          Putative protein of unknown function; encoded opposite
          a Ty1 LTR
          Length = 84

 Score = 45.1 bits (105), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 21/36 (58%), Positives = 26/36 (72%)

Query: 1  ERLANFEMIVGIPWFIKAILFGIYNILEVLFGDIGI 36
          E   NF+++VGIP  IKA++  I NILEVL  DIGI
Sbjct: 5  ENHVNFQIVVGIPLLIKAVILCIQNILEVLLEDIGI 40

>Smik_1.87 Chr1
          complement(158862..158903,158907..158945,
          158949..159029) [162 bp, 54 aa] {ON} YDR366C (REPEAT)
          Length = 54

 Score = 43.1 bits (100), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 24/36 (66%), Positives = 26/36 (72%), Gaps = 1/36 (2%)

Query: 1  ERLANFEMIVGIPWFIKAILFGIYNILEVLFGDIGI 36
          E L NFE+IVGIP  IK IL G  NILEVL  DIG+
Sbjct: 5  ENLVNFEIIVGIPLLIKVILLG-TNILEVLLEDIGM 39

>Smik_7.177 Chr7 complement(313993..314118,314122..314178) [183
          bp, 61 aa] {ON} YDR366C (REPEAT)
          Length = 61

 Score = 43.1 bits (100), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 25/36 (69%), Positives = 26/36 (72%), Gaps = 1/36 (2%)

Query: 1  ERLANFEMIVGIPWFIKAILFGIYNILEVLFGDIGI 36
          ERL N EMIVGIP  IKAI F I NI EVLF +I I
Sbjct: 1  ERLVNIEMIVGIPLLIKAI-FCIQNIQEVLFENIEI 35

>Smik_6.244 Chr6 complement(397202..397249,397253..397330) [126
          bp, 42 aa] {ON}  YOL106W (REPEAT)
          Length = 42

 Score = 42.7 bits (99), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 25/36 (69%), Positives = 27/36 (75%), Gaps = 1/36 (2%)

Query: 1  ERLANFEMIVGIPWFIKAILFGIYNILEVLFGDIGI 36
          ER  +FE IVGIP FIKAILFGI + LEVL   IGI
Sbjct: 4  ERCVSFETIVGIPLFIKAILFGI-STLEVLLRYIGI 38

>Smik_12.563 Chr12 complement(990482..990661) [180 bp, 60 aa] {ON}
          YCR018C-A (REPEAT)
          Length = 60

 Score = 42.7 bits (99), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 22/33 (66%), Positives = 23/33 (69%)

Query: 4  ANFEMIVGIPWFIKAILFGIYNILEVLFGDIGI 36
           NFE+IVGIP  IKAIL  I NILEVL  D  I
Sbjct: 1  VNFEIIVGIPLLIKAILLSIQNILEVLLEDFKI 33

>Smik_10.263 Chr10 complement(412543..412677) [135 bp, 45 aa] {ON}
          YCR018C-A (REPEAT)
          Length = 45

 Score = 40.8 bits (94), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 21/33 (63%), Positives = 24/33 (72%)

Query: 4  ANFEMIVGIPWFIKAILFGIYNILEVLFGDIGI 36
           NFE+IV IP +IK IL  I NIL+VL  DIGI
Sbjct: 1  VNFEVIVNIPLWIKVILLCIQNILDVLLEDIGI 33

>Smik_8.57 Chr8 (95346..95372,95379..95450) [99 bp, 33 aa] {ON}
          YOL106W (REPEAT)
          Length = 33

 Score = 39.7 bits (91), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 18/23 (78%), Positives = 20/23 (86%)

Query: 1  ERLANFEMIVGIPWFIKAILFGI 23
          ERLANFEMIVGIP  IKAI+ G+
Sbjct: 11 ERLANFEMIVGIPLLIKAIILGM 33

>Smik_16.239 Chr16 (437266..437292,437296..437406,437410..437433)
          [162 bp, 54 aa] {ON}  YDR366C (REPEAT)
          Length = 54

 Score = 40.0 bits (92), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 21/29 (72%), Positives = 23/29 (79%), Gaps = 1/29 (3%)

Query: 1  ERLANFEMIVGIPWFIKAILFGIYNILEV 29
          E   NFE+IVGIPW IKAIL GI NIL+V
Sbjct: 24 ESFVNFEIIVGIPWLIKAILLGI-NILDV 51

>Smik_8.76 Chr8 (113465..113533) [69 bp, 23 aa] {ON}  YOL106W
          (REPEAT)
          Length = 23

 Score = 39.3 bits (90), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 18/23 (78%), Positives = 20/23 (86%)

Query: 1  ERLANFEMIVGIPWFIKAILFGI 23
          ERLANFEMIVGIP  IKAI+ G+
Sbjct: 1  ERLANFEMIVGIPLLIKAIILGM 23

>Smik_8.205 Chr8 complement(335066..335134) [69 bp, 23 aa] {ON}
          YOL106W (REPEAT)
          Length = 23

