Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Smik_4.3888.318ON59759728880.0
YDR144C (MKC7)8.318ON59659623270.0
Skud_4.4038.318ON59059621540.0
Suva_2.3058.318ON59760018420.0
YLR120C (YPS1)8.318ON56953113251e-177
Skud_12.1928.318ON56952513251e-177
Smik_12.1868.318ON57249213131e-175
Suva_10.2118.318ON56653313041e-174
SAKL0H15664g8.318ON55652312571e-167
CAGL0M04191g8.318ON60150012611e-167
NCAS0B035608.318ON58654112501e-165
Kwal_26.7254singletonON57052212051e-159
Kpol_543.618.318ON58847811971e-157
TDEL0F044508.318ON52449711481e-151
KNAG0G024108.318ON53050711481e-151
TPHA0A015808.318ON60048311321e-147
KAFR0B057108.318ON57553211141e-145
KAFR0B06530singletonON53850211061e-144
KAFR0H023008.318ON52148311021e-144
NDAI0G026208.318ON59048111021e-143
KLLA0E04049g8.318ON58953610921e-141
NCAS0C033008.318ON55948510741e-139
Smik_12.1878.319ON50747910391e-135
YLR121C (YPS3)8.319ON50848710381e-134
KLTH0G12386g8.318ON58053410441e-134
ZYRO0F10274gsingletonON57252010421e-134
Skud_12.1938.319ON49748410351e-134
KNAG0I009108.318ON56950610341e-133
ZYRO0F10230g8.318ON58053510251e-132
Suva_10.2128.319ON74550110341e-131
ZYRO0G02904gsingletonON53151010141e-131
Kwal_56.239028.318ON62954910091e-129
TBLA0A039108.318ON59649310031e-128
AGL192W8.318ON4994769901e-127
TBLA0D00140singletonON6075189801e-124
ZYRO0F10318g8.319ON4865229681e-124
Ecym_42518.318ON5024919641e-123
NDAI0J010308.318ON6523519721e-123
TBLA0E02630singletonON6893489441e-118
KNAG0E03220singletonON5404909291e-118
ZYRO0F10252gsingletonON5514649121e-115
SAKL0C02970gsingletonON5925259141e-115
KLTH0F06754gsingletonON7674999251e-114
TBLA0H012908.318ON6673689161e-114
Kwal_33.14239singletonON6514809141e-114
KAFR0E03940singletonON6385048951e-111
CAGL0E01419g8.318ON5915098531e-106
KAFR0I01700singletonON5525098141e-100
ZYRO0E02266gsingletonON5065068091e-100
KNAG0I01200singletonON6774558143e-99
KNAG0I009008.319ON5314967981e-98
CAGL0E01815gsingletonON5194777857e-97
SAKL0F07172g7.182ON5424457861e-96
TPHA0C008408.318ON10004807897e-93
CAGL0E01749gsingletonON4824467523e-92
ZYRO0F10296gsingletonON5285017527e-92
CAGL0E01793gsingletonON5164777456e-91
CAGL0E01859gsingletonON5054857369e-90
CAGL0E01771gsingletonON5194677282e-88
CAGL0E01837gsingletonON5214947188e-87
Suva_16.14singletonON5404337153e-86
Suva_9.13singletonON4644336954e-84
KAFR0B06700singletonON5315116952e-83
YIR039C (YPS6)singletonON5374226934e-83
NCAS0A124607.182ON5404446743e-80
CAGL0E01881gsingletonON5084456471e-76
CAGL0E01727gsingletonON5394796325e-74
Ecym_43947.182ON5184356201e-72
KLLA0D15917g7.182ON5114626104e-71
YIL015W (BAR1)7.182ON5874006032e-69
Suva_34.1singletonON3873275831e-68
Smik_9.1757.182ON5934005981e-68
Smik_65.1singletonON3423125782e-68
Skud_9.1547.182ON5164425885e-68
KNAG0H027607.182ON5634485909e-68
SAKL0E15356gsingletonON5574685784e-66
NDAI0B017207.182ON5474425713e-65
ZYRO0D15554g7.182ON5214465459e-62
CAGL0J02288g7.182ON5413955232e-58
TDEL0H026507.182ON5524425138e-57
AGR240W7.182ON4524364866e-54
SAKL0H00330gsingletonON5784274649e-50
Smik_5.7singletonON3042324275e-47
Kpol_1063.227.182ON3363243953e-42
Suva_79.1singletonON2272363522e-37
TBLA0D045807.182ON3954093395e-34
Suva_9.1877.182ON3331752544e-23
Suva_9.186singletonOFF5431802553e-22
ZYRO0F07392g8.677ON4184192495e-22
Smik_6.3518.677ON4054762423e-21
Suva_16.1568.677ON4064762391e-20
YPL154C (PEP4)8.677ON4054762391e-20
Skud_16.1288.677ON4054762381e-20
Suva_62.1singletonON2521882301e-20
KNAG0J017108.677ON4154732353e-20
Kwal_26.88028.677ON4124892336e-20
Ecym_23968.677ON4154362203e-18
KLLA0D05929g8.677ON4094762194e-18
Kpol_1072.158.677ON3994402175e-18
NCAS0C013608.677ON4064422176e-18
KLTH0D11264g8.677ON4174192132e-17
KLLA0F22088g5.401ON5583032134e-17
NDAI0E021058.677ON4083132096e-17
TBLA0B038308.677ON4134512062e-16
TPHA0D012608.677ON4194112062e-16
Smik_5.6singletonON1231051892e-16
SAKL0H06512g8.677ON4044131972e-15
KAFR0H024208.677ON4164931972e-15
TPHA0E019205.401ON6243641876e-14
Kpol_1013.68.677ON4024141856e-14
Ecym_13245.401ON5763251869e-14
TDEL0A062308.677ON4083121831e-13
ACR144W8.677ON4083351751e-12
ACR150W5.401ON5533441698e-12
CAGL0M02211g8.677ON4154981661e-11
Kwal_55.200345.401ON5931971601e-10
Skud_4.6185.401ON5862831573e-10
TDEL0E022305.401ON5733111563e-10
KLTH0E02596g5.401ON5961981555e-10
Smik_4.6135.401ON5963371483e-09
ZYRO0A06578g5.401ON7204291465e-09
AGR407CsingletonON2682971417e-09
YDR349C (YPS7)5.401ON5963401431e-08
ACR143WsingletonON3933141374e-08
NDAI0C046105.401ON6094181351e-07
Suva_2.5205.401ON5982641332e-07
KAFR0E040805.401ON5964661332e-07
Smik_67.1singletonON110531212e-07
TBLA0H016805.401ON6092371289e-07
NCAS0F031505.401ON6454231216e-06
YGL259W (YPS5)singletonON165881121e-05
CAGL0A02431g5.401ON5872381181e-05
YGL258W-AsingletonON77791016e-05
SAKL0G07524g5.401ON6324171126e-05
Kpol_1059.335.401ON6623621038e-04
KNAG0C051405.401ON598342960.005
SAKL0D01408gna 1ON506315900.029
ABL123Cna 1ON494263860.085
Suva_2.4725.327ON47941800.44
Ecym_4614na 1ON481290751.5
Smik_4.5555.327ON47941732.8
YDR306C5.327ON47841733.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Smik_4.388
         (597 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Smik_4.388 Chr4 complement(705092..706885) [1794 bp, 597 aa] {ON...  1117   0.0  
YDR144C Chr4 complement(744311..746101) [1791 bp, 596 aa] {ON}  ...   900   0.0  
Skud_4.403 Chr4 complement(715972..717744) [1773 bp, 590 aa] {ON...   834   0.0  
Suva_2.305 Chr2 complement(539604..541397) [1794 bp, 597 aa] {ON...   714   0.0  
YLR120C Chr12 complement(386511..388220) [1710 bp, 569 aa] {ON} ...   514   e-177
Skud_12.192 Chr12 complement(369422..371131) [1710 bp, 569 aa] {...   514   e-177
Smik_12.186 Chr12 complement(367771..369489) [1719 bp, 572 aa] {...   510   e-175
Suva_10.211 Chr10 complement(394404..396104) [1701 bp, 566 aa] {...   506   e-174
SAKL0H15664g Chr8 (1365886..1367556) [1671 bp, 556 aa] {ON} simi...   488   e-167
CAGL0M04191g Chr13 complement(461446..463251) [1806 bp, 601 aa] ...   490   e-167
NCAS0B03560 Chr2 complement(629374..631134) [1761 bp, 586 aa] {O...   486   e-165
Kwal_26.7254 s26 (280683..282395) [1713 bp, 570 aa] {ON} YLR120C...   468   e-159
Kpol_543.61 s543 complement(141395..143161) [1767 bp, 588 aa] {O...   465   e-157
TDEL0F04450 Chr6 complement(835112..836686) [1575 bp, 524 aa] {O...   446   e-151
KNAG0G02410 Chr7 complement(550827..552419) [1593 bp, 530 aa] {O...   446   e-151
TPHA0A01580 Chr1 (315749..317551) [1803 bp, 600 aa] {ON} Anc_8.3...   440   e-147
KAFR0B05710 Chr2 complement(1177594..1179321) [1728 bp, 575 aa] ...   433   e-145
KAFR0B06530 Chr2 (1355295..1356911) [1617 bp, 538 aa] {ON}            430   e-144
KAFR0H02300 Chr8 (439083..440648) [1566 bp, 521 aa] {ON} Anc_8.3...   429   e-144
NDAI0G02620 Chr7 (599890..601662) [1773 bp, 590 aa] {ON}  YGL258W-A   429   e-143
KLLA0E04049g Chr5 (366535..368304) [1770 bp, 589 aa] {ON} simila...   425   e-141
NCAS0C03300 Chr3 (647716..649395) [1680 bp, 559 aa] {ON}              418   e-139
Smik_12.187 Chr12 complement(370001..371524) [1524 bp, 507 aa] {...   404   e-135
YLR121C Chr12 complement(388744..390270) [1527 bp, 508 aa] {ON} ...   404   e-134
KLTH0G12386g Chr7 (1052977..1054719) [1743 bp, 580 aa] {ON} simi...   406   e-134
ZYRO0F10274g Chr6 complement(831057..832775) [1719 bp, 572 aa] {...   405   e-134
Skud_12.193 Chr12 complement(371627..373120) [1494 bp, 497 aa] {...   403   e-134
KNAG0I00910 Chr9 (171104..172813) [1710 bp, 569 aa] {ON}              402   e-133
ZYRO0F10230g Chr6 complement(826246..827988) [1743 bp, 580 aa] {...   399   e-132
Suva_10.212 Chr10 complement(396611..398848) [2238 bp, 745 aa] {...   402   e-131
ZYRO0G02904g Chr7 (220115..221710) [1596 bp, 531 aa] {ON} simila...   395   e-131
Kwal_56.23902 s56 complement(767431..769320) [1890 bp, 629 aa] {...   393   e-129
TBLA0A03910 Chr1 complement(977504..979294) [1791 bp, 596 aa] {O...   390   e-128
AGL192W Chr7 (337445..338944) [1500 bp, 499 aa] {ON} Syntenic ho...   385   e-127
TBLA0D00140 Chr4 (31269..33092) [1824 bp, 607 aa] {ON}                382   e-124
ZYRO0F10318g Chr6 complement(835672..837132) [1461 bp, 486 aa] {...   377   e-124
Ecym_4251 Chr4 complement(520455..521963) [1509 bp, 502 aa] {ON}...   375   e-123
NDAI0J01030 Chr10 (235967..237925) [1959 bp, 652 aa] {ON}             379   e-123
TBLA0E02630 Chr5 complement(665115..667184) [2070 bp, 689 aa] {O...   368   e-118
KNAG0E03220 Chr5 complement(647282..648904) [1623 bp, 540 aa] {O...   362   e-118
ZYRO0F10252g Chr6 complement(828774..830429) [1656 bp, 551 aa] {...   355   e-115
SAKL0C02970g Chr3 (285647..287425) [1779 bp, 592 aa] {ON} some s...   356   e-115
KLTH0F06754g Chr6 (590569..592872) [2304 bp, 767 aa] {ON} weakly...   360   e-114
TBLA0H01290 Chr8 (290515..292518) [2004 bp, 667 aa] {ON} Anc_8.3...   357   e-114
Kwal_33.14239 s33 (582768..584723) [1956 bp, 651 aa] {ON} YDR144...   356   e-114
KAFR0E03940 Chr5 (779476..781392) [1917 bp, 638 aa] {ON}              349   e-111
CAGL0E01419g Chr5 (132904..134679) [1776 bp, 591 aa] {ON} simila...   333   e-106
KAFR0I01700 Chr9 complement(346265..347923) [1659 bp, 552 aa] {O...   318   e-100
ZYRO0E02266g Chr5 complement(169081..170601) [1521 bp, 506 aa] {...   316   e-100
KNAG0I01200 Chr9 (226271..228304) [2034 bp, 677 aa] {ON}              318   3e-99
KNAG0I00900 Chr9 (169003..170598) [1596 bp, 531 aa] {ON}              311   1e-98
CAGL0E01815g Chr5 complement(181154..182713) [1560 bp, 519 aa] {...   306   7e-97
SAKL0F07172g Chr6 complement(541680..543308) [1629 bp, 542 aa] {...   307   1e-96
TPHA0C00840 Chr3 (173318..176320) [3003 bp, 1000 aa] {ON} Anc_8....   308   7e-93
CAGL0E01749g Chr5 complement(172875..174323) [1449 bp, 482 aa] {...   294   3e-92
ZYRO0F10296g Chr6 complement(833615..835201) [1587 bp, 528 aa] {...   294   7e-92
CAGL0E01793g Chr5 complement(178411..179961) [1551 bp, 516 aa] {...   291   6e-91
CAGL0E01859g Chr5 complement(185870..187387) [1518 bp, 505 aa] {...   288   9e-90
CAGL0E01771g Chr5 complement(175652..177211) [1560 bp, 519 aa] {...   285   2e-88
CAGL0E01837g Chr5 complement(183237..184802) [1566 bp, 521 aa] {...   281   8e-87
Suva_16.14 Chr16 (11240..12862) [1623 bp, 540 aa] {ON} YIR039C (...   280   3e-86
Suva_9.13 Chr9 (14409..15803) [1395 bp, 464 aa] {ON} YIR039C (REAL)   272   4e-84
KAFR0B06700 Chr2 complement(1396587..1398182) [1596 bp, 531 aa] ...   272   2e-83
YIR039C Chr9 complement(430498..432111) [1614 bp, 537 aa] {ON}  ...   271   4e-83
NCAS0A12460 Chr1 complement(2461028..2462650) [1623 bp, 540 aa] ...   264   3e-80
CAGL0E01881g Chr5 (188277..189803) [1527 bp, 508 aa] {ON} simila...   253   1e-76
CAGL0E01727g Chr5 (171119..172738) [1620 bp, 539 aa] {ON} simila...   248   5e-74
Ecym_4394 Chr4 (827655..829211) [1557 bp, 518 aa] {ON} similar t...   243   1e-72
KLLA0D15917g Chr4 complement(1336727..1338262) [1536 bp, 511 aa]...   239   4e-71
YIL015W Chr9 (322342..324105) [1764 bp, 587 aa] {ON}  BAR1Aspart...   236   2e-69
Suva_34.1 Chr34 complement(13..1176) [1164 bp, 387 aa] {ON} YIR0...   229   1e-68
Smik_9.175 Chr9 (296875..298656) [1782 bp, 593 aa] {ON} YIL015W ...   234   1e-68
Smik_65.1 Chr65 (2..1027) [1026 bp, 342 aa] {ON} YIR039C (REAL)       227   2e-68
Skud_9.154 Chr9 (291885..293435) [1551 bp, 516 aa] {ON} YIL015W ...   231   5e-68
KNAG0H02760 Chr8 (507659..509350) [1692 bp, 563 aa] {ON} Anc_7.1...   231   9e-68
SAKL0E15356g Chr5 (1283552..1285225) [1674 bp, 557 aa] {ON} weak...   227   4e-66
NDAI0B01720 Chr2 complement(409125..410768) [1644 bp, 547 aa] {O...   224   3e-65
ZYRO0D15554g Chr4 complement(1298587..1300152) [1566 bp, 521 aa]...   214   9e-62
CAGL0J02288g Chr10 complement(223820..225445) [1626 bp, 541 aa] ...   206   2e-58
TDEL0H02650 Chr8 (445052..446710) [1659 bp, 552 aa] {ON} Anc_7.1...   202   8e-57
AGR240W Chr7 (1200736..1202094) [1359 bp, 452 aa] {ON} Syntenic ...   191   6e-54
SAKL0H00330g Chr8 complement(40564..42300) [1737 bp, 578 aa] {ON...   183   9e-50
Smik_5.7 Chr5 (4489..5403) [915 bp, 304 aa] {ON} YIR039C (REAL)       169   5e-47
Kpol_1063.22 s1063 (50979..51989) [1011 bp, 336 aa] {ON} (50979....   156   3e-42
Suva_79.1 Chr79 complement(1..681) [681 bp, 227 aa] {ON} YIR039C...   140   2e-37
TBLA0D04580 Chr4 complement(1133223..1134410) [1188 bp, 395 aa] ...   135   5e-34
Suva_9.187 Chr9 (310921..311922) [1002 bp, 333 aa] {ON} YIL015W ...   102   4e-23
Suva_9.186 Chr9 (310161..310220,310267..310332,310362..310451,31...   102   3e-22
ZYRO0F07392g Chr6 (598584..599840) [1257 bp, 418 aa] {ON} highly...   100   5e-22
Smik_6.351 Chr6 (563275..564492) [1218 bp, 405 aa] {ON} YPL154C ...    98   3e-21
Suva_16.156 Chr16 complement(268862..270082) [1221 bp, 406 aa] {...    97   1e-20
YPL154C Chr16 complement(259714..260931) [1218 bp, 405 aa] {ON} ...    97   1e-20
Skud_16.128 Chr16 complement(231348..232565) [1218 bp, 405 aa] {...    96   1e-20
Suva_62.1 Chr62 complement(3..758) [756 bp, 252 aa] {ON} YIR039C...    93   1e-20
KNAG0J01710 Chr10 (312872..314119) [1248 bp, 415 aa] {ON} Anc_8....    95   3e-20
Kwal_26.8802 s26 (949063..950301) [1239 bp, 412 aa] {ON} YPL154C...    94   6e-20
Ecym_2396 Chr2 complement(769479..770726) [1248 bp, 415 aa] {ON}...    89   3e-18
KLLA0D05929g Chr4 (507555..508784) [1230 bp, 409 aa] {ON} highly...    89   4e-18
Kpol_1072.15 s1072 complement(35798..36997) [1200 bp, 399 aa] {O...    88   5e-18
NCAS0C01360 Chr3 complement(249141..250361) [1221 bp, 406 aa] {O...    88   6e-18
KLTH0D11264g Chr4 (920981..922234) [1254 bp, 417 aa] {ON} highly...    87   2e-17
KLLA0F22088g Chr6 (2064310..2065986) [1677 bp, 558 aa] {ON} weak...    87   4e-17
NDAI0E02105 Chr5 complement(429293..430519) [1227 bp, 408 aa] {ON}     85   6e-17
TBLA0B03830 Chr2 complement(880233..881474) [1242 bp, 413 aa] {O...    84   2e-16
TPHA0D01260 Chr4 (262523..263782) [1260 bp, 419 aa] {ON} Anc_8.6...    84   2e-16
Smik_5.6 Chr5 (4120..4488) [369 bp, 123 aa] {ON} YIR039C (REAL)        77   2e-16
SAKL0H06512g Chr8 complement(573927..575141) [1215 bp, 404 aa] {...    80   2e-15
KAFR0H02420 Chr8 complement(462759..464009) [1251 bp, 416 aa] {O...    80   2e-15
TPHA0E01920 Chr5 (393982..395856) [1875 bp, 624 aa] {ON} Anc_5.4...    77   6e-14
Kpol_1013.6 s1013 (10059..11267) [1209 bp, 402 aa] {ON} (10059.....    76   6e-14
Ecym_1324 Chr1 complement(662306..664036) [1731 bp, 576 aa] {ON}...    76   9e-14
TDEL0A06230 Chr1 (1091257..1092483) [1227 bp, 408 aa] {ON} Anc_8...    75   1e-13
ACR144W Chr3 (603306..604532) [1227 bp, 408 aa] {ON} Syntenic ho...    72   1e-12
ACR150W Chr3 (614407..616068) [1662 bp, 553 aa] {ON} Syntenic ho...    70   8e-12
CAGL0M02211g Chr13 complement(264202..265449) [1248 bp, 415 aa] ...    69   1e-11
Kwal_55.20034 s55 (223867..225648) [1782 bp, 593 aa] {ON} YDR349...    66   1e-10
Skud_4.618 Chr4 complement(1101382..1103142) [1761 bp, 586 aa] {...    65   3e-10
TDEL0E02230 Chr5 (427831..429552) [1722 bp, 573 aa] {ON} Anc_5.4...    65   3e-10
KLTH0E02596g Chr5 (235803..237593) [1791 bp, 596 aa] {ON} weakly...    64   5e-10
Smik_4.613 Chr4 complement(1098592..1100382) [1791 bp, 596 aa] {...    62   3e-09
ZYRO0A06578g Chr1 (533368..535530) [2163 bp, 720 aa] {ON} simila...    61   5e-09
AGR407C Chr7 complement(1475317..1476123) [807 bp, 268 aa] {ON} ...    59   7e-09
YDR349C Chr4 complement(1172386..1174176) [1791 bp, 596 aa] {ON}...    60   1e-08
ACR143W Chr3 (601369..602550) [1182 bp, 393 aa] {ON} Syntenic ho...    57   4e-08
NDAI0C04610 Chr3 complement(1052297..1054126) [1830 bp, 609 aa] ...    57   1e-07
Suva_2.520 Chr2 complement(929574..931370) [1797 bp, 598 aa] {ON...    56   2e-07
KAFR0E04080 Chr5 (818320..820110) [1791 bp, 596 aa] {ON} Anc_5.4...    56   2e-07
Smik_67.1 Chr67 (653..982) [330 bp, 110 aa] {ON} YGL259W (REAL)        51   2e-07
TBLA0H01680 Chr8 (385315..387144) [1830 bp, 609 aa] {ON} Anc_5.4...    54   9e-07
NCAS0F03150 Chr6 complement(630327..632264) [1938 bp, 645 aa] {O...    51   6e-06
YGL259W Chr7 (8470..8967) [498 bp, 165 aa] {ON}  YPS5Protein wit...    48   1e-05
CAGL0A02431g Chr1 complement(261812..263575) [1764 bp, 587 aa] {...    50   1e-05
YGL258W-A Chr7 (9162..9395) [234 bp, 77 aa] {ON} Putative protei...    44   6e-05
SAKL0G07524g Chr7 (624810..626708) [1899 bp, 632 aa] {ON} simila...    48   6e-05
Kpol_1059.33 s1059 (70588..72576) [1989 bp, 662 aa] {ON} (70588....    44   8e-04
KNAG0C05140 Chr3 (999304..1001100) [1797 bp, 598 aa] {ON} Anc_5....    42   0.005
SAKL0D01408g Chr4 (112123..113643) [1521 bp, 506 aa] {ON} weakly...    39   0.029
ABL123C Chr2 complement(164739..166223) [1485 bp, 494 aa] {ON} N...    38   0.085
Suva_2.472 Chr2 complement(838549..839988) [1440 bp, 479 aa] {ON...    35   0.44 
Ecym_4614 Chr4 complement(1197114..1198559) [1446 bp, 481 aa] {O...    33   1.5  
Smik_4.555 Chr4 complement(1005283..1006722) [1440 bp, 479 aa] {...    33   2.8  
YDR306C Chr4 complement(1073735..1075171) [1437 bp, 478 aa] {ON}...    33   3.0  

>Smik_4.388 Chr4 complement(705092..706885) [1794 bp, 597 aa] {ON}
           YDR144C (REAL)
          Length = 597

 Score = 1117 bits (2888), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 553/597 (92%), Positives = 553/597 (92%)

Query: 1   MKLSTIKFVVNALLLHSSMVFADSIISQSSEINDGYVKMNFQRKYGDSFESATNDTKARA 60
           MKLSTIKFVVNALLLHSSMVFADSIISQSSEINDGYVKMNFQRKYGDSFESATNDTKARA
Sbjct: 1   MKLSTIKFVVNALLLHSSMVFADSIISQSSEINDGYVKMNFQRKYGDSFESATNDTKARA 60

Query: 61  RLVTRGDDYELVELTNQNSFYSVELDIGTPPQKVTVLVDTGSSDLWVTGSDNPYCFTEGE 120
           RLVTRGDDYELVELTNQNSFYSVELDIGTPPQKVTVLVDTGSSDLWVTGSDNPYCFTEGE
Sbjct: 61  RLVTRGDDYELVELTNQNSFYSVELDIGTPPQKVTVLVDTGSSDLWVTGSDNPYCFTEGE 120

Query: 121 DTSGSSFKHVNKDNLVSVVESVFTEISYDTTMVTSVATATIGNTASTSQAMNCTTYGTFD 180
           DTSGSSFKHVNKDNLVSVVESVFTEISYDTTMVTSVATATIGNTASTSQAMNCTTYGTFD
Sbjct: 121 DTSGSSFKHVNKDNLVSVVESVFTEISYDTTMVTSVATATIGNTASTSQAMNCTTYGTFD 180

Query: 181 TSKSSTFESNKTEFSITYGDSTFASGTWGHDRLSLNNLNVTGLSFAVANETNSTVGVLGI 240
           TSKSSTFESNKTEFSITYGDSTFASGTWGHDRLSLNNLNVTGLSFAVANETNSTVGVLGI
Sbjct: 181 TSKSSTFESNKTEFSITYGDSTFASGTWGHDRLSLNNLNVTGLSFAVANETNSTVGVLGI 240

Query: 241 GLPGLESTYSGVSLSSAQKSYTYNNFPMILKNSGAIKSTAYSLFTNHSDSKHGTILFGAV 300
           GLPGLESTYSGVSLSSAQKSYTYNNFPMILKNSGAIKSTAYSLFTNHSDSKHGTILFGAV
Sbjct: 241 GLPGLESTYSGVSLSSAQKSYTYNNFPMILKNSGAIKSTAYSLFTNHSDSKHGTILFGAV 300

Query: 301 DHGKYAGDLYTIPIINTLQNRGYKDPIQFQVTLQGIGVSHGERDENMTTLTTTKIPVLLD 360
           DHGKYAGDLYTIPIINTLQNRGYKDPIQFQVTLQGIGVSHGERDENMTTLTTTKIPVLLD
Sbjct: 301 DHGKYAGDLYTIPIINTLQNRGYKDPIQFQVTLQGIGVSHGERDENMTTLTTTKIPVLLD 360

Query: 361 SGTTISYMPADLVEMIASEVGATYSPDYGYYIMDCINEMEEESSLIFDFGGFYIANWLSN 420
           SGTTISYMPADLVEMIASEVGATYSPDYGYYIMDCINEMEEESSLIFDFGGFYIANWLSN
Sbjct: 361 SGTTISYMPADLVEMIASEVGATYSPDYGYYIMDCINEMEEESSLIFDFGGFYIANWLSN 420

Query: 421 FQLLTDSRSNVCILGIAPQSDPAIILGDNFLVSTYVVYDLDNMEISMAHADFSDGGEYID 480
           FQLLTDSRSNVCILGIAPQSDPAIILGDNFLVSTYVVYDLDNMEISMAHADFSDGGEYID
Sbjct: 421 FQLLTDSRSNVCILGIAPQSDPAIILGDNFLVSTYVVYDLDNMEISMAHADFSDGGEYID 480

Query: 481 TIKDSVPSALKAPGYSSTWSTYESIVPGGNMFPTXXXXXXXXXXXXXXXATGTSSNKGQK 540
           TIKDSVPSALKAPGYSSTWSTYESIVPGGNMFPT               ATGTSSNKGQK
Sbjct: 481 TIKDSVPSALKAPGYSSTWSTYESIVPGGNMFPTSYNFSSSNSVSLSHSATGTSSNKGQK 540

Query: 541 SQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRKENGGHNLNPPFFATFVMAILYHIR 597
           SQ                             RKENGGHNLNPPFFATFVMAILYHIR
Sbjct: 541 SQTSTTAFSNSRSSSTISSTAMSSSTSSSSTRKENGGHNLNPPFFATFVMAILYHIR 597

>YDR144C Chr4 complement(744311..746101) [1791 bp, 596 aa] {ON}
           MKC7GPI-anchored aspartyl protease, member of the yapsin
           family of proteases involved in cell wall growth and
           maintenance; shares functions with Yap3p and Kex2p
          Length = 596

 Score =  900 bits (2327), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 448/596 (75%), Positives = 497/596 (83%)

Query: 1   MKLSTIKFVVNALLLHSSMVFADSIISQSSEINDGYVKMNFQRKYGDSFESATNDTKARA 60
           MKLS + FVV+ALL+ SS+V A      S   N+ YVKMNFQ+KYG SFE+A +DTK R 
Sbjct: 1   MKLSVLTFVVDALLVCSSIVDAGVTDFPSLPSNEVYVKMNFQKKYGSSFENALDDTKGRT 60

Query: 61  RLVTRGDDYELVELTNQNSFYSVELDIGTPPQKVTVLVDTGSSDLWVTGSDNPYCFTEGE 120
           RL+TR DDYELVELTNQNSFYSVELDIGTPPQKVTVLVDTGSSDLWVTGSDNPYC T+ +
Sbjct: 61  RLMTRDDDYELVELTNQNSFYSVELDIGTPPQKVTVLVDTGSSDLWVTGSDNPYCSTKKK 120

Query: 121 DTSGSSFKHVNKDNLVSVVESVFTEISYDTTMVTSVATATIGNTASTSQAMNCTTYGTFD 180
           DT+GSSFK VNKD L SVVESVFTEISYDTT+VTS ATAT  +TASTSQ ++C TYGTF+
Sbjct: 121 DTTGSSFKQVNKDALASVVESVFTEISYDTTIVTSEATATFDSTASTSQLIDCATYGTFN 180

Query: 181 TSKSSTFESNKTEFSITYGDSTFASGTWGHDRLSLNNLNVTGLSFAVANETNSTVGVLGI 240
           TSKSSTF SN TEFSI YGD+TFASGTWGHD+LSLN+LN+TGLSFAVANETNSTVGVLGI
Sbjct: 181 TSKSSTFNSNNTEFSIAYGDTTFASGTWGHDQLSLNDLNITGLSFAVANETNSTVGVLGI 240

Query: 241 GLPGLESTYSGVSLSSAQKSYTYNNFPMILKNSGAIKSTAYSLFTNHSDSKHGTILFGAV 300
           GLPGLESTYSGVSLSS QKSYTYNNFPM+LKNSG IKSTAYSLF N SDSKHGTILFGAV
Sbjct: 241 GLPGLESTYSGVSLSSVQKSYTYNNFPMVLKNSGVIKSTAYSLFANDSDSKHGTILFGAV 300

Query: 301 DHGKYAGDLYTIPIINTLQNRGYKDPIQFQVTLQGIGVSHGERDENMTTLTTTKIPVLLD 360
           DHGKYAGDLYTIPIINTLQ+RGYKDPIQFQVTLQG+G S G++++N+TTLTTTKIPVLLD
Sbjct: 301 DHGKYAGDLYTIPIINTLQHRGYKDPIQFQVTLQGLGTSKGDKEDNLTTLTTTKIPVLLD 360

Query: 361 SGTTISYMPADLVEMIASEVGATYSPDYGYYIMDCINEMEEESSLIFDFGGFYIANWLSN 420
           SGTTISYMP +LV+M+A +VGATYS  YGYYIMDCI EMEEESS+IFDFGGFY++NWLS+
Sbjct: 361 SGTTISYMPTELVKMLADQVGATYSSAYGYYIMDCIKEMEEESSIIFDFGGFYLSNWLSD 420

Query: 421 FQLLTDSRSNVCILGIAPQSDPAIILGDNFLVSTYVVYDLDNMEISMAHADFSDGGEYID 480
           FQL+TDSRSN+CILGIAPQSDP IILGDNFL +TYVVYDLDNMEISMA A+FSD GEYI+
Sbjct: 421 FQLVTDSRSNICILGIAPQSDPTIILGDNFLANTYVVYDLDNMEISMAQANFSDDGEYIE 480

Query: 481 TIKDSVPSALKAPGYSSTWSTYESIVPGGNMFPTXXXXXXXXXXXXXXXATGTSSNKGQK 540
            I+ +VPSALKAPGYSSTWSTYESIV GGNMF T               AT +SS+KGQK
Sbjct: 481 IIESAVPSALKAPGYSSTWSTYESIVSGGNMFSTAANSSISYFASTSHSATSSSSSKGQK 540

Query: 541 SQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRKENGGHNLNPPFFATFVMAILYHI 596
           +Q                             RKENGGHNLNPPFFA F+ AI +HI
Sbjct: 541 TQTSTTALSISKSTSSTSSTGMLSPTSSSSTRKENGGHNLNPPFFARFITAIFHHI 596

>Skud_4.403 Chr4 complement(715972..717744) [1773 bp, 590 aa] {ON}
           YDR144C (REAL)
          Length = 590

 Score =  834 bits (2154), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 418/596 (70%), Positives = 479/596 (80%), Gaps = 6/596 (1%)

Query: 1   MKLSTIKFVVNALLLHSSMVFADSIISQSSEINDGYVKMNFQRKYGDSFESATNDTKARA 60
           MK S   FV NA LL+SS V ADSI S S   ++ YV MNF++KYGDSFE+A+ND  A A
Sbjct: 1   MKFSAATFVANAFLLYSSTVSADSIASASIATSESYVIMNFEKKYGDSFENASNDRNAGA 60

Query: 61  RLVTRGDDYELVELTNQNSFYSVELDIGTPPQKVTVLVDTGSSDLWVTGSDNPYCFTEGE 120
            LV R DDYELV+LTN+NSFYSVELDIGTPPQK+TVLVDTGSSDLWVTGS+NPYC T+G+
Sbjct: 61  HLVRREDDYELVKLTNENSFYSVELDIGTPPQKITVLVDTGSSDLWVTGSNNPYCSTKGK 120

Query: 121 DTSGSSFKHVNKDNLVSVVESVFTEISYDTTMVTSVATATIGNTASTSQAMNCTTYGTFD 180
           DTS  SFK ++KDN  SVVESV TEISYDTT+    ATAT+ NT   SQ +NC TYGTFD
Sbjct: 121 DTSDFSFKQIHKDNPASVVESVITEISYDTTISVIEATATLDNTPLASQKINCGTYGTFD 180

Query: 181 TSKSSTFESNKTEFSITYGDSTFASGTWGHDRLSLNNLNVTGLSFAVANETNSTVGVLGI 240
           +SKSSTFESNKT+FSITYGDSTFASGTWGHD+L+LNNLNVTGLSFAVANETNSTVGVLGI
Sbjct: 181 SSKSSTFESNKTKFSITYGDSTFASGTWGHDQLNLNNLNVTGLSFAVANETNSTVGVLGI 240

Query: 241 GLPGLESTYSGVSLSSAQKSYTYNNFPMILKNSGAIKSTAYSLFTNHSDSKHGTILFGAV 300
           GLPGLESTYSGVSLSS QKSYTYNNFPM+LKNSGAIKS+AYSLF+N S+S+HGTILFGAV
Sbjct: 241 GLPGLESTYSGVSLSSVQKSYTYNNFPMVLKNSGAIKSSAYSLFSNKSNSEHGTILFGAV 300

Query: 301 DHGKYAGDLYTIPIINTLQNRGYKDPIQFQVTLQGIGVSHGERDENMTTLTTTKIPVLLD 360
           DHGKY GDLYTIPIIN LQN GYKDPIQF VTLQGI V+ G+  +N TTLTTTKIP LLD
Sbjct: 301 DHGKYTGDLYTIPIINILQNNGYKDPIQFHVTLQGIAVATGDGMDNATTLTTTKIPALLD 360

Query: 361 SGTTISYMPADLVEMIASEVGATYSPDYGYYIMDCINEMEEESSLIFDFGGFYIANWLSN 420
           SGTTISY+P  LVE++A +VGA+YS +YGYY+M+CI+E++++ +++FDFGGF+I++WLSN
Sbjct: 361 SGTTISYLPVKLVELLADKVGASYSSEYGYYVMNCIHEVKKDITVVFDFGGFHISSWLSN 420

Query: 421 FQLLTDSRSNVCILGIAPQSDPAIILGDNFLVSTYVVYDLDNMEISMAHADFSDGGEYID 480
           FQL TDS S+VCILG APQSDP +ILGDNFLVSTY+VYDLDNMEISMA+ADFSD  EYID
Sbjct: 421 FQLFTDSSSDVCILGFAPQSDPTVILGDNFLVSTYIVYDLDNMEISMANADFSDNDEYID 480

Query: 481 TIKDSVPSALKAPGYSSTWSTYESIVPGGNMFPTXXXXXXXXXXXXXXXATGTSSNKGQK 540
            I+ +VPSALKAP YS+TWSTYESIVPGGN+F T               AT +SS KGQK
Sbjct: 481 VIESAVPSALKAPNYSNTWSTYESIVPGGNIFSTSSNVSMSGSGSRSHSATSSSSLKGQK 540

Query: 541 SQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRKENGGHNLNPPFFATFVMAILYHI 596
            Q                             RKENGG NL+PPFFA  +  ILY+I
Sbjct: 541 LQ------TSTTNSRSSAATSVSSPTLSSSTRKENGGDNLSPPFFARLITTILYYI 590

>Suva_2.305 Chr2 complement(539604..541397) [1794 bp, 597 aa] {ON}
           YDR144C (REAL)
          Length = 597

 Score =  714 bits (1842), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 381/600 (63%), Positives = 456/600 (76%), Gaps = 7/600 (1%)

Query: 1   MKLSTIKFVVNALLLHSSMVFADSIISQSSEINDGYVKMNFQRKYGDSFESATNDTKARA 60
           MK S I    NA L +SSM  ADS+ S S    D YV++ FQ+KYGDSFE+A+++ K  A
Sbjct: 1   MKFSAITLATNAFLFYSSMANADSLASPSLAAGDNYVRIQFQKKYGDSFENASSNKKTEA 60

Query: 61  RLVTRGDDYELVELTNQNSFYSVELDIGTPPQKVTVLVDTGSSDLWVTGSDNPYCFTEGE 120
           RLV RGDDYE+V+L+NQNSFYSV+LDIGTP QKVTVLVDTGSSDLWVTGS+NPYC T+  
Sbjct: 61  RLVKRGDDYEVVDLSNQNSFYSVDLDIGTPSQKVTVLVDTGSSDLWVTGSNNPYCSTKSG 120

Query: 121 DTSGSSFKHVNKDNLVS----VVESVFTEISYDTTMVTSVATATIGNTASTSQAMNCTTY 176
            TS SS +  ++DN++S    VV+SV +EISYDTT+  + ATAT  +T+S  Q ++CTTY
Sbjct: 121 HTSSSSKERKDEDNILSLVQSVVQSVASEISYDTTITDTDATATQDSTSSALQTIDCTTY 180

Query: 177 GTFDTSKSSTFESNKTEFSITYGDSTFASGTWGHDRLSLNNLNVTGLSFAVANETNSTVG 236
           G FD+SKSSTF+SNKT+FSITYGD TFASGTWGHD+L+LNNLNVTGLSFAVANETNSTVG
Sbjct: 181 GVFDSSKSSTFQSNKTDFSITYGDLTFASGTWGHDQLNLNNLNVTGLSFAVANETNSTVG 240

Query: 237 VLGIGLPGLESTYSGVSLSSAQKSYTYNNFPMILKNSGAIKSTAYSLFTNHSDSKHGTIL 296
           VLGIGL GLESTYSG +LSSAQ+SYTYNNFPM+LKNSGAIKS AYSLF N +++KHG+IL
Sbjct: 241 VLGIGLAGLESTYSGATLSSAQESYTYNNFPMVLKNSGAIKSAAYSLFLNETNAKHGSIL 300

Query: 297 FGAVDHGKYAGDLYTIPIINTLQNRGYKDPIQFQVTLQGIGVSHGERDENMTTLTTTKIP 356
           FGAVDHGKY+GDLYTIPIINTLQ+ GYKDPIQFQVTLQG+G++ G  D   TT+TTTKIP
Sbjct: 301 FGAVDHGKYSGDLYTIPIINTLQDHGYKDPIQFQVTLQGLGLAKG--DSESTTITTTKIP 358

Query: 357 VLLDSGTTISYMPADLVEMIASEVGATYSPDYGYYIMDCINEMEEESSLIFDFGGFYIAN 416
            LLDSGTTISYMP +L+EM+A ++GA+YS   GYY+MDCI + +++ +++FDFGGFYI+ 
Sbjct: 359 ALLDSGTTISYMPVELMEMLADKLGASYSSKVGYYLMDCITDTDDDINVVFDFGGFYISG 418

Query: 417 WLSNFQLLTDSRSNVCILGIAPQSDPAIILGDNFLVSTYVVYDLDNMEISMAHADFSDGG 476
            LS++QL  DS S+VCILG APQSD  +ILGDNFL + YVVYDLDNMEISMA  D S   
Sbjct: 419 NLSSYQLSADSSSDVCILGFAPQSDSTVILGDNFLSNAYVVYDLDNMEISMAQVDLSGRS 478

Query: 477 EYIDTIKDSVPSALKAPGYSSTWSTYESIVPGGNMFPTXXXXXXXXXXXXXXXATGTSSN 536
           E ID I+DSVPSA+KAP YSSTWST  SIV GG++F                  T TSS+
Sbjct: 479 EDIDVIEDSVPSAVKAPSYSSTWSTDGSIVSGGDIFTVSSGSSNQRSGSGSYSTTSTSSS 538

Query: 537 KGQKSQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRKENGGHNLNPPFFATFVMAILYHI 596
           KGQK Q                             +KEN GH LNPPFFA F+  +L +I
Sbjct: 539 KGQKDQ-GSTTYAKSGAGSTASSTMASSSTSASSTKKENVGHTLNPPFFAKFITIVLSYI 597

>YLR120C Chr12 complement(386511..388220) [1710 bp, 569 aa] {ON}
           YPS1Aspartic protease, member of the yapsin family of
           proteases involved in cell wall growth and maintenance;
           attached to the plasma membrane via a
           glycosylphosphatidylinositol (GPI) anchor
          Length = 569

 Score =  514 bits (1325), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 283/531 (53%), Positives = 366/531 (68%), Gaps = 31/531 (5%)

Query: 1   MKLSTIKFVVNALLLHSSMVFADSIISQSSEIND----GYVKMNFQRKYGDSFESATNDT 56
           MKL T++  V + L  S ++    II  +++ +D     +VK+ F + YGDS E+  +D 
Sbjct: 1   MKLKTVRSAVLSSLFASQVL--GKIIPAANKRDDDSNSKFVKLPFHKLYGDSLENVGSDK 58

Query: 57  KARARLVTRGDDYELVELTNQNSFYSVELDIGTPPQKVTVLVDTGSSDLWVTGSDNPYCF 116
           K   RL+ R D YE + +TNQ SFYSV+L++GTPPQ VTVLVDTGSSDLW+ GSDNPYC 
Sbjct: 59  KPEVRLLKRADGYEEIIITNQQSFYSVDLEVGTPPQNVTVLVDTGSSDLWIMGSDNPYC- 117

Query: 117 TEGEDTSGSSFKHV--NKDNLVS---VVESV--FTEISYDTTMVTSVATATIGNTASTSQ 169
               ++ GSS + V   +D+  S   ++  +  F  ++   + +   AT   G + + +Q
Sbjct: 118 --SSNSMGSSRRRVIDKRDDSSSGGSLINDINPFGWLTGTGSAIGPTATGLGGGSGTATQ 175

Query: 170 A-------MNCTTYGTFDTSKSSTFESNKTEFSITYGDSTFASGTWGHDRLSLNNLNVTG 222
           +       M+C  YGTF TS SSTF SN T FSI+YGD TFASGT+G D L L++LNVTG
Sbjct: 176 SVPASEATMDCQQYGTFSTSGSSTFRSNNTYFSISYGDGTFASGTFGTDVLDLSDLNVTG 235

Query: 223 LSFAVANETNSTVGVLGIGLPGLESTYSGVSLSSAQKSYTYNNFPMILKNSGAIKSTAYS 282
           LSFAVANETNST+GVLGIGLP LE TYSG + S + K+Y Y+NFP++LKNSGAIKS  YS
Sbjct: 236 LSFAVANETNSTMGVLGIGLPELEVTYSGSTASHSGKAYKYDNFPIVLKNSGAIKSNTYS 295

Query: 283 LFTNHSDSKHGTILFGAVDHGKYAGDLYTIPIINTLQNRGYKDPIQFQVTLQGIGVSHGE 342
           L+ N SD+ HGTILFGAVDH KY G LYTIPI+NTL   G+  PIQF VT+ GIG+S  +
Sbjct: 296 LYLNDSDAMHGTILFGAVDHSKYTGTLYTIPIVNTLSASGFSSPIQFDVTINGIGIS--D 353