 Score = 39.3 bits (90), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 18/23 (78%), Positives = 20/23 (86%)

Query: 1  ERLANFEMIVGIPWFIKAILFGI 23
          ERLANFEMIVGIP  IKAI+ G+
Sbjct: 1  ERLANFEMIVGIPLLIKAIILGM 23

>Smik_12.508 Chr12
          (895841..895867,895871..895885,895889..895972,
          895976..896011,896018..896098) [243 bp, 81 aa] {OFF}
          YCR018C-A (PSEUDO)
          Length = 81

 Score = 40.0 bits (92), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 22/36 (61%), Positives = 26/36 (72%), Gaps = 1/36 (2%)

Query: 1  ERLANFEMIVGIPWFIKAILFGIYNILEVLFGDIGI 36
          E + NFE+IVGI   IK   FGI NIL++LF DIGI
Sbjct: 20 ENMVNFEIIVGISLLIKKYHFGI-NILDILFEDIGI 54

>Smik_12.380 Chr12 complement(669961..670068,670072..670140) [177
          bp, 59 aa] {ON} YOL106W (REPEAT)
          Length = 59

 Score = 39.7 bits (91), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 24/33 (72%), Positives = 25/33 (75%), Gaps = 1/33 (3%)

Query: 4  ANFEMIVGIPWFIKAILFGIYNILEVLFGDIGI 36
           NFE+IVG    IKAILFGI NILEVL  DIGI
Sbjct: 4  VNFEIIVGNSLLIKAILFGI-NILEVLLEDIGI 35

>Smik_6.464 Chr6 (767126..767194,767198..767203,767207..767353)
          [222 bp, 74 aa] {ON} YOL106W (REPEAT)
          Length = 74

 Score = 39.7 bits (91), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 18/23 (78%), Positives = 20/23 (86%)

Query: 1  ERLANFEMIVGIPWFIKAILFGI 23
          ERLANFEMIVGIP  IKAI+ G+
Sbjct: 1  ERLANFEMIVGIPLLIKAIILGM 23

>Smik_4.527 Chr4 complement(950709..951071) [363 bp, 120 aa] {ON}
          YER181C (REPEAT)
          Length = 120

 Score = 40.8 bits (94), Expect = 5e-06,   Method: Composition-based stats.
 Identities = 20/36 (55%), Positives = 24/36 (66%)

Query: 1  ERLANFEMIVGIPWFIKAILFGIYNILEVLFGDIGI 36
          E+  NFE+IV  P+ IK IL   +NIL VL  DIGI
Sbjct: 23 EKQVNFEIIVEAPFLIKVILLCTHNILRVLLKDIGI 58

>Skud_41.4 Chr41 (1247..1414,1418..1468) [219 bp, 73 aa] {ON}
          YCR018C-A (REPEAT)
          Length = 73

 Score = 39.3 bits (90), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 18/32 (56%), Positives = 24/32 (75%)

Query: 5  NFEMIVGIPWFIKAILFGIYNILEVLFGDIGI 36
          N   IVGIP+F++ I+  I+NILEVL  D+GI
Sbjct: 1  NLVTIVGIPFFVRLIILCIWNILEVLLMDVGI 32

>Smik_15.529 Chr15 complement(925250..925360,925364..925414) [162
          bp, 54 aa] {ON}  YDR366C (REPEAT)
          Length = 54

 Score = 38.5 bits (88), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 22/30 (73%), Positives = 24/30 (80%), Gaps = 1/30 (3%)

Query: 7  EMIVGIPWFIKAILFGIYNILEVLFGDIGI 36
          E+IVGIP  IKAIL GI NILEVL  D+GI
Sbjct: 1  EIIVGIPLLIKAILSGI-NILEVLLEDVGI 29

>Smik_10.273 Chr10 complement(420927..421070) [144 bp, 48 aa] {ON}
          YCR018C-A (REPEAT)
          Length = 48

 Score = 37.7 bits (86), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 20/36 (55%), Positives = 23/36 (63%)

Query: 1  ERLANFEMIVGIPWFIKAILFGIYNILEVLFGDIGI 36
          ER  NFE   G+  +IK IL  I NIL+VL  DIGI
Sbjct: 1  ERSGNFEKADGVTLWIKVILLCIQNILDVLLEDIGI 36

>Smik_13.365 Chr13 (570650..570658,570662..570721,570725..570760)
          [105 bp, 35 aa] {ON}  YDR366C (REPEAT)
          Length = 35

 Score = 37.4 bits (85), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 23/32 (71%), Positives = 23/32 (71%), Gaps = 1/32 (3%)

Query: 5  NFEMIVGIPWFIKAILFGIYNILEVLFGDIGI 36
          NFE IVGIP  IKAIL GI NILEVL   I I
Sbjct: 5  NFETIVGIPLLIKAILLGI-NILEVLLRYIEI 35

>Smik_8.147 Chr8 complement(214508..214585,214589..214609) [99 bp,
          33 aa] {ON}  YOL106W (REPEAT)
          Length = 33

 Score = 37.0 bits (84), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 16/23 (69%), Positives = 19/23 (82%)

Query: 1  ERLANFEMIVGIPWFIKAILFGI 23
          ERL NFEMIVG+P  IKAI+ G+
Sbjct: 11 ERLVNFEMIVGVPLLIKAIILGM 33

>Smik_10.207 Chr10 (348819..348881) [63 bp, 21 aa] {ON}  YOL106W
          (REPEAT)
          Length = 21

 Score = 36.6 bits (83), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 17/21 (80%), Positives = 18/21 (85%)

Query: 1  ERLANFEMIVGIPWFIKAILF 21
          ERLANFEMIVGIP  IKAI+ 
Sbjct: 1  ERLANFEMIVGIPLLIKAIIL 21

>Smik_4.693 Chr4 complement(1226937..1227038) [102 bp, 34 aa] {ON}
           YDR366C (REPEAT)
          Length = 34

 Score = 36.6 bits (83), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 17/23 (73%), Positives = 19/23 (82%)

Query: 1  ERLANFEMIVGIPWFIKAILFGI 23
          E + NFE+IVGIP  IKAILFGI
Sbjct: 12 ENMVNFEIIVGIPLLIKAILFGI 34

>Smik_15.49 Chr15 (82181..82348) [168 bp, 56 aa] {ON} YOL106W
          (REPEAT)
          Length = 56

 Score = 37.0 bits (84), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 16/23 (69%), Positives = 19/23 (82%)

Query: 1  ERLANFEMIVGIPWFIKAILFGI 23
          E+L NFEMIVGIP  IKAI+ G+
Sbjct: 34 EKLVNFEMIVGIPLLIKAIILGM 56

>Smik_16.270 Chr16 complement(498736..498867) [132 bp, 44 aa] {ON}
          YDR366C (REPEAT)
          Length = 44

 Score = 36.6 bits (83), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 17/30 (56%), Positives = 21/30 (70%)

Query: 7  EMIVGIPWFIKAILFGIYNILEVLFGDIGI 36
          ++IVGIP  +K IL  I NILE LF D+ I
Sbjct: 1  KIIVGIPTLMKPILLSIQNILEALFHDVKI 30

>Smik_10.199 Chr10 (346712..346798) [87 bp, 29 aa] {ON}  YDR366C
          (REPEAT)
          Length = 29

 Score = 35.8 bits (81), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 16/23 (69%), Positives = 18/23 (78%)

Query: 1  ERLANFEMIVGIPWFIKAILFGI 23
          ERL NFEMIVGIP  IK I+ G+
Sbjct: 7  ERLVNFEMIVGIPLLIKVIILGM 29

>Smik_3.63 Chr3 (88885..88953) [69 bp, 23 aa] {ON}  YOL106W
          (REPEAT)
          Length = 23

 Score = 35.8 bits (81), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 16/23 (69%), Positives = 18/23 (78%)

Query: 1  ERLANFEMIVGIPWFIKAILFGI 23
          ERL NFEMIVGIP  IK I+ G+
Sbjct: 1  ERLVNFEMIVGIPLLIKVIILGM 23

>Smik_3.92 Chr3 complement(126975..127106) [132 bp, 44 aa] {ON}
          YOL106W (REPEAT)
          Length = 44

 Score = 35.8 bits (81), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 21/37 (56%), Positives = 26/37 (70%), Gaps = 1/37 (2%)

Query: 1  ERLANFEMIVGIPWFIKAILFGIYNILEV-LFGDIGI 36
          E   NFE+IVGIP  IKA+L  I++I EV L  D+GI
Sbjct: 1  ENWVNFEIIVGIPLLIKAVLLFIHSIPEVLLLEDVGI 37

>Smik_6.285 Chr6
          complement(453139..453228,453232..453270,
          453274..453315) [171 bp, 57 aa] {ON} YDR366C (REPEAT)
          Length = 57

 Score = 36.2 bits (82), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 21/27 (77%), Positives = 21/27 (77%), Gaps = 1/27 (3%)

Query: 10 VGIPWFIKAILFGIYNILEVLFGDIGI 36
          VGIP  IKAILFGI  ILEVL  DIGI
Sbjct: 1  VGIPLLIKAILFGI-KILEVLLEDIGI 26

>Smik_13.227 Chr13
          complement(361490..361576,361580..361657,
          361661..361777) [282 bp, 94 aa] {ON} YDR366C (REPEAT)
          Length = 94

 Score = 37.0 bits (84), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 21/36 (58%), Positives = 22/36 (61%)

Query: 1  ERLANFEMIVGIPWFIKAILFGIYNILEVLFGDIGI 36
          E + N E IVG    IKA   GI NILEVL  DIGI
Sbjct: 3  EMMVNCETIVGKLLTIKAYYLGIQNILEVLLKDIGI 38