Query: 343 RDENMTTLTTTKIPVLLDSGTTISYMPADLVEMIASEVGATYSPDYGYYIMDCINEMEEE 402
              +  TLTTTKIP LLDSGTT++Y+P  +V MIA+E+GA YS   GYY++DC ++   E
Sbjct: 354 SGSSNKTLTTTKIPALLDSGTTLTYLPQTVVSMIATELGAQYSSRIGYYVLDCPSDDSME 413

Query: 403 SSLIFDFGGFYIANWLSNFQLLTDSRSNVCILGIAPQS-DPAIILGDNFLVSTYVVYDLD 461
             ++FDFGGF+I   LS+F L   S    C+LGI P S D   ILGD+FL + YVVYDL+
Sbjct: 414 --IVFDFGGFHINAPLSSFIL---STGTTCLLGIIPTSDDTGTILGDSFLTNAYVVYDLE 468

Query: 462 NMEISMAHADFSDGGEYIDTIKDSVPSALKAPGYSSTWSTYESIVPGGNMF 512
           N+EISMA A ++   E I+ I  SVPSA+KAPGY++TWST  SIV GGN+F
Sbjct: 469 NLEISMAQARYNTTSENIEIITSSVPSAVKAPGYTNTWSTSASIVTGGNIF 519

>Skud_12.192 Chr12 complement(369422..371131) [1710 bp, 569 aa] {ON}
           YLR120C (REAL)
          Length = 569

 Score =  514 bits (1325), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 276/525 (52%), Positives = 353/525 (67%), Gaps = 20/525 (3%)

Query: 1   MKLSTIKFVVNALL--LHSSMVFADSIISQSSEINDGYVKMNFQRKYGDSFESATNDTKA 58
           MKL+T++  V + L  L +      +   +  + N  +VK+ F + YGD+ +    D K 
Sbjct: 1   MKLTTVRSAVLSSLFALQTLAKIIPAASKRDDDSNSKFVKLPFHKLYGDTRDDVGTDKKP 60

Query: 59  RARLVTRGDDYELVELTNQNSFYSVELDIGTPPQKVTVLVDTGSSDLWVTGSDNPYC--- 115
             RL+ R D YE + +TNQ SFYSV+L++GTPPQ VTVLVDTGSSDLW+ GS+NPYC   
Sbjct: 61  EVRLLKRADGYEEIIITNQQSFYSVDLEVGTPPQNVTVLVDTGSSDLWIMGSNNPYCSSG 120

Query: 116 --------FTEGEDTSGSSFKHVNKDNLVSVVESVFTEISYDTTMVTSVATATIGNTAST 167
                        D S SS   VN  N    +    + I    T     +     +  ++
Sbjct: 121 SMSSSRRRVINKRDDSSSSGALVNDINPFGWLTGTGSAIGPTATGSGGGSGTATQSVPAS 180

Query: 168 SQAMNCTTYGTFDTSKSSTFESNKTEFSITYGDSTFASGTWGHDRLSLNNLNVTGLSFAV 227
              MNC  +GTF TS SSTF SN T FSI+YGD TFASGT+G D L L++LNVTGLSFAV
Sbjct: 181 EATMNCQEFGTFTTSDSSTFRSNNTYFSISYGDGTFASGTFGTDILDLSDLNVTGLSFAV 240

Query: 228 ANETNSTVGVLGIGLPGLESTYSGVSLSSAQKSYTYNNFPMILKNSGAIKSTAYSLFTNH 287
           ANETNST+GVLGIGLP LE TYSG + SS+++ YTY+NFPM+LKNSGAIK+ AYSL+ N 
Sbjct: 241 ANETNSTMGVLGIGLPELEVTYSGSTASSSRRPYTYDNFPMVLKNSGAIKTNAYSLYLND 300

Query: 288 SDSKHGTILFGAVDHGKYAGDLYTIPIINTLQNRGYKDPIQFQVTLQGIGVSHGERDENM 347
           SD+KHGTILFGAVDH KYAG LYT+PI+NTL   G+  PIQF VT+ GIG+S+   D + 
Sbjct: 301 SDAKHGTILFGAVDHSKYAGTLYTVPIVNTLSASGFSSPIQFDVTINGIGISY--PDNSQ 358

Query: 348 TTLTTTKIPVLLDSGTTISYMPADLVEMIASEVGATYSPDYGYYIMDCINEMEEESSLIF 407
            TLTTT+IP LLDSGTT++Y+P  +V MIA E+ A YS   GYY++DC +     + ++F
Sbjct: 359 KTLTTTQIPALLDSGTTLTYLPQAVVAMIADELDAQYSSRLGYYVLDCPSN-SNSTQIVF 417

Query: 408 DFGGFYIANWLSNFQLLTDSRSNVCILGIAPQSDPAIILGDNFLVSTYVVYDLDNMEISM 467
           DFGGF+I   LS+F L   +  N+C+LGI   +D   ILGD+FL + YVVYDLDN+EISM
Sbjct: 418 DFGGFHINASLSSFIL---NAGNICLLGII-ATDDTTILGDSFLTNAYVVYDLDNLEISM 473

Query: 468 AHADFSDGGEYIDTIKDSVPSALKAPGYSSTWSTYESIVPGGNMF 512
           A A ++   E I+ I  S+PSA+KAPGY+STWST  SIV GGN+F
Sbjct: 474 AQAQYNITNENIEVITSSIPSAIKAPGYTSTWSTSASIVTGGNIF 518

>Smik_12.186 Chr12 complement(367771..369489) [1719 bp, 572 aa] {ON}
           YLR120C (REAL)
          Length = 572

 Score =  510 bits (1313), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 271/492 (55%), Positives = 347/492 (70%), Gaps = 25/492 (5%)

Query: 36  YVKMNFQRKYGDSFESATNDTKARARLVTRGDDYELVELTNQNSFYSVELDIGTPPQKVT 95
           +VK+ F + YGDS ++   D K  A L  R D YE + +TNQ SFYSVELD+G+PPQ VT
Sbjct: 41  FVKLPFHKLYGDSLDNVGRDKKPEAHLFKRADGYEEIIITNQQSFYSVELDVGSPPQNVT 100

Query: 96  VLVDTGSSDLWVTGSDNPYCFTEGEDTSGSSFKHV--NKDNLVS---VVESV--FTEISY 148
           VLVDTGSSDLW+ GS+NPYC     DT  +S + V   +D+  S   +V  +  F  ++ 
Sbjct: 101 VLVDTGSSDLWIMGSNNPYC---SSDTRSNSRRRVIDKRDDSSSSGALVNDINPFGWLTG 157

Query: 149 DTTMVTSVATATIGNTASTSQA-------MNCTTYGTFDTSKSSTFESNKTEFSITYGDS 201
              ++   AT + G++ + +Q+       M+C  YGTF TS SSTF SN T FSI+YGD 
Sbjct: 158 TGGLIGPTATGSGGSSETATQSVPASEATMDCKEYGTFTTSDSSTFRSNNTYFSISYGDG 217

Query: 202 TFASGTWGHDRLSLNNLNVTGLSFAVANETNSTVGVLGIGLPGLESTYSGVSLSSAQKSY 261
           TFASGT+G D L L++LNVTGLSFAVANETNST+GVLGIGLP LE TYSG + S  ++ +
Sbjct: 218 TFASGTFGTDVLDLSDLNVTGLSFAVANETNSTMGVLGIGLPELEVTYSGSTASRGRRPF 277

Query: 262 TYNNFPMILKNSGAIKSTAYSLFTNHSDSKHGTILFGAVDHGKYAGDLYTIPIINTLQNR 321
            Y+NFP++LKNSGAIK+ AYSL+ N SD++HGTILFGAVDH KY G LYTIPI+NTL   
Sbjct: 278 KYDNFPIVLKNSGAIKTNAYSLYLNDSDAEHGTILFGAVDHSKYTGTLYTIPIVNTLSAS 337

Query: 322 GYKDPIQFQVTLQGIGVSHGERDENMTTLTTTKIPVLLDSGTTISYMPADLVEMIASEVG 381
           G+  PIQF VT+ GIGVS  +  E   TLTTTKIP LLDSGTT++Y+P  +V +IA E+G
Sbjct: 338 GFSSPIQFDVTINGIGVSDSKNGEK--TLTTTKIPALLDSGTTLTYLPETVVALIADEIG 395

Query: 382 ATYSPDYGYYIMDCINEMEEESSLIFDFGGFYIANWLSNFQLLTDSRSNVCILGIAPQSD 441
           A YS   GYY++DC    ++ + ++FDFGGF+I   LS+F L T S    C+LGI P SD
Sbjct: 396 AQYSYRLGYYVLDC--PSDDSTQIVFDFGGFHINASLSSFILSTGS---TCLLGIIPTSD 450

Query: 442 -PAIILGDNFLVSTYVVYDLDNMEISMAHADFSDGGEYIDTIKDSVPSALKAPGYSSTWS 500
               ILGD+FL + YVVYDLDN+EISMA A ++   E I+ I  S+PSA+KAPGY++TWS
Sbjct: 451 NTGTILGDSFLTNAYVVYDLDNLEISMAQAQYNTTTENIEVISSSIPSAVKAPGYTNTWS 510

Query: 501 TYESIVPGGNMF 512
           T  +IV GGN+F
Sbjct: 511 TSATIVTGGNIF 522

>Suva_10.211 Chr10 complement(394404..396104) [1701 bp, 566 aa] {ON}
           YLR120C (REAL)
          Length = 566

 Score =  506 bits (1304), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 283/533 (53%), Positives = 366/533 (68%), Gaps = 39/533 (7%)

Query: 1   MKLSTIKFVVNALL--LHSSMVFADSIISQSSEINDG-----YVKMNFQRKYGDSFESAT 53
           M+L+TI+   +ALL  L +S   A  +I  +++ + G     +VK++F + YGDS ++A 
Sbjct: 1   MRLATIR---SALLSSLFASQTLA-KLIPVATDGDGGDTGSKFVKLSFDKLYGDSLDTAG 56

Query: 54  NDTKARARLVTRGDDYELVELTNQNSFYSVELDIGTPPQKVTVLVDTGSSDLWVTGSDNP 113
            D K   RL  R D YE + +TNQ SFYSV+L++GTP Q +TVLVDTGSSDLW+ GS NP
Sbjct: 57  RDKKPEVRLSKRADGYEEIIITNQQSFYSVDLEVGTPAQNITVLVDTGSSDLWIMGSSNP 116

Query: 114 YCFTE--------GEDTSGSSFKHVNKDNLVSVVESVFTEISYDTTMVTSVATATIGNTA 165
           YC ++          DTS SS   VN  N        F  ++   ++  + ATAT   TA
Sbjct: 117 YCSSDDSSKYVLRKRDTSSSSGDLVNDIN-------PFGWLTETGSVTGATATATGSGTA 169

Query: 166 STS-----QAMNCTTYGTFDTSKSSTFESNKTEFSITYGDSTFASGTWGHDRLSLNNLNV 220
           + S       M+C  YGTF +S SSTF+SN T F I+YGD TFA+GT+G D L+L++LNV
Sbjct: 170 TQSVPASEATMDCEEYGTFTSSDSSTFKSNNTAFEISYGDGTFAAGTFGTDVLNLSDLNV 229

Query: 221 TGLSFAVANETNSTVGVLGIGLPGLESTYSGVSLSSAQKSYTYNNFPMILKNSGAIKSTA 280
           TGLSFAVANETNST+GVLGIGLP LE TYSG S S+  KSY Y+NFP++LKNSGAIKS A
Sbjct: 230 TGLSFAVANETNSTMGVLGIGLPSLEVTYSGSSASNGGKSYKYDNFPIVLKNSGAIKSNA 289

Query: 281 YSLFTNHSDSKHGTILFGAVDHGKYAGDLYTIPIINTLQNRGYKDPIQFQVTLQGIGVSH 340
           YSL+ N SD+KHGTILFG VDH KY+G LYT+ ++NTL   G+  PIQF +TL G+G+  
Sbjct: 290 YSLYLNDSDAKHGTILFGGVDHNKYSGTLYTVALVNTLS--GFTSPIQFDITLNGLGIID 347

Query: 341 GERDENMTTLTTTKIPVLLDSGTTISYMPADLVEMIASEVGATYSPDYGYYIMDCINEME 400
              DE   TLTTTKIPVLLDSGTT++Y+P ++VE+IA  VGA YS   GYY+M+C +  +
Sbjct: 348 DNGDEK--TLTTTKIPVLLDSGTTLTYLPVEMVELIAENVGAQYSSRIGYYVMECPSS-D 404

Query: 401 EESSLIFDFGGFYIANWLSNFQLLTDSRSNVCILGIAPQSDP-AIILGDNFLVSTYVVYD 459
             + ++FDFGGF+I   LS+F L T    N C+LGI P SD    ILGD+FL + YVVYD
Sbjct: 405 NSTEIVFDFGGFHINASLSSFILST--SGNTCLLGIIPTSDSTGSILGDSFLTNAYVVYD 462

Query: 460 LDNMEISMAHADFSDGGEYIDTIKDSVPSALKAPGYSSTWSTYESIVPGGNMF 512
           L+N+EISMA A ++   E I+ I  SVP+A+KAPGY++TWST  SI  GGN+F
Sbjct: 463 LENLEISMAQAKYNVTSEDIEVISTSVPNAVKAPGYTNTWSTTASIATGGNIF 515

>SAKL0H15664g Chr8 (1365886..1367556) [1671 bp, 556 aa] {ON} similar
           to uniprot|P12630 Saccharomyces cerevisiae YIL015W BAR1
           Aspartyl protease secreted into the periplasmic space of
           mating type a cells, cleaves and inactivates alpha
           factor allowing cells to recover from
           alpha-factor-induced cell cycle arrest and to YLR121C
           uniprot|Q12303 Saccharomyces cerevisiae YLR121C YPS3
           Aspartic protease, attached to the plasma membrane via a
           glycosylphosphatidylinositol (GPI) anchor and to YLR120C
           uniprot|P32329 Saccharomyces cerevisiae YLR120C YPS1
           Aspartic protease, attached to the plasma membrane via a
           glycosylphosphatidylinositol (GPI) anchor and to YDR144C
           uniprot|P53379 Saccharomyces cerevisiae YDR144C MKC7
           GPI- anchored aspartyl protease (yapsin) involved in
           protein processing; shares functions with Yap3p and
           Kex2p and to YIR039C uniprot|P40583 Saccharomyces
           cerevisiae YIR039C YPS6 Putative GPI-anchored aspartic
           protease, member on vGLC.1466.
          Length = 556

 Score =  488 bits (1257), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 265/523 (50%), Positives = 358/523 (68%), Gaps = 25/523 (4%)

Query: 6   IKFVVNALLLHSSMVFADSIISQSSEINDGYVKMNFQRKYGDSFESATNDTKARARLVTR 65
           ++F + A+ L  S +   S++ + S     YV + F +  G ++E ++   K  A L  R
Sbjct: 1   MRFDIIAISLLLSQLVTASVLKKRSP---KYVSLPFDKSRGSTYEESSKHNKPYAVLSKR 57

Query: 66  GDDYELVELTNQNSFYSVELDIGTPPQKVTVLVDTGSSDLWVTGSDNPYC---------- 115
            D ++ +EL NQ SF+SVEL+IGTP Q VTVLVDTGSSDLWVTGS+NPYC          
Sbjct: 58  DDGFQEIELKNQVSFFSVELEIGTPRQNVTVLVDTGSSDLWVTGSNNPYCRAGSVGNRRN 117

Query: 116 ----FTEGEDTSGSSFKHVN-KDNLVSVVESVFTEISYDTTMVTSVATATIGNTASTSQA 170
                +     S ++ K VN K + +S V S  T    +T   +  A+AT  N+ S++ A
Sbjct: 118 DASSGSGSGSGSSNNKKRVNIKRDEISSVRSWLTASGTNTRTQSGSASATRANSLSSALA 177

Query: 171 -MNCTTYGTFDTSKSSTFESNKTEFSITYGDSTFASGTWGHDRLSLNNLNVTGLSFAVAN 229
            ++C+ YGTF+TS SSTF SN T F I YGDS++A GTWG D L L+++++ GLSFAVAN
Sbjct: 178 TIDCSQYGTFNTSASSTFSSNDTLFVIFYGDSSYAYGTWGQDELYLHDIDIGGLSFAVAN 237

Query: 230 ETNSTVGVLGIGLPGLESTYSGVSLSSAQKSYTYNNFPMILKNSGAIKSTAYSLFTNHSD 289
           +TNSTVGVLGIGLPGLE TYSG + SSA+  Y Y+NFP+ILK +  IK+ AYSLF N ++
Sbjct: 238 QTNSTVGVLGIGLPGLEVTYSGYA-SSARNRYQYDNFPLILKRNNVIKANAYSLFLNSTN 296

Query: 290 SKHGTILFGAVDHGKYAGDLYTIPIINTLQNRGYKDPIQFQVTLQGIGVSHGERDENMTT 349
           S  G++LFGAVDH KY+G LYT+P++NTL++ GY DPIQF+V +QGIGV     +   TT
Sbjct: 297 SSSGSLLFGAVDHSKYSGQLYTVPLLNTLESSGYTDPIQFEVAVQGIGVRTSGSN---TT 353

Query: 350 LTTTKIPVLLDSGTTISYMPADLVEMIASEVGATYSPDYGYYIMDCINEMEEESSLIFDF 409
           LTTT IP LLDSG T+SY P  + EMIA  + ATYS  YGYYI+DC +  ++++ +I+DF
Sbjct: 354 LTTTVIPALLDSGATLSYFPVQVAEMIADALDATYSSSYGYYIVDCPSS-DDDTEIIYDF 412

Query: 410 GGFYIANWLSNFQLLTDSRSNVCILGIAPQSDPAIILGDNFLVSTYVVYDLDNMEISMAH 469
           GGF+IA+ L+++ +LT +R ++C+LGI PQ+    ILGD FL S YVVYDLDN EIS+A 
Sbjct: 413 GGFHIASKLTDY-ILTTNRPSICVLGIVPQNSNRFILGDVFLTSAYVVYDLDNFEISLAQ 471

Query: 470 ADFSDGGEYIDTIKDSVPSALKAPGYSSTWSTYESIVPGGNMF 512
           A++  G E I+ I +SVPSA+KAP YSST  +  S   GG++F
Sbjct: 472 ANYEGGDEQIEVISESVPSAIKAPSYSSTRFSSASASTGGDIF 514

>CAGL0M04191g Chr13 complement(461446..463251) [1806 bp, 601 aa]
           {ON} similar to uniprot|P32329 Saccharomyces cerevisiae
           YLR120c YAP3 or uniprot|P53379 Saccharomyces cerevisiae
           YDR144c MKC7 or uniprot|Q12303 Saccharomyces cerevisiae
           YLR121c YPS3
          Length = 601

 Score =  490 bits (1261), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 260/500 (52%), Positives = 344/500 (68%), Gaps = 44/500 (8%)

Query: 36  YVKMNFQRKYGDSFESATN-DTKARARLVTRGDDYELVELTNQNSFYSVELDIGTPPQKV 94
           YVK++F + YG++FE+A    ++A  R+  R + YE V++TNQNSFYSV L++GTPPQ V
Sbjct: 27  YVKLDFDKYYGETFETAKRGRSQADIRVNKRANGYEEVQITNQNSFYSVTLEVGTPPQSV 86

Query: 95  TVLVDTGSSDLWVTGSDNPYCFTEGEDTSGSSFKHV------------------------ 130
            VLVDTGSSDLW+TGSDNPYC      ++G+S K++                        
Sbjct: 87  VVLVDTGSSDLWITGSDNPYC----RGSTGTSGKNMLLEAELKRALEDARDIAKERTTLA 142

Query: 131 -----NKDNLVSVV---ESVFTEISYDTTMVTSVATATIGNTASTSQA-MNCTTYGTFDT 181
                + D L+S +   + +       T  +T  A  T   T++ ++A +NC  YGTFDT
Sbjct: 143 PRDDEHNDGLLSWLTGSDGLLGGQGGTTITLTDSAQPTAAGTSNGARATINCAKYGTFDT 202

Query: 182 SKSSTFESNKTEFSITYGDSTFASGTWGHDRLSLNNLNVTGLSFAVANETNSTVGVLGIG 241
           SKSST+ SN T F I YGDSTFASGTWG D L L++LNVTGLSFAVAN TNSTVGVLGIG
Sbjct: 203 SKSSTWHSNDTAFMIQYGDSTFASGTWGMDNLHLSDLNVTGLSFAVANRTNSTVGVLGIG 262

Query: 242 LPGLESTYSGVSLSSAQKSYTYNNFPMILKNSGAIKSTAYSLFTNHSDSKHGTILFGAVD 301
           LP LE TYSG +  S Q+ Y Y+NFP++L  +GAIKS +YSLF N++ ++ G++LFGAVD
Sbjct: 263 LPALEVTYSGRTAVSGQRPYQYDNFPLVLLRNGAIKSNSYSLFLNNASAETGSVLFGAVD 322

Query: 302 HGKYAGDLYTIPIINTLQNRGYKDPIQFQVTLQGIGVSHGERDENMTTLTTTKIPVLLDS 361
           H KY GDLYTIP++NT  ++GYK+PIQF+VTL G+G+S    +   TT+TTTKIP LLDS
Sbjct: 323 HSKYLGDLYTIPMVNTYASQGYKNPIQFEVTLNGLGISSSSDN---TTITTTKIPALLDS 379

Query: 362 GTTISYMPADLVEMIASEVGATYSPDYGYYIMDCINEMEEESSLIFDFGGFYIANWLSNF 421
           GTT++Y+P  LV  I  ++ ATYS   GYY+  C ++  +++ ++FDFGGF+I   ++NF
Sbjct: 380 GTTLTYLPQALVTRIVQKLQATYSNRAGYYVFSCPSQ-SDDTEVVFDFGGFHINAPITNF 438

Query: 422 QLLTDSRSNVCILGIAPQSDPAIILGDNFLVSTYVVYDLDNMEISMAHADFSDGGEYIDT 481
             +  S  + CILGI PQS   IILGD+FL S YVVYDL+N EISMA A+++ G E I+ 
Sbjct: 439 --IIGSSGDSCILGIMPQSGGGIILGDSFLNSAYVVYDLENYEISMAQANYAGGQEDIEV 496

Query: 482 IKDSVPSALKAPGYSSTWST 501
           I  SVP A++APG+SSTWST
Sbjct: 497 ISSSVPGAVRAPGFSSTWST 516

>NCAS0B03560 Chr2 complement(629374..631134) [1761 bp, 586 aa] {ON} 
          Length = 586

 Score =  486 bits (1250), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 271/541 (50%), Positives = 359/541 (66%), Gaps = 42/541 (7%)

Query: 1   MKLSTIKFVVNALLLHSSMVFADSIISQSSEINDGYVKMNFQRKYGDSFESATNDTKARA 60
           M+LSTIK++ ++ LL ++++ +     ++++ +  YV + F +  GDS+E AT D K   
Sbjct: 1   MRLSTIKYIFSSSLLFTNILASTIPEHETTDQSSKYVILPFNKLVGDSYEDATPDKKPHF 60

Query: 61  RLVTRGDDYELVELTNQNSFYSVELDIGTPPQKVTVLVDTGSSDLWVTGSDNPYCFT--- 117
            LV R   YE V + N+ SFYSVEL IGTP QK+TVLVDTGSSDLW+ GSDNPYC +   
Sbjct: 61  ALVKRDGSYENVAIKNEQSFYSVELLIGTPSQKITVLVDTGSSDLWIMGSDNPYCASTSN 120

Query: 118 -----EGEDTS---GSSFKHVNKDNLVSVVESVFTEISY----DTTMVTSV-ATATIG-- 162
                  +D++   G  F  +   NL S +   F++ S+    +T + T V +T T+G  
Sbjct: 121 GKNVMRKDDSNLPDGILFTEITVTNL-SDLTGFFSDFSFIPMSETDIPTGVTSTNTVGGP 179

Query: 163 -------NTASTSQAMNCTTYGTFDTSKSSTFESNKTEFSITYGDSTFASGTWGHDRLSL 215
                  N A + + ++C+ YGTFD ++SSTF++N T F  +YGDSTFASGTW HD L+L
Sbjct: 180 VFPTQTNNIALSERTIDCSQYGTFDKNQSSTFQTNFTSFLTSYGDSTFASGTWAHDVLNL 239

Query: 216 NNLNVTGLSFAVANETNSTVGVLGIGLPGLESTYSGVSLSSAQKSYTYNNFPMILKNSGA 275
             LN+TGLSFAVAN +NSTVGVLGIGLPGLE+TYSG    S  K Y YNNFPM+LK SGA
Sbjct: 240 GGLNITGLSFAVANMSNSTVGVLGIGLPGLETTYSG----STSKLYQYNNFPMLLKQSGA 295

Query: 276 IKSTAYSLFTNHSDSKHGTILFGAVDHGKYAGDLYTIPIINTLQNRGYKDPIQFQVTLQG 335
           I ST+YSLF +  D+K G++LFGAVDH KY G+LYT+P++N L ++GY +PIQF VTL G
Sbjct: 296 IDSTSYSLFLDDLDAKQGSVLFGAVDHTKYVGNLYTVPMVNILASKGYPNPIQFDVTLAG 355

Query: 336 IGVSHGERDENMTTLTTTKIPVLLDSGTTISYMPADLVEMIASEVGATYSPDYGYYIMDC 395
           IG+   + D    T+TT K P LLDSGTTISY P ++V+ IA ++GA YS   G+Y M C
Sbjct: 356 IGI---QNDSKNYTVTTNKFPALLDSGTTISYFPQEVVQTIARQLGARYSSALGFYAMSC 412

Query: 396 INEMEEESSLIFDFGGFYIANWLSNFQLLTDSRSNVCILGIAPQSDPAIILGDNFLVSTY 455
            N +   ++ +FDFGGF+I   +S+F L T    N C+L +APQ    I+LGD FL   Y
Sbjct: 413 -NGVSSSTNFVFDFGGFHITGPVSDFLLPT--SGNTCVLAMAPQESQHILLGDIFLTHAY 469

Query: 456 VVYDLDNMEISMAHADFSDGGEYIDT----IKDSVPSALKAPGYSSTWSTYESIVPGGNM 511
           VVYDLDN EIS+A A+   G + +D+    I DSVPSA+KAP YS TWS    I  GGN+
Sbjct: 470 VVYDLDNYEISLAQAN--TGTQNLDSNIQIISDSVPSAIKAPLYSETWSKAMPISTGGNI 527

Query: 512 F 512
           F
Sbjct: 528 F 528

>Kwal_26.7254 s26 (280683..282395) [1713 bp, 570 aa] {ON} YLR120C
           (YPS1) - GPI-anchored aspartic protease [contig 47] FULL
          Length = 570

 Score =  468 bits (1205), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 246/522 (47%), Positives = 344/522 (65%), Gaps = 27/522 (5%)

Query: 6   IKFVVNALLLHSSMVFADSIIS-QSSEIND--GYVKMNFQRKYGDSFESATNDTKARARL 62
           +KF  +A  L  S + + + +S Q  E  D   YV+++F +  GD+ E A      RA L
Sbjct: 1   MKFSASAAFLAISGLVSSTAVSLQEIEPQDVSKYVRISFDKLRGDTAEDARVGLMPRAEL 60

Query: 63  VTRGDDYELVELTNQNSFYSVELDIGTPPQKVTVLVDTGSSDLWVTGSDNPYCFTEGEDT 122
           V R D  E +++ NQN+FYSVE+ +G+P Q VT+L+DTGSSD+WV GS+NP+C  EG   
Sbjct: 61  VKRADGSETIKIKNQNNFYSVEVGVGSPAQNVTLLIDTGSSDMWVMGSNNPFC--EG--- 115

Query: 123 SGSSFKHV------------NKDNLVSVVESVFTEISYDTTMVTSVATATIGNTASTSQA 170
           S  S KHV             K +  S   S+ T  +  T   ++VA +   + A++   
Sbjct: 116 SSRSSKHVLLGENIGLEDETVKKDFFSSFRSLLTATATSTVSASAVAPSRT-SVAASDAT 174

Query: 171 MNCTTYGTFDTSKSSTFESNKTEFSITYGDSTFASGTWGHDRLSLNNLNVTGLSFAVANE 230
           ++C++YGTF T  SS+F+SN T+F I YGD T+A GTWGHD ++L ++ V+ LS AVANE
Sbjct: 175 LSCSSYGTFATGSSSSFKSNNTDFYIQYGDLTYALGTWGHDDVTLQDITVSDLSMAVANE 234

Query: 231 TNSTVGVLGIGLPGLESTYSGVSLSSAQKSYTYNNFPMILKNSGAIKSTAYSLFTNHSDS 290
           +NST GVLGIGL GLE T  G  +SS++ +YTY N P +L + G I   AYSLF +  D+
Sbjct: 235 SNSTFGVLGIGLTGLEVTNVGSLVSSSRSAYTYQNLPALLVDQGKIHQNAYSLFLDDLDA 294

Query: 291 KHGTILFGAVDHGKYAGDLYTIPIINTLQNRGYKDPIQFQVTLQGIGVSHGERDENMTTL 350
           +HG++LFGAVDH KY G+LYT+P++N  ++ G+ DPIQ  VTLQG+G+S  + +    T 
Sbjct: 295 EHGSVLFGAVDHSKYTGNLYTVPLVNIYKSSGFPDPIQLDVTLQGLGMSANKTN---ITF 351

Query: 351 TTTKIPVLLDSGTTISYMPADLVEMIASEVGATYSPDYGYYIMDCINEMEEESSLIFDFG 410
           TTT IP LLDSGTT++Y+P+ +V+ IA  + A YS D GYY+++C +E+ +   L+FDFG
Sbjct: 352 TTTPIPALLDSGTTLTYLPSSMVQSIARRLSAQYSYDVGYYVLEC-SEVSDSDELVFDFG 410

Query: 411 GFYIANWLSNFQLLTDSRSNVCILGIAPQSDPAIILGDNFLVSTYVVYDLDNMEISMAHA 470
           GF+I + L NF  L  + SN C LG+ PQS    ILGDNFL + YVVYDL+N+E+SMA A
Sbjct: 411 GFHIKSKLQNF--LIKASSNFCALGLVPQSSSRAILGDNFLTAAYVVYDLENLEVSMAQA 468

Query: 471 DFSDGGEYIDTIKDSVPSALKAPGYSSTWSTYESIVPGGNMF 512
           ++  G E I+ I  ++P A+KAPGYSSTWS+   I  GGN+F
Sbjct: 469 NYDGGSEDIEVISSTIPGAVKAPGYSSTWSSRIPISTGGNIF 510

>Kpol_543.61 s543 complement(141395..143161) [1767 bp, 588 aa] {ON}
           complement(141395..143161) [1767 nt, 589 aa]
          Length = 588

 Score =  465 bits (1197), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 245/478 (51%), Positives = 317/478 (66%), Gaps = 52/478 (10%)

Query: 35  GYVKMNFQRKYGDSFESATNDTKARARLVTRGDDYELVELTNQNSFYSVELDIGTPPQKV 94
           G+V+ +F +  GDSFE+A+N  K  A +V R +  E VE+ NQ++FYSV L IG+  Q V
Sbjct: 63  GFVRYHFDKLVGDSFENASNKNKRYANIVKRDNGVEEVEIMNQSNFYSVSLSIGSNAQNV 122

Query: 95  TVLVDTGSSDLWVTGSDNPYCFTEGEDTSGSSFKHVNKDNLVSVVESVFTEISYDTTMVT 154
           TVL+DTGSSDLWVTGS+NP C + G+                                  
Sbjct: 123 TVLLDTGSSDLWVTGSNNPLC-SRGD---------------------------------- 147

Query: 155 SVATATIGNTASTSQAMNCTTYGTFDTSKSSTFESNKTEFSITYGDSTFASGTWGHDRLS 214
                      S S A++C  +GTF+ S S T+ SN+T FSI+Y DS++ASGTWG D L 
Sbjct: 148 -----------SNSDAVDCAKFGTFNPSTSDTWSSNETSFSISYADSSYASGTWGQDTLK 196

Query: 215 LNNLNVTGLSFAVANETNSTVGVLGIGLPGLESTYSGVSLSSAQKSYTYNNFPMILKNSG 274
           L +L+VTGLSFAVAN TNSTVGVLGIGLP LE TYSG S + A   Y Y NFP++LKNSG
Sbjct: 197 LQDLDVTGLSFAVANYTNSTVGVLGIGLPSLEVTYSG-SNNVAGTRYQYENFPLLLKNSG 255

Query: 275 AIKSTAYSLFTNHSDSKHGTILFGAVDHGKYAGDLYTIPIINTLQNRGYKDPIQFQVTLQ 334
           A K+ AYSL+ N  DS+ G++LFG VDH KY+G LYTIP++NTL+  G+  P++F VTLQ
Sbjct: 256 ATKANAYSLYLNDLDSRTGSVLFGGVDHNKYSGTLYTIPLVNTLRAAGFSQPVEFDVTLQ 315

Query: 335 GIGVSHGERDENMTTLTTTKIPVLLDSGTTISYMPADLVEMIASEVGATYSPDYGYYIMD 394
           G+G+S  E      TLTTTKIP LLDSGTT+ Y+P+ LV +IA E  A Y+   GYY+M+
Sbjct: 316 GMGISDDEHGN--VTLTTTKIPALLDSGTTLVYLPSALVSLIADEYDAVYNSRTGYYVMN 373

Query: 395 CINEMEEESSLIFDFGGFYIANWLSNFQLLTDSRSNVCILGIAPQSDPAIILGDNFLVST 454
           C +  +E+S ++FDFGGF+I+  L+ +  +  +   +C+LGI PQS    ILGD+FL   
Sbjct: 374 CPDS-DEDSQIVFDFGGFHISTNLTTY--IIQAVGGICVLGILPQSSGTAILGDSFLQHA 430

Query: 455 YVVYDLDNMEISMAHADFSDGGEYIDTIKDSVPSALKAPGYSSTWSTYESIVPGGNMF 512
           YVVYDLDN+EISMA A F    E ++ I  S+PSA+KAPGYSSTWST+ SI  GGN+F
Sbjct: 431 YVVYDLDNLEISMAQASFETDDENVEVISSSIPSAVKAPGYSSTWSTFSSISSGGNIF 488

>TDEL0F04450 Chr6 complement(835112..836686) [1575 bp, 524 aa] {ON}
           Anc_8.318 YLR120C
          Length = 524

 Score =  446 bits (1148), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 248/497 (49%), Positives = 329/497 (66%), Gaps = 30/497 (6%)

Query: 9   VVNALLLHSSMVFADSIISQSSEINDGYVKMNFQRKYGDSFESATNDTKARARLVTRGDD 68
           +++  LL S  V     +S   E    YV ++F +  G+S+E A    K  A L  R D 
Sbjct: 8   LISGFLLGSQAV----ALSDVDEKPGKYVHLSFDKLRGNSYEEAGKGNKPSAELRKRDDG 63

Query: 69  YELVELTNQNSFYSVELDIGTPPQKVTVLVDTGSSDLWVTGSDNPYCFTEGEDTSGSSFK 128
           YE +E+ N+ +FYS+EL+IGTP Q VTVL+DTGSSDLWV+  +NPYC             
Sbjct: 64  YEEIEIYNEQNFYSIELEIGTPSQNVTVLLDTGSSDLWVSSPENPYC------------- 110

Query: 129 HVNKDNLVSVVESVFTEISYDTTMVTSVATATIGNTASTSQAMNCTTYGTFDTSKSSTFE 188
            ++ D+   V     T++S  +T+ TS  TAT    +  +  ++C+ YGTFD SKS++F 
Sbjct: 111 -IDSDDTKPV-----TQLS-TSTLATSSGTATSSGNSGIA-TVDCSEYGTFDPSKSTSFR 162

Query: 189 SNKTEFSITYGDSTFASGTWGHDRLSLNNLNVTGLSFAVANETNSTVGVLGIGLPGLEST 248
           SN T FSI+YGD+TFASGTWG D   L +LNVT LSFAVAN++NSTVGV+GIGL GL+ST
Sbjct: 163 SNNTAFSISYGDTTFASGTWGTDNFDLGDLNVTNLSFAVANQSNSTVGVMGIGLAGLQST 222

Query: 249 YSGVSLSSAQKSYTYNNFPMILKNSGAIKSTAYSLFTNHSDSKHGTILFGAVDHGKYAGD 308
           Y GV+ S++  +Y Y NFPM LK+ G I   AYSLF N  D+  G++LFGAVDH KY+G 
Sbjct: 223 YVGVN-SASSGAYQYENFPMALKSQGIIDRNAYSLFLNEPDADKGSVLFGAVDHSKYSGQ 281

Query: 309 LYTIPIINTLQNRGYKDPIQFQVTLQGIGVSHGERDENMTTLTTTKIPVLLDSGTTISYM 368
           LYT+P++N  +NRG ++PI+F VT+QG+ V+ G    N   LT T+ P LLDSGTT+SYM
Sbjct: 282 LYTVPMLNMYRNRGIQNPIEFDVTVQGVSVTSGSTIRN---LTNTQFPALLDSGTTLSYM 338

Query: 369 PADLVEMIASEVGATYSPDYGYYIMDCINEMEEESSLIFDFGGFYIANWLSNFQLLTDSR 428
           P  L ++IA  VGA YS   GYY M C +E   ++ L FDFGGF I+  LS++ L + S 
Sbjct: 339 PYTLTQLIAGAVGAQYSQYTGYYSMRCPSE-NNDTRLNFDFGGFQISANLSSYLLSSRSS 397

Query: 429 SNVCILGIAPQSDPAIILGDNFLVSTYVVYDLDNMEISMAHADFSDGGEYIDTIKDSVPS 488
           S+ C LG+ P +  A I GDNFLV  YVVYDL+N EISMA A F++    I+ I DS+PS
Sbjct: 398 SSTCYLGMIPLTSNAAIFGDNFLVHAYVVYDLENYEISMAQAAFNNSDSQIEVISDSIPS 457

Query: 489 ALKAPGYSSTWSTYESI 505
           A++A GYSSTWST ++I
Sbjct: 458 AVRAQGYSSTWSTNQAI 474

>KNAG0G02410 Chr7 complement(550827..552419) [1593 bp, 530 aa] {ON} 
          Length = 530

 Score =  446 bits (1148), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 240/507 (47%), Positives = 323/507 (63%), Gaps = 58/507 (11%)

Query: 13  LLLHSSMVFADSIISQSSEINDGYVKMNFQRKYGDSFESATNDTKARARLVTRGDDYELV 72
           +LL  S++F   +++  +   D YV M F++K+GD++  AT   + + RL  R   YE +
Sbjct: 1   MLLAPSVLFP--LVAVCAAAKD-YVGMRFEKKFGDNYAGATKWQRPQMRLAKRNTGYEEI 57

Query: 73  ELTNQNSFYSVELDIGTPPQKVTVLVDTGSSDLWVTGSDNPYCFTEGEDTSGSSFKHVNK 132
            LTNQ SF+SVELD+GTP Q VTVLVDTGSSDLW+TG+DNPYC T     SGS    + +
Sbjct: 58  TLTNQQSFFSVELDVGTPAQNVTVLVDTGSSDLWITGADNPYCLTY----SGSGADSIPR 113

Query: 133 DNLVSVVESVFTEISYDTTMVTSVATATIGNTASTSQAMNCTTYGTFDTSKSSTFESNKT 192
            + V                                   +C+ YGTF    SST+  N +
Sbjct: 114 RDRV-----------------------------------DCSEYGTFSLEDSSTWSQNSS 138

Query: 193 E--FSITYGDSTFASGTWGHDRLSLNNLNVTGLSFAVANETNSTVGVLGIGLPGLESTYS 250
              F ITYGD+TFASG WG D L L ++NVTG+SFAVAN TNSTVGV+GIGLPGLE+T S
Sbjct: 139 APPFYITYGDTTFASGVWGQDHLHLQDVNVTGVSFAVANRTNSTVGVMGIGLPGLETTNS 198

Query: 251 GVSLSSAQKSYTYNNFPMILKNSGAIKSTAYSLFTNHSDSKHGTILFGAVDHGKYAGDLY 310
           G       + YTY NFP +LKNSGA +S  YSL+ N  + + G+ILFGAVDH KY G +Y
Sbjct: 199 G------SRPYTYANFPQVLKNSGATQSALYSLYLNDLEEERGSILFGAVDHSKYTGSMY 252

Query: 311 TIPIINTLQNRGYKDPIQFQVTLQGIGVSHGERDENMTTLTTTKIPVLLDSGTTISYMPA 370
           T+PIIN LQ+ GY  PIQF +TLQGIG+S  E + +  T+T+TK+P LLDSGTT++Y+P+
Sbjct: 253 TLPIINRLQSYGYTTPIQFDITLQGIGLSSSESNGDEVTITSTKMPALLDSGTTMTYLPS 312

Query: 371 DLVEMIASEVGATYSPDYGYYIMDCINEMEEESSLIFDFGGFYIANWLSNFQLLTDSRSN 430
           ++V  IA ++GA+ S  +G Y++ C N + E   L++DFGGF+I + L+N+  +  +   
Sbjct: 313 NIVSQIAQQLGASMSARFGQYVLPCSN-VPENMHLVYDFGGFHINSNLTNY--IVQASQT 369

Query: 431 VCILGIAPQSDPAIILGDNFLVSTYVVYDLDNMEISMAHADF--SDGGEYIDTIKDS--V 486
           +CILG+ P+     ILGD FL   YVVYDL+N++I +A A F  SD    ID +  S  +
Sbjct: 370 LCILGLFPRDSNTAILGDTFLTDAYVVYDLENLQIGLAQAKFGVSDSDAKIDIVTGSAGI 429

Query: 487 PSALKAPGYSSTWST-YESIVPGGNMF 512
           PSA +AP YSSTWST   ++  GGN+F
Sbjct: 430 PSAQRAPDYSSTWSTSVGTVTTGGNIF 456

>TPHA0A01580 Chr1 (315749..317551) [1803 bp, 600 aa] {ON} Anc_8.318
           YLR120C
          Length = 600

 Score =  440 bits (1132), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 233/483 (48%), Positives = 321/483 (66%), Gaps = 48/483 (9%)

Query: 30  SEINDGYVKMNFQRKYGDSFESATNDTKARARLVTRGDDYELVELTNQNSFYSVELDIGT 89
           SEI D ++K  F + YGDS+++++   K +  +V R D YE +EL N++SFYS++L IGT
Sbjct: 39  SEI-DNFIKFKFDKSYGDSYKNSSKRNKPKLDIVKR-DGYEEIELKNESSFYSIKLSIGT 96

Query: 90  PPQKVTVLVDTGSSDLWVTGSDNPYCFTEGEDTSGSSFKHVNKDNLVSVVESVFTEISYD 149
           P Q VTVL+DTGSSDLWVTGSDNP C ++                     ++ FT     
Sbjct: 97  PAQNVTVLIDTGSSDLWVTGSDNPLCSSD---------------------DATFT----- 130

Query: 150 TTMVTSVATATIGNTASTSQAMNCTTYGTFDTSKSSTFESNKTEFSITYGDSTFASGTWG 209
                       G+  S+  +++C+ YGTFD   SS+F SN T F+ITYGD ++A G WG
Sbjct: 131 ------------GSDGSSQSSIDCSLYGTFDIDDSSSFTSNDTSFAITYGDGSYALGNWG 178

Query: 210 HDRLSLNNLNVTGLSFAVANETNSTVGVLGIGLPGLESTYSGVSLSSAQKSYTYNNFPMI 269
            D LSL +++VTGLSFAVAN TNSTVGVLGIGLP LE+TYSG SL+ +   Y Y+N P++
Sbjct: 179 QDVLSLQDIDVTGLSFAVANYTNSTVGVLGIGLPSLEATYSG-SLAGSNP-YQYDNLPLV 236

Query: 270 LKNSGAIKSTAYSLFTNHSDSKHGTILFGAVDHGKYAGDLYTIPIINTLQNRGYKDPIQF 329
           L+NSGA+KS AYSLF N  DS  G+ILFG VDH KY G L T+P++N  ++ G++ P +F
Sbjct: 237 LRNSGAVKSYAYSLFLNDEDSSEGSILFGGVDHSKYEGTLNTLPLVNYQKSSGFQSPYEF 296

Query: 330 QVTLQGIGVSHGERDENMTTLTTTKIPVLLDSGTTISYMPADLVEMIASEVGATYSPDYG 389
            +TLQG+G+S   ++   TT++ T+I  LLDSGTT++Y+P  L  ++A+E+ A+YS   G
Sbjct: 297 DITLQGLGISTSSKN---TTVSDTQIVALLDSGTTLTYLPVTLTSLLAAELNASYSARLG 353