>Smik_11.26 Chr11 (58522..58596,58600..58638,58642..58809) [282
          bp, 94 aa] {ON} YER181C (REPEAT)
          Length = 94

 Score = 36.6 bits (83), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 20/33 (60%), Positives = 24/33 (72%), Gaps = 1/33 (3%)

Query: 4  ANFEMIVGIPWFIKAILFGIYNILEVLFGDIGI 36
           NFE+IVGIP  IK IL  I NIL+V+  +IGI
Sbjct: 6  VNFEIIVGIPLLIKTILLDI-NILKVILENIGI 37

>Smik_11.219 Chr11
          complement(366097..366162,366166..366204,
          366208..366267) [165 bp, 55 aa] {ON} YOL106W (REPEAT)
          Length = 55

 Score = 35.4 bits (80), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 20/32 (62%), Positives = 22/32 (68%), Gaps = 1/32 (3%)

Query: 5  NFEMIVGIPWFIKAILFGIYNILEVLFGDIGI 36
          NFE+IVGIP   KA+  GI NI EVL  D GI
Sbjct: 2  NFEIIVGIPLLTKALFLGI-NIPEVLLEDTGI 32

>Smik_4.181 Chr4 complement(336248..336355,336359..336367) [117
          bp, 39 aa] {ON} YCR018C-A (REPEAT)
          Length = 39

 Score = 35.0 bits (79), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 19/33 (57%), Positives = 20/33 (60%)

Query: 4  ANFEMIVGIPWFIKAILFGIYNILEVLFGDIGI 36
           NF MIVGIP+ IK     I NILEV   DI I
Sbjct: 4  VNFGMIVGIPFLIKVTFLCITNILEVSLEDIRI 36

>Smik_12.178 Chr12
          complement(355239..355298,355302..355340,
          355344..355403,355407..355430) [183 bp, 61 aa] {ON}
          YOL106W (REPEAT)
          Length = 61

 Score = 35.4 bits (80), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 21/36 (58%), Positives = 24/36 (66%), Gaps = 1/36 (2%)

Query: 1  ERLANFEMIVGIPWFIKAILFGIYNILEVLFGDIGI 36
            + +  +IVGIP  IKAILFGI  ILEVL  DI I
Sbjct: 6  SEIVSLGIIVGIPLLIKAILFGI-KILEVLLEDIEI 40

>Smik_14.285 Chr14 (520719..520796) [78 bp, 26 aa] {ON}  YOL106W
          (REPEAT)
          Length = 26

 Score = 34.3 bits (77), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 16/26 (61%), Positives = 19/26 (73%)

Query: 1  ERLANFEMIVGIPWFIKAILFGIYNI 26
          E+  NFEMIVGIP  IKAI+ G  N+
Sbjct: 1  EKWVNFEMIVGIPLLIKAIILGRSNV 26

>Smik_3.62 Chr3 complement(88736..88804) [69 bp, 23 aa] {ON}
          YOL106W (REPEAT)
          Length = 23

 Score = 33.9 bits (76), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 16/23 (69%), Positives = 18/23 (78%)

Query: 1  ERLANFEMIVGIPWFIKAILFGI 23
          ER ANFEMIVGIP  IK I+ G+
Sbjct: 1  ERWANFEMIVGIPLLIKVIILGM 23

>Smik_5.361 Chr5 complement(559269..559463,559467..559553) [282
          bp, 94 aa] {ON} YOL106W (REPEAT)
          Length = 94

 Score = 35.0 bits (79), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 20/36 (55%), Positives = 24/36 (66%), Gaps = 1/36 (2%)

Query: 1  ERLANFEMIVGIPWFIKAILFGIYNILEVLFGDIGI 36
          E+  NFE+IVGI   IKA+L   +NIL VL  DI I
Sbjct: 3  EKWVNFEIIVGISLLIKAVLLFRHNIL-VLLHDIAI 37

>Smik_13.112 Chr13 complement(190877..191179) [303 bp, 100 aa]
          {ON} YCR018C-A (REPEAT)
          Length = 100

 Score = 35.0 bits (79), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 19/33 (57%), Positives = 23/33 (69%)

Query: 4  ANFEMIVGIPWFIKAILFGIYNILEVLFGDIGI 36
           NF +I+ I   IKAILF I +ILE+L  DIGI
Sbjct: 3  VNFGLILEIALLIKAILFCIQSILELLLEDIGI 35

>Smik_16.413 Chr16 (720870..720926,720930..720965) [93 bp, 31 aa]
          {ON}  YDR366C (REPEAT)
          Length = 31

 Score = 33.5 bits (75), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 20/32 (62%), Positives = 22/32 (68%), Gaps = 1/32 (3%)

Query: 5  NFEMIVGIPWFIKAILFGIYNILEVLFGDIGI 36
          +FE+ V IP FIKAI   I NILEVL  D GI
Sbjct: 1  DFEIFVKIPVFIKAISLDI-NILEVLLRDTGI 31

>YER181C Chr5 complement(551473..551796) [324 bp, 107 aa] {OFF}
          Dubious open reading frame unlikely to encode a
          protein, based on available experimental and
          comparative data; extensively overlaps a Ty1 LTR;
          protein product is detected in highly purified
          mitochondria in high-throughput studies
          Length = 107

 Score = 33.9 bits (76), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 18/36 (50%), Positives = 23/36 (63%)

Query: 1  ERLANFEMIVGIPWFIKAILFGIYNILEVLFGDIGI 36
          E   NF +I+GIP  I+A +  I NILE+L   IGI
Sbjct: 9  EVCVNFVIIIGIPLLIEASILCIQNILELLLKGIGI 44

>Smik_7.231 Chr7 complement(396783..396851) [69 bp, 23 aa] {ON}
          YOL106W (REPEAT)
          Length = 23

 Score = 32.3 bits (72), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 15/23 (65%), Positives = 18/23 (78%)

Query: 1  ERLANFEMIVGIPWFIKAILFGI 23
          E+  NFEMIVGIP  IKAI+ G+
Sbjct: 1  EKWVNFEMIVGIPLLIKAIILGM 23

>Smik_3.89 Chr3 (123152..123211,123215..123244,123248..123316)
          [159 bp, 53 aa] {ON}  YDR366C (REPEAT)
          Length = 53

 Score = 33.1 bits (74), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 20/30 (66%), Positives = 22/30 (73%), Gaps = 1/30 (3%)

Query: 5  NFEMIVGIPWFIKAILFGIYNILEVLFGDI 34
          N E+I  IP  IKAILFGI +IL VLF DI
Sbjct: 2  NVEIIADIPLLIKAILFGI-SILGVLFEDI 30

>Smik_3.56 Chr3 (83840..83929) [90 bp, 30 aa] {ON}  YDR366C
          (REPEAT)
          Length = 30

 Score = 32.3 bits (72), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 15/23 (65%), Positives = 18/23 (78%)

Query: 1  ERLANFEMIVGIPWFIKAILFGI 23
          E+  NFEMIVGIP  IKAI+ G+
Sbjct: 8  EKWVNFEMIVGIPLLIKAIILGM 30

>Smik_27.3 Chr27 complement(1694..1864) [171 bp, 57 aa] {ON}
          YDR366C (REPEAT)
          Length = 57

 Score = 32.7 bits (73), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 16/25 (64%), Positives = 18/25 (72%)

Query: 11 GIPWFIKAILFGIYNILEVLFGDIG 35
          GIP  IKAI+ GI NILE L  D+G
Sbjct: 12 GIPLLIKAIILGIQNILEELLEDVG 36

>Skud_7.386 Chr7 (645551..645589,645593..645757,645761..645802)
          [246 bp, 82 aa] {ON} YCR018C-A (REPEAT)
          Length = 82

 Score = 33.1 bits (74), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 16/32 (50%), Positives = 20/32 (62%)

Query: 4  ANFEMIVGIPWFIKAILFGIYNILEVLFGDIG 35
           N    VGIP+ I+ I+  I NILEVL  D+G
Sbjct: 13 QNLVTSVGIPFLIRLIILCIQNILEVLLMDLG 44

>Smik_5.214 Chr5 complement(320782..320838,320842..321006) [222
          bp, 74 aa] {ON} YCR018C-A (REPEAT)
          Length = 74

 Score = 32.7 bits (73), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 17/36 (47%), Positives = 22/36 (61%)

Query: 1  ERLANFEMIVGIPWFIKAILFGIYNILEVLFGDIGI 36
          ++   FE+  G+P  IK I   I+NILEVL   IGI
Sbjct: 1  QKYVKFEINFGVPLTIKVISICIHNILEVLLEGIGI 36

>Smik_7.67 Chr7 complement(109941..110054,110058..110126) [183 bp,
          61 aa] {ON} YOL106W (REPEAT)
          Length = 61

 Score = 32.7 bits (73), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 17/27 (62%), Positives = 20/27 (74%), Gaps = 1/27 (3%)

Query: 5  NFEMIVGIPWFIKAILFGIYNILEVLF 31
          NFEMI G+P  IKAI+  + NILEVL 
Sbjct: 5  NFEMIAGVPMLIKAIILDM-NILEVLL 30

>Smik_12.412 Chr12 (722297..722305,722309..722368) [69 bp, 23 aa]
          {ON}  YOL106W (REPEAT)
          Length = 23

 Score = 32.0 bits (71), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 15/19 (78%), Positives = 16/19 (84%)

Query: 5  NFEMIVGIPWFIKAILFGI 23
          NFE+IVGIP  IKAIL GI
Sbjct: 5  NFEIIVGIPLLIKAILLGI 23

>Smik_9.162 Chr9 (275247..275366,275376..275477) [222 bp, 74 aa]
          {ON}  YOL106W (REPEAT)
          Length = 74