Query: 390 YYIMDCINEMEEESSLIFDFGGFYIANWLSNFQLLTDSRSNVCILGIAPQSDPAIILGDN 449
           YY M C +   + + ++FDFGGF+I   L++F  +  S  NVCILGI P+S    ILGD+
Sbjct: 354 YYTMSCPSS-SDSTEIVFDFGGFHINVPLTSF--IVTSSMNVCILGIIPRSGDQAILGDS 410

Query: 450 FLVSTYVVYDLDNMEISMAHADFSDGGEYIDTIKDSVPSALKAPGYSSTWSTYESIVPGG 509
           FL   YVVYDL+N+EIS+A A +    E I+ I  SVPSA++A  YS+TWST  +I  GG
Sbjct: 411 FLQHAYVVYDLENLEISLAQAKYGSSSEDIEAIVSSVPSAVRAASYSNTWSTAATINSGG 470

Query: 510 NMF 512
           ++F
Sbjct: 471 DIF 473

>KAFR0B05710 Chr2 complement(1177594..1179321) [1728 bp, 575 aa]
           {ON} Anc_8.318 YLR120C
          Length = 575

 Score =  433 bits (1114), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 250/532 (46%), Positives = 346/532 (65%), Gaps = 38/532 (7%)

Query: 1   MKLSTIKFVVNALLL----HSSMVFADSIISQSSEIN-DGYVKMNFQRKYGDSFESATND 55
           MKL   K +++  L+     +S+V  DS   Q S+ N + Y+K+ F +  G+SF+ ++ D
Sbjct: 1   MKLLNSKLILSTSLITALTDASIVAKDS--KQPSDFNKNKYLKLGFDKYVGESFDKSSKD 58

Query: 56  T-KARARLVTRGDDYELVELTNQNSFYSVELDIGTPPQKVTVLVDTGSSDLWVTGSDNPY 114
           + + RA       +Y +  LTNQ SFYSVEL IGTP Q VTVLVDTGSSDLWVTGSDNP 
Sbjct: 59  SLQKRA-------EYAIFNLTNQASFYSVELAIGTPSQNVTVLVDTGSSDLWVTGSDNPL 111

Query: 115 CFTEGEDTSGS--SFKHVNKDNLVSVVESVFTE-----ISYDTTMVTSVATATIGNTAST 167
           C T+  D      +FK    + +V   E+  TE        D       +TAT G+  ++
Sbjct: 112 CSTDSSDDDDDSYAFKKKRAETIVVTEEATITENGNNLDGLDPFGWLGGSTATSGSFETS 171

Query: 168 SQAMNCTT-------YGTFDTSKSSTFESNKTEFSITYGDSTFASGTWGHDRLSLNNLNV 220
             + + ++       YGTF+T+ SST+ SN T F I+YGDS+ A G WG D LS+++++V
Sbjct: 172 FPSSSSSSGDFDCSEYGTFNTNDSSTWSSNHTSFFISYGDSSVAEGVWGQDVLSISDVDV 231

Query: 221 TGLSFAVANETNSTVGVLGIGLPGLESTYSGVSLSSAQKSYTYNNFPMILKNSGAIKSTA 280
           +G+SFAVAN TNSTVGVLGIGL GLE+TYSG   +S+ +SY Y N PM+LK+SG I + A
Sbjct: 232 SGVSFAVANYTNSTVGVLGIGLSGLETTYSG---TSSSESYIYENLPMLLKSSGVIDTIA 288

Query: 281 YSLFTNHSDSKHGTILFGAVDHGKYAGDLYTIPIINTLQNRGYKDPIQFQVTLQGIGVSH 340
           YSLF N      G +LFGAVDH KY+G LYT+PI+N   + GYK+P++F VT+ G+G+S 
Sbjct: 289 YSLFLNEKSDTTGNLLFGAVDHSKYSGSLYTLPIVNVYASEGYKNPLEFDVTMYGLGIST 348

Query: 341 GERDENMTTLTTTKIPVLLDSGTTISYMPADLVEMIASEVGATYSPDYGYYIMDCINEME 400
            + +   TT+ T KIP LLDSGTTI Y P  L+E++A ++GA+YS + G+Y M C++   
Sbjct: 349 SDSN---TTIATMKIPALLDSGTTIVYFPETLLELVADQLGASYSDELGFYAMSCVSS-S 404

Query: 401 EESSLIFDFGGFYIANWLSNFQLLTDSRSNVCILGIAPQSDPAIILGDNFLVSTYVVYDL 460
           +++  +FDFGGF+I   LS+F  L     + CIL +A Q D +IILGD FL + YVVYDL
Sbjct: 405 DDTEFVFDFGGFHITVPLSDF--LIRVSGSECILAMAAQDDESIILGDYFLTNAYVVYDL 462

Query: 461 DNMEISMAHADFSDGGEYIDTIKDSVPSALKAPGYSSTWSTYESIVPGGNMF 512
           +N EISMA A++    E I+ I  +VPSA+KA  YS++WS+  SI  GG++F
Sbjct: 463 ENYEISMAQANYDSEDEDIEVISSTVPSAVKAASYSNSWSSTGSITSGGDIF 514

>KAFR0B06530 Chr2 (1355295..1356911) [1617 bp, 538 aa] {ON} 
          Length = 538

 Score =  430 bits (1106), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 235/502 (46%), Positives = 324/502 (64%), Gaps = 63/502 (12%)

Query: 26  ISQSSEINDGYVKMNFQRKYGDSFESAT----------NDTKARARLVTRGD-DYELVEL 74
           IS+ S+ N+G++ + F + YG SF+ A           N    ++ L  R   DY+ +E+
Sbjct: 26  ISRFSQHNNGFLDLQFNKLYGTSFDIAKKWQDINLGQHNLNFKQSELYKRASSDYQELEI 85

Query: 75  TNQNSFYSVELDIGTPPQKVTVLVDTGSSDLWVTGSDNPYCFTEGEDTSGSSFKHVNKDN 134
            NQ SFYS++L IGTP Q VTV +DTGSSDLWVTGS+NPYC       +GS+F       
Sbjct: 86  KNQQSFYSLDLFIGTPGQNVTVQIDTGSSDLWVTGSNNPYC-------NGSTFS------ 132

Query: 135 LVSVVESVFTEISYDTTMVTSVATATIGNTASTSQAMNCTTYGTFDTSKSSTFESNKTEF 194
                                       +T  + +  NC+ YGTF+T+KSST+ SN + F
Sbjct: 133 ----------------------------DTVPSRELFNCSQYGTFNTNKSSTWSSNNSRF 164

Query: 195 SITYGDSTFASGTWGHDRLSLNNLNVTGLSFAVANETNSTVGVLGIGLPGLESTYSGVSL 254
            I YGD+TFASGTWG D +S+N LNVTGL+FAVAN +NS+  VLGIGL  LE+TY+G   
Sbjct: 165 FIQYGDTTFASGTWGRDVMSINGLNVTGLTFAVANASNSSNSVLGIGLTQLETTYNG--- 221

Query: 255 SSAQKSYTYNNFPMILKNSGAIKSTAYSLFTNHSDSKHGTILFGAVDHGKYAGDLYTIPI 314
           S++  SYTY NFP++LKN+G  +S +YSLF N  D++ G+ILFGAVDH KY+G+LYT+P+
Sbjct: 222 SNSSHSYTYANFPVVLKNAGLTESISYSLFLNELDAESGSILFGAVDHSKYSGNLYTLPL 281

Query: 315 INTLQNRGYKDPIQFQVTLQGIGVSHGERDENMTTLTTTKIPVLLDSGTTISYMPADLVE 374
           +NT ++RG+ +PI+F VTLQGIG+  G +    TT+T TK+  +LDSGT+++ +P  ++ 
Sbjct: 282 VNTYKDRGFPNPIEFAVTLQGIGIVSGSKK---TTITQTKLAAILDSGTSLTVLPGTIIH 338

Query: 375 MIASEVGATYSPDYGYYIMDCINEMEEESSLIFDFGGFYIANWLSNFQLLTDSRSNVCIL 434
            IAS +   YSP    Y++ C       ++L+FDFGGF I   LSNF L  +   ++CIL
Sbjct: 339 SIASSLNGRYSPLIDSYLVSCSLRNSTNTNLVFDFGGFTIKGTLSNFIL--EIEDDICIL 396

Query: 435 GIAPQSDPAIILGDNFLVSTYVVYDLDNMEISMAHADFSDGGEYIDTIKDS--VPSALKA 492
           G++   + ++ILGD FL S YVVYDL+N++ISMA A F +    ID I+ +  VPSA+KA
Sbjct: 397 GLSSVDENSVILGDTFLASAYVVYDLENLQISMAQAKFDNSTSDIDVIRGNSGVPSAIKA 456

Query: 493 PGYSSTW-STYESIVPGGNMFP 513
           PGYSSTW +T  SI  GGN+FP
Sbjct: 457 PGYSSTWTATPSSISTGGNIFP 478

>KAFR0H02300 Chr8 (439083..440648) [1566 bp, 521 aa] {ON} Anc_8.319
           YLR121C
          Length = 521

 Score =  429 bits (1102), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 241/483 (49%), Positives = 320/483 (66%), Gaps = 61/483 (12%)

Query: 36  YVKMNFQRKYGDSFESATNDTKARARLVTRGDDYELVELTNQNSFYSVELDIGTPPQKVT 95
           YV + F++ YGDSFE +T  +    R  TRG  YELV+L N+ +FYSV+LDIGTP Q +T
Sbjct: 34  YVNLKFKKTYGDSFEGSTTWSALAKR--TRG--YELVDLVNRQNFYSVDLDIGTPSQTIT 89

Query: 96  VLVDTGSSDLWVTGSDNPYCFTEGEDTSGSSFKHVNKDNLVSVVESVFTEISYDTTMVTS 155
           VLVDTGSSDLWVTGSDNPYC +              K NLV                   
Sbjct: 90  VLVDTGSSDLWVTGSDNPYCVSV-------------KSNLV------------------- 117

Query: 156 VATATIGNTASTSQAMNCTTYGTFDTSKSSTFESNKTEFSITYGDSTFASGTWGHDRLSL 215
                     S++   +C TYGTFD ++SST+ SN T FSITYGD++FA GTWG D+L L
Sbjct: 118 ----------SSTNKFDCNTYGTFDKNQSSTWSSNDTLFSITYGDTSFARGTWGQDKLHL 167

Query: 216 NNLNVTGLSFAVANETNSTVGVLGIGLPGLESTYSGVSLSSAQKSYTYNNFPMILKNSGA 275
           ++L+V+GLSFAVAN TNSTVGVLGIGLPGLE TY    +++ +  Y Y+NFPMILKNSGA
Sbjct: 168 DDLDVSGLSFAVANVTNSTVGVLGIGLPGLEVTY----INAPRNRYQYDNFPMILKNSGA 223

Query: 276 IKSTAYSLFTNHSDSKHGTILFGAVDHGKYAGDLYTIPIINTLQNRGYKDPIQFQVTLQG 335
             S  YSL  +H +++HGT+LFGAVDH KY G LYTIP++NTL+  G+ DP +F+VTLQG
Sbjct: 224 THSNLYSLHLDHPEAEHGTVLFGAVDHSKYTGSLYTIPLVNTLKTHGFSDPAKFEVTLQG 283

Query: 336 IGVSHGERDENMTTLTTTKIPVLLDSGTTISYMPADLVEMIASEVGATYSPDYGYYIMDC 395
           +G+     +   TTLT TKI  LLDSGTT++Y+P  LV++IA  +GA +S  YGYYI+ C
Sbjct: 284 VGIV---ANNTQTTLTNTKIAALLDSGTTLTYLPQALVQVIADSIGARWSSRYGYYIVSC 340

Query: 396 INEMEEESSLIFDFGGFYIANWLSNFQLLTDSRSNVCILGIAPQSDP-AIILGDNFLVST 454
                 +++L+FDFGGF+I   L++F  + ++  NVC+L I  ++   + ILGDNFL++ 
Sbjct: 341 RAVENSDTTLVFDFGGFHINGKLTDF--IVETFGNVCLLTIIEETGSNSAILGDNFLINA 398

Query: 455 YVVYDLDNMEISMAHADFS-DGGEYIDTIKDS--VPSALKAPGYSSTWSTYESIVP--GG 509
           YVV+DL+N EISMA A  + D  + I+ +  +  V SA+ A GYSSTW+   S +    G
Sbjct: 399 YVVFDLENNEISMAQALHNVDDDQDIEIVTSNAGVASAVTALGYSSTWTAEPSTIETFAG 458

Query: 510 NMF 512
           ++F
Sbjct: 459 DIF 461

>NDAI0G02620 Chr7 (599890..601662) [1773 bp, 590 aa] {ON}  YGL258W-A
          Length = 590

 Score =  429 bits (1102), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 232/481 (48%), Positives = 313/481 (65%), Gaps = 47/481 (9%)

Query: 36  YVKMNFQRKYGDSFESATNDTKARARLVTRGDDYELVELTNQNSFYSVELDIGTPPQKVT 95
           Y+ +NF+++YGDSF ++++     A+L+ R D YE V LTNQ SFYSVE+++GTP QK+T
Sbjct: 33  YLALNFEKRYGDSFLNSSSSNGPSAQLIKRDDGYEQVTLTNQQSFYSVEVEMGTPSQKLT 92

Query: 96  VLVDTGSSDLWVTGSDNPYCFTEGEDTSGSSFKHVNKDNLVSVVESVFTEISYDTTMVTS 155
           VL+DTGSSD WVT SDNPYC T    T GS +    +D +                    
Sbjct: 93  VLLDTGSSDFWVTSSDNPYCGTTS--TEGSLYGGETQDTI-------------------- 130

Query: 156 VATATIGNTASTSQAMNCTTYGTFDTSKSSTFESNKTEFSITYGDSTFASGTWGHDRLSL 215
                           +C+TYGTFD+SKSSTF+SN T+F I+YGD +FA GTWG D + L
Sbjct: 131 ----------------DCSTYGTFDSSKSSTFQSNDTDFLISYGDGSFAEGTWGTDVIKL 174

Query: 216 NN-LNVTGLSFAVANETNSTVGVLGIGLPGLESTYSGVSLSSAQKSYTYNNFPMILKNSG 274
           ++ L++  +S AVA+ TNS++GVLGIGL  LE+TYS     + + SY Y+NFP+ LK SG
Sbjct: 175 DDSLSLNDVSVAVASSTNSSMGVLGIGLRPLETTYSSTKSVNEKTSYMYDNFPISLKKSG 234

Query: 275 AIKSTAYSLFTNHSDSKHGTILFGAVDHGKYAGDLYTIPIINTLQNRGYKDPIQFQVTLQ 334
            I+STAYSL+ N   SK G ILFG VDH KY G LYT+P++++     YK P++F VTL 
Sbjct: 235 LIESTAYSLYLNDPSSKSGNILFGGVDHSKYTGQLYTVPMLSS--TTSYKTPVEFDVTLN 292

Query: 335 GIGVSHGERDENMTTLTTTKIPVLLDSGTTISYMPADLVEMIASEVGATYSPDYGYYIMD 394
           GIG+   +   N  TLT T+   LLDSGTT SY+P+ LV MI  E+GA+Y  + GYY +D
Sbjct: 293 GIGII--DSSGNKKTLTATQFYGLLDSGTTFSYLPSALVAMIGEELGASYDSNIGYYTID 350

Query: 395 CINEMEEESSLIFDFGGFYIANWLSNFQLLTDSRSNVCILGIAPQSDPAIILGDNFLVST 454
           C  E  +++ ++FD GGF+I   LS+F +     ++ CIL I PQ D  ++LGD+FL + 
Sbjct: 351 CSAEDSDDTKIVFDMGGFHINTTLSDFVIQI--STSTCILSIVPQ-DGKVVLGDSFLNNA 407

Query: 455 YVVYDLDNMEISMAHADFSDGGEY-IDTIKDSVPSALKAPGYSSTWSTYESIVPGGNMFP 513
           Y+VYDLDN EI+MA A +    E  ID I  ++PSA++APGYSSTWST  SI  GG++F 
Sbjct: 408 YIVYDLDNYEIAMAQAAWDSTREANIDVISTTIPSAIRAPGYSSTWSTSRSISSGGDIFT 467

Query: 514 T 514
           T
Sbjct: 468 T 468

>KLLA0E04049g Chr5 (366535..368304) [1770 bp, 589 aa] {ON} similar
           to uniprot|P12630 Saccharomyces cerevisiae YIL015W BAR1
           Aspartyl protease secreted into the periplasmic space of
           mating type a cells, cleaves and inactivates alpha
           factor allowing cells to recover from
           alpha-factor-induced cell cycle arrest and to YLR121C
           uniprot|Q12303 Saccharomyces cerevisiae YLR121C YPS3
           Aspartic protease, attached to the plasma membrane via a
           glycosylphosphatidylinositol (GPI) anchor and to YLR120C
           uniprot|P32329 Saccharomyces cerevisiae YLR120C YPS1
           Aspartic protease, attached to the plasma membrane via a
           glycosylphosphatidylinositol (GPI) anchor and to YDR144C
           uniprot|P53379 Saccharomyces cerevisiae YDR144C MKC7
           GPI- anchored aspartyl protease (yapsin) involved in
           protein processing; shares functions with Yap3p and
           Kex2p and to YIR039C uniprot|P40583 Saccharomyces
           cerevisiae YIR039C YPS6 Putative GPI-anchored aspartic
           protease, member on vGLC.1466.
          Length = 589

 Score =  425 bits (1092), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 257/536 (47%), Positives = 343/536 (63%), Gaps = 38/536 (7%)

Query: 1   MKLSTIKFVVNALL--LHSSMVFADSIISQSSEINDGYVKMNFQRKYGDSFESATNDTKA 58
           MKLS +   + ALL  L S+       +SQ  E N  +V M+F +  G+    A+   + 
Sbjct: 1   MKLSDV--CLGALLASLGSAGYITKRDVSQVGEANKKHVFMSFDKLRGNDASEASLSKRR 58

Query: 59  RARLVTRGDDYELVELTNQNSFYSVELDIGTPPQKVTVLVDTGSSDLWVTGSDNPYCFTE 118
              L  R D Y  VE+ NQN+FYSV+L+IGTP QKV VL+DTGSSDLWV GS NP+C   
Sbjct: 59  VGHLKKRADGYVDVEIDNQNTFYSVDLEIGTPAQKVGVLIDTGSSDLWVPGSGNPFCSAS 118

Query: 119 GEDTSGSSFKHVNKDNLVSVVESVF-TEISYDTTMVTSVATAT-------------IGNT 164
              +      +     L+S + SVF T+++ D T  T +A+AT              G  
Sbjct: 119 RSSSKKKRQDYTA---LLSSLLSVFGTDVATDYTY-TGIASATGSAGTQTVPTALTSGTV 174

Query: 165 ASTS--------QAMNCTTYGTFDTSKSSTFESNKTEFSITYGDSTFASGTWGHDRLSLN 216
           A+TS          ++C+ +GTFDTSKSS+++SN T F I+Y D TFA G WG D + L+
Sbjct: 175 AATSIRSVPSSLATLDCSEFGTFDTSKSSSWQSNDTRFYISYADGTFADGDWGVDEIHLD 234

Query: 217 NLNVTGLSFAVANETNSTVGVLGIGLPGLESTYSGVSLSSAQKSYTYNNFPMILKNSGAI 276
           ++NVTGLSFAV+N T+S  GVLGIGL G ESTYSG  LS+  + Y Y+NFP++L+ +G I
Sbjct: 235 DVNVTGLSFAVSNYTDSQFGVLGIGLTGSESTYSG-QLSTYNR-YQYDNFPIVLQRNGVI 292

Query: 277 KSTAYSLFTNHSDSKHGTILFGAVDHGKYAGDLYTIPIINTLQNRGYKDPIQFQVTLQGI 336
           +  AYS+F N  D+  G+ILFGAVDH KY G LYT+P++N L++ GY + I+  +TLQGI
Sbjct: 293 EKNAYSVFLNDLDADSGSILFGAVDHSKYTGTLYTVPMVNALRSIGYTEQIRLSITLQGI 352

Query: 337 GVSHGERDENMTTLTTTKIPVLLDSGTTISYMPADLVEMIASEVGATYSPDYGYYIMDCI 396
           GV+    +E   T+T TK P LLD+G T  Y P+ L   IAS V ATYS   GYY +DC 
Sbjct: 353 GVTSSYGNE---TVTQTKYPALLDTGATFCYFPSSLAAAIASSVSATYSSSSGYYFVDC- 408

Query: 397 NEMEEESSLIFDFGGFYIANWLSNFQLLTDSRSNVCILGIAPQSDPAIILGDNFLVSTYV 456
            +   +  L+FDFGGF+I + LS++ ++T S S+ C+LGI PQSD  I LGD FL S YV
Sbjct: 409 -DSGSDYDLVFDFGGFHIISPLSDY-IVTTSSSSQCVLGILPQSDNEITLGDAFLTSAYV 466

Query: 457 VYDLDNMEISMAHADFSDGGEYIDTIKDSVPSALKAPGYSSTWSTYESIVPGGNMF 512
           VYDL+ +EIS+A A ++ G E I+ I+DSVPSA+ APGYSSTWST  S+  GGN+F
Sbjct: 467 VYDLEELEISLAQASYTSGDEKIEVIRDSVPSAVAAPGYSSTWSTAASLSTGGNIF 522

>NCAS0C03300 Chr3 (647716..649395) [1680 bp, 559 aa] {ON} 
          Length = 559

 Score =  418 bits (1074), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 224/485 (46%), Positives = 308/485 (63%), Gaps = 54/485 (11%)

Query: 31  EINDGYVKMNFQRKYGDSFESATNDT-KARARLVTR-GDDYELVELTNQNSFYSVELDIG 88
           E+ + +V + F +KYGD +++A+ D+ K +  LV R G DYE VELTNQ SFYSVE+D+G
Sbjct: 28  ELPNKFVNLRFNKKYGDHYDTASTDSRKPKLELVKRDGSDYEEVELTNQQSFYSVEVDVG 87

Query: 89  TPPQKVTVLVDTGSSDLWVTGSDNPYCFTEGEDTSGSSFKHVNKDNLVSVVESVFTEISY 148
           TP Q+VTVL+DTGSSD WV GSDNPYC    +DTS                         
Sbjct: 88  TPSQRVTVLLDTGSSDFWVMGSDNPYC---SDDTS------------------------- 119

Query: 149 DTTMVTSVATATIGNTASTSQAMNCTTYGTFDTSKSSTFESNKTEFSITYGDSTFASGTW 208
                              +  ++C+ +GTFD+S SSTF +N T F+I YGD +FA GTW
Sbjct: 120 -------------------TTGIDCSEFGTFDSSSSSTFHNNGTAFNIHYGDGSFALGTW 160

Query: 209 GHDRLSLNNLNVTGLSFAVANETNSTVGVLGIGLPGLESTYSGVSLSSAQKSYTYNNFPM 268
           G D +S++++ +  LS AVAN +NS++GV+G+GL GLE+TYS      + ++Y Y NFP+
Sbjct: 161 GTDTVSIDDITLDALSLAVANSSNSSMGVIGLGLAGLETTYSSSHAVKSGQTYQYANFPL 220

Query: 269 ILKNSGAIKSTAYSLFTNHSDSKHGTILFGAVDHGKYAGDLYTIPIINTLQNRGYKDPIQ 328
            LKN+G + + AYSL+ N  +   G ILFGAVDH  Y+G LYTIP++N     G+K+ ++
Sbjct: 221 ALKNAGIVAANAYSLYLNDPEETTGNILFGAVDHSLYSGQLYTIPLVNIYSGSGFKNAVE 280

Query: 329 FQVTLQGIGVSHGERDENMTTLTTTKIPVLLDSGTTISYMPADLVEMIASEVGATYSPDY 388
           F VTL GIG+   +   + TT++TT I  LLDSGTT++Y P   V ++A+++GA YS   
Sbjct: 281 FDVTLNGIGIV--DSSGSATTVSTTPIIALLDSGTTLTYFPTQYVSLLAAQLGAQYSSSN 338

Query: 389 GYYIMDCINEMEEESSLIFDFGGFYIANWLSNFQLLTDSRSNVCILGIAPQSDPAIILGD 448
           GYY + C    +  + L+FDFGGF+I   L++F  +  S ++ C L I PQ+  + ILGD
Sbjct: 339 GYYTISCDAMQDTTTKLVFDFGGFHINATLADF--VVQSGTSTCFLSIIPQNSSSAILGD 396

Query: 449 NFLVSTYVVYDLDNMEISMAHADFSDGG-EYIDTIKDSVPSALKAPGYSSTWSTYESIVP 507
            FL + YVVYDLDN+EISMA A +     E I+ I  SVPSA+KAPGYS+TWST  SI  
Sbjct: 397 TFLNNAYVVYDLDNLEISMAQAKWDQSSDEDIEVISSSVPSAVKAPGYSNTWSTTMSITS 456

Query: 508 GGNMF 512
           GGN+F
Sbjct: 457 GGNIF 461

>Smik_12.187 Chr12 complement(370001..371524) [1524 bp, 507 aa] {ON}
           YLR121C (REAL)
          Length = 507

 Score =  404 bits (1039), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 224/479 (46%), Positives = 287/479 (59%), Gaps = 70/479 (14%)

Query: 36  YVKMNFQRKYGDSFESATNDTKARARLVTRGDDYELVELTNQNSFYSVELDIGTPPQKVT 95
           YVKM F +K G+S  S          L  R   +E   L N+ SFYSVEL IGTP Q +T
Sbjct: 28  YVKMPFVKK-GNSESSV---------LSKRSSGHENFVLANEQSFYSVELAIGTPSQNLT 77

Query: 96  VLVDTGSSDLWVTGSDNPYCFTEGEDTSGSSFKHVNKDNLVSVVESVFTEISYDTTMVTS 155
           VL+DTGS+DLWV G  NPYC                                        
Sbjct: 78  VLLDTGSADLWVPGKGNPYC---------------------------------------- 97

Query: 156 VATATIGNTASTSQAMNCTTYGTFDTSKSSTFESNKTE-FSITYGDSTFASGTWGHDRLS 214
                          M+C  YG FD SKSSTF++NK+  F   YGD TFA G +G D+L 
Sbjct: 98  ------------GSVMDCDQYGVFDKSKSSTFKANKSSPFYAAYGDGTFAEGAFGQDKLK 145

Query: 215 LNNLNVTGLSFAVANETNSTVGVLGIGLPGLESTYSGVSLSSAQKSYTYNNFPMILKNSG 274
            NNL+++GL FAVANE+NST GVLGIGL  LE TYSG      ++SY Y+NFP+ LK+SG
Sbjct: 146 YNNLDLSGLPFAVANESNSTFGVLGIGLSTLEVTYSGKVAVMDKRSYEYDNFPLFLKHSG 205

Query: 275 AIKSTAYSLFTNHSDSKHGTILFGAVDHGKYAGDLYTIPIINTLQNRGYKDPIQFQVTLQ 334
           AI +TAYSLF N      G+ILFGAVDH KY G LYTIP++N  +++GY+ P+ F VTLQ
Sbjct: 206 AIDATAYSLFLNDESQASGSILFGAVDHSKYEGQLYTIPLVNMYKSQGYQHPVAFDVTLQ 265

Query: 335 GIGVSHGERDENMTTLTTTKIPVLLDSGTTISYMPADLVEMIASEVGATYSPDYGYYIMD 394
           G+G+   + D+  TTLTTTK P LLDSGTT++Y+P+  V ++A  + A+YS   GYY   
Sbjct: 266 GLGL---QTDKRNTTLTTTKFPALLDSGTTLTYLPSQAVALLAKSLNASYSKTLGYYEYT 322

Query: 395 CINEMEEESSLIFDFGGFYIANWLSNFQLLTDSRSNVCILGIAPQSDPA-IILGDNFLVS 453
           C +  + ++S+ FDFGGF I   LS+F + T      C L + PQ+  A  ILGD+FL +
Sbjct: 323 CPSS-DNKTSIAFDFGGFRINAPLSDFTMQTS--VGTCALALIPQAGNATAILGDSFLRN 379

Query: 454 TYVVYDLDNMEISMAHADFSDGGEYIDTIKDSVPSALKAPGYSSTWSTYESIVPGGNMF 512
            YVVYDLDN EIS+A A +    E I+ IK +VP A +AP Y++TWSTY S+  GGN+F
Sbjct: 380 AYVVYDLDNYEISLAQAKYGKAKENIEAIKSTVPGATRAPSYNNTWSTYASVTSGGNIF 438

>YLR121C Chr12 complement(388744..390270) [1527 bp, 508 aa] {ON}
           YPS3Aspartic protease, member of the yapsin family of
           proteases involved in cell wall growth and maintenance;
           attached to the plasma membrane via a
           glycosylphosphatidylinositol (GPI) anchor
          Length = 508

 Score =  404 bits (1038), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 224/487 (45%), Positives = 295/487 (60%), Gaps = 73/487 (14%)

Query: 32  INDG-YVKMNF-QRKYGDSFESATNDTKARARLVTRGDDYELVELTNQNSFYSVELDIGT 89
           + DG YVK+ F ++K GD+ E           L  R + +E   L N+ SFYSVEL IGT
Sbjct: 23  LPDGKYVKIPFTKKKNGDNGE-----------LSKRSNGHEKFVLANEQSFYSVELAIGT 71

Query: 90  PPQKVTVLVDTGSSDLWVTGSDNPYCFTEGEDTSGSSFKHVNKDNLVSVVESVFTEISYD 149
           P Q +TVL+DTGS+DLWV G  NPYC                                  
Sbjct: 72  PSQNLTVLLDTGSADLWVPGKGNPYC---------------------------------- 97

Query: 150 TTMVTSVATATIGNTASTSQAMNCTTYGTFDTSKSSTFESNKTE-FSITYGDSTFASGTW 208
                                M+C  YG FD +KSSTF++NK+  F   YGD T+A G +
Sbjct: 98  ------------------GSVMDCDQYGVFDKTKSSTFKANKSSPFYAAYGDGTYAEGAF 139

Query: 209 GHDRLSLNNLNVTGLSFAVANETNSTVGVLGIGLPGLESTYSGVSLSSAQKSYTYNNFPM 268
           G D+L  N L+++GLSFAVANE+NST GVLGIGL  LE TYSG      ++SY Y+NFP+
Sbjct: 140 GQDKLKYNELDLSGLSFAVANESNSTFGVLGIGLSTLEVTYSGKVAIMDKRSYEYDNFPL 199

Query: 269 ILKNSGAIKSTAYSLFTNHSDSKHGTILFGAVDHGKYAGDLYTIPIINTLQNRGYKDPIQ 328
            LK+SGAI +TAYSLF N      G+ILFGAVDH KY G LYTIP++N  +++GY+ P+ 
Sbjct: 200 FLKHSGAIDATAYSLFLNDESQSSGSILFGAVDHSKYEGQLYTIPLVNLYKSQGYQHPVA 259

Query: 329 FQVTLQGIGVSHGERDENMTTLTTTKIPVLLDSGTTISYMPADLVEMIASEVGATYSPDY 388
           F VTLQG+G+   + D+   TLTTTK+P LLDSGTT++Y+P+  V ++A  + A+YS   
Sbjct: 260 FDVTLQGLGL---QTDKRNITLTTTKLPALLDSGTTLTYLPSQAVALLAKSLNASYSKTL 316

Query: 389 GYYIMDCINEMEEESSLIFDFGGFYIANWLSNFQLLTDSRSNVCILGIAPQSDPA-IILG 447
           GYY   C +  + ++S+ FDFGGF I   LS+F + T      C+L I PQ+  A  ILG
Sbjct: 317 GYYEYTCPSS-DNKTSVAFDFGGFRINAPLSDFTMQTS--VGTCVLAIIPQAGNATAILG 373

Query: 448 DNFLVSTYVVYDLDNMEISMAHADFSDGGEYIDTIKDSVPSALKAPGYSSTWSTYESIVP 507
           D+FL + YVVYDLDN EIS+A A +  G E ++ IK +VPSA++AP Y++TWS Y S   
Sbjct: 374 DSFLRNAYVVYDLDNYEISLAQAKYGTGKENVEVIKSTVPSAIRAPSYNNTWSNYASATS 433

Query: 508 GGNMFPT 514
           GGN+F T
Sbjct: 434 GGNIFTT 440

>KLTH0G12386g Chr7 (1052977..1054719) [1743 bp, 580 aa] {ON} similar
           to uniprot|P12630 Saccharomyces cerevisiae YIL015W BAR1
           Aspartyl protease secreted into the periplasmic space of
           mating type a cells, cleaves and inactivates alpha
           factor allowing cells to recover from
           alpha-factor-induced cell cycle arrest and to YLR121C
           uniprot|Q12303 Saccharomyces cerevisiae YLR121C YPS3
           Aspartic protease, attached to the plasma membrane via a
           glycosylphosphatidylinositol (GPI) anchor and to YLR120C
           uniprot|P32329 Saccharomyces cerevisiae YLR120C YPS1
           Aspartic protease, attached to the plasma membrane via a
           glycosylphosphatidylinositol (GPI) anchor and to YDR144C
           uniprot|P53379 Saccharomyces cerevisiae YDR144C MKC7
           GPI- anchored aspartyl protease (yapsin) involved in
           protein processing; shares functions with Yap3p and
           Kex2p and to YIR039C uniprot|P40583 Saccharomyces
           cerevisiae YIR039C YPS6 Putative GPI-anchored aspartic
           protease, member on vGLC.1466.
          Length = 580

 Score =  406 bits (1044), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 245/534 (45%), Positives = 338/534 (63%), Gaps = 41/534 (7%)

Query: 3   LSTIKFVVNALLLHSSMVFADSIISQSSEINDGYVKMNFQRKYGDSFESATNDTKARARL 62
           LST  F+    L  +++V +    +QS+     +VK++F +  GD+ E AT    A   L
Sbjct: 4   LSTSTFLAACGLASAAVVSSRDEGAQSAS---KFVKVSFDKLRGDTAEDATAGAVAHGVL 60

Query: 63  VTRGDDYELVELTNQNSFYSVELDIGTPPQKVTVLVDTGSSDLWVTGSDNPYCFTEGEDT 122
             R D  E V + NQ +FYSVEL +G+P Q VT+L+DTGSSD+WV GS+NPYC  EG  +
Sbjct: 61  AKRADGSETVVIKNQQTFYSVELGVGSPAQNVTLLIDTGSSDMWVMGSNNPYC--EG-GS 117

Query: 123 SGSSFKHVNKDNLVSVVESVFTEISYD-----------------TTMVTSVATATIGNTA 165
           SG+S KHV    L   V+S   E++ D                 T   T+  +A  G  A
Sbjct: 118 SGNS-KHVL---LGDHVDSRDEEVNRDWFSTLRSFLTATATATATATATATGSADSGGNA 173

Query: 166 STSQAMN-------CTTYGTFDTSKSSTFESNKTEFSITYGDSTFASGTWGHDRLSLNNL 218
            +  ++N       C++YGTF T  SS+F+SN T F I YGDST+A GTWG D ++L ++
Sbjct: 174 PSRTSVNSQYATLTCSSYGTFATDSSSSFQSNNTAFYIEYGDSTYALGTWGRDNVTLQDI 233

Query: 219 NVTGLSFAVANETNSTVGVLGIGLPGLESTYSGVSLSSAQKSYTYNNFPMILKNSGAIKS 278
            ++G+S AVANE+NST GVLGIGL  LE T  G +L++   SYTY N P  + + G I  
Sbjct: 234 TLSGISMAVANESNSTFGVLGIGLAALEVTNVG-TLATRGNSYTYENLPAKMVSEGIIHK 292

Query: 279 TAYSLFTNHSDSKHGTILFGAVDHGKYAGDLYTIPIINTLQNRGYKDPIQFQVTLQGIGV 338
            AYSLF +  D+K G++LFGAVDH KY G LYT+P+ N+ ++ GY DPIQ +VTLQG G+
Sbjct: 293 NAYSLFLDSLDAKEGSVLFGAVDHSKYTGSLYTLPLSNSYKSMGYSDPIQLEVTLQGFGM 352

Query: 339 SHGERDENMTTLTTTKIPVLLDSGTTISYMPADLVEMIASEVGATYSPDYGYYIMDCINE 398
           +    +   +T TTT +  LLDSGTT++Y+P  LV  +A++ GA Y   YGYY++ C ++
Sbjct: 353 TA---NNTNSTFTTTPLTALLDSGTTLTYLPTTLVRQVAAKYGARYDSSYGYYLLSC-SD 408

Query: 399 MEEESSLIFDFGGFYIANWLSNFQLLTDSRSNVCILGIAPQSDPAIILGDNFLVSTYVVY 458
           +++   L+FDFGGF+I + + NF  L  + SN+C LG+ PQS  ++ILGDNFL + YVVY
Sbjct: 409 VKDTDELVFDFGGFHINSKVENF--LIRATSNICALGLIPQSSSSLILGDNFLTAAYVVY 466

Query: 459 DLDNMEISMAHADFSDGGEYIDTIKDSVPSALKAPGYSSTWSTYESIVPGGNMF 512
           DLDN+EIS+A A++  G   I+ I  SVPSA+K P YSSTWST   I  GGN+F
Sbjct: 467 DLDNLEISLAQANYDGGSSNIEVISSSVPSAVKGPSYSSTWSTSVPISTGGNIF 520

>ZYRO0F10274g Chr6 complement(831057..832775) [1719 bp, 572 aa] {ON}
           similar to uniprot|P12630 Saccharomyces cerevisiae
           YIL015W BAR1 Aspartyl protease secreted into the
           periplasmic space of mating type a cells, cleaves and
           inactivates alpha factor allowing cells to recover from
           alpha-factor-induced cell cycle arrest and to YLR121C
           uniprot|Q12303 Saccharomyces cerevisiae YLR121C YPS3
           Aspartic protease, attached to the plasma membrane via a
           glycosylphosphatidylinositol (GPI) anchor and to YLR120C
           uniprot|P32329 Saccharomyces cerevisiae YLR120C YPS1
           Aspartic protease, attached to the plasma membrane via a
           glycosylphosphatidylinositol (GPI) anchor and to YDR144C
           uniprot|P53379 Saccharomyces cerevisiae YDR144C MKC7
           GPI- anchored aspartyl protease (yapsin) involved in
           protein processing; shares functions with Yap3p and
           Kex2p and to YIR039C uniprot|P40583 Saccharomyces
           cerevisiae YIR039C YPS6 Putative GPI-anchored aspartic
           protease, member on vGLC.1466.
          Length = 572

 Score =  405 bits (1042), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 237/520 (45%), Positives = 325/520 (62%), Gaps = 35/520 (6%)

Query: 14  LLHSSMVFADSIISQSSEINDGYVKMNFQRKYGDSFESATNDTKARARLVTRGDDYELVE 73
           LL  +     ++I Q+S      VK++F + +G ++E ++ +   R  L TR +      
Sbjct: 10  LLSVASTCKSALIEQTSSP---MVKLSFNKWHGPTYEESSLE---RRSLETRNNKEFNFI 63

Query: 74  LTNQNSFYSVELDIGTPPQKVTVLVDTGSSDLWVTGSDNPYCFTE-GEDTSGSSFKHVNK 132
           + NQ +FYSV+L +GTP Q +TVL+DTGSSDLW+T  +NPYC +  G +     ++  + 
Sbjct: 64  VENQQNFYSVDLLVGTPGQNITVLLDTGSSDLWLTAKNNPYCKSNAGSNDKKEDYRLEDG 123

Query: 133 DNLVSVVESVFTEISYDTTMV--TSVATATIGNT----------------ASTSQAMNCT 174
           DN    + S+ T     T  +  + + TA  G+                 +S    M+C+
Sbjct: 124 DN--QSIVSMLTASGTGTNPIGGSGIPTAISGSAQLTGTYTSGTGTGPSGSSPEPTMDCS 181

Query: 175 TYGTFDTSKSSTFESNKTEFSITYGDSTFASGTWGHDRLSLNNLNVTGLSFAVANETNST 234
            YGTFD +KS +F SNKTEF I+YGD +FASG WG D ++  N+N+ G+SFAVANETNST
Sbjct: 182 QYGTFDVNKSKSFRSNKTEFYISYGDGSFASGYWGTDSVNFANMNLEGVSFAVANETNST 241

Query: 235 VGVLGIGLPGLESTYSGVSLSSAQKSYTYNNFPMILKNSGAIKSTAYSLFTNHSDSKHGT 294
           VGV GIGLP  E+TY+     +    Y Y NFP +LK+ GAI   AYSLF N  D+  G 
Sbjct: 242 VGVFGIGLPENEATYTPDPSLNDFHPYEYQNFPQVLKSKGAINKAAYSLFLNSLDASSGD 301

Query: 295 ILFGAVDHGKYAGDLYTIPIINTLQNRGYKDPIQFQVTLQGIGVSHGERDENMTTLTTTK 354
           ILFGAVD  KY GDLYT+P++N+   + YK+P++F VTLQG+G ++G    + TT TTTK
Sbjct: 302 ILFGAVDRSKYKGDLYTLPLLNSDPTK-YKNPMEFDVTLQGVGFTNG---SSKTTFTTTK 357

Query: 355 IPVLLDSGTTISYMPADLVEMIASEVGATYSPDYGYYIMDCINEMEEESSLIFDFGGFYI 414
           IP LLDSGT++ Y+P  L + IA ++G +Y+ D GYY++ C +E  ++S L+FDFGGF I
Sbjct: 358 IPALLDSGTSLIYLPDALAKGIAHKLGGSYNEDIGYYVIGCPSE-NDDSQLVFDFGGFTI 416

Query: 415 ANWLSNFQLLT--DSRSNVCILGIAPQSDPAIILGDNFLVSTYVVYDLDNMEISMAHADF 472
            N LSN+ L +  D   + C+LGI P SD   ILGD FL   YVVYDLD+ E+S+A A F
Sbjct: 417 KNNLSNYLLGSPDDGDDSQCVLGILP-SDVQAILGDVFLADAYVVYDLDDYEVSLAQASF 475

Query: 473 SDGGEYIDTIKDSVPSALKAPGYSSTWSTYESIVPGGNMF 512
            +  E I  I DS+P A +APGYS TWST  SI  GGN+F
Sbjct: 476 DNSKEDIQIISDSIPGAKRAPGYSKTWSTPASIKSGGNIF 515

>Skud_12.193 Chr12 complement(371627..373120) [1494 bp, 497 aa] {ON}
           YLR121C (REAL)
          Length = 497

 Score =  403 bits (1035), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 224/484 (46%), Positives = 291/484 (60%), Gaps = 69/484 (14%)

Query: 33  NDGYVKMNFQRKYGDSFESATNDTKARARLVTRGDDYELVELTNQNSFYSVELDIGTPPQ 92
            + YVK+ F +          N   A   L  R + +E   L N+ SFYSVEL IGTP Q
Sbjct: 25  REKYVKIPFVK----------NQDGAGNVLGKRSNGHEKFVLANEQSFYSVELAIGTPSQ 74

Query: 93  KVTVLVDTGSSDLWVTGSDNPYCFTEGEDTSGSSFKHVNKDNLVSVVESVFTEISYDTTM 152
            +TVL+DTGS+DLWV         ++G    GS                           
Sbjct: 75  SLTVLLDTGSADLWVP--------SKGNPYCGS--------------------------- 99

Query: 153 VTSVATATIGNTASTSQAMNCTTYGTFDTSKSSTFESNKTE-FSITYGDSTFASGTWGHD 211
                             M+C  YG FD +KSSTF++NK+  F   YGD TFA G +G D
Sbjct: 100 -----------------VMDCDQYGVFDKTKSSTFKANKSSPFYAAYGDGTFAQGAFGQD 142

Query: 212 RLSLNNLNVTGLSFAVANETNSTVGVLGIGLPGLESTYSGVSLSSAQKSYTYNNFPMILK 271
           RL  N L+++GLSFAVANE+NST GVLGIGLP LE TYSG      +KSY Y+NFP+ LK
Sbjct: 143 RLKYNGLDLSGLSFAVANESNSTFGVLGIGLPALEVTYSGKVAVVDKKSYEYDNFPLFLK 202

Query: 272 NSGAIKSTAYSLFTNHSDSKHGTILFGAVDHGKYAGDLYTIPIINTLQNRGYKDPIQFQV 331
            SGAI +TAYSLF N      G+ILFGAVDH KY G LYT+P++N  +++GY+ P+ F V
Sbjct: 203 RSGAIDATAYSLFLNDESQSSGSILFGAVDHSKYEGRLYTVPLVNLYRSQGYQHPVAFDV 262

Query: 332 TLQGIGVSHGERDENMTTLTTTKIPVLLDSGTTISYMPADLVEMIASEVGATYSPDYGYY 391
           TL GIG+   + D + TTLT TKIP LLDSGTT++Y+P+  V ++A  + ATYS   GYY
Sbjct: 263 TLHGIGL---QTDRHNTTLTATKIPALLDSGTTLTYLPSQAVALLAKSLNATYSKALGYY 319

Query: 392 IMDCINEMEEESSLIFDFGGFYIANWLSNFQLLTDSRSNVCILGIAPQSDPA-IILGDNF 450
              C +  + ++S+ FDFGGF+I   +S+F + T S    C+L + PQ+  A  ILGD+F
Sbjct: 320 EYACPSS-DNDTSVAFDFGGFHINAPVSDFTMQT-SVGGTCVLAVIPQAGNATAILGDSF 377

Query: 451 LVSTYVVYDLDNMEISMAHADFSDGGEYIDTIKDSVPSALKAPGYSSTWSTYESIVPGGN 510
           L + YVVYDLDN E+S+A A +  G E I+ IK +VPSA +APGY+STWS Y S+  GGN
Sbjct: 378 LRNAYVVYDLDNYEVSLAQAKYGTGAEDIEAIKSTVPSATRAPGYNSTWSNYASVTSGGN 437

Query: 511 MFPT 514
           +F T
Sbjct: 438 IFTT 441

>KNAG0I00910 Chr9 (171104..172813) [1710 bp, 569 aa] {ON} 
          Length = 569

 Score =  402 bits (1034), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 227/506 (44%), Positives = 306/506 (60%), Gaps = 58/506 (11%)

Query: 59  RARLVTRG--DDYELVELTNQNSFYSVELDIGTPPQKVTVLVDTGSSDLWVTGSDNPYC- 115
           R  L  R   D Y L+++ NQ SFYSV+L+IGTPPQKVTVLVDTGSSDLWV G+DNP C 
Sbjct: 2   REWLAKRDNTDGYSLMDVQNQVSFYSVDLEIGTPPQKVTVLVDTGSSDLWVMGTDNPLCA 61

Query: 116 -------FTEGEDTSGSSFKHVNKDNLVS----------------VVESVFTEISYDTTM 152
                  F   E  +    +   KD  V+                +  SV  ++    TM
Sbjct: 62  SGRRGKKFLGDEGDARVEIEAQQKDEWVTTGVVTITLGDLPPGGNIWNSVAGDLESGWTM 121

Query: 153 V---------------TSVATATIGNT--ASTSQAMNCTTYGTFDTSKSSTFESNKTEFS 195
           +               T+VAT     T  ++    + C+TYGTFD SKSSTF+SN T F+
Sbjct: 122 MTGAENTMMMTGTGTETAVATGVPARTTDSAAEATVQCSTYGTFDHSKSSTFKSNNTAFA 181

Query: 196 ITYGDSTFASGTWGHDRLSLNNLNVTGLSFAVANETNSTVGVLGIGLPGLESTYSGVSLS 255
           I+YGD+++ASG+WG D +S+N LNV+G+SFAVAN +NS++GVLGIGLPGLE T    + +
Sbjct: 182 ISYGDTSYASGSWGIDTMSINKLNVSGVSFAVANYSNSSMGVLGIGLPGLEVTNQLSNTA 241

Query: 256 SAQKS--------YTYNNFPMILKNSGAIKSTAYSLFTNHSDSKHGTILFGAVDHGKYAG 307
           S +K         Y Y NFPM+LKN G I   AYSLF N    + G++LFGAVDH KY G
Sbjct: 242 SGKKDIAAASSSLYQYANFPMVLKNDGIIHKVAYSLFLNDPQEQEGSVLFGAVDHSKYTG 301

Query: 308 DLYTIPIINTLQNRGYKDPIQFQVTLQGIGVSHGERDENMTTLTTTKIPVLLDSGTTISY 367
            LYT+P+++   +     P++F +TL G+GV   ++D + +T+ TT IP LLDSGTTISY
Sbjct: 302 TLYTVPLVDIYHDSASSKPVEFDITLYGLGV---DKDGSQSTIATTTIPALLDSGTTISY 358

Query: 368 MPADLVEMIASEVGATYSPDYGYYIMDCINEMEEESSLIFDFGGFYIANWLSNFQLLTDS 427
            PA L   IA +  ATY    G+Y M C  +    ++L+FDFGGF+I   L +F  +   
Sbjct: 359 FPAQLANEIARKFNATYDSRSGFYTMSCSYDT-SNTNLVFDFGGFHITAPLDDF--VVQQ 415

Query: 428 RSNVCILGIAPQSDPAIILGDNFLVSTYVVYDLDNMEISMAHADF-SDGGEYIDTIKDSV 486
            S  C+L I PQ +  ++LGD FL + YVVYDL+N+E+SMA A+F S   E ++ I  +V
Sbjct: 416 SSQTCVLAIGPQQENWVVLGDVFLSNAYVVYDLENLEVSMAQANFDSSLPESVEVISSTV 475

Query: 487 PSALKAPGYSSTWSTYESIVPGGNMF 512
           PSA+KA  YS+ WS+   +  GGN+F
Sbjct: 476 PSAVKAASYSNPWSSAVMMSTGGNIF 501

>ZYRO0F10230g Chr6 complement(826246..827988) [1743 bp, 580 aa] {ON}
           similar to uniprot|P12630 Saccharomyces cerevisiae
           YIL015W BAR1 Aspartyl protease secreted into the
           periplasmic space of mating type a cells, cleaves and
           inactivates alpha factor allowing cells to recover from
           alpha-factor-induced cell cycle arrest and to YLR121C
           uniprot|Q12303 Saccharomyces cerevisiae YLR121C YPS3
           Aspartic protease, attached to the plasma membrane via a
           glycosylphosphatidylinositol (GPI) anchor and to YLR120C
           uniprot|P32329 Saccharomyces cerevisiae YLR120C YPS1
           Aspartic protease, attached to the plasma membrane via a
           glycosylphosphatidylinositol (GPI) anchor and to YDR144C
           uniprot|P53379 Saccharomyces cerevisiae YDR144C MKC7
           GPI- anchored aspartyl protease (yapsin) involved in
           protein processing; shares functions with Yap3p and
           Kex2p and to YIR039C uniprot|P40583 Saccharomyces
           cerevisiae YIR039C YPS6 Putative GPI-anchored aspartic
           protease, member on vGLC.1466.
          Length = 580

 Score =  399 bits (1025), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 238/535 (44%), Positives = 338/535 (63%), Gaps = 58/535 (10%)

Query: 18  SMVFADSIISQSSEINDGYVKMNFQRKYGDSFESATNDTKARARLVTRGD-DYELVELTN 76
           S  F+  +  Q+ +I    VK++F +++G+++E +    +     V R D +YEL  L N
Sbjct: 18  SAAFSQEVEEQTPKI----VKLSFDKRHGENYEESLLGKRDALPFVKRDDGEYEL-SLRN 72

Query: 77  QNSFYSVELDIGTPPQKVTVLVDTGSSDLWVTGSDNPYCFTEGEDTSGSSFKHVNKDNLV 136
           + +FYSV+L++G+P QK+TVL+DTGSSDLW+TGSDNPYC    +  S SS K    DN  
Sbjct: 73  RQNFYSVDLEVGSPSQKITVLLDTGSSDLWITGSDNPYC----KSNSHSSKKRDIGDN-- 126

Query: 137 SVVESVFTEIS-------YDTTMVTS--------------VATATIGNTAS--------- 166
             ++ +F++I+       Y T  +T               V+T  I  T +         
Sbjct: 127 -SLDDIFSDITAGGSGAIYKTLTLTGGSMPSSFGSFGSIDVSTGGIEPTETISGGGGGSG 185

Query: 167 ---------TSQAMNCTTYGTFDTSKSSTFESNKTEFSITYGDSTFASGTWGHDRLSLNN 217
                      Q+++C+ YGTFD ++SST++SN T F I+YGD +FASG WG D + L +
Sbjct: 186 GSPTGSSSSGGQSIDCSRYGTFDKNQSSTYKSNNTAFEISYGDGSFASGEWGRDHIELGS 245

Query: 218 LNVTGLSFAVANETNSTVGVLGIGLPGLESTYSGVSLSSAQKSYTYNNFPMILKNSGAIK 277
           LN++ +S AVAN+TNSTVGVLGIGLPGLE+TYS      +   + Y+NFPM+LK  G  K
Sbjct: 246 LNISDVSMAVANDTNSTVGVLGIGLPGLETTYSSDQSMVSGDRHMYSNFPMVLKERGITK 305

Query: 278 STAYSLFTNHSDSKHGTILFGAVDHGKYAGDLYTIPIINTLQNRGYKDPIQFQVTLQGIG 337
              YSL+ N  D+ +G+ILFGAVD  K+ G LYTIPI+N  ++RG   PIQF VTLQG+G
Sbjct: 306 KNVYSLYLNSPDAHNGSILFGAVDKSKFDGSLYTIPILNVYKSRGVSQPIQFDVTLQGLG 365

Query: 338 VSHGERDENMTTLTTTKIPVLLDSGTTISYMPADLVEMIASEVGATYSPDYGYYIMDCIN 397
           +S+     + TTL+TTKIP LLDSG+T++Y+P DL+EM+A  +GA +S +  YY+MDC +
Sbjct: 366 LSN---QTSTTTLSTTKIPALLDSGSTLAYLPEDLLEMVADGLGARFSENLNYYLMDCPS 422

Query: 398 EMEEESSLIFDFGGFYIANWLSNFQLLTDSRSNVCILGIAPQSDPAIILGDNFLVSTYVV 457
           +  +E+ ++F+FGGF I   L+ +   T   S+ C+L I P  D + ILGD FLV  YVV
Sbjct: 423 K-HDETKIVFNFGGFNIETNLTTYT--TPISSDTCVLRILPSGDSSAILGDAFLVHAYVV 479

Query: 458 YDLDNMEISMAHADFSDGGEYIDTIKDSVPSALKAPGYSSTWSTYESIVPGGNMF 512
           YDL++ EISMA A+F    E I+ +  S+P A  A GYSST+S+ +SI  GGN+F
Sbjct: 480 YDLEDFEISMAQANFDVNHEDIEVVSSSIPQATAAAGYSSTYSSSKSITSGGNIF 534

>Suva_10.212 Chr10 complement(396611..398848) [2238 bp, 745 aa] {ON}
           YLR121C (REAL)
          Length = 745

 Score =  402 bits (1034), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 227/501 (45%), Positives = 298/501 (59%), Gaps = 72/501 (14%)

Query: 18  SMVFADSIISQSSEINDGYVKMNF-QRKYGDSFESATNDTKARARLVTRGDDYELVELTN 76
           S+   +S++  S   N  YV++ F +R+ G   E           L  R    E   L+N
Sbjct: 11  SLALLNSLVVGSVLPNVKYVRIPFAKRQNGPGSE-----------LGKRAGGDENFVLSN 59

Query: 77  QNSFYSVELDIGTPPQKVTVLVDTGSSDLWVTGSDNPYCFTEGEDTSGSSFKHVNKDNLV 136
           + SFYSVEL +GTP Q VTVL+DTGS+DLWV  + NPYC                     
Sbjct: 60  EQSFYSVELALGTPSQNVTVLLDTGSADLWVPSNANPYC--------------------- 98

Query: 137 SVVESVFTEISYDTTMVTSVATATIGNTASTSQAMNCTTYGTFDTSKSSTFESNKTE-FS 195
                                            AMNC  YG FD + SSTF +N +  F 
Sbjct: 99  -------------------------------GSAMNCDQYGVFDKANSSTFTANHSAPFY 127

Query: 196 ITYGDSTFASGTWGHDRLSLNN-LNVTGLSFAVANETNSTVGVLGIGLPGLESTYSGVSL 254
            +YGD TFA G +G D+L  +  L+++GLSFAVAN++NSTVGVLGIGLP LE TYSG   
Sbjct: 128 ASYGDGTFAEGVFGQDKLHYSGGLDLSGLSFAVANKSNSTVGVLGIGLPMLEVTYSGKVA 187

Query: 255 SSAQKSYTYNNFPMILKNSGAIKSTAYSLFTNHSDSKHGTILFGAVDHGKYAGDLYTIPI 314
            + ++SY Y+NFP+ LK SGAI +TAYSLF N      G++LFGAVDH KY G LYTIP+
Sbjct: 188 VADKRSYQYDNFPLFLKRSGAIDATAYSLFLNDETQTSGSVLFGAVDHSKYLGQLYTIPL 247

Query: 315 INTLQNRGYKDPIQFQVTLQGIGVSHGERDENMTTLTTTKIPVLLDSGTTISYMPADLVE 374
           +N  + +GY+ P+ F VTLQG+G+    R  N TTLTTT+IP LLDSGTT++Y+PAD V 
Sbjct: 248 VNLYKAQGYQRPVAFDVTLQGLGLQ--TRAHN-TTLTTTRIPALLDSGTTLTYLPADAVA 304

Query: 375 MIASEVGATYSPDYGYYIMDCINEMEEESSLIFDFGGFYIANWLSNFQLLTDSRSNVCIL 434
           ++A  + AT+S + GYY   C    +  +S++FD GGF+I   LS+F + T+     C+L
Sbjct: 305 LMAKSLNATFSKELGYYEYACPTSGDNATSVVFDLGGFHINAPLSDFTMQTN--VGTCVL 362

Query: 435 GIAPQSDPA-IILGDNFLVSTYVVYDLDNMEISMAHADFSDGGEYIDTIKDSVPSALKAP 493
            I PQ+  A  ILGD+FL S YVVYDLDN E+S+A A +  G E I+ I+ SVP A +AP
Sbjct: 363 AIVPQAGNATAILGDSFLRSAYVVYDLDNYEVSLAQAKYGSGKEDIEAIRSSVPGATRAP 422

Query: 494 GYSSTWSTYESIVPGGNMFPT 514
           GY+STW  Y S+  GGN+F T
Sbjct: 423 GYNSTWVNYASVTSGGNIFTT 443

>ZYRO0G02904g Chr7 (220115..221710) [1596 bp, 531 aa] {ON} similar
           to uniprot|P12630 Saccharomyces cerevisiae YIL015W BAR1
           Aspartyl protease secreted into the periplasmic space of
           mating type a cells, cleaves and inactivates alpha
           factor allowing cells to recover from
           alpha-factor-induced cell cycle arrest and to YLR121C
           uniprot|Q12303 Saccharomyces cerevisiae YLR121C YPS3
           Aspartic protease, attached to the plasma membrane via a
           glycosylphosphatidylinositol (GPI) anchor and to YLR120C
           uniprot|P32329 Saccharomyces cerevisiae YLR120C YPS1
           Aspartic protease, attached to the plasma membrane via a
           glycosylphosphatidylinositol (GPI) anchor and to YDR144C
           uniprot|P53379 Saccharomyces cerevisiae YDR144C MKC7
           GPI- anchored aspartyl protease (yapsin) involved in
           protein processing; shares functions with Yap3p and
           Kex2p and to YIR039C uniprot|P40583 Saccharomyces
           cerevisiae YIR039C YPS6 Putative GPI-anchored aspartic
           protease, member on vGLC.1466.
          Length = 531

 Score =  395 bits (1014), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 210/510 (41%), Positives = 319/510 (62%), Gaps = 29/510 (5%)

Query: 5   TIKFVVNALLLHSSM--VFADSIISQSSEINDGYVKMNFQRKYGDSFESATNDTKARARL 62
           TI F    +LL  ++  +     + +    +   VK +F +  G +F +A+ +   R + 
Sbjct: 4   TILFAACCVLLSETVQCISVRHYLEEEEASSPKLVKFSFNKHQGRTF-TASEELSKRDKD 62

Query: 63  VTRGDDYELVELTNQNSFYSVELDIGTPPQKVTVLVDTGSSDLWVTGSDNPYCFTEGEDT 122
           VT        +L N+ +FYS++L +GTP Q+V VL+DTGSSDLW+ GSDNPYC    +++
Sbjct: 63  VT-------FDLKNEQNFYSIKLSVGTPGQEVVVLLDTGSSDLWIPGSDNPYC----KES 111

Query: 123 SGSSFKHVNKDNLVSVVESVFTEISYDTTMVTSVATATIGNTASTSQAMNCTTYGTFDTS 182
           S  S  +  K+N     E  F       T+   V    +   ++ S  ++C  +GTF+  
Sbjct: 112 SSFSISNQGKEN---GAEGPFQ------TLPGGVTATNMSGGSTASATLDCKEFGTFNRE 162

Query: 183 KSSTFESNKTEFSITYGDSTFASGTWGHDRLSLNNLNVTGLSFAVANETNSTVGVLGIGL 242
            S TF SN TEFS++YGD+++A GTWG+D +++N++N+T +S  VAN+TNS+VG++GIGL
Sbjct: 163 DSKTFHSNDTEFSVSYGDTSYAIGTWGYDSININDVNLTNVSIGVANKTNSSVGIMGIGL 222

Query: 243 PGLESTYSGVSLSSAQKSYTYNNFPMILKNSGAIKSTAYSLFTNHSDSKHGTILFGAVDH 302
             LE+TY+GV     + ++ Y NFPM+LK  G I+   YSLF N  ++  G+ILFGAVDH
Sbjct: 223 SNLENTYTGVENVKNRNTHKYLNFPMLLKEQGFIEKNVYSLFLNRREAFEGSILFGAVDH 282

Query: 303 GKYAGDLYTIPIINTLQNRGYKDPIQFQVTLQGIGVSHGERDENMTTLTTTKIPVLLDSG 362
            KY+G LYT+P++N  Q +G KDP+Q QVTLQG+G+   E +    T +TT +P LLDSG
Sbjct: 283 SKYSGQLYTVPMLNLYQQQGLKDPLQLQVTLQGVGI---EANNMTNTTSTTPVPALLDSG 339

Query: 363 TTISYMPADLVEMIASEVGATYSPDYGYYIMDCINEMEEESSLIFDFGGFYIANWLSNFQ 422
           TT+ Y+P  ++ M+A ++ A +    GYY+ DC     + ++L F+FGGF I + +S + 
Sbjct: 340 TTLVYLPDKMLAMLAEQLNAHWDRGIGYYVTDC--SRVDNTNLYFNFGGFNIVSNMSTY- 396

Query: 423 LLTDSRSNVCILGIAPQSDPAIILGDNFLVSTYVVYDLDNMEISMAHADFSDGGEYIDTI 482
           +++ S  N C+LG+ P    A ILGD F+   Y+V+DLD+ EISMA A+++ G   ++ +
Sbjct: 397 VVSRSNENSCVLGLQPGGPEAAILGDMFMQHAYIVFDLDDFEISMAQANYAGGKNQLEAV 456

Query: 483 KDSVPSALKAPGYSSTWSTYESIVPGGNMF 512
              VPSA+KAPGYS T+S  + I  GGN+F
Sbjct: 457 TQQVPSAMKAPGYSHTFSGSQGITGGGNIF 486

>Kwal_56.23902 s56 complement(767431..769320) [1890 bp, 629 aa] {ON}
           YLR120C (YPS1) - GPI-anchored aspartic protease [contig
           171] FULL
          Length = 629

 Score =  393 bits (1009), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 237/549 (43%), Positives = 336/549 (61%), Gaps = 53/549 (9%)

Query: 1   MKLSTIKFVVN-ALLLHSSMVFADSIISQSSEINDGYVKMNFQRKYGDSFESATNDTKAR 59
           M++S+   ++  A L+ S+ + A++  SQ       +VK++F +  GD  E+A      R
Sbjct: 1   MRISSSTAILGLAGLVSSTAISAEAKYSQDES---KFVKLSFDKLRGDLVENARAGQIPR 57

Query: 60  ARLVTRGDDYELVELTNQNSFYSVELDIGTPPQKVTVLVDTGSSDLWVTGSDNPYCFTEG 119
            + V R D     E+ NQ++FYSV + +G+P Q VT+L+DTGSSD+WV GS+NPYC    
Sbjct: 58  VKRVKRDDGTASFEIDNQDTFYSVTIGVGSPAQDVTLLIDTGSSDIWVMGSNNPYC---- 113

Query: 120 EDTSGSSFKHV-------------NKD---NLVSVVESV------------FTEISYDTT 151
           E +SG S KHV              KD   +L+S + +              T+++ +TT
Sbjct: 114 EGSSGKS-KHVLLHEDSGFEDDTNGKDFYSDLLSYLTATGTAEYSGSYWATATDVTVETT 172

Query: 152 MV----TSVATATIGNTASTSQAMNCTTYGTFDTSKSSTFESNKTEFSITYGDSTFASGT 207
                 T V TAT  +  S    ++C+ YGTF T  SS+F+SN T+F I YGD ++A G 
Sbjct: 173 SYWPDDTDVPTAT--SMDSYQATISCSEYGTFATDSSSSFKSNGTQFLIQYGDLSYALGV 230

Query: 208 WGHDRLSLNNLNVTGLSFAVANETNSTVGVLGIGLPGLESTYSGVSLSSAQKSYTYNNFP 267
           WG D ++L ++ V+ +S AVAN +NST GVLGIGLPGLE T       S   +YTY NFP
Sbjct: 231 WGRDDVTLQDVKVSDISLAVANISNSTFGVLGIGLPGLEVT--NALAESPSDAYTYKNFP 288

Query: 268 MILKNSGAIKSTAYSLFTNHSDSKHGTILFGAVDHGKYAGDLYTIPIINTLQNRGYKDPI 327
            +L + G I+ +AYSLF N  ++ HG++LFGAVDH KY G L TIP++N++++     PI
Sbjct: 289 AMLVDQGKIRKSAYSLFVNDLNATHGSVLFGAVDHSKYTGTLQTIPLVNSIKSAQVPKPI 348

Query: 328 QFQVTLQGIGVSHGERDENMTTLTTTKIPVLLDSGTTISYMPADLVEMIASEVGATYSPD 387
           QF VTL G+G++  +     TT+TTT  P LLDSGTT +++P  LV  IA ++ A Y  +
Sbjct: 349 QFDVTLHGLGITLNDT---NTTITTTPFPALLDSGTTFTHLPGYLVSAIAKKLNAEYGDE 405

Query: 388 YGYYIMDCINEMEEESSLIFDFGGFYIANWLSNFQLLT----DSRSNVCILGIAPQSDPA 443
            G+Y   C +E+ +   L+FDFGGF+I + L NF L T    D+ ++VC L + P +   
Sbjct: 406 DGFYRYQC-DEISDSDELVFDFGGFHIKSKLDNFALATYDDDDNETDVCALALIPYNRGE 464

Query: 444 IILGDNFLVSTYVVYDLDNMEISMAHADFSDGGEYIDTIKDSVPSALKAPGYSSTWSTYE 503
           IILGDNFL + YVVYDL+N+EISMA A+   G E I+ I  +VPSA+KAPGYSSTW++  
Sbjct: 465 IILGDNFLTAAYVVYDLENLEISMAQANLDGGSEDIEEIVSTVPSAVKAPGYSSTWTSAI 524

Query: 504 SIVPGGNMF 512
            I  GGN+F
Sbjct: 525 PISTGGNIF 533

>TBLA0A03910 Chr1 complement(977504..979294) [1791 bp, 596 aa] {ON}
           Anc_8.318 YLR120C
          Length = 596

 Score =  390 bits (1003), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 236/493 (47%), Positives = 302/493 (61%), Gaps = 41/493 (8%)

Query: 32  INDGYVKMNFQRKYGDSFESATNDTKARARLVTRGDD------YELVELTNQNSFYSVEL 85
           I   ++++ F R YG+S+E +T        L  R  D      YE V LTNQ +FYSVEL
Sbjct: 42  IKPKFLELKFDRHYGESYEDSTLGKDGAVHLEKRTFDSAYNGSYEDVILTNQLTFYSVEL 101

Query: 86  DIGTPPQKVTVLVDTGSSDLWVTGSDNPYCFTEGEDTSGSSF-KHVNKDNLVSVVESVFT 144
           DIGTP QKVTV+VDTGSSDLW+T + NP+C T  +DT  S +   + KD    +   V  
Sbjct: 102 DIGTPAQKVTVVVDTGSSDLWITETSNPFCSTGDDDTEDSVWSPFLLKDK---IDPRVLK 158

Query: 145 EISYDTTMVTSVATATIGN-----------TASTSQAMNCTTYGTFDTSKSSTFESNKTE 193
                TT +   ATAT G+           T      +NCT +GTF+T KSSTF++N T+
Sbjct: 159 HKGKRTTSIDVTATATTGSINISIDLGSNFTLPPEFLINCTEFGTFNTKKSSTFKNNHTD 218

Query: 194 FSITYGDSTFASGTWGHDRLSLNNLNVTGLSFAVANETNSTVGVLGIGLPGLESTYSGVS 253
           F I+YGD+TFASG WG D LS  ++NVTGLSF VAN TNSTVGVLGIGLP LESTY G  
Sbjct: 219 FFISYGDNTFASGYWGRDVLSFQDINVTGLSFGVANVTNSTVGVLGIGLPELESTYFGTV 278

Query: 254 LSSAQKSYTYNNFPMILKNSGAIKSTAYSLFTNHSDSKHGTILFGAVDHGKYAGDLYTIP 313
            S  + SY YNNFP +LKNSG I  TAYSLF N SDS  G++L GAVD  K+A  LYT+P
Sbjct: 279 NSVNESSYIYNNFPQVLKNSGIINKTAYSLFLNKSDSTQGSLLLGAVDTSKFADKLYTVP 338

Query: 314 IINTLQNRGYKDPIQFQVTLQGI-----GVSHGERDENMTTLTTTKIPVLLDSGTTISYM 368
           ++N   ++GY DP  F V +Q +     G  H         + +++IPVLLDSGTT+ Y+
Sbjct: 339 MLNINPSKGYTDPSAFLVLMQKMTRYKYGQGH--------LVPSSRIPVLLDSGTTMVYL 390

Query: 369 PADLVEMIASEVGATYSPDYGYYIMDCINEMEE-ESSLIFDFGGFYIANWLSNFQLLTDS 427
           P  +VE I     A Y  +   Y + C +  ++ ++S  FDFGGF I   LS+F + TD+
Sbjct: 391 PRSIVEQIMRHEEAQYVEELDLYQIKCPSPNKKNQTSFSFDFGGFQIKASLSDFIVPTDN 450

Query: 428 RSNVCILGIAPQSDPAIILGDNFLVSTYVVYDLDNMEISMAHADFSDGGE--YIDTIKDS 485
               CI G+ PQ     ILGD+FL   YVVYDL++ EISMA A + DGGE  YI  I  +
Sbjct: 451 GQ--CIFGMIPQDMNVGILGDSFLTHAYVVYDLEDYEISMAQAVY-DGGEPNYI-PIVST 506

Query: 486 VPSALKAPGYSST 498
           VPSA++A  YS+T
Sbjct: 507 VPSAVRAKYYSAT 519

>AGL192W Chr7 (337445..338944) [1500 bp, 499 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YLR121C (YPS3),
           YDR144C (MKC7) and YLR120C (YPS1); Tandem gene
           duplication in Saccharomyces cerevisiae
          Length = 499

 Score =  385 bits (990), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 199/476 (41%), Positives = 282/476 (59%), Gaps = 53/476 (11%)

Query: 36  YVKMNFQRKYGDSFESATNDTKARARLVTRGDDYELVELTNQNSFYSVELDIGTPPQKVT 95
           +V+M+F +K G SF  A +   A  RL  R +D+  +E+ NQ  FYSV L IGTPPQ+V 
Sbjct: 30  FVRMDFDKKRGPSFSEAWSGRAAVPRLAKR-NDWVDIEIDNQQMFYSVNLSIGTPPQEVR 88

Query: 96  VLVDTGSSDLWVTGSDNPYCFTEGEDTSGSSFKHVNKDNLVSVVESVFTEISYDTTMVTS 155
           VL+DTGSSDLWV G+        G     +++ + N+                       
Sbjct: 89  VLMDTGSSDLWVVGA--------GVRCGPNNYPNPNQ----------------------- 117

Query: 156 VATATIGNTASTSQAMNCTTYGTFDTSKSSTFESNKTEFSITYGDSTFASGTWGHDRLSL 215
                          +NC  +G+FDTS+SST++ N T+F I YGDST+A GTWG DRL L
Sbjct: 118 ---------------LNCYEHGSFDTSRSSTWKDNNTQFHIRYGDSTYAHGTWGTDRLDL 162

Query: 216 NNLNVTGLSFAVANETNSTVGVLGIGLPGLESTYSGVSLSSAQKSYTYNNFPMILKNSGA 275
              NV GL+FAVA+ +NS+V VLGIGLP +E+T     +SS Q  Y Y+N PM+LK +  
Sbjct: 163 GQANVDGLTFAVAHASNSSVAVLGIGLPAMETT-----MSSQQFGYQYDNLPMVLKRNNV 217

Query: 276 IKSTAYSLFTNHSDSKHGTILFGAVDHGKYAGDLYTIPIINTLQNRGYKDPIQFQVTLQG 335
           IK T YS+F N  ++K G++LFGAVDH KY G L T+P++N    R    P++  VTL  
Sbjct: 218 IKKTVYSMFINELNAKTGSVLFGAVDHSKYKGTLNTVPLVNANYRRRVNKPVELHVTLAA 277

Query: 336 IGVSHGERDENMTTLTTTKIPVLLDSGTTISYMPADLVEMIASEVGATYSPDYGYYIMDC 395
           IG+  G  ++ + TL  +K+P LLDSGTT++Y P  L + +A   GA +  +   YI+DC
Sbjct: 278 IGLHTGRDEDKVQTLLGSKVPALLDSGTTLTYFPMQLADRLARAAGARWHSEEVGYIVDC 337

Query: 396 INEMEEESSLIFDFGGFYIANWLSNFQLLTDSRSNVCILGIAPQSDPAIILGDNFLVSTY 455
            +    +++ I+DFGGF I + LS++ ++T+ R   C  GI P S   +ILGD FL   Y
Sbjct: 338 NSRRLHQTAYIYDFGGFQIRSPLSDYSMMTNVRG-TCRFGIMPHSSDYVILGDVFLTRAY 396

Query: 456 VVYDLDNMEISMAHADFSDGGEYIDTIKDSVPSALKAPGYSSTWSTYESIVPGGNM 511
           VV+DL+ +E+SMA A++  G E I+ I  +VP A++APGY+  W  Y  +V  G +
Sbjct: 397 VVFDLEALEVSMAQANYEGGKEQIEVIAGAVPRAVRAPGYNDPWKAYTPLVFNGEL 452

>TBLA0D00140 Chr4 (31269..33092) [1824 bp, 607 aa] {ON} 
          Length = 607

 Score =  382 bits (980), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 226/518 (43%), Positives = 309/518 (59%), Gaps = 55/518 (10%)

Query: 34  DGYVKMNFQRKYGDS-----FESATNDTKARARLVTRGDDYELVELTNQNSFYSVELDIG 88
           D  ++++  + YGDS      E   + +   ARLV R D +E++E+ NQ +FYSV+L +G
Sbjct: 27  DKVLRLDINKFYGDSKFNLGSEIDEDISTPSARLVKREDGHEIIEIQNQQAFYSVDLMLG 86

Query: 89  TPPQKVTVLVDTGSSDLWVTGSDNPYCFTEGEDTSGSSFKHVN---------KDNLVSVV 139
           TPPQKVTVLVDTGSSDLWVTG++NPYC        G+S K V+         K+ +  VV
Sbjct: 87  TPPQKVTVLVDTGSSDLWVTGNNNPYCI------DGTSSKAVSSNIEDDSQTKNPISKVV 140

Query: 140 ESVFTEISY-------DTTMVTSVA-----TATIGNTASTSQAMNCTTYGTFDTSKSSTF 187
            +   +I         D + +         ++ + +       ++C+TYGTFD SKSSTF
Sbjct: 141 GTTINKIRKYFSHNLPDLSFLEDSGSGKYNSSQLKDVTPQDAHIDCSTYGTFDPSKSSTF 200

Query: 188 ESNKTEFSITYGDSTFASGTWGHDRLSL-NNLNVTGLSFAVANETNSTVGVLGIGLPGLE 246
            SN T F I YGD TFASGTWG D +   ++LN+T  SF VA+ TNST+ VLG+GLP LE
Sbjct: 201 VSNDTNFMIRYGDRTFASGTWGRDSIEFSDHLNLTDFSFGVADLTNSTISVLGMGLPRLE 260

Query: 247 STYSGVSLSSAQKSYTYNNFPMILKNSGAIKSTAYSLFTNHSDSKHGTILFGAVDHGKYA 306
            TYSG+SL   +  YTY NFPM LK SG I    YSL+ N + +  G++LFGAVDH KY 
Sbjct: 261 VTYSGLSLD--RSPYTYANFPMALKQSGLIDRMVYSLYLNKAGASTGSVLFGAVDHSKYH 318

Query: 307 GDLYTIPIINTLQNRGYKDPIQFQVTLQGIGVSHGERDENMTTLTTTKIPVLLDSGTTIS 366
           G L TIP+I +L   G   PI F V LQG+G+S     +   T  +T +P LLDSGTT++
Sbjct: 319 GSLNTIPLI-SLSGSGI--PIAFNVALQGLGMSSDS--QGTQTFLSTPLPALLDSGTTMT 373

Query: 367 YMPADLVEMIASEVGATYSPDYGYYIMDCINEMEEESSLIFDFGGFYIANWLSNFQLLTD 426
           Y+P  LV  +AS +GA++    G Y++DC +   ++    FDFGGF I+  LSNF L  +
Sbjct: 374 YLPDALVATVASTLGASFDEAQGLYLLDCPSG-SDDREFNFDFGGFQISVPLSNFIL--E 430

Query: 427 SRSNVCILGIAPQSDPAIILGDNFLVSTYVVYDLDNMEISMAHADFSDGGE--------- 477
           +  +VC+L +        ILGD+FL   YVVYDL+N+EISMA A + D  +         
Sbjct: 431 ALPDVCVLTLFESHAERAILGDSFLTEAYVVYDLENLEISMAQARYDDDNDSDIEKYNAD 490

Query: 478 ---YIDTIKDSVPSALKAPGYSSTWSTYESIVPGGNMF 512
               ++ +  ++PSA +APGYSST     +I P GNM+
Sbjct: 491 NKVLLEVVTSNIPSANQAPGYSSTLINRSTIQPSGNMY 528

>ZYRO0F10318g Chr6 complement(835672..837132) [1461 bp, 486 aa] {ON}
           similar to uniprot|P12630 Saccharomyces cerevisiae
           YIL015W BAR1 Aspartyl protease secreted into the
           periplasmic space of mating type a cells, cleaves and
           inactivates alpha factor allowing cells to recover from
           alpha-factor-induced cell cycle arrest and to YLR121C
           uniprot|Q12303 Saccharomyces cerevisiae YLR121C YPS3
           Aspartic protease, attached to the plasma membrane via a
           glycosylphosphatidylinositol (GPI) anchor and to YLR120C
           uniprot|P32329 Saccharomyces cerevisiae YLR120C YPS1
           Aspartic protease, attached to the plasma membrane via a
           glycosylphosphatidylinositol (GPI) anchor and to YDR144C
           uniprot|P53379 Saccharomyces cerevisiae YDR144C MKC7
           GPI- anchored aspartyl protease (yapsin) involved in
           protein processing; shares functions with Yap3p and
           Kex2p and to YIR039C uniprot|P40583 Saccharomyces
           cerevisiae YIR039C YPS6 Putative GPI-anchored aspartic
           protease, member on vGLC.1466.
          Length = 486

 Score =  377 bits (968), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 220/522 (42%), Positives = 307/522 (58%), Gaps = 57/522 (10%)

Query: 1   MKLSTIKFVVNALLLHSSMVFADSIISQSSEINDGYVKMNFQRKYGDSFESATNDTKARA 60
           MK +T+    NA+ + +S V   +I +   E++   ++++F +  G     A N+   + 
Sbjct: 1   MKFTTL----NAIGILASTVSGAAIENHRREVSPKIIQLSFNKHGG-----AANN---KD 48

Query: 61  RLVTRGDDYEL-VELTNQNSFYSVELDIGTPPQKVTVLVDTGSSDLWVTGSDNPYCFTEG 119
            L     + ++ V  TN+  FYSVEL +GTP QK++VL+DTGSSDLWV G+DN +C    
Sbjct: 49  ILTPTSQNTDISVNATNRYIFYSVELSVGTPAQKLSVLLDTGSSDLWVPGADNLFCENHA 108

Query: 120 EDTSGSSFKHVNKDNLVSVVESVFTEISYDTTMVTSVATATIGNTASTSQAMNCTTYGTF 179
              S S+ K +    L                              S    ++C  YGTF
Sbjct: 109 VSDSNSTDKPLKSPTL-----------------------------PSPQPTIDCNQYGTF 139

Query: 180 DTSKSSTFESNKTEFSITYGDSTFASGTWGHDRLSLNNLNVTGLSFAVANETNSTVGVLG 239
           D SKSS+F++N +   I YGD ++A G +G D + +N+L++  +S  VA++ N T GVLG
Sbjct: 140 DYSKSSSFKANDSSLLIRYGDQSYALGRFGQDTVEMNSLSIPNVSLGVAHQANVTQGVLG 199

Query: 240 IGLPGLESTYSGVSLSSAQKSYTYNNFPMILKNSGAIKSTAYSLFTNHSDSKHGTILFGA 299
           IGL GLE+T +G S +   KSYTY NFP +LK+ G I + AYSLF N   +  G ILFG 
Sbjct: 200 IGLAGLETTNTGFSSTLNSKSYTYENFPQVLKSQGIIDANAYSLFLNSPGASQGGILFGG 259

Query: 300 VDHGKYAGDLYTIPIINTLQNRGYKDPIQFQVTLQGIGVSHGERDENMT---------TL 350
           VDH KY G LYT+PIINT       +PIQFQVTLQG+G+S  + +   T         TL
Sbjct: 260 VDHSKYTGPLYTVPIINT---GAPGNPIQFQVTLQGVGISLDKSNGTNTNAADSTSNVTL 316

Query: 351 TTTKIPVLLDSGTTISYMPADLVEMIASEVGATYSPDYGYYIMDCINEMEEESSLIFDFG 410
           T +K PVLLDSGTT+  +P  + + +A ++GATY+ +  YY + C ++  + + LI DFG
Sbjct: 317 TASKFPVLLDSGTTLMTLPRPVTDQMAKQLGATYNSETSYYQLKCPSQ-NDNTRLILDFG 375

Query: 411 GFYIANWLSNFQLLTDSRSNVCILGIAPQSDPAIILGDNFLVSTYVVYDLDNMEISMAHA 470
           GF +   ++N   +T S++  C+LGI P    +  LGD FLV  YVVYDLDN EIS+A A
Sbjct: 376 GFQVNAKITNH--ITRSQNGECLLGITPSDTDSGTLGDVFLVDAYVVYDLDNYEISLAQA 433

Query: 471 DFSDGGEYIDTIKDSVPSALKAPGYSSTWSTYESIVPGGNMF 512
           DFSD  + I+ I  SVPSA KAPGYS+TW+  ESI  GGN+F
Sbjct: 434 DFSDSAQSIEPISSSVPSATKAPGYSNTWTGSESIKTGGNIF 475

>Ecym_4251 Chr4 complement(520455..521963) [1509 bp, 502 aa] {ON}
           similar to Ashbya gossypii AGL192W
          Length = 502

 Score =  375 bits (964), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 208/491 (42%), Positives = 288/491 (58%), Gaps = 58/491 (11%)

Query: 24  SIISQSSEINDGYVKMNFQRKYGDSFESATNDTKARARLVTRGDDYELVELTNQNSFYSV 83
           ++++Q +E +  YV+ +  +  G+ F S+         L  R D+Y  V++ N+ +FYSV
Sbjct: 20  ALLAQRAE-SAAYVRFDLDKTRGNDFRSSEKGVMPFGELKKRDDEYVDVKIHNEQTFYSV 78

Query: 84  ELDIGTPPQKVTVLVDTGSSDLWVTGSDNPYCFTEGEDTSGSSFKHVNKDNLVSVVESVF 143
            L IGTP Q+VTVLVDTGSSDLW+ G+D       G D S S+                 
Sbjct: 79  NLSIGTPAQEVTVLVDTGSSDLWIIGAD----VDCGPDNSDST----------------- 117

Query: 144 TEISYDTTMVTSVATATIGNTASTSQAMNCTTYGTFDTSKSSTFESNKTEFSITYGDSTF 203
                                    + ++C  YG FD SKSS++++N TEF I+YGD++F
Sbjct: 118 -------------------------EPLDCFEYGAFDKSKSSSWKNNHTEFYISYGDTSF 152

Query: 204 ASGTWGHDRLSLNNLNVTGLSFAVANETNSTVGVLGIGLPGLESTYSGVSLSSAQKSYTY 263
           ASG WG D+L L +LN  GL+FAVA  +NS+V VLGIGL G+E     V+ +S    Y Y
Sbjct: 153 ASGEWGTDKLDLGDLNADGLTFAVATASNSSVAVLGIGLTGIE-----VTRASGDNGYEY 207

Query: 264 NNFPMILKNSGAIKSTAYSLFTNHSDSKHGTILFGAVDHGKYAGDLYTIPIINTLQNRGY 323
           +N P++LK +G I  TAYSL+ N  D+  G++LFGAVDH KY G L T+P++N     G+
Sbjct: 208 DNLPIVLKRNGVIDKTAYSLYLNDLDATSGSVLFGAVDHSKYTGTLATVPLVNVNARYGF 267

Query: 324 KDPIQFQVTLQGIGVSHGERDENMTTLTTTKIPVLLDSGTTISYMPADLVEMIASEVGAT 383
             PI+  +TL G+G S G++     T++ TK+P LLDSGTT+SY P +L   IAS VGA 
Sbjct: 268 PKPIELHITLNGLGFSSGKK---RGTISATKVPALLDSGTTLSYFPTELAAAIASNVGAV 324

Query: 384 YSPDYGYYIMDCINEMEEESSLIFDFGGFYIANWLSNFQLLTDSRSNVCILGIAPQSDPA 443
           ++     +++ C         LI++FGG  I + L N+ L   +  +VC+LGI P S   
Sbjct: 325 WNARLRKFLIPCSQAKRNNIDLIYNFGGVEITSPLVNY-LSETNVEDVCLLGIVPTSSND 383

Query: 444 IILGDNFLVSTYVVYDLDNMEISMAHADF--SDGGEYIDTIKDSVPSALKAPGYSSTWST 501
           IILGD FL S Y VYDL+ +E+S+A A +  S   E I+ IK +VP A KAPGYS+TWST
Sbjct: 384 IILGDVFLTSVYTVYDLEALEVSIAQAAYGASAEKENIEVIKSTVPGATKAPGYSNTWST 443

Query: 502 YESIVPGGNMF 512
           Y  I  GGNMF
Sbjct: 444 YAPISTGGNMF 454

>NDAI0J01030 Chr10 (235967..237925) [1959 bp, 652 aa] {ON} 
          Length = 652

 Score =  379 bits (972), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 190/351 (54%), Positives = 252/351 (71%), Gaps = 11/351 (3%)

Query: 167 TSQAMNCTTYGTFDTSKSSTFESNKTEFSITYGDSTFASGTWGHDRLSLNNLNVTGLSFA 226
           + + ++C  YGTF++S+SSTF++N T FSI+YGDSTFASGTW  D L+L++LNVTGLSFA
Sbjct: 238 SERTLDCQEYGTFNSSRSSTFKNNYTSFSISYGDSTFASGTWAQDVLNLSDLNVTGLSFA 297

Query: 227 VANETNSTVGVLGIGLPGLESTYSGVSLSSAQKSYTYNNFPMILKNSGAIKSTAYSLFTN 286
           VAN TNSTVGVLGIGLP LESTYSG S ++ ++ Y Y NFPM+LK SGAI +T YSLF +
Sbjct: 298 VANMTNSTVGVLGIGLPALESTYSGASGATQRQMYQYMNFPMVLKQSGAIHTTTYSLFLD 357

Query: 287 HSDSKHGTILFGAVDHGKYAGDLYTIPIINTLQNRGYKDPIQFQVTLQGIGVSHGERDEN 346
             D  HG++LFGA+DH KY G LYT+P+IN ++N GY +PIQF VTL GIG+ +GER+  
Sbjct: 358 DLDESHGSVLFGAIDHSKYTGQLYTVPMINIMRNSGYSNPIQFDVTLFGIGLQNGERN-- 415

Query: 347 MTTLTTTKIPVLLDSGTTISYMPADLVEMIASEVGATYSPDYGYYIMDCINEMEEESSLI 406
             TLTTTK+  LLDSGTTISY P  +VE++A ++ A YS   G+Y + C   +   ++L+
Sbjct: 416 -LTLTTTKLAALLDSGTTISYFPTSVVELVARQINAQYSARLGFYTVPC-RSVSSNTNLV 473

Query: 407 FDFGGFYIANWLSNFQLLTDSRSNVCILGIAPQSDPAIILGDNFLVSTYVVYDLDNMEIS 466
           FDFGGF+I+  L +F + T  ++  CIL +APQ    +ILGD FL   YVVYDLDN  I+
Sbjct: 474 FDFGGFHISGPLQDFLIQTSQQT--CILAMAPQESQHVILGDIFLTHAYVVYDLDNYVIA 531