 Score = 32.7 bits (73), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 17/30 (56%), Positives = 21/30 (70%)

Query: 5  NFEMIVGIPWFIKAILFGIYNILEVLFGDI 34
          N E+IVGI   ++AI+ G  NILEVL  DI
Sbjct: 1  NIEVIVGITLLLEAIILGKQNILEVLLNDI 30

>Smik_16.122 Chr16 complement(220698..220823) [126 bp, 42 aa] {ON}
          YOL106W (REPEAT)
          Length = 42

 Score = 32.0 bits (71), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 15/23 (65%), Positives = 18/23 (78%)

Query: 1  ERLANFEMIVGIPWFIKAILFGI 23
          E+  NFEMIVGIP  IKAI+ G+
Sbjct: 20 EKWVNFEMIVGIPLLIKAIILGM 42

>YOL013W-B Chr15 (300690..300980) [291 bp, 96 aa] {OFF} Dubious
          open reading frame unlikely to encode a protein, based
          on available experimental and comparative sequence
          data; completely overlaps the long terminal repeat
          (LTR) of a Ty1 element
          Length = 96

 Score = 32.7 bits (73), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 16/34 (47%), Positives = 24/34 (70%)

Query: 3  LANFEMIVGIPWFIKAILFGIYNILEVLFGDIGI 36
          +++FE+IVGI   ++ I+  I N+LEVL   IGI
Sbjct: 1  MSDFEIIVGISSLLQVIILNIQNMLEVLLEYIGI 34

>Smik_7.261 Chr7 complement(432507..432575) [69 bp, 23 aa] {ON}
          YOL106W (REPEAT)
          Length = 23

 Score = 31.2 bits (69), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 14/23 (60%), Positives = 18/23 (78%)

Query: 1  ERLANFEMIVGIPWFIKAILFGI 23
          E+  NF+MIVGIP  IKAI+ G+
Sbjct: 1  EKWVNFKMIVGIPLLIKAIILGM 23

>Smik_5.291 Chr5 (448351..448482,448489..448566) [210 bp, 70 aa]
          {ON}  YDR366C (REPEAT)
          Length = 70

 Score = 31.6 bits (70), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 19/35 (54%), Positives = 22/35 (62%)

Query: 1  ERLANFEMIVGIPWFIKAILFGIYNILEVLFGDIG 35
          E   + E+IV I   IKAIL GI +I EVL  DIG
Sbjct: 4  ENDVDLEIIVWILLLIKAILSGIQDIPEVLLKDIG 38

>Smik_8.228 Chr8 (366280..366369,366373..366459) [177 bp, 59 aa]
          {ON} YCR018C-A (REPEAT)
          Length = 59

 Score = 31.6 bits (70), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 16/29 (55%), Positives = 19/29 (65%)

Query: 8  MIVGIPWFIKAILFGIYNILEVLFGDIGI 36
          +++  P  IK ILFGI  I EVL  DIGI
Sbjct: 1  LLIATPLLIKEILFGIQIIQEVLLEDIGI 29

>Smik_13.71 Chr13 (129995..130069) [75 bp, 25 aa] {ON}  YCR018C-A
          (REPEAT)
          Length = 25

 Score = 30.8 bits (68), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 14/21 (66%), Positives = 16/21 (76%)

Query: 1  ERLANFEMIVGIPWFIKAILF 21
          +R  NFE+IVGIP  IKAIL 
Sbjct: 5  KRRVNFEIIVGIPLLIKAILL 25

>Skud_4.609 Chr4
          complement(1087174..1087224,1087228..1087335,
          1087339..1087395) [216 bp, 72 aa] {ON} YCR018C-A
          (REPEAT)
          Length = 72

 Score = 31.6 bits (70), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 18/32 (56%), Positives = 21/32 (65%), Gaps = 1/32 (3%)

Query: 5  NFEMIVGIPWFIKAILFGIYNILEVLFGDIGI 36
          N    VGIP+ IK I+  I NILEVL  D+GI
Sbjct: 1  NLVTFVGIPFLIKLIMLCI-NILEVLLMDLGI 31

>Smik_5.97 Chr5 (137480..137698,137702..137758) [276 bp, 92 aa]
          {ON}  YOL106W (REPEAT)
          Length = 92

 Score = 31.6 bits (70), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 17/32 (53%), Positives = 20/32 (62%)

Query: 5  NFEMIVGIPWFIKAILFGIYNILEVLFGDIGI 36
          NFE+I GIP  IKAIL  I +ILE      G+
Sbjct: 6  NFEIINGIPSLIKAILLSIQDILEDFLEGTGV 37

>Smik_12.329 Chr12 (595891..595959) [69 bp, 23 aa] {ON}  YOL106W
          (REPEAT)
          Length = 23

 Score = 30.0 bits (66), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 14/19 (73%), Positives = 16/19 (84%)