Query: 467 MAHADFSDGGEY----IDTIKDS-VPSALKAPGYSSTWSTYESIVPGGNMF 512
           +A AD S   +     I+ I +S +P A++AP YS TW+    +  GGN+F
Sbjct: 532 LAQADTSTSNQSSSSDIELITNSTIPRAIRAPLYSETWTANRPVQSGGNIF 582

 Score =  110 bits (275), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 54/84 (64%), Positives = 64/84 (76%), Gaps = 4/84 (4%)

Query: 36  YVKMNFQRKYGDSFESATNDTKARARLVTR----GDDYELVELTNQNSFYSVELDIGTPP 91
           YVK+ F++  GDSFESAT + K   +L+ R    G  YE V++TNQ SFYSVEL IGTPP
Sbjct: 57  YVKLPFEKYTGDSFESATRNNKPLNQLLKRDNEDGAGYEDVKITNQQSFYSVELAIGTPP 116

Query: 92  QKVTVLVDTGSSDLWVTGSDNPYC 115
           Q VTVLVDTGS+DLWVTGS NP+C
Sbjct: 117 QHVTVLVDTGSADLWVTGSMNPFC 140

>TBLA0E02630 Chr5 complement(665115..667184) [2070 bp, 689 aa] {ON} 
          Length = 689

 Score =  368 bits (944), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 191/348 (54%), Positives = 259/348 (74%), Gaps = 11/348 (3%)

Query: 171 MNCTTYGTFDTSKSSTFESNKTEFSITYGDSTFASGTWGHDRLSLNN-LNVTGLSFAVAN 229
           +NC  YGTFD   SST++SN+T F+I Y D++FASG WG D L+ ++ LNVTGLSFAVAN
Sbjct: 282 INCDAYGTFDIENSSTYQSNQTGFAIRYADTSFASGDWGRDVLTFSDGLNVTGLSFAVAN 341

Query: 230 ETNSTVGVLGIGLPGLESTYSGVSLSSAQKSYTYNNFPMILKNSGAIKSTAYSLFTNHSD 289
           +TNSTVGVLGIGLP LE TY+GV  ++  K YTY+NFP++LKNSGAI  +AYSL+ N   
Sbjct: 342 QTNSTVGVLGIGLPQLEVTYAGVYQTT--KPYTYDNFPLVLKNSGAIHKSAYSLYLNKQS 399

Query: 290 SKHGTILFGAVDHGKYAGD-LYTIPIINTLQNRGYKDPIQFQVTLQGIGVSHGERDENMT 348
           +K+G +LFGA+DH +Y GD LYTIP++N+  + GY  PI+F VTLQG+GVS   R+ N  
Sbjct: 400 AKNGNVLFGAIDHSQYQGDTLYTIPLVNSDTSSGYSKPIEFDVTLQGLGVSD-NRNGNF- 457

Query: 349 TLTTTKIPVLLDSGTTISYMPADLVEMIASEVGATYSPDYGYYIMDCINEMEEESSLIFD 408
           T+TTT+I  LLDSGTT++Y P D++ ++A  + A+YS   GYY+M+C +   + + L+FD
Sbjct: 458 TVTTTQIVALLDSGTTLTYFPKDMLNLLAKRINASYSEALGYYVMNCPDS-RDNTQLVFD 516

Query: 409 FGGFYIANWLSNFQLLTDSRSNVCILGIAPQSDPAIILGDNFLVSTYVVYDLDNMEISMA 468
           FGGF+I   L+NF L   S S  C+LG+ P +  + ILGD FL   YVVY+LD++EISMA
Sbjct: 517 FGGFHIKTNLTNFVL--SSASGKCVLGLLPYNGNSAILGDIFLTHAYVVYNLDDLEISMA 574

Query: 469 HADFSDGG-EYIDTIKDSVPSALKAPGYSSTWSTYESIVPGGNMF-PT 514
            A+F++G  E I+ I  ++P+A+KAPGYS T+S  +SIVPGG++F PT
Sbjct: 575 QANFNNGNDEDIEVISSTIPNAVKAPGYSYTYSVSKSIVPGGDIFVPT 622

 Score = 94.7 bits (234), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 46/97 (47%), Positives = 59/97 (60%), Gaps = 15/97 (15%)

Query: 34  DGYVKMNFQRKYGDSFESAT---------------NDTKARARLVTRGDDYELVELTNQN 78
           D ++K+ FQ+ Y DS                     ++K   +L+ R D YE +++ NQ 
Sbjct: 38  DKFLKLEFQKFYADSVNDIPPRDYSFNKRDSVLDLKNSKPYIKLIKRHDGYEKIQIINQQ 97

Query: 79  SFYSVELDIGTPPQKVTVLVDTGSSDLWVTGSDNPYC 115
           SFYSV L IGTP Q +TVLVDTGSSDLWVTGS+NPYC
Sbjct: 98  SFYSVNLQIGTPAQSITVLVDTGSSDLWVTGSNNPYC 134

>KNAG0E03220 Chr5 complement(647282..648904) [1623 bp, 540 aa] {ON} 
          Length = 540

 Score =  362 bits (929), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 211/490 (43%), Positives = 297/490 (60%), Gaps = 23/490 (4%)

Query: 24  SIISQSSEINDGYVKMNFQRKYGDSFESATNDTKARARLVTRGDDYELVELTNQNSFYSV 83
           ++++ S    + YV+M F +    SF S   D+ AR     R DDY  V++ NQ  +YSV
Sbjct: 15  AVLASSQASPNKYVQMGFHKSR--SFSSG-GDSLAR-----RADDYLSVDVENQQLYYSV 66

Query: 84  ELDIGTPPQKVTVLVDTGSSDLWVTGSDNPYCFTEGEDTSGSSFKHVNKDNLVSVVESVF 143
           EL +GTPPQ V+VL+DTGSSDLW+T  DNPYC   G    GS+ K   ++   +    + 
Sbjct: 67  ELYVGTPPQNVSVLIDTGSSDLWLTSPDNPYCI--GFKQPGSA-KFALEEKEAANATVLT 123

Query: 144 TEISYDTTMVTSVATATIGNTASTSQAMNCTTYGTFDTSKSSTFESNKTEFSITYGDSTF 203
            + +   T  +  A AT G+        +C   GTF+ S+SS+F+SN T+F   Y D+TF
Sbjct: 124 AQNAEGPTRSSKAAKATGGHL----DQFDCALLGTFNNSESSSFKSNNTDFLTGYADNTF 179

Query: 204 ASGTWGHDRLSLNNLNVTGLSFAVANETNSTVGVLGIGLPGLESTYSGVSLSSAQKSYTY 263
           ASG WG D + + +++V+ +S AV N TNST  VLGIG+P LES+ +G   +    SY Y
Sbjct: 180 ASGFWGTDVVRIGDVDVSDVSLAVVNLTNSTSPVLGIGMPVLESSNAGRLAAETNSSYEY 239

Query: 264 NNFPMILKNSGAIKSTAYSLFTNHSDSKHGTILFGAVDHGKYAGDLYTIPIINTLQNRGY 323
           +NFP+ LKN G I+  AYSLF N SD+  G++LFGAVDH KY   L+T+P++NT +++G 
Sbjct: 240 DNFPVQLKNKGVIEKIAYSLFLNDSDATEGSVLFGAVDHSKYENGLFTVPMVNTYKDQGV 299

Query: 324 KDPIQFQVTLQGIGVSHGERDENMTTLTTTKIPVLLDSGTTISYMPADLVEMIASEVGAT 383
           + PI+F VT+ G+G    ++D  + T+TTT  PVLLDSG+T SY+P  LV M+AS + AT
Sbjct: 300 QHPIEFYVTMYGLGF---KKDGFLNTITTTNFPVLLDSGSTTSYLPDTLVSMLASALNAT 356

Query: 384 YSPDYGYYIMDCINEMEEESSLIFDFGGFYIANWLSNFQLLTDSRSNVCILGIAPQ--SD 441
           +S     Y + C +E E+ + L FD GGF I   LS+  L+     N C+L +  Q   +
Sbjct: 357 FSEKINGYTLKCPSE-EDATFLSFDLGGFLIDVPLSD--LVAKRHKNQCVLMVKGQGEGE 413

Query: 442 PAIILGDNFLVSTYVVYDLDNMEISMAHADFSDGGEYIDTIKDSVPSALKAPGYSSTWST 501
              ILGD FL S YVVYDL++ EIS+  A   D  E I+ IK +VP A++AP Y   W+ 
Sbjct: 414 GGYILGDTFLSSAYVVYDLESYEISIGQASTGDAAEDIEVIKSTVPGAVRAPFYDRPWTG 473

Query: 502 YESIVPGGNM 511
              I   GN+
Sbjct: 474 GTVISMSGNI 483

>ZYRO0F10252g Chr6 complement(828774..830429) [1656 bp, 551 aa] {ON}
           weakly similar to YYIL015W uniprot|P12630 Saccharomyces
           cerevisiae YIL015W BAR1 Aspartyl protease secreted into
           the periplasmic space of mating type a cells, cleaves
           and inactivates alpha factor allowing cells to recover
           from alpha-factor-induced cell cycle arrest and to
           YLR121C uniprot|Q12303 Saccharomyces cerevisiae YLR121C
           YPS3 Aspartic protease, attached to the plasma membrane
           via a glycosylphosphatidylinositol (GPI) anchor and to
           YLR120C uniprot|P32329 Saccharomyces cerevisiae YLR120C
           YPS1 Aspartic protease, attached to the plasma membrane
           via a glycosylphosphatidylinositol (GPI) anchor and to
           YDR144C uniprot|P53379 Saccharomyces cerevisiae YDR144C
           MKC7 GPI- anchored aspartyl protease (yapsin) involved
           in protein processing; shares functions with Yap3p and
           Kex2p and to YIR039C uniprot|P40583 Saccharomyces
           cerevisiae YIR039C YPS6 Putative GPI-anchored aspartic
           protease, member on vGLC.1466.
          Length = 551

 Score =  355 bits (912), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 199/464 (42%), Positives = 281/464 (60%), Gaps = 41/464 (8%)

Query: 38  KMNFQRKYGDSFESATNDTKARARLVTRGDDYELVELTNQNSFYSVELDIGTPPQKVTVL 97
           K++F +  G++FE A  ++   A            ++ NQ +FYSVEL +GTP Q V VL
Sbjct: 27  KLSFNKLRGETFEKAVGNSNGHANF----------DIKNQQNFYSVELKVGTPAQNVLVL 76

Query: 98  VDTGSSDLWVTGSDNPYCFTEGEDTS-GSSFKHVNKDNLVSVVESVFTEISYDTTMVTSV 156
           +DTGSSDLW+TGS NPYC     ++  GS+  + + +N                      
Sbjct: 77  LDTGSSDLWITGSGNPYCSPSTRNSHLGSAGSNSSTNN---------------------- 114

Query: 157 ATATIGNTASTSQAMNCTTYGTFDTSKSSTFESNKTEFSITYGDSTFASGTWGHDRLSLN 216
             ++  N  S+S  ++C+ YGTF+   S TF+SN + F +TYGD +FA G WG D + L+
Sbjct: 115 GPSSTANFPSSSATIDCSQYGTFNLDGSETFKSNDSTFYLTYGDGSFAKGLWGMDHVYLD 174

Query: 217 NLNVTGLSFAVANETNSTVGVLGIGLPGLESTYSGVSLSSAQKSYTYNNFPMILKNSGAI 276
            LNV+ +SFAVANE+NSTVGV G+GLPG E+T   V+       Y Y NFP +LK++G +
Sbjct: 175 GLNVSDVSFAVANESNSTVGVFGVGLPGEEAT---VTPGVNGNHYQYKNFPQVLKDNGVV 231

Query: 277 KSTAYSLFTNHSDSKHGTILFGAVDHGKYAGDLYTIPIINTLQNRGYKDPIQFQVTLQGI 336
           +  AYSL+ N  DS  G ILFGAVDH KY+G+LYT+PI+NT  ++G   P +F VT+QGI
Sbjct: 232 QKNAYSLYLNSPDSNSGNILFGAVDHSKYSGNLYTLPIVNTYADQGVA-PREFDVTVQGI 290

Query: 337 GVSHGERDENMTTLTTTKIPVLLDSGTTISYMPADLVEMIASEVGATYSPDYGYYIMDCI 396
            V       + +T+++ K   LLDSGTT+ Y+P  L + +A  +G  +SP  GYY++   
Sbjct: 291 TVG---NSSSNSTVSSDKTLALLDSGTTLMYLPTALADELAKSLGGKFSPSTGYYLIPKP 347

Query: 397 NEMEEESSLIFDFGGFYIANWLSNFQLLTDSRSNVCILGIAPQSDPAIILGDNFLVSTYV 456
           +E  +++ + FDFGGF+I   LSN+ L      +V ILGI        I GD FLV  YV
Sbjct: 348 SE-NDDTKITFDFGGFHIETKLSNYILQGSGPQDVAILGILRTEGDRAIFGDVFLVDAYV 406

Query: 457 VYDLDNMEISMAHADFSDGGEYIDTIKDSVPSALKAPGYSSTWS 500
           VYDL++ EIS+A A+F+ G   I+ I  SVP A +APGYS T++
Sbjct: 407 VYDLEDYEISLAQANFNSGSSDIEAISGSVPGASRAPGYSQTYT 450

>SAKL0C02970g Chr3 (285647..287425) [1779 bp, 592 aa] {ON} some
           similarities with uniprot|P12630 Saccharomyces
           cerevisiae YIL015W BAR1 Aspartyl protease secreted into
           the periplasmic space of mating type a cells, cleaves
           and inactivates alpha factor allowing cells to recover
           from alpha-factor-induced cell cycle arrest and to
           YLR121C uniprot|Q12303 Saccharomyces cerevisiae YLR121C
           YPS3 Aspartic protease, attached to the plasma membrane
           via a glycosylphosphatidylinositol (GPI) anchor and to
           YLR120C uniprot|P32329 Saccharomyces cerevisiae YLR120C
           YPS1 Aspartic protease, attached to the plasma membrane
           via a glycosylphosphatidylinositol (GPI) anchor and to
           YDR144C uniprot|P53379 Saccharomyces cerevisiae YDR144C
           MKC7 GPI- anchored aspartyl protease (yapsin) involved
           in protein processing; shares functions with Yap3p and
           Kex2p and to YIR039C uniprot|P40583 Saccharomyces
           cerevisiae YIR039C YPS6 Putative GPI-anchored aspartic
           protease, member on vGLC.1466.
          Length = 592

 Score =  356 bits (914), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 215/525 (40%), Positives = 310/525 (59%), Gaps = 54/525 (10%)

Query: 10  VNALLLHSSMVFADSIISQSSEINDGYVKMNFQRKYGDSFESATNDTKARARLVTRGDDY 69
           V A+LL  ++     I  ++S+    +V + F++  G +F  + +  K R RL  RGDDY
Sbjct: 6   VFAVLLLPALGVGSVIEPETSK----HVSIPFKKAKGKTFSGSADSNKWRNRLSKRGDDY 61

Query: 70  ELVELTNQNSFYSVELDIGTPPQKVTVLVDTGSSDLWVTGSDNPYCF----TEGEDTSGS 125
           E + L      Y VEL +GTP QK  V +DTGSSDLWV  S NPYC     T  E   G 
Sbjct: 62  ENLGLKTDKLAYYVELSLGTPGQKFEVQLDTGSSDLWVYDSHNPYCMPSETTHNEKVYG- 120

Query: 126 SFKHVNKDNLVSVVESVFTEISYDTTMV----TSVATATIGNTA--------STSQAMNC 173
                         E+ + E ++D T +    T +A+AT  + +        S+   ++C
Sbjct: 121 --------------EAAYGETAFDQTALDQFETLLASATEDDPSYTQTEAVPSSEATIDC 166

Query: 174 TTYGTFDTSKSSTFESNKTEFSITYGDSTFASGTWGHDRLSLNNLNVTGLSFAVANETNS 233
            ++GTF+ + SS+F +N TEF I+Y DST A G W  D L L +L ++ + FAVA   + 
Sbjct: 167 ASFGTFNYTLSSSFSANDTEFYISYLDSTAAYGIWAQDVLKLGDLEISDMPFAVAVVGDV 226

Query: 234 TVGVLGIGLPGLESTYSGVSLSSAQKSYTYNNFPMILKNSGAIKSTAYSLFTNHSDSKHG 293
              V G+G PG EST    + SS ++ Y Y NFP++LK+ G +K   YSLF +  DS  G
Sbjct: 227 QTPVFGVGFPGTEST----AGSSVKEPYEYANFPVLLKSQGYVKKVVYSLFLDAQDSSSG 282

Query: 294 TILFGAVDHGKYAGDLYTIPII------NTLQNRGYKDPIQFQVTLQGIGVSHGERDENM 347
           + L GAVDH KY+G LYT+P+       +TL +     P +F +TLQG+G+S  ++ EN 
Sbjct: 283 SFLLGAVDHSKYSGGLYTLPMYSGTDGDDTLSST----PSRFIITLQGLGIS--DKGENK 336

Query: 348 TTLTTTKIPVLLDSGTTISYMPADLVEMIASEVGATYSPDYGYYIMDCINEMEEESSLIF 407
           T  TT  + V LDSG+T +  P++  E+IA  +GA+YS DY  Y+M C ++ +++++ ++
Sbjct: 337 TVATTRSL-VYLDSGSTGTVFPSEYAELIADSLGASYSGDYEAYVMKCPSK-DDDTNFVY 394

Query: 408 DFGGFYIANWLSNFQLLTDSRSNVCILGIAPQSDPAIILGDNFLVSTYVVYDLDNMEISM 467
           DFGGF I++ LSN+   T   S VC+L I     P I+LGD FLVS YVVYDL++ EIS+
Sbjct: 395 DFGGFTISSPLSNYMEATGDDS-VCVLDIDTDDIPYIVLGDAFLVSAYVVYDLEDYEISI 453

Query: 468 AHADFSDGGEYIDTIKDSVPSALKAPGYSSTWSTYESIVPGGNMF 512
           A A++  G E I+ + DS+PSA+KAP YSSTWSTY +   GGN+F
Sbjct: 454 AQANYDGGSENIEVVSDSIPSAVKAPFYSSTWSTYVTATSGGNIF 498

>KLTH0F06754g Chr6 (590569..592872) [2304 bp, 767 aa] {ON} weakly
           similar to uniprot|P12630 Saccharomyces cerevisiae
           YIL015W BAR1 Aspartyl protease secreted into the
           periplasmic space of mating type a cells, cleaves and
           inactivates alpha factor allowing cells to recover from
           alpha-factor-induced cell cycle arrest and to YLR121C
           uniprot|Q12303 Saccharomyces cerevisiae YLR121C YPS3
           Aspartic protease, attached to the plasma membrane via a
           glycosylphosphatidylinositol (GPI) anchor and to YLR120C
           uniprot|P32329 Saccharomyces cerevisiae YLR120C YPS1
           Aspartic protease, attached to the plasma membrane via a
           glycosylphosphatidylinositol (GPI) anchor and to YDR144C
           uniprot|P53379 Saccharomyces cerevisiae YDR144C MKC7
           GPI- anchored aspartyl protease (yapsin) involved in
           protein processing; shares functions with Yap3p and
           Kex2p and to YIR039C uniprot|P40583 Saccharomyces
           cerevisiae YIR039C YPS6 Putative GPI-anchored aspartic
           protease, member on vGLC.1466.
          Length = 767

 Score =  360 bits (925), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 211/499 (42%), Positives = 304/499 (60%), Gaps = 32/499 (6%)

Query: 9   VVNALLLHSSMVFADSIISQSSEINDGYVKMNFQRKYGDSFESA---TNDTKARARLVTR 65
           V  A+L     +F   +I+ S     GYV ++F +  G S++ A       K + R +++
Sbjct: 11  VPCAMLALFLALFVPCVIASSGM---GYVAIDFAKAKGISYQDARVGARPAKLQKRALSQ 67

Query: 66  GDDYELVELTNQNSFYSVELDIGTPPQKVTVLVDTGSSDLWVTGSDNPYCFTEGEDTSGS 125
           G+     EL N N FYSV LDIGTPPQ+VTVL DTGSSDLWV+ +DNPYC + G+ T   
Sbjct: 68  GETLN-SELVNNNVFYSVGLDIGTPPQQVTVLFDTGSSDLWVSSNDNPYC-SNGDSTE-- 123

Query: 126 SFKHVNKDNLVSVVESVFTEISYDTTMVTSVATATIGNTASTSQAMNCTTYGTFDTSKSS 185
           S+ +   D L S            ++ +T+  T TI    + +  ++C  YGTF+  +S+
Sbjct: 124 SYANYRAD-LKS------------SSALTAAPTTTISGI-TIAPTIDCAQYGTFNADRST 169

Query: 186 TFESNKTE-FSITYGDSTFASGTWGHDRLSLNNLNVTGLSFAVANETNSTVGVLGIGLPG 244
           +  +N ++ F ++Y D ++A G W  D+L ++  +++ L FAVA  +NSTVGVLG+GL G
Sbjct: 170 SLFANYSKPFFVSYNDDSYALGYWARDKLVVDGDDISSLEFAVAEISNSTVGVLGVGLQG 229

Query: 245 LESTYSGVSLSSAQKSYTYNNFPMILKNSGAIKSTAYSLFTNHSDSKHGTILFGAVDHGK 304
           LEST   V   S   S  Y NFPM+LK +GAI   AYSL+ N  D+  G++LFG VDH K
Sbjct: 230 LEST---VHYRSPNISSIYPNFPMVLKENGAIDKIAYSLYLNSLDAPSGSVLFGGVDHSK 286

Query: 305 YAGDLYTIPIINTLQNRGYKDPIQFQVTLQGIGVSHGERDENMTTLTTTKIPVLLDSGTT 364
           Y G LYT+P++NT ++ G K P+QF VT+QGIG+   E+     T TTTKI  L+DSGTT
Sbjct: 287 YTGGLYTLPLVNTYKDYGVKTPVQFDVTVQGIGI-ESEKACRQETFTTTKIAALMDSGTT 345

Query: 365 ISYMPADLVEMIASEVGATYSPDYGYYIMDCINEMEEESSLIFDFGGFYIANWLSNFQLL 424
           + Y   ++V  IA  V A++SP YG ++  C ++  +++  IFDFGGF I + LSN+ L 
Sbjct: 346 LMYTAPEIVNKIALYVNASFSPGYGLFMFRCPSD-GDDTQFIFDFGGFQIKSPLSNYILR 404

Query: 425 TDSRSNVCILGIAPQSDPAIILGDNFLVSTYVVYDLDNMEISMAHADFSDGGEYIDTIKD 484
           TD   N+C LG+   S+   I GD FL S YVVYDL+N+E+S+A A+++ G   I+ I  
Sbjct: 405 TDDE-NICGLGLI-SSNQGTIFGDEFLASAYVVYDLENLELSLAQANWNPGSPEIEKIVS 462

Query: 485 SVPSALKAPGYSSTWSTYE 503
            +P A +A  Y +TW + E
Sbjct: 463 EIPRAQRASQYWNTWVSDE 481

>TBLA0H01290 Chr8 (290515..292518) [2004 bp, 667 aa] {ON} Anc_8.318
           YLR120C
          Length = 667

 Score =  357 bits (916), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 194/368 (52%), Positives = 262/368 (71%), Gaps = 18/368 (4%)

Query: 155 SVATATIGNTA-------STSQA-MNCTTYGTFDTSKSSTFESNKTEFSITYGDSTFASG 206
           S ATAT G  +         SQA +NC TYGTFD   SSTF+SNKT F+I Y D+++A+G
Sbjct: 237 STATATTGGNSGYQTMSLDPSQATINCDTYGTFDIEDSSTFQSNKTSFAIRYADTSYATG 296

Query: 207 TWGHDRLSLNN-LNVTGLSFAVANETNSTVGVLGIGLPGLESTYSGVSLSSAQKSYTYNN 265
            WG D L+ ++ LNVTGLSFAVAN+TNSTVGVLGIGLP LE TYSGV  S+  K Y Y+N
Sbjct: 297 EWGRDVLTFSDGLNVTGLSFAVANQTNSTVGVLGIGLPQLEVTYSGVYQST--KPYIYDN 354

Query: 266 FPMILKNSGAIKSTAYSLFTNHSDSKHGTILFGAVDHGKYAGD-LYTIPIINTLQNRGYK 324
           FP++LKNSGAI  + YSL+ N  ++K+G +LFGAVDH +Y GD LYT+P++N   + GY 
Sbjct: 355 FPLVLKNSGAIHKSVYSLYLNKQNAKNGNVLFGAVDHSQYEGDTLYTVPLVNGDSSSGYS 414

Query: 325 DPIQFQVTLQGIGVSHGERDENMTTLTTTKIPVLLDSGTTISYMPADLVEMIASEVGATY 384
            PI+F +TLQG+GV+         T+TTT+I  LLDSGTT++Y P D++ ++A  + A+Y
Sbjct: 415 TPIEFDITLQGLGVTDNTN---NYTVTTTQIVALLDSGTTLTYFPKDMLNLLAKTINASY 471

Query: 385 SPDYGYYIMDCINEMEEESSLIFDFGGFYIANWLSNFQLLTDSRSNVCILGIAPQSDPAI 444
           S   GYY+M+C  + ++ + ++FDFGGF+I   L+NF L   S S  C+LG+ P +  + 
Sbjct: 472 SDALGYYVMNCP-DSDDNTQIVFDFGGFHINANLTNFVL--SSASGKCVLGLLPYNGNSA 528

Query: 445 ILGDNFLVSTYVVYDLDNMEISMAHADFSDGGEYIDTIKDSVPSALKAPGYSSTWSTYES 504
           ILGD FL   YVVY+LD++EISMA A++ +  E I+ I  +VP+A+KAPGYS T+ST +S
Sbjct: 529 ILGDMFLTHAYVVYNLDDLEISMAQANYDNSNEDIEVITSTVPNAVKAPGYSYTYSTSKS 588

Query: 505 IVPGGNMF 512
           IV GGN+F
Sbjct: 589 IVSGGNIF 596

 Score = 97.1 bits (240), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 48/105 (45%), Positives = 65/105 (61%), Gaps = 21/105 (20%)

Query: 32  INDGYVKMNFQRKYGDS-------FESATNDTKARAR--------------LVTRGDDYE 70
           +N  ++K+ F++ Y DS       +++ T+D + + R              L+ R D YE
Sbjct: 37  VNSNFLKLGFEKFYADSINDIVIEYDNDTDDYRLQKRDSIIDLKESKPYVNLIKRNDGYE 96

Query: 71  LVELTNQNSFYSVELDIGTPPQKVTVLVDTGSSDLWVTGSDNPYC 115
            +++ NQ SFYSV L IGTP Q +TVLVDTGSSDLWVTGSDNPYC
Sbjct: 97  EIQIINQQSFYSVNLRIGTPAQSITVLVDTGSSDLWVTGSDNPYC 141

>Kwal_33.14239 s33 (582768..584723) [1956 bp, 651 aa] {ON} YDR144C
           (MKC7) - aspartyl protease related to Yap3p [contig 105]
           FULL
          Length = 651

 Score =  356 bits (914), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 204/480 (42%), Positives = 286/480 (59%), Gaps = 34/480 (7%)

Query: 24  SIISQSSEINDGYVKMNFQRKYGDSFESATNDTKARA--RLVTRGDDYELVELTNQNSFY 81
           S+++ S   N  YV  NF +  G SF  A   ++     R  +   D  L  L N+  FY
Sbjct: 16  SVVAASESSNGDYVSFNFGKSLGSSFHGARGGSRPGKLHRRDSGSSDSALSVLKNEEVFY 75

Query: 82  SVELDIGTPPQKVTVLVDTGSSDLWVTGSDNPYCFTEGEDTSGSSFKHVNKDNLVSVVES 141
           SV+L+IGTPPQ +TVL DTGSSDLWV+ + NP+C  +G          VN+         
Sbjct: 76  SVKLNIGTPPQDITVLFDTGSSDLWVSSNSNPFCEADG----------VNR--------- 116

Query: 142 VFTEISYDTTMVTSVATATIGNTASTSQAMNCTTYGTFDTSKSSTFESNKTE-FSITYGD 200
                   ++   SVA +T  +    +  ++C  +GTF+ +KSSTF     + F I YGD
Sbjct: 117 ---RADLKSSSTYSVAPSTTIDGFEVAPTVDCAEFGTFNPNKSSTFRPQGNDTFMIMYGD 173

Query: 201 STFASGTWGHDRLSLNNLNVTGLSFAVANETNSTVGVLGIGLPGLESTYSGVSLSSAQKS 260
            TFA+G W  D LSL+  +++ L FAVAN ++S VGVLG+GL GLES+        +Q  
Sbjct: 174 GTFANGLWAKDTLSLDGHDISNLQFAVANMSDSDVGVLGVGLTGLESSADPFDDEPSQ-- 231

Query: 261 YTYNNFPMILKNSGAIKSTAYSLFTNHSDSKHGTILFGAVDHGKYAGDLYTIPIINTLQN 320
             Y NFP++LK +  I   AYSL+ N  D++ G++LFGAVDH KY G LYTIP++N L  
Sbjct: 232 --YPNFPVVLKQNNVISKMAYSLYINSLDAEAGSVLFGAVDHSKYTGGLYTIPLVNALAQ 289

Query: 321 RGYKDPIQFQVTLQGIGVSHGERDENMTTLTTTKIPVLLDSGTTISYMPADLVEMIASEV 380
               + ++F VT+QG+G+   +++    TLTT + P L+DSGTT+ Y+  DL + IA  +
Sbjct: 290 YFVDEILEFDVTVQGLGI-ESKKNCFQKTLTTAQFPALMDSGTTLIYIDPDLADAIADSL 348

Query: 381 GATYSPDYGYYIMDCINEMEEESSLIFDFGGFYIANWLSNFQLLTDSRSNVCILGIAPQS 440
           GAT S DY  Y  +C  + ++++ L+FDFGGF I N LSN+ L TD    VC LG+ P  
Sbjct: 349 GATMSDDYELYTFECPAK-DDDTQLVFDFGGFQITNPLSNYVLETDDE-KVCGLGVVPSY 406

Query: 441 DPAIILGDNFLVSTYVVYDLDNMEISMAHADFSDGGEYIDTIKDSVPSALKAPGYSSTWS 500
             + ILGD FL S YVV+DL+N+E+S+  A+ + G E I+ I  +VP A KAPGYSSTW+
Sbjct: 407 --SNILGDEFLASAYVVFDLENLELSIGQANLNPGPEDIEPIISTVPGAQKAPGYSSTWT 464

>KAFR0E03940 Chr5 (779476..781392) [1917 bp, 638 aa] {ON} 
          Length = 638

 Score =  349 bits (895), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 218/504 (43%), Positives = 305/504 (60%), Gaps = 56/504 (11%)

Query: 12  ALLLHSSMVFADSIISQSSEINDGYVKMNFQRKYGDSFESATNDTKARARLVTRGDDYEL 71
           +L+  SS+    S+ + ++E   G+V + F ++YG   +S ++ + A+  LV R    + 
Sbjct: 4   SLVSVSSVALFSSLKAAAAEA-PGFVGVQFSKRYG---KSISDSSLAKGNLVKRSSGTDE 59

Query: 72  VELTNQNSFYSVELDIGTPPQKVTVLVDTGSSDLWVTGSDNPYCFTEGEDTSGSSFKHVN 131
           VEL N++ FY+++++IGTP Q VTVLVDTGSSD WV  S NPYC ++             
Sbjct: 60  VELINESVFYAIDMEIGTPKQSVTVLVDTGSSDFWVPSSTNPYCESKS------------ 107

Query: 132 KDNLVSVVESVFTEISYDTTMVTSVATATIGNTASTSQAMNCTTYGTFDTSKSSTFESNK 191
                                    AT+TI    ++S  ++CTTYGTF  S SS+F  N 
Sbjct: 108 -------------------------ATSTI----ASSDLIDCTTYGTFSVSDSSSFVYNN 138

Query: 192 TEFSITYGDSTFASGTWGHDRLSLNNLNVTGLSFAVANETNSTVGVLGIGLPGLESTYSG 251
           T+F   Y D + A+G WGHD +      ++ +S AVA++T+S+ GVLGIGL GLESTYSG
Sbjct: 139 TDFQTQYADGSSATGFWGHDVVDFGGQELSDISIAVADQTDSSFGVLGIGLTGLESTYSG 198

Query: 252 VSLSSAQKS-YTYNNFPMILKNSGAIKSTAYSLFTNHSDSKHGTILFGAVDHGKYAGDLY 310
            + +S+    Y Y+NFP+ L     I++ AYSL+ + +    GTILFG VDH KY+GDL 
Sbjct: 199 SAAASSSTGRYQYDNFPIRLVQENVIQANAYSLYLDPATGSSGTILFGGVDHNKYSGDLN 258

Query: 311 TIPIINTLQNRGYKDPIQFQVTLQGIGVSHGERDENMTTLTTTKIPVLLDSGTTISYMPA 370
           TIP+INTL+  GY  PI+ QVTL G+GVS G      +T+TTT+IP LLDSGTT++Y+P 
Sbjct: 259 TIPLINTLEANGYTSPIKLQVTLNGLGVSDGSS---TSTVTTTQIPALLDSGTTLTYLPT 315

Query: 371 DLVEMIASEVGATYSPDYGYYIMDCINEMEEESSLIFDFGGFYIANWLSN--FQLLTDSR 428
            + +++A ++GATYS     Y++ C N ++E+S +++DFGGF I   L+   +QL  D  
Sbjct: 316 AMFDLLAEQIGATYSSTSNGYVLSCAN-VDEDSMIVYDFGGFQIQTPLAGSLYQLSDDQ- 373

Query: 429 SNVCILGIAPQSDPAIILGDNFLVSTYVVYDLDNMEISMAHADFSDGGEYIDTIKDSVPS 488
              C L I   S     LGD FL   YVVYDLDN EISMA  +++   E I+ I DSVP 
Sbjct: 374 ---CELAIGSTSSSYATLGDLFLTHAYVVYDLDNKEISMAQINYNATTEDIEIISDSVPG 430

Query: 489 ALKAPGYSSTWSTYESIVPGGNMF 512
           A KA GY +TW+T ESI  GGN+F
Sbjct: 431 ATKAAGYYNTWTTSESITAGGNIF 454

>CAGL0E01419g Chr5 (132904..134679) [1776 bp, 591 aa] {ON} similar
           to uniprot|P32329 Saccharomyces cerevisiae YLR120c YAP3
           or uniprot|P53379 Saccharomyces cerevisiae YDR144c MKC7
           or uniprot|Q12303 Saccharomyces cerevisiae YLR121c YPS3
          Length = 591

 Score =  333 bits (853), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 190/509 (37%), Positives = 285/509 (55%), Gaps = 37/509 (7%)

Query: 34  DGYVKMNFQRKYGDSFESATNDTKARARLVTRG-DDYELVELTNQNSFYSVELDIGTPPQ 92
           + Y+K++F++   D  E       A  +L  R  DD     L  Q ++YS+ L++GTPPQ
Sbjct: 19  EKYLKLDFEKHRADIDEELPLTHSAARQLRKRASDDSVAFPLVAQENYYSINLEVGTPPQ 78

Query: 93  KVTVLVDTGSSDLWVTGSDNPYCFTEGEDTSGSSFKHVNKDNLVSVVESVFTEISYDTTM 152
            V++L+DTGSSD+WV GS+N YC  +  D    +   +  +       SV +      T 
Sbjct: 79  NVSLLLDTGSSDMWVIGSNNGYC--KNSDNKSRNLDALGSNRFAKRASSVASASPSSATD 136

Query: 153 VTSVATATIGNTA------------STSQAMNCTTYGTFDTSKSSTFESNKTEFSITYGD 200
                       A            + ++ ++C +   FD  KSS+F+SN T F  +YGD
Sbjct: 137 SDGGDDGDDSGDAEQFYPTAASEIPAAAKTLDCQSLSLFDLEKSSSFKSNSTPFFTSYGD 196

Query: 201 STFASGTWGHDRLSLNNLNVTGLSFAVANETNSTVGVLGIGLPGLE------------ST 248
           +++ASG WG D + L NL++  + FAVAN +NS+ GVLG+GLP LE            S 
Sbjct: 197 NSYASGLWGTDDVRLGNLSIADVFFAVANFSNSSTGVLGVGLPALESYNPALSDNFNVSD 256

Query: 249 YSGVSLSSAQ----KSYTYNNFPMILKNSGAIKSTAYSLFTNHSDSKHGTILFGAVDHGK 304
           Y  V+ S A        TY NFP ILK    I+  AYSLF N +++ +G ILFGAVDH K
Sbjct: 257 YLPVNASDADIDNISKPTYANFPQILKQKNVIEKVAYSLFLNDTNATNGQILFGAVDHSK 316

Query: 305 YAGDLYTIPIINTLQNRGYKDPIQFQVTLQGIGVSHGERDENMTTLTTTKIPVLLDSGTT 364
           Y G L T+P++N+L   G  D  Q ++TL G+G+ +    +   T+   K+P LLDSGTT
Sbjct: 317 YTGSLSTLPLVNSLYVEGINDTTQLEITLDGMGLKNS---QGQFTIYNQKMPALLDSGTT 373

Query: 365 ISYMPADLVEMIASEVGATYSPDYGYYIMDCINEMEEESSLIFDFGGFYIANWLSNFQLL 424
           +SY+P DL  ++A ++     P  G+  +       + + L+F+FGG +I+   + F  +
Sbjct: 374 VSYLPIDLHSLVAKQLKGIVDPQTGFIELKNCPAKNDNTQLVFNFGGAFISIKYTEF--I 431

Query: 425 TDSRSNVCILGIAPQSDPAIILGDNFLVSTYVVYDLDNMEISMAHADFSDGGEYIDTIKD 484
             S  + C +   PQ +P I+LGDNFL + Y+VYDL++MEIS+A A+F+ G E I+ I  
Sbjct: 432 EKSDDDNCYVTFMPQGEPGILLGDNFLRNAYIVYDLEDMEISIAQANFNGGAENIEAIVK 491

Query: 485 SVPSALKAPGYSSTWSTY-ESIVPGGNMF 512
           +VPSA+KAPGYS++++ +  S    GN+F
Sbjct: 492 NVPSAVKAPGYSASFTEFPSSYATTGNIF 520

>KAFR0I01700 Chr9 complement(346265..347923) [1659 bp, 552 aa] {ON} 
          Length = 552

 Score =  318 bits (814), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 197/509 (38%), Positives = 290/509 (56%), Gaps = 49/509 (9%)

Query: 17  SSMVFADSIISQSSEINDGYVKMNFQRKYGDSFESATNDTKARARLVTRGDDYELVELTN 76
           +S +  D  + Q S   + Y+K++F         S T +  +R  L  R D Y  V ++ 
Sbjct: 19  TSALIVDKNVEQLSSNENKYLKLDFA--------SETFEKSSRLPLQKR-DTYATVNISA 69

Query: 77  QNSFYSVELDIGTPPQKVTVLVDTGSSDLWVTGSDNPYCFTEGEDTSGSSFKHVNKDNLV 136
           +  +Y V+L +GTP Q VT+LVDT SSD+WVT  DNP C  +G+         +  DN+ 
Sbjct: 70  E-FYYVVQLSVGTPGQNVTLLVDTCSSDIWVTSPDNPLC--DGD---------IFYDNVE 117

Query: 137 SVVESVFTEISYDTTMVTSVATATI-GNTASTSQ-----------AMNCTTYGTFDTSKS 184
              + V    + ++T+    +   + G   ST+             ++C  +GTF+ + S
Sbjct: 118 KTAKHVVVAAAEESTVSDGDSNGLLDGEPVSTTPFESSVIYPAEGLVDCGFFGTFNPNDS 177

Query: 185 STFESNKTEFSITYGDSTFASGTWGHDRLSLNNLNVTGLSFAVANETNSTVGVLGIGLPG 244
           ST+ +N T+F ITY D++ A G WG D LS+  L+++G+ FAVAN TNS++GVLGIGLPG
Sbjct: 178 STWSTNHTDFVITYSDNSTAEGVWGQDVLSIGGLDISGVPFAVANYTNSSLGVLGIGLPG 237

Query: 245 LESTYSGVSLSSAQKSYTYNNFPMILKNSGAIKSTAYSLFTNHSDSKHGTILFGAVDHGK 304
            E+TY          SY Y+N PM+LK SG I S AYSL     ++    +LFGAVDH K
Sbjct: 238 SETTY-------LTNSYMYDNLPMVLKKSGVIDSAAYSLLLAAYNNYTSGLLFGAVDHSK 290

Query: 305 YAGDLYTIPIINTLQNRGYKDPIQFQVTLQGIGVSHGERDENMTTLTTTKIPVLLDSGTT 364
           Y+G LYTIP+IN  ++RGY+ P++F VT+ G+G+S  + +   TT+ T K P LLDSG+T
Sbjct: 291 YSGSLYTIPMINIYESRGYESPVEFDVTIYGLGISSTDSN---TTIATMKTPALLDSGST 347

Query: 365 ISYMPADLVEMIASEVGATYSPDYGYYIMDCINEMEEESSLIFDFGGFYIANWLSNFQLL 424
             + P  L+ + A ++ ATYS + G Y    I       S +FDFGGF+I   L   +L 
Sbjct: 348 AIFFPTTLLNLAAEQLNATYSEEKGLY---TIPYSPANISFVFDFGGFHIN--LPIRELC 402

Query: 425 TDSRSNV-CILGIAPQSDPAIILGDNFLVSTYVVYDLDNMEISMAHADFSDGGEYIDTIK 483
           + S      IL I   ++  I+LG+ FL   YVV+D +N EISM  + +    E I+ I 
Sbjct: 403 SVSYGEPEYILNIVAHNENRIVLGEAFLARAYVVFDFENYEISMGQSSYDYAEEDIEAII 462

Query: 484 DSVPSALKAPGYSSTWSTYESIVPGGNMF 512
            +VP A+K   YS++WS++ SI  GG++F
Sbjct: 463 STVPGAVKVASYSNSWSSFGSITSGGDIF 491

>ZYRO0E02266g Chr5 complement(169081..170601) [1521 bp, 506 aa] {ON}
           weakly similar to uniprot|P12630 Saccharomyces
           cerevisiae YIL015W BAR1 Aspartyl protease secreted into
           the periplasmic space of mating type a cells, cleaves
           and inactivates alpha factor allowing cells to recover
           from alpha-factor-induced cell cycle arrest and to
           YLR121C uniprot|Q12303 Saccharomyces cerevisiae YLR121C
           YPS3 Aspartic protease, attached to the plasma membrane
           via a glycosylphosphatidylinositol (GPI) anchor and to
           YLR120C uniprot|P32329 Saccharomyces cerevisiae YLR120C
           YPS1 Aspartic protease, attached to the plasma membrane
           via a glycosylphosphatidylinositol (GPI) anchor and to
           YDR144C uniprot|P53379 Saccharomyces cerevisiae YDR144C
           MKC7 GPI- anchored aspartyl protease (yapsin) involved
           in protein processing; shares functions with Yap3p and
           Kex2p and to YIR039C uniprot|P40583 Saccharomyces
           cerevisiae YIR039C YPS6 Putative GPI-anchored aspartic
           protease, member on vGLC.1466.
          Length = 506

 Score =  316 bits (809), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 197/506 (38%), Positives = 296/506 (58%), Gaps = 53/506 (10%)

Query: 34  DGYVKMNFQRKYGDSFESATNDTKARARLVTRGDDYELVELTNQNSFYSVELDIGTPPQK 93
           DG  K+ F ++YG SF+ +   + +     T GDD E ++++NQN +YS  + +GTP Q+
Sbjct: 27  DGVGKIPFSKRYGKSFDESRQISFSEKG--TGGDDQE-IDISNQNVYYSASIYLGTPGQE 83

Query: 94  VTVLVDTGSSDLWVTGSDNPYCFTEGEDTSGSSFKHVNKDNLVSVVESVFTEISYDTTMV 153
           +T+L+DTGSSDLW+      +C ++ +D +        K     +   +F+  S +    
Sbjct: 84  LTLLLDTGSSDLWIPQKGGYHCQSDSDDAT--------KGKSSGIASQLFSIASAEGGPS 135

Query: 154 TSVATATIGN----------------------TASTSQAMNCTTYGTFDTSKSSTFESNK 191
            S+ T  IG+                      TAS  +    ++ G FD + SS+F  N 
Sbjct: 136 PSLTTTLIGSSGGSHPDPLEPTNRNVQPPAAITASALEESCQSSSGNFDPNSSSSFNKND 195

Query: 192 T--EFSITYGDSTFASGTWGHDRLSLNNLNVTGLSFAVANETNSTVGVLGIGLPGLESTY 249
           T   F I YGD+++ASG W  D L++ +++V  ++ AVA++TNS+V V GI   GLES+ 
Sbjct: 196 TVDGFFIEYGDNSYASGYWATDDLTVGDISVKDMTIAVADDTNSSVAVFGISYRGLESSV 255