Query: 5  NFEMIVGIPWFIKAILFGI 23
          NFEMIVGIP  IKAI+ G+
Sbjct: 5  NFEMIVGIPLLIKAIILGM 23

>YPR002C-A Chr16 complement(560569..560766) [198 bp, 65 aa] {OFF}
          Dubious open reading frame unlikely to encode a
          protein, based on available experimental and
          comparative sequence data; completely overlaps the Ty1
          long terminal repeat, YPRWdelta12
          Length = 65

 Score = 30.8 bits (68), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 15/21 (71%), Positives = 17/21 (80%)

Query: 16 IKAILFGIYNILEVLFGDIGI 36
          +KAI+ GI NILEVL  DIGI
Sbjct: 1  MKAIILGIQNILEVLLEDIGI 21

>Smik_6.122 Chr6 (199157..199228,199232..199270,199274..199345)
          [183 bp, 61 aa] {ON} YCR018C-A (REPEAT)
          Length = 61

 Score = 30.8 bits (68), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 20/36 (55%), Positives = 21/36 (58%), Gaps = 1/36 (2%)

Query: 1  ERLANFEMIVGIPWFIKAILFGIYNILEVLFGDIGI 36
          + L  F     IP  IKAIL GI NILE L  DIGI
Sbjct: 2  KNLVIFMATASIPLSIKAILLGI-NILEFLLEDIGI 36

>Smik_5.114 Chr5
          complement(156357..156467,156471..156518,
          156522..156596) [234 bp, 78 aa] {ON} YCR018C-A (REPEAT)
          Length = 78

 Score = 30.8 bits (68), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 16/36 (44%), Positives = 23/36 (63%)

Query: 1  ERLANFEMIVGIPWFIKAILFGIYNILEVLFGDIGI 36
          E+ A+++ +V IP  I  ILF + NI +VL   IGI
Sbjct: 3  EKQADYQFVVMIPLLIGVILFCVNNISKVLSKVIGI 38

>Skud_16.21 Chr16
          (35466..35510,35514..35603,35607..35621,35625..35675)
          [201 bp, 67 aa] {ON} YCR018C-A (REPEAT)
          Length = 67

 Score = 30.4 bits (67), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 16/28 (57%), Positives = 21/28 (75%), Gaps = 1/28 (3%)

Query: 9  IVGIPWFIKAILFGIYNILEVLFGDIGI 36
          IVGIP+ ++ I+  I NILEVL  D+GI
Sbjct: 1  IVGIPFLVRLIILCI-NILEVLLRDLGI 27

>Smik_5.2 Chr5 (796..1047) [252 bp, 84 aa] {ON} YER181C (REPEAT)
          Length = 84

 Score = 30.4 bits (67), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 13/26 (50%), Positives = 17/26 (65%)

Query: 11 GIPWFIKAILFGIYNILEVLFGDIGI 36
          GIP  +K I+  I NILEV   D+G+
Sbjct: 1  GIPLLLKTIVLDIQNILEVHLEDLGV 26

>Smik_11.174 Chr11 (294261..294311) [51 bp, 17 aa] {ON}  YDR366C
          (REPEAT)
          Length = 17

 Score = 28.9 bits (63), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 13/17 (76%), Positives = 14/17 (82%)

Query: 5  NFEMIVGIPWFIKAILF 21
          NFEMIVGIP  IKAI+ 
Sbjct: 1  NFEMIVGIPLLIKAIIL 17

>Skud_11.100 Chr11
          complement(189059..189109,189113..189220,
          189224..189280) [216 bp, 72 aa] {ON} YCR018C-A (REPEAT)
          Length = 72

 Score = 29.6 bits (65), Expect = 0.046,   Method: Compositional matrix adjust.
 Identities = 16/32 (50%), Positives = 21/32 (65%), Gaps = 1/32 (3%)

Query: 5  NFEMIVGIPWFIKAILFGIYNILEVLFGDIGI 36
          N    VGIP+ ++ I+  I NILEVL  D+GI
Sbjct: 1  NLVTFVGIPFLVRLIILCI-NILEVLLMDLGI 31

>Skud_12.327 Chr12 complement(575005..575052,575056..575112) [105
          bp, 35 aa] {ON}  YOL106W (REPEAT)
          Length = 35

 Score = 28.5 bits (62), Expect = 0.069,   Method: Compositional matrix adjust.
 Identities = 17/32 (53%), Positives = 22/32 (68%), Gaps = 1/32 (3%)

Query: 5  NFEMIVGIPWFIKAILFGIYNILEVLFGDIGI 36
          N  +I G  + +KA+L GIY ILEV  G+IGI
Sbjct: 1  NAVIIFGFKFLMKAVLLGIY-ILEVFLGEIGI 31

>Smik_10.234 Chr10 (374037..374183) [147 bp, 49 aa] {ON} YOL106W
          (REPEAT)
          Length = 49

 Score = 28.9 bits (63), Expect = 0.070,   Method: Compositional matrix adjust.
 Identities = 19/37 (51%), Positives = 23/37 (62%), Gaps = 1/37 (2%)

Query: 1  ERLANFEMIVGIPWFIKAILFGIYNILEV-LFGDIGI 36
          E   NF +I GIP  IKA+L  I++I EV L  D GI
Sbjct: 2  EMWVNFGIIFGIPLLIKAVLLFIHSIPEVLLLEDAGI 38

>Smik_9.102 Chr9 (184132..184173,184177..184260,184264..184275)
          [138 bp, 46 aa] {ON} YDR366C (REPEAT)
          Length = 46

 Score = 28.1 bits (61), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 14/36 (38%), Positives = 21/36 (58%), Gaps = 1/36 (2%)

Query: 1  ERLANFEMIVGIPWFIKAILFGIYNILEVLFGDIGI 36
          E+    +M++G P   KA + G+ NIL VL   IG+
Sbjct: 1  EKWVCIDMVIGTP-LTKATILGVRNILGVLLEKIGL 35

>Smik_6.238 Chr6 (392222..392299) [78 bp, 26 aa] {ON}  YDR366C
          (REPEAT)
          Length = 26

 Score = 27.7 bits (60), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 12/23 (52%), Positives = 18/23 (78%)

Query: 1  ERLANFEMIVGIPWFIKAILFGI 23
          E +  F++IVGIP+F KAI+ G+
Sbjct: 4  EIIVEFDVIVGIPFFYKAIILGM 26

>Smik_10.266 Chr10 (417416..417637) [222 bp, 74 aa] {ON} YCR018C-A
          (REPEAT)
          Length = 74

 Score = 28.1 bits (61), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 16/32 (50%), Positives = 18/32 (56%)

Query: 5  NFEMIVGIPWFIKAILFGIYNILEVLFGDIGI 36
          NFE   G+   IK I   I NIL+VL  DI I
Sbjct: 1  NFEKAEGVTLRIKVIFSCIQNILDVLLEDIEI 32

>Smik_5.128 Chr5 (180826..180864,180868..180906,180910..180984)
          [153 bp, 51 aa] {ON} YDR366C (REPEAT)
          Length = 51

 Score = 26.9 bits (58), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 16/26 (61%), Positives = 17/26 (65%), Gaps = 1/26 (3%)

Query: 11 GIPWFIKAILFGIYNILEVLFGDIGI 36
          GIP  IK +   I NILEVL  DIGI
Sbjct: 1  GIPLLIKLMYLDI-NILEVLLEDIGI 25

>Smik_7.339 Chr7 (567980..568066) [87 bp, 29 aa] {ON}  YDR366C
          (REPEAT)
          Length = 29

 Score = 26.2 bits (56), Expect = 0.64,   Method: Compositional matrix adjust.
 Identities = 13/29 (44%), Positives = 18/29 (62%)

Query: 8  MIVGIPWFIKAILFGIYNILEVLFGDIGI 36
          +IVGIP+ IK+ +    NI E    D+GI
Sbjct: 1  IIVGIPFLIKSKIIRCQNIPEFFLEDLGI 29

>YLR334C Chr12 complement(796698..797078) [381 bp, 126 aa] {OFF}
          Dubious open reading frame unlikely to encode a
          protein, based on available experimental and
          comparative sequence data; overlaps a stand-alone long
          terminal repeat sequence whose presence indicates a
          retrotransposition event occurred here
          Length = 126

 Score = 26.9 bits (58), Expect = 0.80,   Method: Composition-based stats.
 Identities = 14/20 (70%), Positives = 16/20 (80%)

Query: 17 KAILFGIYNILEVLFGDIGI 36
          KA++F I NILEVL  DIGI
Sbjct: 14 KAMIFCIVNILEVLLEDIGI 33

>SAKL0E04686g Chr5 (379624..379890) [267 bp, 88 aa] {ON} some
          similarities with uniprot|P87287 Saccharomyces
          cerevisiae YDR366C Hypothetical ORF
          Length = 88

 Score = 25.8 bits (55), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 15/36 (41%), Positives = 21/36 (58%)

Query: 1  ERLANFEMIVGIPWFIKAILFGIYNILEVLFGDIGI 36
          E+  N   I  IP+ +KAI+    +ILEVL   +GI
Sbjct: 6  EKYVNSGTIFEIPFLVKAIIIWYMSILEVLLTFLGI 41

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.335    0.159    0.499 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 3,293,618
Number of extensions: 64092
Number of successful extensions: 448
Number of sequences better than 10.0: 94
Number of HSP's gapped: 433
Number of HSP's successfully gapped: 94
Length of query: 36
Length of database: 53,481,399
Length adjustment: 11
Effective length of query: 25
Effective length of database: 52,220,073
Effective search space: 1305501825
Effective search space used: 1305501825
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 39 (21.5 bits)
S2: 59 (27.3 bits)