Query: 250 SGVSLSSAQKSYTYNNFPMILKNSGAIKSTAYSLFTNHSDSKHGTILFGAVDHGKYAGDL 309
            G +L   Q  + Y NFP +LK+ G +K  AYSL+ N + +  G ILFG VDH KY+GDL
Sbjct: 256 FGDNL---QDPHEYENFPYLLKDQGIVKRNAYSLYLNSAGASDGNILFGGVDHNKYSGDL 312

Query: 310 YTIPIINTLQNRGYKDPIQ-FQVTLQGIGVSHGERDENMTTLTTTKIPVLLDSGTTISYM 368
           YT+P++   ++    DP + F VT+QGIG+   +  E   TLTTT    LLDSGTT  Y+
Sbjct: 313 YTLPVLKGQED---SDPWERFVVTVQGIGI---KGSETQNTLTTTPFIGLLDSGTTAVYL 366

Query: 369 PADLVEMIASEVGATY--SPDYGYYIMDCINEMEEESSLIFDFGGFYIANWLSNFQLLTD 426
           P  + +M+A+  G ++   P+   Y++ C ++ E+   ++F+FGGF I   LSN+  +TD
Sbjct: 367 PEPVADMVANAYGGSFDDDPEVQSYVISCPSDDEK---IVFNFGGFNIETSLSNY--ITD 421

Query: 427 SRSNVCILGIAPQSDPAIILGDNFLVSTYVVYDLDNMEISMAHADFSDGGEYIDTIKDSV 486
           + +  CIL I+P SD   ILGD+FL  +YVVYD+DN EIS+A A+F D  E ++ I   V
Sbjct: 422 NGNGQCILNISPTSDYMGILGDSFLRDSYVVYDMDNNEISLAQANF-DSTEDVEAITGPV 480

Query: 487 PSALKAPGYSSTWSTYESIVPGGNMF 512
           P A KAPGYSST+S  ++   GGN+F
Sbjct: 481 PGATKAPGYSSTYSGPQTFQTGGNIF 506

>KNAG0I01200 Chr9 (226271..228304) [2034 bp, 677 aa] {ON} 
          Length = 677

 Score =  318 bits (814), Expect = 3e-99,   Method: Compositional matrix adjust.
 Identities = 186/455 (40%), Positives = 257/455 (56%), Gaps = 67/455 (14%)

Query: 63  VTRGDDYELVELTNQNSFYSVELDIGTPPQKVTVLVDTGSSDLWVTGSDNPYCFTEGEDT 122
           + R +D + V L  Q  FYS++L IGTP QKVTVL+DTGSSDLWVTG++NPYC       
Sbjct: 33  LVRREDGDSVHLGKQTGFYSIDLAIGTPSQKVTVLLDTGSSDLWVTGANNPYC------- 85

Query: 123 SGSSFKHVNKDNLVSVVESVFTEISYDTTMVTSVATATIGNTASTSQAMNCTTYGTFDTS 182
                                                       TS +  C  YGTFD  
Sbjct: 86  -------------------------------------------QTSLSSECKEYGTFDYG 102

Query: 183 KSSTFESNKTEFSITYGDSTFASGTWGHDRLSLNN--LNVTGLSFAVANETNSTVGVLGI 240
           +SSTF+   +   I Y D T   G WG D L LNN  + +      VA+ ++S  GV+G+
Sbjct: 103 QSSTFQDRNSALKINYQDGTKVDGRWGVDTLELNNGAIQLQNTMIGVADSSDSVAGVIGL 162

Query: 241 GLPGLESTYSGVSLSSAQKSYTYNNFPMILKNSGAIKSTAYSLFTNHSDSKHGTILFGAV 300
           G PGLE+T    ++ +  +SYTY NFPM LK  G   +T +++  +  +S  G ILFGAV
Sbjct: 163 GFPGLETTN---NVQANGESYTYANFPMQLKQQGVTDATVFAIALD--NSYGGDILFGAV 217

Query: 301 DHGKYAGDLYTIPIINTLQNRGYKDPIQFQVTLQGIGVSHGERDENMTTLTTTKIPVLLD 360
           D GKY G LYT+P++N+   RG   PI+ +VTLQGIGV     D+   T ++T +  L+D
Sbjct: 218 DEGKYIGGLYTLPVVNS---RGTATPIRMEVTLQGIGVDSDGGDQE--TFSSTPMLALVD 272

Query: 361 SGTTISYMPADLVEMIASEVGATYSPDYGYYIMDCINEMEEESSLIFDFGGFYIANWLSN 420
           SG+T+ Y+P  +   I ++VGA Y      Y +DC   +E + +LIFDFGGF+I+  +SN
Sbjct: 273 SGSTMVYLPELIATAIYNKVGARYDGSSEMYTIDCGTNVEND-NLIFDFGGFHISTPVSN 331

Query: 421 FQLLTDSRSN--VCILGIAPQSDPAIILGDNFLVSTYVVYDLDNMEISMAHADFSDG-GE 477
           + ++TD RS+   C+ GI  QS   ++LGD FL S YVV+DLD+ EISMA  + ++G G 
Sbjct: 332 Y-IITDQRSSNGQCLFGILSQSGNTVVLGDTFLSSAYVVFDLDHYEISMAQGNSNNGDGN 390

Query: 478 YIDTIKDSVPSALKAPGYSSTWSTYESIVPGGNMF 512
             D    ++P+A KAP YS TWST   +  GGN+F
Sbjct: 391 VKDVTSGTIPNARKAPMYSQTWSTNAPVTSGGNIF 425

>KNAG0I00900 Chr9 (169003..170598) [1596 bp, 531 aa] {ON} 
          Length = 531

 Score =  311 bits (798), Expect = 1e-98,   Method: Compositional matrix adjust.
 Identities = 186/496 (37%), Positives = 264/496 (53%), Gaps = 24/496 (4%)

Query: 18  SMVFADSIISQSSEINDGYVKMNFQRKYGDSFESATNDTKARARLVTRGDDYELVELTNQ 77
           S+    + I+   ++   YV+M F +    S  SAT D         R  DY LV+L N+
Sbjct: 16  SLCLGTAAIASVVKLPKKYVQMGFDK----SCTSATGDMV----FAKRDGDYVLVDLINE 67

Query: 78  NSFYSVELDIGTPPQKVTVLVDTGSSDLWVTGSDNPYCFTEGEDTSGSSFKHVNKDNLVS 137
              Y+V+L +GTPPQ +TV ++ GS+D W+T  DNPYC  +         KH   +  V 
Sbjct: 68  KILYTVQLAVGTPPQNITVSINIGSADPWMTSPDNPYCEIK---------KHSGYEKQVG 118

Query: 138 VVESVFTEISYDTTMVTSVATATIGNTASTSQAM-NCTTYGTFDTSKSSTFESNKTEFSI 196
              SV    S     VT   T T G ++S  Q + +CT YGTF+ S SS+F++N T F++
Sbjct: 119 ANTSVSLLSSLSNDRVTMSGTVTTGTSSSMVQPIIDCTNYGTFNHSSSSSFKNNGTNFTM 178

Query: 197 TYGDSTFASGTWGHDRLSLNNLNVTGLSFAVANETNSTVGVLGIGLPGLESTYSGVSLSS 256
            Y D T AS  WG D + +  L +  +SF VAN  N+T GV GIG P LE+T    +   
Sbjct: 179 FYADKTGASRFWGTDVVRVELLEILDMSFGVANVFNATEGVFGIGFPSLETTNMFNARID 238

Query: 257 AQKSYTYNNFPMILKNSGAIKSTAYSLFTNHSDSKHGTILFGAVDHGKYAGDLYTIPIIN 316
              SY Y NFP  L N G++   AYSLF N S +  G++LFGAVDH KY  DL+T+P++N
Sbjct: 239 PYSSYEYANFPQALNNQGSVDKVAYSLFLNDSHAMKGSVLFGAVDHSKYRNDLFTVPLVN 298

Query: 317 TLQNRGYKDPIQFQVTLQGIGVSHGERDENMTTLTTTKIPVLLDSGTTISYMPADLVEMI 376
             +++G   P  F V     G  +  R +N       +  V+LDSG T+S +P  LV+ +
Sbjct: 299 DFRDKGMDHPHYFNVFNARRGCPNKRRPQNR---RHDEFIVVLDSGATVSSLPTKLVDQL 355

Query: 377 ASEVGATYSPDYGYYIMDCINEMEEESSLIFDFGGFYIANWLSNFQLLTDSRSNVCILGI 436
              + AT+  +   Y + C ++ ++ S   FD G F+I   LSNF  +     N CIL +
Sbjct: 356 VQSLNATFDEELNSYTLKCPSK-KDTSVASFDIGRFHIDGPLSNF--VRKYEKNKCILRL 412

Query: 437 APQSDPAIILGDNFLVSTYVVYDLDNMEISMAHADFSDGGEYIDTIKDSVPSALKAPGYS 496
            P  +   IL DNFL   YVV+DL++ EISM  A+     E I+ IK  VP  ++AP Y 
Sbjct: 413 DPADNQPYILCDNFLSRAYVVHDLESYEISMGQANTEYAPEQIEAIKSKVPGTVRAPSYD 472

Query: 497 STWSTYESIVPGGNMF 512
            TW     + P GN++
Sbjct: 473 KTWGNGTDVSPSGNIY 488

>CAGL0E01815g Chr5 complement(181154..182713) [1560 bp, 519 aa] {ON}
           similar to uniprot|P32329 Saccharomyces cerevisiae
           YLR120c YAP3 or uniprot|P53379 Saccharomyces cerevisiae
           YDR144c MKC7 or uniprot|Q12303 Saccharomyces cerevisiae
           YLR121c YPS3
          Length = 519

 Score =  306 bits (785), Expect = 7e-97,   Method: Compositional matrix adjust.
 Identities = 185/477 (38%), Positives = 274/477 (57%), Gaps = 50/477 (10%)

Query: 35  GYVKMNFQRKYGDSFESATNDTKARARLVTRGDDYELVELTNQNSFYSVELDIGTPPQKV 94
            Y+K++F++             KA + LV R D+Y  V L N    Y V+L +GTPPQ +
Sbjct: 15  AYLKLDFEKS-----------PKASSDLVKRDDEYVNVPLKNDGDLYLVQLAVGTPPQNI 63

Query: 95  TVLVDTGSSDLWVTGSDNPYCFTEGEDTSGSSFKHVNKDNLVSVVESVFTEISYDTTMVT 154
           TV +DTGSSDLW   +DNP+C          + K+  K   V  ++              
Sbjct: 64  TVQLDTGSSDLWFPSADNPFC--------KENKKYAPKGKDVQPLDD------------- 102

Query: 155 SVATATIGNTASTSQAMNCTTYGTFDTSKSSTFESNKTEFSITYGDSTFASGTWGHDRLS 214
           S   +       +S+ +NC  YG F++S+SSTF+ N +EF ++Y D +FA+G WG D +S
Sbjct: 103 SGYPSASNQVPKSSRTLNCKKYGVFNSSESSTFKRNDSEFLLSYADMSFATGNWGSDVVS 162

Query: 215 LNNLNVTGLSFAVANETNSTVGVLGIGLPGLESTYSGVSLSSAQK---SYTYNNFPMILK 271
            N LN++ ++FA+ +  NS+ GVLG+GLP +ESTY G    S +    S+ Y NFP+ LK
Sbjct: 163 FNELNISNVNFALGSFANSSNGVLGVGLPDVESTYDGPYAGSRKNISDSHQYANFPITLK 222

Query: 272 NSGAIKSTAYSLFTNHSDSKHGTILFGAVDHGKYAGDLYTIPIINTL-QNRGYKDPIQFQ 330
            +G I   AYSL+ N S SK G++LFGAVDH +Y G LYT+P+ N+L QN  + DP Q +
Sbjct: 223 QNGVIDKIAYSLYLNSSKSKFGSVLFGAVDHNRYNGPLYTLPLANSLFQN--FTDPFQLE 280

Query: 331 VTLQGIGVSHGERDENMTTLTTTKIPVLLDSGTTISYMPADLVEMIASEVGATYS-PDYG 389
           +T+ G+G+     D N+ TL   K   LLDSGTT++ +   + ++IA++V  T +  D  
Sbjct: 281 ITMNGLGLQG--NDANI-TLYDKKSAALLDSGTTLTVVSKHIGDLIAAQVNGTIAGKDQC 337

Query: 390 YYIMDCINEMEEESSLIFDFGGFYIANWLSNFQLLTDSRSNVCILGIAPQSD---PAIIL 446
             +  C ++ +E   LIF+F G  +A    +   + +     C L  A   D    AII 
Sbjct: 338 IRLPKCPSK-KENKKLIFNFSGAEVA---VDINQMMNKHKGKCYLQFAVHEDTSNDAIIF 393

Query: 447 GDNFLVSTYVVYDLDNMEISMAHADF-SDGGEYIDTIKDSVPSALKAPGYSSTWSTY 502
           GDNFL S Y+VY+L++ EIS+A A+F S   E I+ IK +VPSA++AP Y +T+S +
Sbjct: 394 GDNFLRSVYLVYNLEDKEISIAPANFNSSLPENIEPIKSTVPSAIRAPQYYNTYSEH 450

>SAKL0F07172g Chr6 complement(541680..543308) [1629 bp, 542 aa] {ON}
           some similarities with uniprot|P12630 Saccharomyces
           cerevisiae YIL015W BAR1 Aspartyl protease secreted into
           the periplasmic space of mating type a cells, cleaves
           and inactivates alpha factor allowing cells to recover
           from alpha-factor-induced cell cycle arrest and to
           YLR121C uniprot|Q12303 Saccharomyces cerevisiae YLR121C
           YPS3 Aspartic protease, attached to the plasma membrane
           via a glycosylphosphatidylinositol (GPI) anchor and to
           YLR120C uniprot|P32329 Saccharomyces cerevisiae YLR120C
           YPS1 Aspartic protease, attached to the plasma membrane
           via a glycosylphosphatidylinositol (GPI) anchor and to
           YDR144C uniprot|P53379 Saccharomyces cerevisiae YDR144C
           MKC7 GPI- anchored aspartyl protease (yapsin) involved
           in protein processing; shares functions with Yap3p and
           Kex2p and to YIR039C uniprot|P40583 Saccharomyces
           cerevisiae YIR039C YPS6 Putative GPI-anchored aspartic
           protease, member on vGLC.1466.
          Length = 542

 Score =  307 bits (786), Expect = 1e-96,   Method: Compositional matrix adjust.
 Identities = 186/445 (41%), Positives = 252/445 (56%), Gaps = 54/445 (12%)

Query: 62  LVTRGDDYELVELTNQNSFYSVELDIGTPPQKVTVLVDTGSSDLWVTGSDNPYCFTEGED 121
           L  R  +   + L N+  FY+ +L++GTPPQ +TVL+DTGSSDLWVTGSDNPYC +    
Sbjct: 41  LWKRNQNSLALNLKNEQIFYAADLNVGTPPQNLTVLLDTGSSDLWVTGSDNPYCLSNETT 100

Query: 122 TSGSSFKHVNKDNLVSVVESVFTEISYDTTMVTSVATATIGNTASTSQAMNCTTYGTFDT 181
           T  S  K++ K    SVV+                                C+ YGTF+ 
Sbjct: 101 TEPS--KNITK----SVVD--------------------------------CSRYGTFEK 122

Query: 182 SKSSTFESNKTEFSITYGDSTFASGTWGHDRLSLNNLNVTGLSFAVANETNSTVGVLGIG 241
             S TF  + + F I Y D+TFA+G W  D +S  +  +  + FAVANETNSTVGVLGIG
Sbjct: 123 DNSLTFSQSDSRFQINYADNTFANGYWAKDVVSFGDNFIADMQFAVANETNSTVGVLGIG 182

Query: 242 LPGLEST--YSGVSLSSAQKSYTYNNFPMILKNSGAIKSTAYSLFTNHSDSKHGTILFGA 299
              LES   Y G     A  +Y Y NFP+ LKN+G I  TAYSL+ N  DS  G+ILFG 
Sbjct: 183 FERLESVKGYEG-----APNTY-YQNFPLALKNNGVIDKTAYSLYLNSLDSSSGSILFGG 236

Query: 300 VDHGKYAGDLYTIPIINTLQNRGYKDPIQFQVTLQGIGVSHGERDENMTTLTTTKIPVLL 359
           +D  KY GDLYT P++N +       P +F VT+QGIGV     ++++  L +TK P LL
Sbjct: 237 IDSNKYTGDLYTFPLVN-IHPSVVNKPAKFHVTVQGIGVQSSGSEQSI--LMSTKYPALL 293

Query: 360 DSGTTISYMPADLVEMIASEVGATYSPDYGYYIMDCINEMEEESSLIFDFGGFYIANWLS 419
           DSGTT+   P +  + +A+ V ATY+   G Y M C  E  +++  +FDFG   I   L 
Sbjct: 294 DSGTTLLVAPQEFADSMANYVNATYNDLEGIYTMTCPPE-NDDTEFLFDFGDLKIKVPLK 352

Query: 420 NFQLLTDSRSNVCILGIAPQSDPAIILGDNFLVSTYVVYDLDNMEISMAHADFSDGGEYI 479
           NF +L    +  C  G+ P  D  +ILGD FL + YVVYDL++ E+S+A A+++     I
Sbjct: 353 NF-ILAPEDNEYCGFGVLPTVD-TMILGDMFLSAAYVVYDLESYEVSLAQANWNSDESEI 410

Query: 480 DTIKDSVPSALKAPGYSSTWSTYES 504
             I+ +VP A KA   ++TWS YE+
Sbjct: 411 QAIRHTVPGATKAT--AATWSPYET 433

>TPHA0C00840 Chr3 (173318..176320) [3003 bp, 1000 aa] {ON} Anc_8.318
           YLR120C
          Length = 1000

 Score =  308 bits (789), Expect = 7e-93,   Method: Compositional matrix adjust.
 Identities = 186/480 (38%), Positives = 258/480 (53%), Gaps = 69/480 (14%)

Query: 41  FQRKYGDSFESAT-NDTKARARLVTRGDDYELVELTNQNSFYSVELDIGTPPQKVTVLVD 99
           F++ Y DS E    N + +  +LV R  D E + LTN+N+FYS E+++GTP Q + V+VD
Sbjct: 34  FRKYYADSLEELDYNTSTSETKLVKR--DGEDIVLTNRNTFYSAEIEVGTPAQTMNVIVD 91

Query: 100 TGSSDLWVTGSDNPYCFTEGEDTSGSSFKHVNKDNLVSVVESVFTEISYDTTMVTSVATA 159
           TGSSDLWV G DN  C                                            
Sbjct: 92  TGSSDLWVIGHDNLTC-------------------------------------------- 107

Query: 160 TIGNTASTSQAMNCTTYGTFDTSKSSTFESNKTEFSITYGDSTFASGTWGHDRLSLNNLN 219
                 ++  + NC  +G+F  SKSSTF  N TEF+ITY       G WG D L +  +N
Sbjct: 108 ----PLASDGSFNCERFGSFSISKSSTFTKNSTEFAITYVSGNNCIGVWGQDNLIIGGVN 163

Query: 220 VTGLSFAVANETNSTVGVLGIGLPGLESTYSGVSLSSAQKSYTYNNFPMILKNSGAIKST 279
            TGLSF V + T S+ G+LGIGLP  E+T  G         Y Y+NFPM+LKN G I   
Sbjct: 164 ATGLSFGVVHTTTSSAGILGIGLPDTETTAVG-----QYGHYKYDNFPMVLKNKGIISHQ 218

Query: 280 AYSLFTNHSDSKHGTILFGAVDHGKYAGDLYTIPIINTLQNRGYKDPIQFQVTLQGIGVS 339
            YS++ + S S +G  L G VD  KY G LY +P++N   N  +  P  F VTLQG+G+ 
Sbjct: 219 GYSIYLDSSSSTYGEFLLGGVDTSKYTGTLYKLPLVN-WYNTYFSSPGDFHVTLQGLGLI 277

Query: 340 HGERDENMTTLTTTKIPVLLDSGTTISYMPADLVEMIASEVGATYSPDYGYYIMDCINEM 399
                 +  TLT TK+ V+LD+G+T++ +PA L   + S +G  YS  +G Y+  C  E 
Sbjct: 278 --TNSGSAVTLTETKMAVILDTGSTVTGIPATLYNALLSSLGGYYSSTHGAYVFTCPTET 335

Query: 400 EEESSLIFDFGGFYIANWLSNFQLLTDSRSNVCILGIAPQSDPAIILGDNFLVSTYVVYD 459
              S L+F+FGG      +S+F  +     NVC L ++ +SD   ILGD+FL + Y  +D
Sbjct: 336 ---SKLVFNFGGINYKLPMSSF--INTLGDNVCSLKVSSRSDSNFILGDDFLRNVYAAFD 390

Query: 460 LDNMEISMAHADF--SDGGEYIDTI---KDSVPSALKAPGYSSTWSTYESIVPGGNMFPT 514
           L+N EI +A ADF  S   +  DT+   +  +P A++AP YS+TW TYE++V GG+MF T
Sbjct: 391 LENKEIGLAMADFDSSSNNKREDTVIAMESGIPDAVQAPEYSATWVTYEAVVTGGSMFET 450

>CAGL0E01749g Chr5 complement(172875..174323) [1449 bp, 482 aa] {ON}
           similar to uniprot|P53379 Saccharomyces cerevisiae
           YDR144c MKC7 or uniprot|P32329 Saccharomyces cerevisiae
           YLR120c YAP3 or uniprot|Q12303 Saccharomyces cerevisiae
           YLR121c YPS3
          Length = 482

 Score =  294 bits (752), Expect = 3e-92,   Method: Compositional matrix adjust.
 Identities = 173/446 (38%), Positives = 257/446 (57%), Gaps = 31/446 (6%)

Query: 62  LVTRGDDYELVELTNQNSFYSVELDIGTPPQKVTVLVDTGSSDLWVTGSDNPYCFTEGED 121
           L  R D    +EL N    Y+V+L +GTPPQ +TV +DTGSSDLW T   NPYC      
Sbjct: 31  LNKRDDKGLQLELENGGLLYAVQLSVGTPPQNITVQLDTGSSDLWFTSEANPYC------ 84

Query: 122 TSGSSFKHVNKDNLVSVVESVFTEISYDTTMVTSVATATIGNTASTSQAMNCTTYGTFDT 181
              ++ KH  K + +  +     +  Y T+               + + ++C  +G F+T
Sbjct: 85  --KNNRKHSPKKSQIEPLN----DADYPTSP---------NQIPKSLRDIDCKAFGFFNT 129

Query: 182 SKSSTFESNKTEFSITYGDSTFASGTWGHDRLSLNNLNVTGLSFAVANETNSTVGVLGIG 241
           SKSST+++N T F+++Y D+TFASG WG D LS N + V  ++F +A  +NST  V GI 
Sbjct: 130 SKSSTYKNNGTNFTLSYADTTFASGPWGVDTLSFNGVKVDNVTFGLAAFSNSTTPVFGIS 189

Query: 242 LPGLESTYSGVSLSS--AQKSYTYNNFPMILKNSGAIKSTAYSLFTNHSDSKHGTILFGA 299
           LP  E+T    +  S     SY Y+NFPM+LK  G +K  AYS++ N + SK+G+ILFGA
Sbjct: 190 LPARETTNQLAANGSRIGPNSYEYSNFPMLLKEQGIVKKIAYSVYLNDTRSKYGSILFGA 249

Query: 300 VDHGKYAGDLYTIPIINTLQNRGYKDPIQFQVTLQGIGVSHGERDENMTTLTTTKIPVLL 359
           VD  KY G LYT+P++N+L  +  K P QF++TL GIG+   +++    TL   K+  LL
Sbjct: 250 VDQSKYIGTLYTLPLVNSLYKQVSK-PFQFEITLNGIGLQTADKN---YTLYDQKLATLL 305

Query: 360 DSGTTISYMPADLVEMIASEVGATYSPDYGYYIMDCINEMEEESSLIFDFGGFYIANWLS 419
           D+G T S +PA +  ++AS+V  T   D G+  +D     +E+ +++F+FGG  I+    
Sbjct: 306 DTGVTTSVLPAKVAALVASKVNGTIDDDNGFIKLDKCPNKKEKRTVVFNFGGAEIS---I 362

Query: 420 NFQLLTDSRSNVCILGIAPQSDPAI-ILGDNFLVSTYVVYDLDNMEISMAHADFSDGGEY 478
           + + LT      C L +  + D     LGD FL   YVVY+L++ EIS+A+A+F+     
Sbjct: 363 DIRDLTRKIKGKCYLQMQARDDIEFAALGDIFLRHVYVVYNLEDEEISIANANFNYSTPD 422

Query: 479 IDTIKDSVPSALKAPGYSSTWSTYES 504
           I  I  +VP A+KAP Y +T+S Y +
Sbjct: 423 IQEIVSTVPGAVKAPQYYNTYSVYPT 448

>ZYRO0F10296g Chr6 complement(833615..835201) [1587 bp, 528 aa] {ON}
           weakly similar to uniprot|P12630 Saccharomyces
           cerevisiae YIL015W BAR1 Aspartyl protease secreted into
           the periplasmic space of mating type a cells, cleaves
           and inactivates alpha factor allowing cells to recover
           from alpha-factor-induced cell cycle arrest and to
           YLR121C uniprot|Q12303 Saccharomyces cerevisiae YLR121C
           YPS3 Aspartic protease, attached to the plasma membrane
           via a glycosylphosphatidylinositol (GPI) anchor and to
           YLR120C uniprot|P32329 Saccharomyces cerevisiae YLR120C
           YPS1 Aspartic protease, attached to the plasma membrane
           via a glycosylphosphatidylinositol (GPI) anchor and to
           YDR144C uniprot|P53379 Saccharomyces cerevisiae YDR144C
           MKC7 GPI- anchored aspartyl protease (yapsin) involved
           in protein processing; shares functions with Yap3p and
           Kex2p and to YIR039C uniprot|P40583 Saccharomyces
           cerevisiae YIR039C YPS6 Putative GPI-anchored aspartic
           protease, member on vGLC.1466.
          Length = 528

 Score =  294 bits (752), Expect = 7e-92,   Method: Compositional matrix adjust.
 Identities = 191/501 (38%), Positives = 261/501 (52%), Gaps = 44/501 (8%)

Query: 37  VKMNFQRKYGDSFESATNDTKA----RARLVTRGDDYELVELTNQNSFYSVELDIGTPPQ 92
            K+ F + YG SF  AT D K     R + ++  +D E+    N N++YSV + +GTP Q
Sbjct: 32  AKIGFNKVYGKSFSEATADRKYVNLFRNKNISDDND-EVALQNNANTYYSVNISLGTPGQ 90

Query: 93  KVTVLVDTGSSDLWVTGSDNPYCFTEGEDTSGSSFKHVNK-DNLVSVVESVFTEI-SYD- 149
            +T+ +DTGSSDLWV       C     D   + FK  ++ DN    + S  +++ SY+ 
Sbjct: 91  NMTIQLDTGSSDLWVIKPGGLQC----TDNDTNLFKKRSENDNDNDAISSFISQLESYEG 146

Query: 150 ----------------TTMVTSVATATIGNTASTSQAM------NCTTYGTFDTSKSSTF 187
                           T  ++S   A  GN +            NC     F+   S TF
Sbjct: 147 SFSTLFGPGPGSVGTPTGTISSSMPAPTGNGSYDGGDSDSDGSNNCNATAFFEADNSKTF 206

Query: 188 ESNKTE-FSITYGDSTFASGTWGHDRLSLNNLNVTGLSFAVANETNSTVGVLGIGLPGLE 246
             N+T+ + I Y D ++ASG WG D L L +L V  +SFAVAN+TNST  V GIG PG E
Sbjct: 207 HRNRTDPYYIQYEDLSYASGYWGTDDLQLGDLQVHNVSFAVANDTNSTTPVFGIGFPGGE 266

Query: 247 STYSGVSLS-SAQKSYTYNNFPMILKNSGAIKSTAYSLFTNHSDSKHGTILFGAVDHGKY 305
           S+++ V     A   + Y NFP  LKN G I+  AYSL+ N  +S +G +LFG VDH +Y
Sbjct: 267 SSFASVGPEYRAAHPHEYANFPQTLKNQGIIQRVAYSLYLNSPNSTYGNVLFGGVDHSQY 326

Query: 306 AGDLYTIPIINTLQNRGYKDPIQ-FQVTLQGIGVSHGERDENMTTLTTTKIPVLLDSGTT 364
            G LYT+PI+         DP     +TLQG+ V+   R  +   + T  IPV+LDSGTT
Sbjct: 327 QGQLYTLPILQLGNLTSDGDPYNTLAITLQGVSVT---RRGSKHKVKTKPIPVVLDSGTT 383

Query: 365 ISYMPADLVEMIASEVGATYSPDYGYYIMDCINEMEEESSLIFDFGGFYIANWLSNFQLL 424
             Y+P  L + IAS       P+   YI+DC    + +  + FDFGG  I   + N+  +
Sbjct: 384 AMYLPYKLAKSIASRYHGILGPEDQGYIIDCPKSGDND-YITFDFGGVTIKTDIRNY--I 440

Query: 425 TDSRSNVCILGIAPQSDPAIILGDNFLVSTYVVYDLDNMEISMAHADFSDGGEYIDTIKD 484
            +   N C+LGI P SD   + GD FL   YVVYDL+  EIS+A A F+   E I+ I  
Sbjct: 441 FEQSENKCLLGIIPNSDILAVFGDVFLTDAYVVYDLEGKEISLAQASFNSSSEQIEAITS 500

Query: 485 S-VPSALKAPGYSSTWSTYES 504
           S VP A +APGYS TW    S
Sbjct: 501 SGVPGAKRAPGYSKTWKVVHS 521

>CAGL0E01793g Chr5 complement(178411..179961) [1551 bp, 516 aa] {ON}
           similar to uniprot|P32329 Saccharomyces cerevisiae
           YLR120c YAP3 or uniprot|P53379 Saccharomyces cerevisiae
           YDR144c MKC7 or uniprot|Q12303 Saccharomyces cerevisiae
           YLR121c YPS3
          Length = 516

 Score =  291 bits (745), Expect = 6e-91,   Method: Compositional matrix adjust.
 Identities = 189/477 (39%), Positives = 268/477 (56%), Gaps = 48/477 (10%)

Query: 35  GYVKMNFQRKYGDSFESATNDTKARARLVTRGDDYELVELTNQNSFYSVELDIGTPPQKV 94
            Y+K++F R              + + L  R DD   V L N    Y V+L +GTPPQ V
Sbjct: 15  AYLKLDFTR------------VPSASVLEKRADDLSPVPLRNDVDQYIVQLAVGTPPQMV 62

Query: 95  TVLVDTGSSDLWVTGSDNPYCFTEGEDTSGSSFKHVNKDNLVSVVESVFTEISYDTTMVT 154
           +V +DTGS+DLW +G+DNPYC T  +    S        +L  V  S F           
Sbjct: 63  SVQLDTGSADLWFSGADNPYCKTNKKKAPKSK-------DLQPVDNSGF----------- 104

Query: 155 SVATATIGNTASTSQAMNCTTYGTFDTSKSSTFESNKTEFSITYGDSTFASGTWGHDRLS 214
                 IG  A   + ++C  YG F+ S SSTF++N T+  + Y D +F  GTWG D +S
Sbjct: 105 PTNPDQIGKKA---RNLDCKKYGFFNMSSSSTFKNNDTDIFLYYEDLSFVRGTWGTDVVS 161

Query: 215 LNNLNVTGLSFAVANETNSTVGVLGIGLPGLESTYSGVSLSSAQKS-YTYNNFPMILKNS 273
           L  LN++G++FAVA  +NS+ GVLG+ LP  ESTYS  S  +   + Y Y+N P+ LK  
Sbjct: 162 LGGLNISGVNFAVAEISNSSSGVLGVSLPSEESTYSINSNGTTNATNYQYSNLPLQLKEQ 221

Query: 274 GAIKSTAYSLFTNHSDSKHGTILFGAVDHGKYAGDLYTIPIINTLQNRGYKDPIQFQVTL 333
           G I    YS++ N + SK+G+ILFGAVDH KY G LYT+P++N+  +   K P +  +TL
Sbjct: 222 GIIDKVTYSIYLNDTKSKYGSILFGAVDHSKYTGTLYTLPLVNSEYDVVNK-PYELDITL 280

Query: 334 QGIGVSHGERDENMTTLTTTKIPVLLDSGTTISYMPADLVEMIASEVGATYSPD-YGYYI 392
            GIG  +     NM TL   K+  L+DSGTTIS  P ++VE++A ++ AT  P+  G  +
Sbjct: 281 NGIG--YQSMSSNM-TLYDQKVAALIDSGTTISEFPDEIVEVVAKQMNATVDPNGNGIRL 337

Query: 393 MDCINEMEEESSLIFDFGGFYIANWLSNFQLLTDSRSNVCILGIAP---QSDPAIILGDN 449
             C ++ ++ + L+F+ GG  I   +  F   T      C L I P   +SD  +ILGDN
Sbjct: 338 AKCPSK-KDNAKLLFNLGGALIYVDIKEF---TTKVKGKCYLEIIPSGAESD-LVILGDN 392

Query: 450 FLVSTYVVYDLDNMEISMAHADF-SDGGEYIDTIKDSVPSALKAPGYSSTWSTYESI 505
           F+ S Y V+DL+  E+S+A A+F S     I+ IK +VPSA+KAP Y +T+S   SI
Sbjct: 393 FMRSVYTVFDLEANEVSIAQANFNSSLPAQIEEIKSTVPSAVKAPQYYNTFSAIASI 449

>CAGL0E01859g Chr5 complement(185870..187387) [1518 bp, 505 aa] {ON}
           similar to uniprot|P32329 Saccharomyces cerevisiae
           YLR120c YAP3 or uniprot|Q12303 Saccharomyces cerevisiae
           YLR121c YPS3 or uniprot|P53379 Saccharomyces cerevisiae
           YDR144c MKC7
          Length = 505

 Score =  288 bits (736), Expect = 9e-90,   Method: Compositional matrix adjust.
 Identities = 177/485 (36%), Positives = 258/485 (53%), Gaps = 43/485 (8%)

Query: 32  INDGYVKMNFQRKYGDSFESATNDTKARARLVTRGDDYELVELTNQNS--FYSVELDIGT 89
           +   YV ++F++ +GD              LV R  D + V+L N      Y+++L +GT
Sbjct: 10  VAQAYVALDFEKSHGDD-------------LVKR--DVQDVKLINSQKAMLYNIQLSVGT 54

Query: 90  PPQKVTVLVDTGSSDLWVTGSDNPYCFTEGEDTSGSSFKHVNKDNLVSVVESVFTEISYD 149
           PPQ +T  +DTGSSDLW   S NPYC               NK      + S+       
Sbjct: 55  PPQNITAQLDTGSSDLWFPDSTNPYC-------------KANKKQAPKSIASLDA----- 96

Query: 150 TTMVTSVATATIGNTASTSQAMNCTTYGTFDTSKSSTFESNKTEFSITYGDSTFASGTWG 209
            T  TS A         + + ++C  +G F++S S+TF SNKTEF I+Y DS++A G W 
Sbjct: 97  GTRPTSPA-----QVPKSLRNLDCAEFGLFNSSASTTFNSNKTEFFISYLDSSYAEGVWA 151

Query: 210 HDRLSLNNLNVTGLSFAVANETNSTVGVLGIGLPGLESTYSGVSLSSAQKSYTYNNFPMI 269
            D L LN LN++GL+F +A  +NS+  VLG+GL  LE++Y           + Y NFP I
Sbjct: 152 TDNLYLNGLNISGLNFGLAYFSNSSNSVLGVGLTPLEASYDTDIKQDDSPRFQYPNFPQI 211

Query: 270 LKNSGAIKSTAYSLFTNHSDSKHGTILFGAVDHGKYAGDLYTIPIINTLQNRGYKDPIQF 329
           LK  GAI    YSL+ N + SK+G ILFG VDH KY G LYTIP++N+   +        
Sbjct: 212 LKQKGAISKVTYSLYLNDTKSKYGQILFGGVDHSKYVGQLYTIPLVNSKYQKSPGVIADL 271

Query: 330 QVTLQGIGVSHGERDENMTTLTTTKIPVLLDSGTTISYMPADLVEMIASEVGATYSPDYG 389
           +VTL G+G+         TTL T K+P L DSGT+ SY+P  + ++IAS+V  T      
Sbjct: 272 EVTLNGLGI-RDNTTNTNTTLYTQKLPALFDSGTSYSYVPYTMAQVIASQVNGTIDNKTE 330

Query: 390 YYIMDCINEMEEESSLIFDFGGFYIANWLSNFQLLTDSRSNVCILGIAPQSDPAIILGDN 449
              +      ++   ++F+F G  IA  L  F      +  + ++   P + P ++LGD 
Sbjct: 331 AIRLPKCPSKKDTREVVFNFNGVEIAIPLKQFYQKKSGKCYLDLMVAPPNNGPGLLLGDT 390

Query: 450 FLVSTYVVYDLDNMEISMAHADF-SDGGEYIDTIKDSVPSALKAPGYSSTWSTYESIVP- 507
           FL   Y V+DL+  E+S+A A+F S     ++ IK +VPSA+KAP Y +T+S Y++    
Sbjct: 391 FLRQVYTVFDLEAQELSIARANFNSSLPADVEEIKSTVPSAIKAPQYYNTFSAYDNATQV 450

Query: 508 GGNMF 512
            GN+F
Sbjct: 451 VGNIF 455

>CAGL0E01771g Chr5 complement(175652..177211) [1560 bp, 519 aa] {ON}
           similar to uniprot|P53379 Saccharomyces cerevisiae
           YDR144c MKC7 or uniprot|P32329 Saccharomyces cerevisiae
           YLR120c YAP3 or uniprot|Q12303 Saccharomyces cerevisiae
           YLR121c YPS3
          Length = 519

 Score =  285 bits (728), Expect = 2e-88,   Method: Compositional matrix adjust.
 Identities = 170/467 (36%), Positives = 251/467 (53%), Gaps = 40/467 (8%)

Query: 35  GYVKMNFQRKYGDSFESATNDTKARARLVTRGD-DYELVELTNQNSFYSVELDIGTPPQK 93
            Y+K++F++             K    L  R D D  +  L N    Y+V++ +GTPPQ 
Sbjct: 15  AYLKLDFEKT-----------PKISDELTKRADNDSFIAPLLNGGELYTVQIAVGTPPQN 63

Query: 94  VTVLVDTGSSDLWVTGSDNPYCFTEGEDTSGSSFKHVNKDNLVSVVESVFTEISYDTTMV 153
           +TV +DTGSSDLW   + NPYC       +   F    +D            I+ D    
Sbjct: 64  LTVQLDTGSSDLWFVSASNPYC------KNNKKFAPKKQD---------LMPITSDDGFP 108

Query: 154 TSVATATIGNTASTSQAMNCTTYGTFDTSKSSTFESNKTEFSITYGDSTFASGTWGHDRL 213
           TS             + +NC  YG F+ S SST+  N T FS++YGD TFASG WG D +
Sbjct: 109 TSP-----NQVPKALRNINCNKYGFFNASGSSTYSRNDTNFSLSYGDETFASGPWGTDTI 163

Query: 214 SLNNLNVTGLSFAVANETNSTVGVLGIGLPGLESTYSGVSLSSAQKSYT-YNNFPMILKN 272
           SLN + V  ++F +A+ +NST  V GIGLPG ESTY+  S  +   + T Y+NFP+ LK 
Sbjct: 164 SLNGVKVENVTFGLASFSNSTNPVFGIGLPGDESTYAMFSEDTNGTTNTQYSNFPLQLKQ 223

Query: 273 SGAIKSTAYSLFTNHSDSKHGTILFGAVDHGKYAGDLYTIPIINTLQNRGYKDPIQFQVT 332
            G I   AYS++ N + SK G+ILFGAVDH KY+G LYT+PI+N   +   ++P + +VT
Sbjct: 224 QGKIDKVAYSIYLNSTKSKQGSILFGAVDHSKYSGPLYTLPIVNRFGHL-VENPYELEVT 282

Query: 333 LQGIGVSHGERDENMTTLTTTKIPVLLDSGTTISYMPADLVEMIASEVGATYSPDYGYYI 392
           L G+G+   +R  +  TL    +P LLD+GTT +YMP+ + + +A++             
Sbjct: 283 LSGLGL---QRATSNITLFDQLLPALLDTGTTYTYMPSSVAQYLANQTNGVIDKKTSLIK 339

Query: 393 MDCINEMEEESSLIFDFGGFYIANWLSNFQLLTDSRSNVCILGIAPQSDPAIILGDNFLV 452
           +      +   +++F+F G  I   + +F    +     C L    Q     +LGD+F+ 
Sbjct: 340 LAKCPSKKSNDTIVFNFSGAQIKIKMVDF---VEKHKGKCYLPCVSQESSFFLLGDSFMR 396

Query: 453 STYVVYDLDNMEISMAHADFSDGGEYIDTIKDSVPSALKAPGYSSTW 499
             Y V+DLD+ EIS+A A+F+   E I+ I  +VPSA+KAP Y S++
Sbjct: 397 HVYTVFDLDDKEISIAQANFNSTKEDIEEISSTVPSAVKAPQYYSSY 443

>CAGL0E01837g Chr5 complement(183237..184802) [1566 bp, 521 aa] {ON}
           similar to uniprot|P53379 Saccharomyces cerevisiae
           YDR144c MKC7 or uniprot|Q12303 Saccharomyces cerevisiae
           YLR121c YPS3 or uniprot|P32329 Saccharomyces cerevisiae
           YLR120c YAP3
          Length = 521

 Score =  281 bits (718), Expect = 8e-87,   Method: Compositional matrix adjust.
 Identities = 177/494 (35%), Positives = 263/494 (53%), Gaps = 54/494 (10%)

Query: 9   VVNALLLHSSMVFADSIISQSSEINDGYVKMNFQRKYGDSFESATNDTKARARLVTRGDD 68
           +V  L+L S + +A +           YVK++F +  G           A+  +V    D
Sbjct: 1   MVKPLVLLSLLAYAQA-----------YVKLDFTKTPGSDL--------AKRDVV----D 37

Query: 69  YELVELTNQNSFYSVELDIGTPPQKVTVLVDTGSSDLWVTGSDNPYCFTEGEDTSGSSFK 128
            E  +LT     Y VE+ +GTPPQKV + +DTGSSDL+V    NPYC             
Sbjct: 38  PEAAQLTFDKDQYIVEVAVGTPPQKVLLQIDTGSSDLFVIEESNPYCKNNKNKAPKKKDL 97

Query: 129 HVNKDNLVSVVESVFTEISYDTTMVTSVATATIGNTASTSQAMNCTTYGTFDTSKSSTFE 188
               D+                         T      + + ++C  YG ++ ++SSTF 
Sbjct: 98  ESPGDDY----------------------PRTPNQVPKSDRTLDCKKYGFYNRNESSTFN 135

Query: 189 SNKTEFSITYGDSTFASGTWGHDRLSLNNLNVTGLSFAVANETNSTVGVLGIGLPGLEST 248
           SN T+  ITYGD+ F  GTWG D +S+ NLN++ LS  V+  TN++ G+LG+GLPG EST
Sbjct: 136 SNGTDLFITYGDNGFVRGTWGTDSVSVGNLNLSNLSIGVSPMTNTSTGILGVGLPGEEST 195

Query: 249 YSGVSLSSAQKSYTYNNFPMILKNSGAIKSTAYSLFTNHSDSKHGTILFGAVDHGKYAGD 308
           ++  S  +   +Y Y+NFP+ LK  G I+  AYS++ N + SK+G+ILFGAVDH KY G 
Sbjct: 196 FNYSSNVTGPSNYQYSNFPIRLKEEGLIEKIAYSIYLNETGSKYGSILFGAVDHSKYQGP 255

Query: 309 LYTIPIINTLQNRGYKDPIQFQVTLQGIGVSHGERDENMTTLTTTKIPVLLDSGTTISYM 368
           LYT P++N+    G  DP QF++T+ G+G+  G+ D    TL   K+P LLDSG+TIS +
Sbjct: 256 LYTFPLVNSKYKEG-SDPFQFEITMNGVGLV-GKTDN--ITLYDQKLPTLLDSGSTISLL 311

Query: 369 PADLVEMIASEVGATYSPDYGYYIMDCINEMEEESSLIFDFGGFYIANWLSNFQLLTDSR 428
           P D+ +++A +V  T         +      ++   LIF+F G   A +  N     +  
Sbjct: 312 PRDVADLVAQQVNGTVDGKGNCIKLPKCPSKKDNQKLIFNFSG---AEFSVNVTDFMEKH 368

Query: 429 SNVCILGI-APQSDPAIILGDNFLVSTYVVYDLDNMEISMAHADF-SDGGEYIDTIKDSV 486
              C L   A       +LGDNF+ + Y V++LD+ E+S+A A++ S     I+ IKD+V
Sbjct: 369 KGKCYLQFSALDGINFALLGDNFMNNVYTVFNLDDKELSLAQANYNSSLKPDIEEIKDTV 428

Query: 487 PSALKAPGYSSTWS 500
           PSA+ AP Y +T+S
Sbjct: 429 PSAVLAPQYYNTFS 442

>Suva_16.14 Chr16 (11240..12862) [1623 bp, 540 aa] {ON} YIR039C
           (REAL)
          Length = 540

 Score =  280 bits (715), Expect = 3e-86,   Method: Compositional matrix adjust.
 Identities = 175/433 (40%), Positives = 247/433 (57%), Gaps = 37/433 (8%)

Query: 71  LVELTNQNSFYSVELDIGTPPQKVTVLVDTGSSDLWVTGSDNPYCFTEGEDTSGSSFKHV 130
           L+ + +    Y V+++IGTPPQ   + +DTGSSD+ +  +D  YC               
Sbjct: 60  LINMFSSAGMYVVKMEIGTPPQTAYLQLDTGSSDMCINEADAAYC--------------- 104

Query: 131 NKDNLVSVVESVFTEISYDTTMVTSVATAT-IGNTASTSQAMN--CTTYGTFDTSKSSTF 187
                    ES+  E +  T+     ATA  I +TA+ S A N  C+ +GTF  + SSTF
Sbjct: 105 ---------ESLADENNISTSNYELTATAIEILSTAAPSAAYNAPCSYWGTFSPNSSSTF 155

Query: 188 ESNKTEFSITYGDSTFASGTWGHDRLSLNNLNVTGLSFAVANETNSTVGVLGIGLPGLES 247
           + N+T F++TYGD+++ +GT+G D +SL N+ ++  +F V+N+T +  G+LG+ LP  E 
Sbjct: 156 KYNETIFNLTYGDNSYYAGTYGTDVVSLGNITLSNFTFGVSNDTTNNGGILGVSLPSAEV 215

Query: 248 T-YSGVSLSSAQKSYTYNNFPMILKNSGAIKSTAYSLFTNHSDSKHGTILFGAVDHGKYA 306
           T  +  +LSS    + YNNFPM LK+ G IK  AYSLF N   ++ G+ILFGAVD  +Y+
Sbjct: 216 TDDTEDALSSNTTPFIYNNFPMALKSQGKIKKIAYSLFLNEPSARFGSILFGAVDKSEYS 275

Query: 307 GDLYTIPIINTLQNRGYKDPIQFQVTLQGIGVSHGERDENMTTLTTTKIPVLLDSGTTIS 366
           G LYT+P++         D   F VT Q + +   +      T++  + PVL DSGT+ S
Sbjct: 276 GQLYTLPMLQAYNTLDATDAGMF-VTAQSVAILDSKSGNK--TVSEVQFPVLFDSGTSTS 332

Query: 367 YMPADLVEMIASEVGATYSPDYGYYIMDCINEMEEESSLIFDFGGFYIANWLSNFQLLTD 426
            +P  + + I       YS D   YI DC       + L FDFGGF I+  +SNF  +T 
Sbjct: 333 VLPTKIADAIGRSFDGKYSSDDQGYIFDCAK--VNNTLLSFDFGGFNISANISNF--VTP 388

Query: 427 SRSNVCILGIAPQSDPAIILGDNFLVSTYVVYDLDNMEISMAHADFSDGGEYIDTIKDSV 486
           ++ + CIL I P SD   +LGD FLV TYVVYDL+N E+S+A A F +  E I  I DSV
Sbjct: 389 AKDH-CILQILP-SDTIFVLGDAFLVDTYVVYDLENHEVSVAQASFDNKEEDIGIISDSV 446

Query: 487 PSALKAPGYSSTW 499
           P A  APGYSSTW
Sbjct: 447 PGATPAPGYSSTW 459

>Suva_9.13 Chr9 (14409..15803) [1395 bp, 464 aa] {ON} YIR039C (REAL)
          Length = 464

 Score =  272 bits (695), Expect = 4e-84,   Method: Compositional matrix adjust.
 Identities = 170/433 (39%), Positives = 244/433 (56%), Gaps = 36/433 (8%)

Query: 71  LVELTNQNSFYSVELDIGTPPQKVTVLVDTGSSDLWVTGSDNPYCFTEGEDTSGSSFKHV 130
           L+ + +    Y VE++IGTPPQ     +DTGSSD+    +D+ YC               
Sbjct: 56  LINMFSSAHIYVVEMEIGTPPQAAYFQLDTGSSDMCANEADSSYC--------------- 100

Query: 131 NKDNLVSVVESVFTEISYDTTMVTSVATAT-IGNTASTSQAMN--CTTYGTFDTSKSSTF 187
                    ES   E +  T+     ATA+ I +TA++S+A N  C+ +GTF  + SSTF
Sbjct: 101 ---------ESFTDESNIWTSNYELTATASEISSTATSSKAYNTPCSYWGTFSPNVSSTF 151

Query: 188 ESNKTEFSITYGDSTFASGTWGHDRLSLNNLNVTGLSFAVANETNSTVGVLGIGLPGLES 247
           + N+T F+I+Y D+ + +GT+G D +SL N+ ++  +F V+N+T  + G+LG+ LP +E 
Sbjct: 152 KYNETIFNISYADNMYYAGTYGTDVVSLGNITLSNFTFGVSNDTKMSYGILGVSLPSVEE 211

Query: 248 TYS-GVSLSSAQKSYTYNNFPMILKNSGAIKSTAYSLFTNHSDSKHGTILFGAVDHGKYA 306
           T     +LSS    + Y NFPM LK+ G I+  AYSLF N   ++ G+ILFGAVD  KY+
Sbjct: 212 TDDIEDALSSNTTPFVYENFPMALKSQGKIEKIAYSLFLNEPSARFGSILFGAVDKSKYS 271

Query: 307 GDLYTIPIINTLQNRGYKDPIQFQVTLQGIGVSHGERDENMTTLTTTKIPVLLDSGTTIS 366
           G LYT+P+   LQ     D +   + +     +  +      T++  + PVL DSGT+ S
Sbjct: 272 GQLYTLPM---LQAYNTLDALYSGMFVTAQSAAIIDSKSGNKTVSEVQFPVLFDSGTSTS 328

Query: 367 YMPADLVEMIASEVGATYSPDYGYYIMDCINEMEEESSLIFDFGGFYIANWLSNFQLLTD 426
            +P ++ + I       YS D   YI DC       + L  DFGGF I+  +SNF  +T 
Sbjct: 329 VLPTEIADAIGRSFDGKYSSDDEGYIFDC--SKVNNTQLSIDFGGFNISANISNF--VTP 384

Query: 427 SRSNVCILGIAPQSDPAIILGDNFLVSTYVVYDLDNMEISMAHADFSDGGEYIDTIKDSV 486
              + C+L I P SD   +LGD FLV TYVVYDL+N E+S+A A F++  E I+ I DSV
Sbjct: 385 LTKDHCVLQILP-SDTVSVLGDAFLVDTYVVYDLENHEVSVAQASFNNEEEDIEIISDSV 443

Query: 487 PSALKAPGYSSTW 499
           P A  APGYSSTW
Sbjct: 444 PGATPAPGYSSTW 456

>KAFR0B06700 Chr2 complement(1396587..1398182) [1596 bp, 531 aa]
           {ON} 
          Length = 531

 Score =  272 bits (695), Expect = 2e-83,   Method: Compositional matrix adjust.
 Identities = 199/511 (38%), Positives = 276/511 (54%), Gaps = 76/511 (14%)

Query: 1   MKLSTIKFVVNALLLHSSMVFADSIISQSSEINDGYVKMNFQRKYGDSFESATNDTKARA 60
           M+  TI  V  ALL     V+A     +SS    G+V MNF R YG S ++A   +K   
Sbjct: 1   MRFQTISSV--ALLSAIQHVYAHLGAEESSS---GFVSMNFNRLYGASPDTAV--SKRSM 53

Query: 61  RLVTRGDDYELVELTNQNSFYSVELDIGTPPQKVTVLVDTGSSDLWVTGSDNPYCFTEGE 120
             + R ++YE V L N+  FYS++L IG+  Q VTVLVDTGSSDL          +  G 
Sbjct: 54  SHIKRSENYEQVRLKNEACFYSMDLAIGSNHQNVTVLVDTGSSDL----------WVPGP 103

Query: 121 DTSGSSFKHVNKDNLVSVVESVFTEISYDTTMVTSVATATIGNTASTSQAMNCTTYGTFD 180
           D+S S                                                  YG F 
Sbjct: 104 DSSAS--------------------------------------------------YGVFS 113

Query: 181 TSKSSTFESNKTEFSITYGDSTFASGTWGHDRLSLNNLNVTGLSFAVANETNSTVGVLGI 240
              S++ + N TEFS  Y D T A G W +D ++L +  V+ ++FAV N+T+S  GVLG+
Sbjct: 114 PKDSTSLKFNGTEFSTQYADGTTAYGEWCYDTVALGDTTVSNVTFAVVNDTDSNFGVLGL 173

Query: 241 GLPGLESTYSGVSLSSAQKSYTYNNFPMILKNSGAIKSTAYSLFTNHSDSKHGTILFGAV 300
           GL GLE+TY+  +LSS    Y Y+NFP+ L   G I++ AYSL+ N +D+  G +LFGAV
Sbjct: 174 GLTGLEATYTN-ALSSP---YQYDNFPVKLVRQGLIQANAYSLYLNKADASSGNVLFGAV 229

Query: 301 DHGKYAGDLYTIPIINTLQNRGYKDPIQFQVTLQGIGVSHGERDENMTTLTTTKIPVLLD 360
           DH KY G L+TIP +NTL++ GY   I+F VTL G+ +S    ++  TTLTT+K PVL+D
Sbjct: 230 DHAKYTGTLHTIPFVNTLESLGYNSVIEFHVTLDGMDLS---TNDGQTTLTTSKFPVLVD 286

Query: 361 SGTTISYMPADLVEMIASEVGATYSPDYGYYIMDCINEMEEESSLIFDFGGFYIANWLSN 420
           SG T SY+P +L++ IAS++GATYS +Y  Y++ C +E ++++ + ++FGGF I   LS 
Sbjct: 287 SGNTFSYLPDNLLQQIASQIGATYSNEYVGYVLTCPSE-DDDTVISYNFGGFNIDTPLSG 345

Query: 421 FQLLTDSRSNVCILGIAPQSDPAIILGDNFLVSTYVVYDLDNMEISMAHADFSDGGEYID 480
                   SN CIL IAP       LGD FL + Y         +S+A A ++D  E I+
Sbjct: 346 SVTELGDDSNTCILMIAPSGSEFGQLGDTFLENVYASSTWTIESLSLAQAQYTDEEE-IE 404

Query: 481 TIKDSVPSALKAPGYSSTWSTYESIVPGGNM 511
            I  S+P A+KA GYS  WS        GN+
Sbjct: 405 IISSSIPGAIKAAGYSDIWSASAKNSTSGNV 435

>YIR039C Chr9 complement(430498..432111) [1614 bp, 537 aa] {ON}
           YPS6Putative GPI-anchored aspartic protease, member of
           the yapsin family of proteases involved in cell wall
           growth and maintenance
          Length = 537

 Score =  271 bits (693), Expect = 4e-83,   Method: Compositional matrix adjust.
 Identities = 170/422 (40%), Positives = 240/422 (56%), Gaps = 34/422 (8%)

Query: 81  YSVELDIGTPPQKVTVLVDTGSSDLWVTGSDNPYCFTEGEDTSGSSFKHVNKDNLVSVVE 140
           Y V+++IGTPPQ + + +DTGSSD+ V  +D  YC +  +   GS +   +   L +   
Sbjct: 67  YVVKMEIGTPPQTLYLQLDTGSSDMIVNNADIAYCKSMSD---GSDYASTDNYELTATFN 123

Query: 141 SVFTEISYDTTMVTSVATATIGNTASTSQAMNCTTYGTFDTSKSSTFESNKTEFSITYGD 200
            +       +T ++S A  T+           C+ +GTFD S SSTFE+N T F+ TYGD
Sbjct: 124 GL------PSTTISSEAYNTL-----------CSYWGTFDASNSSTFENNATFFNNTYGD 166

Query: 201 STFASGTWGHDRLSLNNLNVTGLSFAVANET-NSTVGVLGIGLPGLESTYSGV--SLSSA 257
            T+ +GT+G D +S  N+ +   +F V+N+T  +  G+LGI LP  E T  G+  +L+  
Sbjct: 167 GTYYAGTYGTDVVSFENITLNDFTFGVSNDTIGNPSGILGISLPIAEFT-DGIEYALALN 225

Query: 258 QKSYTYNNFPMILKNSGAIKSTAYSLFTNHSDSKHGTILFGAVDHGKYAGDLYTIPIINT 317
           +  + Y+NFPM LKN G I   AYSLF N  D+  G+ILFGAVD  KY G LYT+P++  
Sbjct: 226 RTPFIYDNFPMELKNQGKINKIAYSLFLNGPDAHFGSILFGAVDKSKYTGQLYTLPMLQA 285

Query: 318 LQNRGYKDPIQFQVTLQGIGVSHGERDENMTTLTTTKIPVLLDSGTTISYMPADLVEMIA 377
               G  +P    +T Q + +   E      T++  + PV+LDSGTT SY+P ++ E I 
Sbjct: 286 FNTLG-SNPGMI-ITAQSVAILDSESGNK--TVSDIQFPVMLDSGTTFSYLPTEIAEAIG 341

Query: 378 SEVGATYSPDYGYYIMDCINEMEEESSLIFDFGGFYIANWLSNFQLLTDSRSNVCILGIA 437
                 YS D   YI DC      ++ L  DFGGF I+  +SNF     S  + C+L + 
Sbjct: 342 KSFDGEYSSDDQGYIFDC--SKVNDTLLSVDFGGFNISANISNF---VTSAKDRCVLNVK 396

Query: 438 PQSDPAIILGDNFLVSTYVVYDLDNMEISMAHADFSDGGEYIDTIKDSVPSALKAPGYSS 497
            QS+   +LGD FLV  YVVYDL+N EIS+A A F++  E I+ I D+VP A  APGY S
Sbjct: 397 -QSESTYMLGDAFLVDAYVVYDLENYEISIAQASFNNQEEDIEVISDTVPGATPAPGYFS 455

Query: 498 TW 499
           TW
Sbjct: 456 TW 457

>NCAS0A12460 Chr1 complement(2461028..2462650) [1623 bp, 540 aa]
           {ON} Anc_7.182
          Length = 540

 Score =  264 bits (674), Expect = 3e-80,   Method: Compositional matrix adjust.
 Identities = 171/444 (38%), Positives = 238/444 (53%), Gaps = 56/444 (12%)

Query: 72  VELTN-QNSFYSVELDIGTPPQKVTVLVDTGSSDLWVTGSDNPYC---FTEGEDTSGSSF 127
           +EL + + ++Y+  L+IGTPPQ +TVL D+GSSDLWV  + NPYC   +T  +  +GSS 
Sbjct: 52  IELQHIEQTYYATTLEIGTPPQNLTVLFDSGSSDLWVMDASNPYCESQYTGSQTYNGSSI 111

Query: 128 KHVNKDNLVSVVESVFTEISYDTTMVTSVATATIGNTASTSQAMNCTTYGTFDTSKSSTF 187
                                              N AST   ++C+++ TF+ S SS+F
Sbjct: 112 -----------------------------------NQAST---IDCSSFMTFNKSLSSSF 133

Query: 188 ESNKT-EFSITYGDSTFASGTWGHDRLSLNNLNVTGLSFAVANETNSTV-GVLGIGLPGL 245
           ++  T  F   Y D TFA G+W  ++L++N ++V+ L F + N   + V GVLGIG P  
Sbjct: 134 KTKGTSRFYAYYSDKTFADGSWATEKLTMNGVDVSSLQFGLGNCVTTPVSGVLGIGFPRR 193

Query: 246 ESTYSGVSLSSAQKSYTYNNFPMILKNSGAIKSTAYSLFTNHSDSKHGTILFGAVDHGKY 305
           ES        +A   + Y NFP +LKN G I   AYS+F N  +S  G+ILFGA+D  KY
Sbjct: 194 ESVK---GYDNAPNEF-YPNFPQVLKNQGIIDVVAYSMFLNKLESDTGSILFGAIDTSKY 249

Query: 306 AGDLYTIPIINTLQNRGYKDPIQFQVTLQGIGVSHGERDENMTTLTTTKIPVLLDSGTTI 365
            GDL T P++N   +   K P    V LQG+G +    +    T  T+KIPVLLDSGTT+
Sbjct: 250 TGDLVTFPMLNIYPDVTDK-PATLMVILQGLG-AQDNANCKAETFVTSKIPVLLDSGTTL 307

Query: 366 SYMPADLVEMIASEVGATYSPDYGYYIMDC-INEMEEESSLIFDFGGFYIANWLSNFQLL 424
              P ++ +M+A  + AT+S D G YIM+C   E    +  IFDFGG  I   LSNF L 
Sbjct: 308 MGAPKEIADMMADFMNATFSEDEGIYIMECPTKETLANTDYIFDFGGVQIKVPLSNFILS 367

Query: 425 TDSRSNVCILGIAPQSDPAIILGDNFLVSTYVVYDLDNMEISMAHADFSDGGEYIDTIKD 484
             S    C   + P     ++LGD FL S YVV+DLDN +IS+A A+  +     D+I +
Sbjct: 368 AQSEGGPCGFAVLPDDSNTMVLGDIFLSSAYVVFDLDNYQISLAAANLDNNVSLEDSIIN 427

Query: 485 SVPSALKAPGYS----STWSTYES 504
            +PS    P         WSTYE+
Sbjct: 428 -IPSDGNIPNAKMATVDPWSTYET 450

>CAGL0E01881g Chr5 (188277..189803) [1527 bp, 508 aa] {ON} similar
           to uniprot|P32329 Saccharomyces cerevisiae YLR120c YAP3
           or uniprot|P53379 Saccharomyces cerevisiae YDR144c MKC7
           or uniprot|Q12303 Saccharomyces cerevisiae YLR121c YPS3
          Length = 508

 Score =  253 bits (647), Expect = 1e-76,   Method: Compositional matrix adjust.
 Identities = 161/445 (36%), Positives = 247/445 (55%), Gaps = 38/445 (8%)

Query: 67  DDYELVELTNQNSFYSVELDIGTPPQKVTVLVDTGSSDLWVTGSDNPYCFTEGEDTSGSS 126
           DDY  V+L N+  FY VE+ IG+  Q +T+LVDTGSSD WV G+ NPYC       S   
Sbjct: 34  DDYLNVQLDNEQIFYGVEVSIGSDKQNMTLLVDTGSSDFWVLGAQNPYC------KSNRG 87

Query: 127 FKHVNKDNLVSVVESVFTEISYDTTMVTSVATATIGNTASTSQAMNCTTYGTFDTSKSST 186
            K   KD   SV         Y  T   ++  A         +  +C+ + TF++S S+T
Sbjct: 88  KKPKKKDQPSSVDPG---RNGY-PTKAEAIPYA--------ERTFDCSDFKTFNSSSSNT 135

Query: 187 FESNKTEFSITYGDSTFASGTWGHDRLSLNNLNVTGLSFAVANETNSTVGVLGIGLPGLE 246
           F+SN T+F ITYGD ++  GTWG D+++L    +  ++FAVA  TN++ G+LGIGLP LE
Sbjct: 136 FKSNDTDFFITYGDGSYVEGTWGTDQVALAGQTLENVTFAVAELTNNSYGLLGIGLPELE 195

Query: 247 STYSGVSLSSAQ-------KSYTYNNFPMILKNSGAIKSTAYSLFTNHSDSKHGTILFGA 299
           S+   +++ +AQ       K   Y NFP  LK +  I    YS++ N ++ K G+ILFGA
Sbjct: 196 SS---ITIDTAQLTNTSSVKKNPYMNFPESLKLNKLINKVVYSIYLNRTNDKFGSILFGA 252

Query: 300 VDHGKYAGDLYTIPIINTLQNRGYKDPIQFQVTLQGIGVSHGERDENMTTL--TTTKIPV 357
           VDH +Y G+L T+P++ + ++ G   P +  VTL G+  S    D N+T +   T+K P 
Sbjct: 253 VDHNRYDGNLTTVPLVFSNRDFGTPRPNELMVTLNGM--SFEATDGNVTQILNATSKFPA 310

Query: 358 LLDSGTTISYMPADLVEMIASEVGATYSPDYG-YYIMDCINEMEEESSLIFDFGGFYIAN 416
           LLD+G+T +++P D+   +A     TY        I  C+++ ++++ L F  GG  I  
Sbjct: 311 LLDTGSTDTHLPVDVYNALAESTNGTYDQTQNKIRIPKCLSK-KDKTILNFSLGGVNIG- 368

Query: 417 WLSNFQLLTDSRSNVCILGIAPQSDPAIILGDNFLVSTYVVYDLDNMEISMAHADFSDG- 475
               ++ +       C + +AP      ILGD+ +   Y+V+DL++ EIS+A A F+D  
Sbjct: 369 --VPYKEMVKKIKGKCYINVAPTGSDFAILGDDVIRYAYMVFDLEDREISLAQASFNDTL 426

Query: 476 GEYIDTIKDSVPSALKAPGYSSTWS 500
            E I+ +  ++P A +A  YS T+S
Sbjct: 427 PEDIEVVVSTIPGATRASAYSETYS 451

>CAGL0E01727g Chr5 (171119..172738) [1620 bp, 539 aa] {ON} similar
           to uniprot|P32329 Saccharomyces cerevisiae YLR120c YAP3
           or uniprot|Q12303 Saccharomyces cerevisiae YLR121c YPS3
           or uniprot|P53379 Saccharomyces cerevisiae YDR144c MKC7
          Length = 539

 Score =  248 bits (632), Expect = 5e-74,   Method: Compositional matrix adjust.
 Identities = 167/479 (34%), Positives = 250/479 (52%), Gaps = 42/479 (8%)

Query: 30  SEINDGYVKMNFQRKYGDSFESATNDTKARARLVTRGDDYELVELTNQNSFYSVELDIGT 89
           + +   Y++++F+R+       A   T   +  V    D  + ++ +    Y+V+L +GT
Sbjct: 7   AAVAQAYLQLDFERQTAQDVALAKRHT---SNGVANAMDVPIEQIGDL--MYTVQLHVGT 61

Query: 90  PPQKVTVLVDTGSSDLWVTGSDNPYCFTEGEDTSGSSFKHVNKDNLVSVVESVFTEISYD 149
           PPQ VTV +DTGSSDLW   + NPYC                K N     + V       
Sbjct: 62  PPQNVTVQLDTGSSDLWFPVASNPYC----------------KRNAKLAPKKV------K 99

Query: 150 TTMVTSVATATIGNTASTSQAMNCTTYG-TFDTSKSSTFESNKTEFSITYGDSTFASGTW 208
               T  AT      A   +  +C  +G    +  SS   ++ +EF + Y D T+ASG W
Sbjct: 100 ALPATGFATEN-DQVAKKLRTFDCDAFGLFNSSMSSSFKSNDSSEFFVKYEDGTYASGMW 158

Query: 209 GHDRLSLNNLNVTGLSFAVANETNSTVGVLGIGLPGLESTYSGVSLSSAQKS-YTYNNFP 267
           G D   LN+ NV+ ++FA+AN  N+++GVLG+G P  E+T      S   K  Y Y+NFP
Sbjct: 159 GTDTFKLNHHNVSNITFALANIANASMGVLGVGFPAEETTDDPSPGSLIDKEHYQYDNFP 218

Query: 268 MILKNSGAIKSTAYSLFTNHSDSKHGTILFGAVDHGKYAGDLYTIPIINTLQNRGYKDPI 327
           + LK +  IK  +YS+F N ++SK G ILFG VDH KY G L+T+P++N L         
Sbjct: 219 IALKRTRTIKKVSYSIFLNDTNSKKGVILFGGVDHSKYQGTLWTVPMVNNLLTLNQTTTS 278

Query: 328 QFQVTLQGIGVSHGERDENMTTLTTTKIPVLLDSGTTISYMPADLVEMIASEVGATY-SP 386
           + ++TL G+G      D+   TL   KIPVLLD+GTT++Y P  +V++IA  V  T  S 
Sbjct: 279 RPEITLNGLGF---RDDKKNVTLWGEKIPVLLDTGTTLAYAPKQVVDVIAKRVNGTIDSK 335

Query: 387 DYGYYIMDCINEMEEESSLIFDFGGFYIANWLSNFQLLTDSRSNVCILGIAPQ---SDPA 443
             G  +  C N  ++ S LIF+F G  I   L N   + + R   C L I      S   
Sbjct: 336 TGGIKLKKCPNA-KDNSELIFNFAGAEIPVSLLN---MVEKRKGKCYLEIRYHEELSKTG 391

Query: 444 IILGDNFLVSTYVVYDLDNMEISMAHADFSDGGEY-IDTIKDSVPSALKAPGYSSTWST 501
           ++LGD F+   Y V+++++ME+S A A+ +D     I+ I   VPSA+KAP Y +T+++
Sbjct: 392 MLLGDIFMRHVYSVFNMEDMEVSFAVANGNDSAPLQIEAIISDVPSAVKAPQYYNTFAS 450

>Ecym_4394 Chr4 (827655..829211) [1557 bp, 518 aa] {ON} similar to
           Ashbya gossypii AGR240W
          Length = 518

 Score =  243 bits (620), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 156/435 (35%), Positives = 230/435 (52%), Gaps = 53/435 (12%)

Query: 72  VELTNQNSFYSVELDIGTPPQKVTVLVDTGSSDLWVTGSDNPYCFTEGEDTSGSSFKHVN 131
           ++L N N  Y  E+++GTPPQK+ VL DTGS+DLW   SDN YC         S+  + N
Sbjct: 43  MDLINNNDHYLAEIEVGTPPQKLKVLFDTGSADLWFQSSDNEYCAASYPQGDNSTNTNDN 102

Query: 132 KDNLVSVVESVFTEISYDTTMVTSVATATIGNTASTSQAMNCTTYGTFDTSKSSTFESNK 191
           + N+ S                                   C++  T++  +SSTF    
Sbjct: 103 EQNMASF----------------------------------CSSSRTYNFQRSSTFTPTG 128

Query: 192 TEFSITYGDSTFASGTWGHDRLSLNNLNVTGLSFAVANETNSTV-GVLGIGLPGLEST-- 248
            +F I Y + TF+ G W  DRL + N +V+GL F V+N +N+T+ G+LG+G   LES   
Sbjct: 129 YKFFIDYVN-TFSRGIWAKDRLVIGNADVSGLQFGVSNISNTTINGILGVGYERLESVKG 187

Query: 249 YSGVSLSSAQKSYTYNNFPMILKNSGAIKSTAYSLFTNHSDSKHGTILFGAVDHGKYAGD 308
           YSG        + TY N PM+LK SG I   AYS+F NH +S   T+ FG VD  KY GD
Sbjct: 188 YSGA------PNRTYPNLPMLLKESGKIDKVAYSVFLNHLNSNVSTVTFGGVDSEKYTGD 241

Query: 309 LYTIPIINTLQNRGYKDPIQFQVTLQGIGVSHGERDENMTTLTTTKIPVLLDSGTTISYM 368
           LY  P++N    +    P +F +TLQ + V HG       T++ T +P L D+GT    +
Sbjct: 242 LYKFPLVNIY--KSIPRPSKFHITLQALEV-HGNYSSLNKTVSNTPLPALFDTGTNGMVV 298

Query: 369 PADLVEMIASEVGATYSPDYGYYIMDCINEMEEESSLIFDFGGFYIANWLSNFQL-LTDS 427
           P ++ E IAS + AT+   +  Y+  C  E E+++ L+FDFG   I   L+NF +   + 
Sbjct: 299 PPNVAENIASTIHATFDEKFSLYLFACPAE-EDDTKLVFDFGDIQIEAPLANFIVPAAEL 357

Query: 428 RSNVCILGIAPQSDPAIILGDNFLVSTYVVYDLDNMEISMAHADFS-DGGEYIDTIKDSV 486
            +  C + I P+ D    LG  FL STYVVY+L++ E+++A A++  DG   I  I  ++
Sbjct: 358 GTEQCGVAIIPE-DGTFTLGIPFLRSTYVVYNLEDYEVALAQANWKWDGKSKITPIISNI 416

Query: 487 PSALKAPGYSSTWST 501
           P A +A   ++ W+T
Sbjct: 417 PGATQA--TATPWNT 429

>KLLA0D15917g Chr4 complement(1336727..1338262) [1536 bp, 511 aa]
           {ON} some similarities with uniprot|P12630 Saccharomyces
           cerevisiae YIL015W BAR1 Aspartyl protease secreted into
           the periplasmic space of mating type a cells, cleaves
           and inactivates alpha factor allowing cells to recover
           from alpha-factor-induced cell cycle arrest and to
           YLR121C uniprot|Q12303 Saccharomyces cerevisiae YLR121C
           YPS3 Aspartic protease, attached to the plasma membrane
           via a glycosylphosphatidylinositol (GPI) anchor and to
           YLR120C uniprot|P32329 Saccharomyces cerevisiae YLR120C
           YPS1 Aspartic protease, attached to the plasma membrane
           via a glycosylphosphatidylinositol (GPI) anchor and to
           YDR144C uniprot|P53379 Saccharomyces cerevisiae YDR144C
           MKC7 GPI- anchored aspartyl protease (yapsin) involved
           in protein processing; shares functions with Yap3p and
           Kex2p and to YIR039C uniprot|P40583 Saccharomyces
           cerevisiae YIR039C YPS6 Putative GPI-anchored aspartic
           protease
          Length = 511

 Score =  239 bits (610), Expect = 4e-71,   Method: Compositional matrix adjust.
 Identities = 161/462 (34%), Positives = 230/462 (49%), Gaps = 58/462 (12%)

Query: 58  ARARLVTRGDDYELVELTNQNSFYSVELDIGTPPQKVTVLVDTGSSDLWVTGSDNPYCFT 117
           A   L  R   +E  +L  Q+ FY+VEL +GTP QK+  + DTGSSDLWV    NP+C  
Sbjct: 38  ADRSLQKRSKSFE-SKLNPQDYFYTVELGVGTPSQKINCIFDTGSSDLWVPAKSNPFCLG 96

Query: 118 EGEDTSGSSFKHVNKDNLVSVVESVFTEISYDTTMVTSVATATIGNTASTSQAMNCTTYG 177
              DT+G++  H                     T +T +              ++C   G
Sbjct: 97  NKLDTNGTNEFH--------------------GTEITPI--------------LDCDKIG 122

Query: 178 TFDTSKSSTFESNKTEFSITYGDSTFASGTWGHDRLSLNNLNVTGLSFAVANETNSTVGV 237
            FD   S +  +    FS  Y D +++ G W  D +S+ +  V  L FAVAN +++  GV
Sbjct: 123 VFDPGSSYSLSATGYNFSTQYFDGSYSDGFWVVDDISIADQQVPDLQFAVANISSAPSGV 182

Query: 238 LGIGLPGLEST--YSGVSLSSAQKSYTYNNFPMILKNSGAIKSTAYSLFTNHSDSKHGTI 295
           LG+GLP LE+   Y G        +  Y+NFP  LK++  I    YSL+ +  D + GT+
Sbjct: 183 LGVGLPRLEAVRGYDGA------PNANYDNFPQTLKSNRLINRVLYSLYFDSGDLESGTV 236

Query: 296 LFGAVDHGKYAGDLYTIPIINTLQNRGYKDPIQFQVTLQGIGVSHGERDENMTTLTTTKI 355
           LFG +D  KY G LYT+P++N  +     +P  F +TLQG+G+   E +   T +   K 
Sbjct: 237 LFGGIDEKKYDGVLYTLPLVNIYEQ--IDEPAAFDITLQGLGI-RSESNCKDTVIAHKKA 293

Query: 356 PVLLDSGTTISYMPADLVEMIASEVGATYSPDYGYYIMDCINEMEEESSLIFDFGGFYIA 415
           P LLDSG+TI   P + +E IA E+GA +S   G Y++DC     ++ +  FDFG   + 
Sbjct: 294 PALLDSGSTIMGAPQEALESIAQELGAAFSESDGLYVLDC-PASNDDRTFYFDFGELKLK 352

Query: 416 NWLSNFQLLTDSRSNVCILGIAPQSDPAIILGDNFLVSTYVVYDLDNMEISMAHADFSDG 475
             + +   L +S  N C L I   S    ILGD  L S YVVYDLDN+EIS+A    + G
Sbjct: 353 VPIHDLLYLPESGQNYCGLAII-ASGEEWILGDLVLKSAYVVYDLDNLEISIAQVKTTSG 411

Query: 476 ---------GEYIDTIK-DSVPSALKAPGYSSTWSTYESIVP 507
                    G    T K +S P +L     SST S ++  +P
Sbjct: 412 SRIQTVSATGSLPQTRKSNSTPWSLSGSTNSSTDSVFDKPLP 453

>YIL015W Chr9 (322342..324105) [1764 bp, 587 aa] {ON}  BAR1Aspartyl
           protease secreted into the periplasmic space of mating
           type a cells, helps cells find mating partners, cleaves
           and inactivates alpha factor allowing cells to recover
           from alpha-factor-induced cell cycle arrest
          Length = 587

 Score =  236 bits (603), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 149/400 (37%), Positives = 215/400 (53%), Gaps = 53/400 (13%)

Query: 80  FYSVELDIGTPPQKVTVLVDTGSSDLWVTGSDNPYCFTEGEDTSGSSFKHVNKDNLVSVV 139
           +Y+  LDIGTP Q +TVL DTGS+D WV  S NP+C      +S S+  +          
Sbjct: 44  YYATTLDIGTPSQSLTVLFDTGSADFWVMDSSNPFCLPNSNTSSYSNATY---------- 93

Query: 140 ESVFTEISYDTTMVTSVATATIGNTASTSQAMNCTTYGTFDTSKSSTFES-NKTEFSITY 198
                                  N      +++C +  T++  +SST++      F ITY
Sbjct: 94  -----------------------NGEEVKPSIDCRSMSTYNEHRSSTYQYLENGRFYITY 130

Query: 199 GDSTFASGTWGHDRLSLNNLNVTGLSFAVANETNSTV-GVLGIGLPGLEST--YSGVSLS 255
            D TFA G+WG + +S+N +++  + F VA    + V GVLGIG P  ES   Y G    
Sbjct: 131 ADGTFADGSWGTETVSINGIDIPNIQFGVAKYATTPVSGVLGIGFPRRESVKGYEG---- 186

Query: 256 SAQKSYTYNNFPMILKNSGAIKSTAYSLFTNHSDSKHGTILFGAVDHGKYAGDLYTIPII 315
            A   Y Y NFP ILK+   I   AYSLF N  DS  G+I+FGA+D  K++GDL+T P++
Sbjct: 187 -APNEY-YPNFPQILKSEKIIDVVAYSLFLNSPDSGTGSIVFGAIDESKFSGDLFTFPMV 244

Query: 316 NTLQNRGYKDPIQFQVTLQGIGVSHGERDENMTTLTTTKIPVLLDSGTTISYMPADLVEM 375
           N         P    +T+QG+G  +    E+  T TTTK PVLLDSGT++   P  + + 
Sbjct: 245 NEYPTI-VDAPATLAMTIQGLGAQNKSSCEH-ETFTTTKYPVLLDSGTSLLNAPKVIADK 302

Query: 376 IASEVGATYSPDYGYYIMDC---INEMEEESSLIFDFGGFYIANWLSNFQLLTDSRSNVC 432
           +AS V A+YS + G YI+DC   + ++E      FDFG   I+  LS+  L  ++  + C
Sbjct: 303 MASFVNASYSEEEGIYILDCPVSVGDVEYN----FDFGDLQISVPLSSLILSPETEGSYC 358

Query: 433 ILGIAPQSDPAIILGDNFLVSTYVVYDLDNMEISMAHADF 472
              + P +D +++LGD FL S YVV+DLDN +IS+A A++
Sbjct: 359 GFAVQPTND-SMVLGDVFLSSAYVVFDLDNYKISLAQANW 397

>Suva_34.1 Chr34 complement(13..1176) [1164 bp, 387 aa] {ON} YIR039C
           (REAL)
          Length = 387

 Score =  229 bits (583), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 141/327 (43%), Positives = 194/327 (59%), Gaps = 19/327 (5%)

Query: 187 FESNKTEFSITYGDSTFASGTWGHDRLSLNNLNVTGLSFAVANETNSTVGVLGIGLPGLE 246
           F+ N+T F+ITY D+++ +GT+G D +SL ++ ++  +F V+N+T    G+LGI LP  E
Sbjct: 1   FKYNETIFNITYDDNSYYAGTFGTDIVSLGDITLSNFTFGVSNDTTINGGILGISLPSAE 60

Query: 247 STYSGV-SLSSAQKSYTYNNFPMILKNSGAIKSTAYSLFTNHSDSKHGTILFGAVDHGKY 305
            T SG  +LSS    + Y+NFPM LKN G I+  AYSLF N  +++ G+ILFGAVD  KY
Sbjct: 61  ITDSGQGALSSNTTPFAYDNFPMALKNQGKIEKIAYSLFLNEPNARFGSILFGAVDKSKY 120

Query: 306 AGDLYTIPII---NTLQNRGYKDPIQFQVTLQGIGVSHGERDENMTTLTTTKIPVLLDSG 362
            G LYT+P++   NTL   G        VT Q + +   +      T++  + PVL DSG
Sbjct: 121 TGQLYTLPMLQAYNTLDALGGG----MLVTAQSVAIL--DSISGNKTVSEVQFPVLFDSG 174

Query: 363 TTISYMPADLVEMIASEVGATYSPDYGYYIMDCINEMEEESSLIFDFGGFYIANWLSNFQ 422
           T+ S +P ++ + I       YS D   YI DC       + L  DFGGF I+  +SNF 
Sbjct: 175 TSTSVLPTEIADAIGRSFDGKYSSDDEGYIFDC--SKVNNTQLSIDFGGFNISANISNF- 231

Query: 423 LLTDSRSNVCILGIAPQSDPAIILGDNFLVSTYVVYDLDNMEISMAHADFSDGGEYIDTI 482
            +T    + C+L I P SD   +LGD FLV TYVVYDL++ E+S+A A F++  E I+ I
Sbjct: 232 -VTPLTKDHCVLQILP-SDTVSVLGDAFLVDTYVVYDLESHEVSVAQASFNNEEEDIEII 289

Query: 483 KDSVPSALKAPGYSSTWSTYESIVPGG 509
            DSVP A  APGYSSTW       PGG
Sbjct: 290 SDSVPGATPAPGYSSTW----VYTPGG 312

>Smik_9.175 Chr9 (296875..298656) [1782 bp, 593 aa] {ON} YIL015W
           (REAL)
          Length = 593

 Score =  234 bits (598), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 147/400 (36%), Positives = 217/400 (54%), Gaps = 47/400 (11%)

Query: 77  QNSFYSVELDIGTPPQKVTVLVDTGSSDLWVTGSDNPYCFTEGEDTSGSSFKHVNKDNLV 136
           ++ +Y+  LDIGTP Q++TVL DTGS+D W+  S NP+C                   L 
Sbjct: 41  EDMYYATTLDIGTPSQQLTVLFDTGSADFWIMDSSNPFC-------------------LS 81

Query: 137 SVVESVFTEISYDTTMVTSVATATIGNTASTSQAMNCTTYGTFDTSKSSTFES-NKTEFS 195
           +   S +   +YD +++T               +++C +  T+    SST+++ +   F 
Sbjct: 82  TSSTSSYLNATYDGSIIT--------------PSVDCQSMVTYSEGNSSTYQNLDNGRFY 127

Query: 196 ITYGDSTFASGTWGHDRLSLNNLNVTGLSFAVANETNSTV-GVLGIGLPGLEST--YSGV 252
           I Y D TFA GTWG + +S++ + +  + F +A    + V GVLGIG P  ES   Y G 
Sbjct: 128 IIYADGTFADGTWGTETVSIDGIVIPNIQFGLAKYATTPVSGVLGIGFPRRESVKGYEG- 186

Query: 253 SLSSAQKSYTYNNFPMILKNSGAIKSTAYSLFTNHSDSKHGTILFGAVDHGKYAGDLYTI 312
               A   Y Y NFP ILK+   I   AYSLF N  +S  G+I+FGA+D  K++GDL+T 
Sbjct: 187 ----APNKY-YPNFPQILKSEQIIDVVAYSLFLNSPESGTGSIIFGAIDESKFSGDLFTF 241

Query: 313 PIINTLQNRGYKDPIQFQVTLQGIGVSHGERDENMTTLTTTKIPVLLDSGTTISYMPADL 372
           P++N   N     P    +T+QG+G  +    E   T  TTK PVLLDSGT++   P  +
Sbjct: 242 PMVNEYPNI-VDTPATLAMTIQGLGAQNKNSCE-YETFMTTKYPVLLDSGTSLLNAPKVI 299

Query: 373 VEMIASEVGATYSPDYGYYIMDCINEMEEESSLIFDFGGFYIANWLSNFQLLTDSRSNVC 432
            + +AS V ATYS + G YI+DC     +E    FDFG   I+  L++  L  ++    C
Sbjct: 300 ADKMASFVNATYSAEEGIYILDC-PAFADEIEYTFDFGDLKISVPLTSLILSPEAEGGYC 358

Query: 433 ILGIAPQSDPAIILGDNFLVSTYVVYDLDNMEISMAHADF 472
              + P +D +++LGD FL S YVV+DLDN +IS+A A++
Sbjct: 359 GFAVQPTND-SMVLGDVFLSSAYVVFDLDNYKISLAQANW 397

>Smik_65.1 Chr65 (2..1027) [1026 bp, 342 aa] {ON} YIR039C (REAL)
          Length = 342

 Score =  227 bits (578), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 134/312 (42%), Positives = 178/312 (57%), Gaps = 14/312 (4%)

Query: 190 NKTEFSITYGDSTFASGTWGHDRLSLNNLNVTGLSFAVANETNSTVGVLGIGLPGLESTY 249
           N T+F  TYGD T+  GT+G D +SL N+ +   SF VAN T +  G+LGI LP  E+T+
Sbjct: 1   NDTQFDETYGDGTYYRGTYGTDVVSLGNITLESFSFGVANNTENQGGILGISLPAGENTH 60

Query: 250 SGVSLSSAQKS--YTYNNFPMILKNSGAIKSTAYSLFTNHSDSKHGTILFGAVDHGKYAG 307
           S   L  A  +  + Y NFPM LK+ G I+  AYSLF N   +  G+ILFGAVD  KY+G
Sbjct: 61  S---LGGAYNTTPFEYENFPMALKSHGKIEKIAYSLFLNEPKAHFGSILFGAVDKSKYSG 117

Query: 308 DLYTIPIINTLQNRGYKDPIQFQVTLQGIGVSHGERDENMTTLTTTKIPVLLDSGTTISY 367
            LYT+P++          P  F VT Q + V +G  D    T++  + PVL DSGTT S 
Sbjct: 118 QLYTLPMLQAYDTLDSVSPGMF-VTAQSVAVLNG--DSGNKTVSKVRFPVLFDSGTTYSS 174

Query: 368 MPADLVEMIASEVGATYSPDYGYYIMDCINEMEEESSLIFDFGGFYIANWLSNFQLLTDS 427
           +P ++   I       YS     Y  DC     +++ L  DFGGF I+  +SNF   T  
Sbjct: 175 LPTEVAHAIGKSFDGKYSSGDQGYTFDC--SKVKDTLLSIDFGGFNISANISNFVTRTKD 232

Query: 428 RSNVCILGIAPQSDPAIILGDNFLVSTYVVYDLDNMEISMAHADFSDGGEYIDTIKDSVP 487
               C+L I   +D   +LGD FLV  YVV+DL++ E+S+A A F D  E I+ I D VP
Sbjct: 233 H---CLLNIE-AADSGFVLGDAFLVDAYVVFDLESHEVSIAQASFDDKKEEIEVISDRVP 288

Query: 488 SALKAPGYSSTW 499
            A++APGYSSTW
Sbjct: 289 GAIRAPGYSSTW 300

>Skud_9.154 Chr9 (291885..293435) [1551 bp, 516 aa] {ON} YIL015W
           (REAL)
          Length = 516

 Score =  231 bits (588), Expect = 5e-68,   Method: Compositional matrix adjust.
 Identities = 154/442 (34%), Positives = 231/442 (52%), Gaps = 53/442 (11%)

Query: 70  ELVELTNQNSFYSVELDIGTPPQKVTVLVDTGSSDLWVTGSDNPYCFTEGEDTSGSSFKH 129
           EL     +  +Y+  LDIGTP Q++TVL DTGS+D WV  S NP+C  +           
Sbjct: 34  ELSLQREEQMYYATTLDIGTPSQQLTVLFDTGSADFWVMDSSNPFCSPKSN--------- 84

Query: 130 VNKDNLVSVVESVFTEISYDTTMVTSVATATIGNTASTSQAMNCTTYGTFDTSKSSTFES 189
                      S++   +Y+ + +T               +++C++  T++ + SST++ 
Sbjct: 85  ----------PSLYQNATYNGSKIT--------------PSVDCSSMSTYNENSSSTYQD 120

Query: 190 -NKTEFSITYGDSTFASGTWGHDRLSLNNLNVTGLSFAVANETNSTV-GVLGIGLPGLES 247
            +   F I Y D TF+ G+WG + +S+N +++  + F +A    + V GVLGIG P  ES
Sbjct: 121 LDNGRFYIIYADETFSDGSWGKETVSVNGIDIPDIQFGLAKYATTPVSGVLGIGFPRRES 180

Query: 248 T--YSGVSLSSAQKSYTYNNFPMILKNSGAIKSTAYSLFTNHSDSKHGTILFGAVDHGKY 305
              Y G     A   Y Y NFP +LK+   I   AYSLF N  DS  G+I+FGA+D  K+
Sbjct: 181 VKGYEG-----APDKY-YPNFPQLLKSEQIIDVVAYSLFLNSPDSGMGSIVFGAIDESKF 234

Query: 306 AGDLYTIPIINTLQNRGYKDPIQFQVTLQGIGVSHGERDENMTTLTTTKIPVLLDSGTTI 365
            GDL T P++N         P    +T+QG+G  +    E   T  TTK PVLLDSGT++
Sbjct: 235 YGDLLTFPMVNEYPTI-VDAPATLAMTIQGLGAQNKSGCER-ETFMTTKYPVLLDSGTSL 292

Query: 366 SYMPADLVEMIASEVGATYSPDYGYYIMDCINEMEEESSLIFDFGGFYIANWLSNFQLLT 425
              P  + + +AS V A+YS D G YI++C +   ++    FDFG   I   L++  L  
Sbjct: 293 LNAPKTIADKMASFVNASYSADEGIYILNCPDS-ADDIEYTFDFGDLQINVPLTSLILSP 351

Query: 426 DSRSNVCILGIAPQSDPAIILGDNFLVSTYVVYDLDNMEISMAHADFS---DGGEYIDTI 482
           +     C   + P +D +++LGD FL S YVV+DLDN +IS+A A+++   D  + I+  
Sbjct: 352 EVEGGYCGFAVQPTND-SMVLGDVFLSSAYVVFDLDNYKISLAQANWNASEDSKQVINIP 410

Query: 483 KD-SVPSALKAPGYSSTWSTYE 503
            D S+P    A   +  WST E
Sbjct: 411 TDGSIPGGKSA--TAEPWSTNE 430

>KNAG0H02760 Chr8 (507659..509350) [1692 bp, 563 aa] {ON} Anc_7.182
           YIL015W
          Length = 563

 Score =  231 bits (590), Expect = 9e-68,   Method: Compositional matrix adjust.
 Identities = 154/448 (34%), Positives = 226/448 (50%), Gaps = 66/448 (14%)

Query: 79  SFYSVELDIGTPPQKVTVLVDTGSSDLWVTGSDNPYCFTEGEDTSGSSFKHVNKDNLVSV 138
           SFY+  L IG PPQ++TV+ D+GS+D WV    NP+C +                     
Sbjct: 55  SFYATTLKIGDPPQEITVIFDSGSADTWVMSRYNPFCLS--------------------- 93

Query: 139 VESVFTEISYDTTMVTSVATATIGNTASTSQAMNCTTYGTFDTSKSSTF-ESNKTEFSIT 197
                      ++ +T+    T+ +  +    ++C+   T++ ++S++F E N   F I 
Sbjct: 94  -----------SSNITANGLKTLYDGKAIIPKVDCSQIKTYNANRSTSFQELNNGRFYII 142

Query: 198 YGDSTFASGTWGHDRLSLNNLNVTGLSFAVANETNSTV-GVLGIGLPGLESTYSGVSLSS 256
           YGD TFA G WG +      + +  + F +A+   + + GVLGIG    ES         
Sbjct: 143 YGDKTFADGIWGTETFEFGGVKIPNVQFGLADYATTPIGGVLGIGFQRRESV-------- 194

Query: 257 AQKSYT------YNNFPMILKNSGAIKSTAYSLFTNHSDSKHGTILFGAVDHGKYAGDLY 310
             K YT      Y NFP +LKN G I + AYSL  +   S H  I+FGA+D   Y GD+ 
Sbjct: 195 --KGYTNAPEVFYPNFPQVLKNEGIIDTVAYSL--SLGQSSH--IMFGAIDRNSYIGDMV 248

Query: 311 TIPIINTLQNRGYKDPIQFQVTLQGIGVSHGERDENMTTLTTTKIPVLLDSGTTISYMPA 370
           T P+IN   N   K P    +T+QG+G +  +++    T +TTK P LLDSG+T+   P 
Sbjct: 249 TFPMINMFPNAVSK-PATLSITIQGLG-AQNKQECKFQTFSTTKYPALLDSGSTLISAPV 306

Query: 371 DLVEMIASEVGATYSPDYGYYIMDCINEMEEESSLIFDFGGFYIANWLSNFQLLTDSRSN 430
           ++ + +A+ +GA +S   G Y ++C N+       IFDFG       LSN  L +   SN
Sbjct: 307 EIADKMAAFIGAQWSESDGIYTLECPNDT-TNIDYIFDFGDMKFTLPLSNLILPSQGGSN 365

Query: 431 VCILGIAPQSDPAIILGDNFLVSTYVVYDLDNMEISMAHADFSDGGEYIDTIKDSVPSAL 490
           VC  G+  +SD  I+LGD FL ST VV+DLD+ +IS+A ++     E I  I    PS  
Sbjct: 366 VCGFGLQ-RSDNEIVLGDVFLCSTLVVFDLDHYQISLAKSNQKSSAEDIVNI----PSDG 420

Query: 491 KAPG----YSSTWSTYESIVPGGNMFPT 514
           K PG     +  W+TYE I    +MF T
Sbjct: 421 KIPGAIIAKAEAWTTYEPITATTDMFET 448

>SAKL0E15356g Chr5 (1283552..1285225) [1674 bp, 557 aa] {ON} weakly
           similar to uniprot|P12630 Saccharomyces cerevisiae
           YIL015W BAR1 Aspartyl protease secreted into the
           periplasmic space of mating type a cells, cleaves and
           inactivates alpha factor allowing cells to recover from
           alpha-factor-induced cell cycle arrest and to YLR121C
           uniprot|Q12303 Saccharomyces cerevisiae YLR121C YPS3
           Aspartic protease, attached to the plasma membrane via a
           glycosylphosphatidylinositol (GPI) anchor and to YLR120C
           uniprot|P32329 Saccharomyces cerevisiae YLR120C YPS1
           Aspartic protease, attached to the plasma membrane via a
           glycosylphosphatidylinositol (GPI) anchor and to YDR144C
           uniprot|P53379 Saccharomyces cerevisiae YDR144C MKC7
           GPI- anchored aspartyl protease (yapsin) involved in
           protein processing; shares functions with Yap3p and
           Kex2p and to YIR039C uniprot|P40583 Saccharomyces
           cerevisiae YIR039C YPS6 Putative GPI-anchored aspartic
           protease, member on vGLC.1466.
          Length = 557

 Score =  227 bits (578), Expect = 4e-66,   Method: Compositional matrix adjust.
 Identities = 152/468 (32%), Positives = 234/468 (50%), Gaps = 61/468 (13%)

Query: 61  RLVTRGDDYELVELTNQ--NSFYSVELDIGTPPQKVTVLVDTGSSDLWVTGSDNPYCFTE 118
           + + R      ++L N+  +   +V + IG   Q +  + DTG SD WV G ++ YC   
Sbjct: 81  KFIKRDGSARELDLYNRAYSGLLNVIISIGKEGQNMFFVADTGLSDTWVVGQNSVYC--- 137

Query: 119 GEDTSGSSFKHVNKDNLVSVVESVFTEISYDTTMVTSVATATIGNTASTSQAMNCTTYGT 178
                                     +I   TT     A  +    A  + A  C     
Sbjct: 138 --------------------------DIENGTTPANHTANFSENTFAFKNHAFPCYLADV 171

Query: 179 FDTSKSSTFESNKTEFSITYGDSTFASGTWGHDRLSLNNLNVTGLSFAVANETNSTVGVL 238
           F+ + S++  SN T+F   + D TFASGTW  D + + ++ +   +F VA ETN+T+G L
Sbjct: 172 FEVNYSTSIVSNNTDFFTQFYDYTFASGTWYQDTIEVGSIIIEKFNFGVAQETNATIGSL 231

Query: 239 GIGLPGLESTYSGVSLSSAQKSYTYNNFPMILKNSGAIKSTAYSLFTNHSDSKHGTILFG 298
           G+GL G E T  G        +YTY NFP  LKNSG IK   YS++    D++ G++LFG
Sbjct: 232 GLGLEGNEITNEG------DYTYTYENFPTKLKNSGMIKRVIYSIYAGKIDTEDGSLLFG 285

Query: 299 AVDHGKYAGD-LYTIPIINTLQNRGYKDPIQFQVTLQGIGVSHGERDENMTTLTTTKIPV 357
           AV+H +Y GD LYT+P++N   N    DP++F VTLQ + VS  + +   TT+ + +   
Sbjct: 286 AVEHSRYVGDTLYTLPLVNV--NNASSDPVEFHVTLQNLVVSVNKTN---TTIMSDRYAA 340

Query: 358 LLDSGTTISYMPADLVEMIASEVGATYSPD-YGYYIMDCINEMEEESSLIFDFGGFYIAN 416
           LL++G  ++Y+P  L      + G + S   YG Y+ DC +E+    S  +DFGGF I +
Sbjct: 341 LLNTGAIVTYLPTHLFSDFIKKTGLSESQKYYGMYVTDCSSEI----SFSYDFGGFKIES 396

Query: 417 WLSNFQLLTDSRS---NVCILGIAPQSDPAIILGDNFLVSTYVVYDLDNMEISMAH-ADF 472
            L+++    D        C + I    +  ++LG  F  S YVV+DL+ +E+S+A  A  
Sbjct: 397 SLNDYLFEIDESEIPGAKCAVTINSHDEKYLVLGSGFFSSAYVVFDLERLEVSIAQAAHV 456

Query: 473 SDGGEY--------IDTIKDSVPSALKAPGYSSTWSTYESIVPGGNMF 512
            D   Y        ++ + DS+PSA KA  YS+TW T++     GN +
Sbjct: 457 YDNFTYSNIEDNPDVEIVIDSIPSATKAASYSNTW-TFDRAPENGNSY 503

>NDAI0B01720 Chr2 complement(409125..410768) [1644 bp, 547 aa] {ON}
           Anc_7.182
          Length = 547

 Score =  224 bits (571), Expect = 3e-65,   Method: Compositional matrix adjust.
 Identities = 150/442 (33%), Positives = 226/442 (51%), Gaps = 54/442 (12%)

Query: 77  QNSFYSVELDIGTPPQKVTVLVDTGSSDLWVTGSDNPYCFTEGEDTSGSSFKHVNKDNLV 136
           Q ++Y+  L +GTPPQ +TVL+D+GSSD W+  S NP+C    E+   S           
Sbjct: 52  QQTYYATTLQVGTPPQNITVLLDSGSSDFWLMDSKNPFCM---ENYCNS----------- 97

Query: 137 SVVESVFTEI-SYDTTMVTSVATATIGNTASTSQAMNCTTYGTFDTSKSSTFE---SNKT 192
                  TEI  Y+  ++T   T            ++C+ +  ++   SST++   ++ +
Sbjct: 98  -------TEIPKYNNDLITQNLT------------IDCSYFNKYNPEISSTYQKLPNDNS 138

Query: 193 EFSITYGDSTFASGTWGHDRLSLNNLNVTGLSFAVANETNSTV-GVLGIGLPGLEST--Y 249
            F + Y D +F  G W  + + ++N N+T L  AVAN   + V G+LGI  P  ES   Y
Sbjct: 139 RFYLQYTDGSFEDGIWSKETVQIDNYNITSLQLAVANYATTPVGGLLGISFPRRESVKGY 198

Query: 250 SGVSLSSAQKSYTYNNFPMILKNSGAIKSTAYSLFTNHSDSKHGTILFGAVDHGKYAGDL 309
            G     A   Y Y NFP +LKN   I    YS++ N  + + G++LFGA+D  K+ GD+
Sbjct: 199 DG-----ALNEY-YPNFPQVLKNENIIDIVLYSMYLNDLN-QDGSLLFGAIDTSKFEGDM 251

Query: 310 YTIPIINTLQNRGYKDPIQFQVTLQGIGVSHGERDENMTTLTTTKIPVLLDSGTTISYMP 369
            T P++N   N   K P    +T+QG+   +        T  T+K PVLLDSGTT+   P
Sbjct: 252 ITYPMVNVYPNVVDK-PATLALTIQGVAAQNTNDCTQNETFMTSKFPVLLDSGTTLMSAP 310

Query: 370 ADLVEMIASEVGATYSPDYGYYIMDCI-NEMEEESSLIFDFGGFYIANWLSNFQLLTDSR 428
            +L + +A  V ATYS D   YI++C   E+  +   IFDFGG  +   L  F L +D  
Sbjct: 311 KELADKMADFVNATYSEDDRIYILNCPSQEVLNDIEYIFDFGGLQVKIPLEKFILPSDDG 370

Query: 429 SNVCILGIAPQSDP-AIILGDNFLVSTYVVYDLDNMEISMAHADFSDGGEYIDTIKDSVP 487
           S  C  G+ P++    ++LGD FL   Y V+DLD+ +IS+A+ + +   E  +    ++P
Sbjct: 371 SGPCAFGVLPETTTDRMVLGDIFLSFVYAVFDLDHYQISLANINKNANSESNEDSIINIP 430

Query: 488 SALKAPGYS----STWSTYESI 505
           S    PG        WST+E I
Sbjct: 431 SNGAIPGAKVATVKPWSTHEPI 452

>ZYRO0D15554g Chr4 complement(1298587..1300152) [1566 bp, 521 aa]
           {ON} weakly similar to uniprot|P12630 Saccharomyces
           cerevisiae YIL015W BAR1 Aspartyl protease secreted into
           the periplasmic space of mating type a cells, cleaves
           and inactivates alpha factor allowing cells to recover
           from alpha-factor-induced cell cycle arrest and to
           YLR121C uniprot|Q12303 Saccharomyces cerevisiae YLR121C
           YPS3 Aspartic protease, attached to the plasma membrane
           via a glycosylphosphatidylinositol (GPI) anchor and to
           YLR120C uniprot|P32329 Saccharomyces cerevisiae YLR120C
           YPS1 Aspartic protease, attached to the plasma membrane
           via a glycosylphosphatidylinositol (GPI) anchor and to
           YDR144C uniprot|P53379 Saccharomyces cerevisiae YDR144C
           MKC7 GPI- anchored aspartyl protease (yapsin) involved
           in protein processing; shares functions with Yap3p and
           Kex2p and to YIR039C uniprot|P40583 Saccharomyces
           cerevisiae YIR039C YPS6 Putative GPI-anchored aspartic
           protease, member on vGLC.1466.
          Length = 521

 Score =  214 bits (545), Expect = 9e-62,   Method: Compositional matrix adjust.
 Identities = 149/446 (33%), Positives = 222/446 (49%), Gaps = 57/446 (12%)

Query: 78  NSFYSVELDIGTPPQKVTVLVDTGSSDLWVTGSDNPYCFTEGEDTSGSSFKHVNKDNLVS 137
           + FYS  L+IG+P QK+ ++VD+GS+D WV  S NP+C +  +  +  ++ +        
Sbjct: 44  DEFYSTTLEIGSPAQKLDLVVDSGSADTWVMASTNPFCSSNAKSGASKNYTY-------- 95

Query: 138 VVESVFTEISYDTTMVTSVATATIGNTASTSQAMNCTTYGTFDTSKSSTFES-NKTEFSI 196
                                    N  + ++ ++C      D + SS F   N   F I
Sbjct: 96  -------------------------NGKAITETIDCQGLTALDVNSSSQFRDLNVGRFYI 130

Query: 197 TYGDSTFASGTWGHDRLSLNNLNVTGLSFAVANETNSTV-GVLGIGLPGLEST--YSGVS 253
            Y D +F  G W  D +S    +++GL F VA   +  + G+LG+G P  ES   Y G  
Sbjct: 131 NYTDGSFDDGYWATDEVSAAGAHISGLQFGVAQYASEEIPGILGLGFPRRESVRGYPGA- 189

Query: 254 LSSAQKSYTYNNFPMILKNSGAIKSTAYSLFTNHSD-SKHGTILFGAVDHGKYAGDLYTI 312
                 +  Y+NFP +LK  G I   AYS++ N  + S  G++LFG VD  KY+GDLYT 
Sbjct: 190 -----PNKFYDNFPQMLKKDGIIDVVAYSMYLNDPNGSGGGSVLFGGVDPSKYSGDLYTF 244

Query: 313 PIINTLQNRGYKDPIQFQVTLQGIGVSHGERDENMTTLTTTKIPVLLDSGTTISYMPADL 372
           P+ N   N   K P    VTLQG G +  + +    T  T    VLLDSGT++   P ++
Sbjct: 245 PMANQYPNIVSK-PATLAVTLQGFG-AQKKSEGRQETFDTNNYAVLLDSGTSLMGAPEEV 302

Query: 373 VEMIASEV--GATYSPDYGYYIMDCINEMEEESSLIFDFGGFYIANWLSNFQLLTDSRSN 430
           V  +A  +   A +S D G Y+MDC  + ++++  +FDFG   IA  +S   +L  S  +
Sbjct: 303 VSKMAHFINKNARFSEDDGIYVMDCPPK-DDDTEFVFDFGDLQIAVPVSTL-ILPPSGES 360

Query: 431 VCILGIAPQSDPAIILGDNFLVSTYVVYDLDNMEISMAHADFSDGGEYIDTIK----DSV 486
            C LG+ P+ D    LGD FL   Y+V+DLDN ++SMA A FS  G+    IK     ++
Sbjct: 361 YCGLGVLPK-DGTWTLGDVFLSYAYLVFDLDNYKVSMAKAKFSGDGDQSPQIKIQTDGTI 419

Query: 487 PSALKAPGYSSTWSTYESIVPGGNMF 512
           P A  A   +  WS+ E     G++F
Sbjct: 420 PGAKSAS--AKPWSSSEPSTVSGSIF 443

>CAGL0J02288g Chr10 complement(223820..225445) [1626 bp, 541 aa]
           {ON} similar to uniprot|P12630 Saccharomyces cerevisiae
           YIL015w BAR1
          Length = 541

 Score =  206 bits (523), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 141/395 (35%), Positives = 208/395 (52%), Gaps = 57/395 (14%)

Query: 78  NSFYSVELDIGTPPQKVTVLVDTGSSDLWVTGSDNPYCFTEGEDTSGSSFKHVNKDNLVS 137
           N +Y   L+ GTPPQ + +++DTGSSDLWVT   NP C+ +G   SG   K +       
Sbjct: 50  NLYYESVLEFGTPPQSIPLVLDTGSSDLWVTLIGNPLCYNKG---SGKPPKCL------- 99

Query: 138 VVESVFTEISYDTTMVTSVATATIGNTASTSQAMNCTTYGTFDTSKSSTFESNK-TEFSI 196
                                            ++C+    +D  KS TF+  K   F I
Sbjct: 100 ---------------------------------IDCSGLVFYDMDKSQTFDYLKNVTFKI 126

Query: 197 TYGDSTFASGTWGHDRLSLNNLNVTGLSFAVANETNSTV-GVLGIGLPGLESTYSGVSLS 255
            Y D+T+ SG W  D ++L   ++  L F +A  TN+T  GVLGIG P +ES  +G   +
Sbjct: 127 GYADTTYTSGIWIVDIITLPEGHLKDLQFGMAFATNATFSGVLGIGFPAMESV-NGYEFA 185

Query: 256 SAQKSYTYNNFPMILKNSGAIKSTAYSLFTNHSDSKHGTILFGAVDHGKYAGDLYTIPII 315
             +    Y NFP+ LKN+G     AYS+  N  +SK G+ILFG++D  ++ G LYT P+I
Sbjct: 186 PGK---FYPNFPLALKNAGFTNIAAYSIEYN-DESKKGSILFGSIDTSRFIGPLYTFPMI 241

Query: 316 NTLQNRGYKDPIQFQVTLQGIGVSHGERDENMTTLTTTKIPVLLDSGTTISYMPADLVEM 375
           N        +P    +TL GIG+  G  ++    ++ TK+P LLD+G+T+  +P  + + 
Sbjct: 242 NEFPGIA-DEPSTLSLTLDGIGID-GSCEQ--WVISNTKLPALLDTGSTLIELPHPITQS 297

Query: 376 IASEVGATYSPDYGYYIMDCI-NEMEEESSLIFDFGGFYIANWLSNFQLLTDSRSN-VCI 433
           IAS + AT+S D+G +++ C  ++    + L F FG  ++   L +F LL D  SN +C 
Sbjct: 298 IASYLNATWSDDHGLFVLACPSDDFLTTTDLAFTFGELHMKIPLRSFILLPDEESNGLCG 357

Query: 434 LGIAPQSDPAIILGDNFLVSTYVVYDLDNMEISMA 468
           LGI   S   +ILGD+FL   Y V+DLDN  IS+A
Sbjct: 358 LGIT-SSKGRVILGDSFLTHVYTVFDLDNYMISLA 391

>TDEL0H02650 Chr8 (445052..446710) [1659 bp, 552 aa] {ON} Anc_7.182
           YIL015W
          Length = 552

 Score =  202 bits (513), Expect = 8e-57,   Method: Compositional matrix adjust.
 Identities = 164/442 (37%), Positives = 230/442 (52%), Gaps = 58/442 (13%)

Query: 80  FYSVELDIGTPPQKVTVLVDTGSSDLWVTGSDNPYCF-TEGEDTSGSSFKHVNKDNLVSV 138
           +YS  L+IGT  Q++ VL D+GSSD+WV+ S NPYC  +EG         +VN+      
Sbjct: 67  YYSAILEIGTSHQELPVLFDSGSSDMWVSSSSNPYCLESEG---------YVNQ------ 111

Query: 139 VESVFTEISYDTTMVTSVATATIGNTASTSQAMNCTTYGTFDTSKSSTFES-NKTEFSIT 197
                   +Y+   VT                ++C   GTFD + SS+FE  +   F I 
Sbjct: 112 --------TYNGETVTPF--------------IDCKALGTFDYNGSSSFERLDIGRFYIK 149

Query: 198 YGDSTFASGTWGHDRLSLNNLNVTGLSFAVANETNSTVG-VLGIGLPGLESTYSGVSLSS 256
           Y D +FA G W  ++L LN ++++ L F VA+     VG VLGIG P  ES         
Sbjct: 150 YSDESFADGFWAKEKLRLNGIDISTLQFGVADYATVPVGGVLGIGFPRRESV---KGYDD 206

Query: 257 AQKSYTYNNFPMILKNSGAIKSTAYSLFTNHSDSKHGTILFGAVDHGKYAGDLYTIPIIN 316
           A   + Y NFP +LKN G I   AYS+F N   S  G+ILFGAVD  KY G LYT P++N
Sbjct: 207 APNEF-YPNFPQVLKNEGVIGVAAYSMFLNEVSSDAGSILFGAVDPTKYTGSLYTFPMVN 265

Query: 317 TLQNRGYKDPIQFQVTLQGIGVSHGERDENMTTLTTTKIPVLLDSGTTISYMPADLVEMI 376
              N   K P    +TLQ +G +  +      T TTTK  VLLDSGTT+   P ++ E +
Sbjct: 266 EYPNVVDK-PATLAMTLQALG-AKSDSSCKYKTFTTTKQAVLLDSGTTLMTAPPEIAEEM 323

Query: 377 ASEV-GATYSPDYGYYIMDCINEMEEESSLIFDFGGFYIANWLSNFQLLTDSRSNVCILG 435
           A    G TY+   G +  DC ++ ++++  IFDFG   I   L++  +++ S    C  G
Sbjct: 324 AFFCWGPTYNESEGIFYFDCPSD-DDDTEFIFDFGDLKITLPLASL-VISSSGDGHCGFG 381

Query: 436 IAPQSDPAIILGDNFLVSTYVVYDLDNMEISMAHADFSDGGE----YIDTIKD-SVPSAL 490
           + P S  ++ LG  FL S YVVYDLDN +IS+A A + DG       +   KD ++  A 
Sbjct: 382 LTPASY-SMTLGAIFLSSAYVVYDLDNYQISIAQAKW-DGNPSQKSRVRIPKDGTIYGAT 439

Query: 491 KAPGYSSTWSTYESIVPGGNMF 512
           KA   ++ W+T E +    +MF
Sbjct: 440 KAT--ATPWTTDEPVKVDYDMF 459

>AGR240W Chr7 (1200736..1202094) [1359 bp, 452 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YIL015W (BAR1)
          Length = 452

 Score =  191 bits (486), Expect = 6e-54,   Method: Compositional matrix adjust.
 Identities = 135/436 (30%), Positives = 205/436 (47%), Gaps = 59/436 (13%)

Query: 66  GDDYELVELTNQNSFYSVELDIGTPPQKVTVLVDTGSSDLWVTGSDNPYCF---TEGEDT 122
           GD +  + L + +  Y +E+++GTPPQK+  ++DTGS+DLW+   +NP+C     E ++ 
Sbjct: 31  GDGFLAMPLHHNDDHYDIEIEVGTPPQKLHAVLDTGSADLWLQAENNPFCVGAKDEKQEV 90

Query: 123 SGSSFKHVNKDNLVSVVESVFTEISYDTTMVTSVATATIGNTASTSQAMNCTTYGTFDTS 182
            G           V+V  S+                             +C    TF   
Sbjct: 91  RG-----------VTVTPSI-----------------------------DCRGIKTFCNE 110

Query: 183 KSSTFESNKTEFSITYGDSTFASGTWGHDRLSLNNLNVTGLSFAVANETNSTV-GVLGIG 241
            S+T       F I Y D TF  G+W  DRL +   +V+G+ F V   +N+ + GVLG+G
Sbjct: 111 SSTTLRILPNPFYIDYAD-TFVDGSWATDRLVIGGHDVSGMKFGVGRTSNTELSGVLGVG 169

Query: 242 LPGLEST--YSGVSLSSAQKSYTYNNFPMILKNSGAIKSTAYSLFTNHSDSKHGTILFGA 299
              LES   Y+G        + TY N P  LK  G+++  AYS+    +  + G ILFGA
Sbjct: 170 HANLESVRGYAGA------PNATYPNLPRQLKLDGSVQKLAYSVSLQKTSERDGEILFGA 223

Query: 300 VDHGKYAGDLYTIPIINTLQNRGYKDPIQFQVTLQGIGVSHGERDENMTTLTTTKIPVLL 359
           +D  KY G L+T PI+N   +     P  F + LQGI +  G R      L  +    LL
Sbjct: 224 IDTSKYVGKLHTFPILNI--DPHLNSPSNFYIALQGIDI-QGGRSSTGRPLINSSFHALL 280

Query: 360 DSGTTISYMPADLVEMIASEVGATYSPDYGYYIMDCINEMEEESSLIFDFGGFYIANWLS 419
           D+GT    + + L E I + + ATY  +   +++ C  E ++     F+FG   IA  +S
Sbjct: 281 DTGTG-GMVVSSLAEDIGAALNATYDTEQCVFVIQCPTE-DDTRQFNFNFGELQIAVPIS 338

Query: 420 NFQLLTDS-RSNVCILGIAPQSDPAIILGDNFLVSTYVVYDLDNMEISMAHADFSDGGEY 478
           NF +      +  C L I P +     LG  FL   Y V++L++ EISMA A+ +     
Sbjct: 339 NFVVPASGLETGQCALAIMPGTSETFALGIPFLKEVYTVFNLEDNEISMARANTNPQEPD 398

Query: 479 IDTIKDSVPSALKAPG 494
           I  I   VP+A++  G
Sbjct: 399 IRPIPAGVPAAIRDSG 414

>SAKL0H00330g Chr8 complement(40564..42300) [1737 bp, 578 aa] {ON}
           weakly similar to uniprot|P12630 Saccharomyces
           cerevisiae YIL015W BAR1 Aspartyl protease secreted into
           the periplasmic space of mating type a cells, cleaves
           and inactivates alpha factor allowing cells to recover
           from alpha-factor-induced cell cycle arrest and to
           YLR121C uniprot|Q12303 Saccharomyces cerevisiae YLR121C
           YPS3 Aspartic protease, attached to the plasma membrane
           via a glycosylphosphatidylinositol (GPI) anchor and to
           YLR120C uniprot|P32329 Saccharomyces cerevisiae YLR120C
           YPS1 Aspartic protease, attached to the plasma membrane
           via a glycosylphosphatidylinositol (GPI) anchor and to
           YDR144C uniprot|P53379 Saccharomyces cerevisiae YDR144C
           MKC7 GPI- anchored aspartyl protease (yapsin) involved
           in protein processing; shares functions with Yap3p and
           Kex2p and to YIR039C uniprot|P40583 Saccharomyces
           cerevisiae YIR039C YPS6 Putative GPI-anchored aspartic
           protease, member on vGLC.1466.
          Length = 578

 Score =  183 bits (464), Expect = 9e-50,   Method: Compositional matrix adjust.
 Identities = 133/427 (31%), Positives = 214/427 (50%), Gaps = 64/427 (14%)

Query: 87  IGTPPQKVTVLVDTGSSDLWVTGSDNPYCFTEGEDTSGSSFKHVNKDNLVSVVESVFTEI 146
           +GTP Q +  L+DT SSD+W+  S++ +C +E                            
Sbjct: 84  VGTPSQAIRFLLDTDSSDIWLLNSNSTFCESEN--------------------------- 116

Query: 147 SYDTTMVTSVATATIGN-TASTSQAMNCTTYGTFDTSKSSTFESNKTEFSITYGDSTFAS 205
              T  + S + +T+ N TAS S A  C     F    SS+F  N  +F + Y D ++A+
Sbjct: 117 --GTVNIDSNSNSTLANETASRSDAYQCKLVNVFYPEDSSSFVLNDLDFHVQYDDYSYAN 174

Query: 206 GTWGHDRLSLNNLNVTGLSFAVANETNSTVGVLGIGLPGLESTYSGVSLSSAQKSYTYNN 265
           GTW  D  S    +   ++ A+ +ETN TVG LG+GL   ++T  G         + YN+
Sbjct: 175 GTWSQDTFSFGYPSFYNVNIALVSETNLTVGSLGLGLRANQATNQG------DDPFVYNS 228

Query: 266 FPMILKNSGAIKSTAYSLFTNHSDSKHGTILFGAVDHGKYAGD-LYTIPIINTLQNRGYK 324
               LK  G I+  AYS++T+  +   G I FG + H  Y G+ LYT+P++N   +    
Sbjct: 229 LLYRLKTQGWIEKIAYSVYTSELNGTGGGIFFGGLYHDLYKGNVLYTLPLVNV--DPELD 286

Query: 325 DPIQFQVTLQGIGVSHGERDENMTTLTTTKIPVLLDSGTTISYMPADLVEMIASEV---- 380
           +P +F +TLQ +  S      N + L + K P LL +G+  +Y+P +L +    E+    
Sbjct: 287 EPARFHITLQNLTTSIN--GTNFSVL-SEKYPALLSTGSMFTYLPEELFDSFVDEMDLEK 343

Query: 381 GATYSPDYGYYIMDCINEMEEESSLIFDFGGFYIANWLSNFQLLTDSRS---NVCILGIA 437
           GA +      Y++ C    +  ++ I+DFGGF I   LS +    +S     ++C + + 
Sbjct: 344 GAKHK---DLYVIPC----DTNATFIYDFGGFEIETPLSGYTFKVESNRTADDMCAVMVK 396

Query: 438 PQSDPAIILGDNFLVSTYVVYDLDNMEISMAHADFSDGGEYIDT-----IKDSVPSALKA 492
           P +   + LG+ F  +TYV+++L+++EISMA A    G EY+D      I+ S+PSA +A
Sbjct: 397 PHNKSYLTLGNGFFAATYVLFNLEDLEISMAPA---SGIEYLDAFDYEYIESSIPSASRA 453

Query: 493 PGYSSTW 499
             YS+TW
Sbjct: 454 ASYSNTW 460

>Smik_5.7 Chr5 (4489..5403) [915 bp, 304 aa] {ON} YIR039C (REAL)
          Length = 304

 Score =  169 bits (427), Expect = 5e-47,   Method: Compositional matrix adjust.
 Identities = 98/232 (42%), Positives = 130/232 (56%), Gaps = 9/232 (3%)

Query: 268 MILKNSGAIKSTAYSLFTNHSDSKHGTILFGAVDHGKYAGDLYTIPIINTLQNRGYKDPI 327
           M LK+ G I+  AYSLF N   +  G+ILFGAVD  KY+G LYT+P++          P 
Sbjct: 1   MALKSHGKIEKIAYSLFLNEPKAHFGSILFGAVDKSKYSGQLYTLPMLQAYDTLDSVSPG 60

Query: 328 QFQVTLQGIGVSHGERDENMTTLTTTKIPVLLDSGTTISYMPADLVEMIASEVGATYSPD 387
            F VT Q + V +G  D    T++  + PVL DSGTT S +P ++   I       YS  
Sbjct: 61  MF-VTAQSVAVLNG--DSGNKTVSKVRFPVLFDSGTTYSSLPTEVAHAIGKSFDGKYSSG 117

Query: 388 YGYYIMDCINEMEEESSLIFDFGGFYIANWLSNFQLLTDSRSNVCILGIAPQSDPAIILG 447
              Y  DC     +++ L  DFGGF I+  +SNF   T      C+L I   +D   +LG
Sbjct: 118 DQGYTFDC--SKVKDTLLSIDFGGFNISANISNFVTRTKDH---CLLNIE-AADSGFVLG 171

Query: 448 DNFLVSTYVVYDLDNMEISMAHADFSDGGEYIDTIKDSVPSALKAPGYSSTW 499
           D FLV  YVV+DL++ E+S+A A F D  E I+ I D VP A++APGYSSTW
Sbjct: 172 DAFLVDAYVVFDLESHEVSIAQASFDDKKEEIEVISDRVPGAIRAPGYSSTW 223

>Kpol_1063.22 s1063 (50979..51989) [1011 bp, 336 aa] {ON}
           (50979..51989) [1011 nt, 337 aa]
          Length = 336

 Score =  156 bits (395), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 107/324 (33%), Positives = 161/324 (49%), Gaps = 60/324 (18%)

Query: 67  DDYELVELTNQ---NSFYSVELDIGTPPQKVTVLVDTGSSDLWVTGSDNPYCFTEGEDTS 123
           D++  +EL  Q     FYS  L  G P Q VTVLVDTGSSDLWV+  +N YC+ +G++T+
Sbjct: 48  DNHNYLELDIQYHYGQFYSTLLSFGNPVQNVTVLVDTGSSDLWVSSPNNIYCYEDGKNTN 107

Query: 124 GSSFKHVNKDNLVSVVESVFTEISYDTTMVTSVATATIGNTASTSQAMNCTTYGTFDTSK 183
                                                       + ++NCT +GT+   K
Sbjct: 108 -------------------------------------------INHSINCTKFGTYTRDK 124

Query: 184 SSTFESNKTEFSITYGDSTFASGTWGHDRLSLNNLNVTGLSFAVANETNSTV-GVLGIGL 242
           SST         I YGD +FA G W  D L++   ++  + F ++N  ++ + GVLG+G 
Sbjct: 125 SSTSNKLDHRLFIQYGDGSFADGEWITDTLTIGPYDLQSVQFGISNNASTIISGVLGLGF 184

Query: 243 PGLEST--YSGVSLSSAQKSYTYNNFPMILKNSGAIKSTAYSLFTNHSDSKHGTILFGAV 300
              ES   Y G    S  K   Y N P  LK+     + A+SLF N+S+   GT+LFG +
Sbjct: 185 LRTESIDGYDG----SPNK--LYYNLPAYLKDQEITNTNAFSLFLNNSNDASGTVLFGGI 238

Query: 301 DHGKYAGDLYTIPIINTLQNRGYKDPIQFQVTLQGI-GVSHGERDENMTTLTTTKIPVLL 359
           D+ K++GDL T P++N +  +   +P  F +TLQ + G  +G +      L   K+P LL
Sbjct: 239 DYSKFSGDLVTFPLVN-IYPKLINEPCTFTITLQQLYGKINGGKS---IGLIKEKVPALL 294

Query: 360 DSGTTISYMPADLVEMIASEVGAT 383
           DSG+++  MP ++ + IA  V +T
Sbjct: 295 DSGSSLISMPIEITDEIALMVNST 318

>Suva_79.1 Chr79 complement(1..681) [681 bp, 227 aa] {ON} YIR039C
           (REAL)
          Length = 227

 Score =  140 bits (352), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 89/236 (37%), Positives = 130/236 (55%), Gaps = 17/236 (7%)

Query: 242 LPGLESTYSGVSLSSAQKS-YTYNNFPMILKNSGAIKSTAYSLFTNHSDSKHGTILFGAV 300
           LP +E T    ++ S   + Y Y+NFPM LK  G I+  AYSLF N  +++ G+ILFGAV
Sbjct: 1   LPSVEETDEIENVMSPDTTPYVYDNFPMALKRQGKIEKIAYSLFLNEPNARFGSILFGAV 60

Query: 301 DHGKYAGDLYTIPII---NTLQNRGYKDPIQFQVTLQGIG---VSHGERDENMTTLTTTK 354
           D  KY+G LYT+P++   NTL +         ++T Q +    V+  +      T++  +
Sbjct: 61  DKSKYSGQLYTLPMLKAYNTLDSSA-----GMEITAQSVAILSVAIIDSKSGNKTVSEVQ 115

Query: 355 IPVLLDSGTTISYMPADLVEMIASEVGATYSPDYGYYIMDCINEMEEESSLIFDFGGFYI 414
            PVL DSGT+ S +P ++ + I       YS D   YI DC       + L  DFGGF I
Sbjct: 116 FPVLFDSGTSTSALPTEIADAIGRSFDGKYSSDNQGYIFDC--SKVNNTLLSIDFGGFNI 173

Query: 415 ANWLSNFQLLTDSRSNVCILGIAPQSDPAIILGDNFLVSTYVVYDLDNMEISMAHA 470
           +  +SN   +T    + C+L I    D   +LGD FL+ TYVV+DL++ E+S+A A
Sbjct: 174 SANISN--SVTPITKDHCLLNIEAD-DSGYVLGDAFLIDTYVVFDLESHEVSVAQA 226

>TBLA0D04580 Chr4 complement(1133223..1134410) [1188 bp, 395 aa]
           {ON} Anc_7.182 YIL015W
          Length = 395

 Score =  135 bits (339), Expect = 5e-34,   Method: Compositional matrix adjust.
 Identities = 113/409 (27%), Positives = 177/409 (43%), Gaps = 76/409 (18%)

Query: 78  NSFYSVELDIGTPPQKVTVLVDTGSSDLWVTGSDNPYCFTEGEDTSGSSFKHVNKDNLVS 137
           +S+Y   + IG PPQ + VLVDTGSSDLWV   +NP C+    D +G +F          
Sbjct: 28  DSYYETNILIGNPPQNIGVLVDTGSSDLWVNSPNNPNCYNGNIDCTGFTF---------- 77

Query: 138 VVESVFTEISYDTTMVTSVATATIGNTASTSQAMNCTTYGTFDTSKSSTFES--NKTEFS 195
                                                    F+ S S TF +    + F 
Sbjct: 78  -----------------------------------------FNKSNSKTFSNIYKNSIFQ 96

Query: 196 ITYGDSTFASGTWGHDRLSLNN------------LNVTGLSFAVANETNSTV-GVLGIGL 242
           I Y D+++  G WG D +S+N+             N+    FA+A  +N  V  VLG+G 
Sbjct: 97  IGYQDASYTFGKWGVDSISINSSYSDSNEDTGLYANIPNAQFAIATNSNVPVQAVLGLGF 156

Query: 243 PGLESTYSGVSLSSAQKSYTYNNFPMILKNSGAIKSTAYSLFTNHSDSKHGTILFGAVDH 302
           P  E+  +G  L++ +    Y N P ++K  G   +   +++   S+  + +I+FGA D 
Sbjct: 157 PRREAV-NGYKLATNK---FYPNLPQLIKQHGYSDNVTIAMYLG-SNETYNSIMFGAYDK 211

Query: 303 GKYAGDLYTIPIINTLQNRGYKDPIQFQVTLQGIGVS-HGERDENMTTLTTTKIPVLLDS 361
            +Y GDL+  P++N   N   K P  F +TL  + +S    + +N+      K  V+LDS
Sbjct: 212 TRYIGDLHNFPMVNQYPNVTDK-PATFAITLDSMYISMDNNQSDNIYISNDEKYSVVLDS 270

Query: 362 GTTISYMPADLVEMIASEVGATYSPDYGYYIMDCINEMEEESSLI--FDFGGFYIANWLS 419
           GT++   P   V  IA  + AT+      Y++    ++     +I  F F  F +   + 
Sbjct: 271 GTSLLSAPDHYVSKIAGLLNATFDNTTHMYLLPSETDLTLYKDMIINFKFMDFNVPINML 330

Query: 420 NFQLLTDSRSNVCILGIAPQSDPAIILGDNFLVSTYVVYDLDNMEISMA 468
            F L  D      IL      +   +LGD FL   Y +++LDN  IS+ 
Sbjct: 331 EFILPYDDSYVFAILP-TKNVNTGFVLGDIFLPHVYTIFNLDNYTISLG 378

>Suva_9.187 Chr9 (310921..311922) [1002 bp, 333 aa] {ON} YIL015W
           (REAL)
          Length = 333

 Score =  102 bits (254), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 66/175 (37%), Positives = 101/175 (57%), Gaps = 9/175 (5%)

Query: 331 VTLQGIGVSHGERDENMTTLTTTKIPVLLDSGTTISYMPADLVEMIASEVGATYSPDYGY 390
           +T+QG+G  +    ++ T +TT K PVLLDSGT++   P  + + +AS V A+YS D G 
Sbjct: 1   MTIQGLGAQNKSSCQHETFMTT-KYPVLLDSGTSLLNAPKSIADKMASFVNASYSADEGI 59

Query: 391 YIMDCINEMEEESSLIFDFGGFYIANWLSNFQLLTDSRSNVCILGIAPQSDPAIILGDNF 450
           YI+DC  E   +    FDFG   I   L++  L  ++    C   + P +D +++LGD F
Sbjct: 60  YILDC-PESTYDVEYTFDFGDLQINVPLTSLILSPETEGGYCGFAVQPTND-SMVLGDVF 117

Query: 451 LVSTYVVYDLDNMEISMAHADF---SDGGEYIDTIKD-SVPSALKAPGYSSTWST 501
           L S YVV+DLDN +IS+A A++   +D  + ++   D S+PS   A   +  WST
Sbjct: 118 LSSAYVVFDLDNYKISLAQANWNASNDSKQLVNIPTDGSIPSGKSA--TAQPWST 170

>Suva_9.186 Chr9
           (310161..310220,310267..310332,310362..310451,
           310470..310622,310626..310658,310662..310688,
           310692..310742,310746..310787,310807..310833,
           310840..311922) [1632 bp, 543 aa] {OFF} YIL015W (PSEUDO)
          Length = 543

 Score =  102 bits (255), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 67/180 (37%), Positives = 100/180 (55%), Gaps = 9/180 (5%)

Query: 326 PIQFQVTLQGIGVSHGERDENMTTLTTTKIPVLLDSGTTISYMPADLVEMIASEVGATYS 385
           P    +T+QG+G  +    ++  T  TTK PVLLDSGT++   P  + + +AS V A+YS
Sbjct: 206 PATLAMTIQGLGAQNKSSCQH-ETFMTTKYPVLLDSGTSLLNAPKSIADKMASFVNASYS 264

Query: 386 PDYGYYIMDCINEMEEESSLIFDFGGFYIANWLSNFQLLTDSRSNVCILGIAPQSDPAII 445
            D G YI+DC  E   +    FDFG   I   L++  L  ++    C   + P +D +++
Sbjct: 265 ADEGIYILDC-PESTYDVEYTFDFGDLQINVPLTSLILSPETEGGYCGFAVQPTND-SMV 322

Query: 446 LGDNFLVSTYVVYDLDNMEISMAHADF---SDGGEYIDTIKD-SVPSALKAPGYSSTWST 501
           LGD FL S YVV+DLDN +IS+A A++   +D  + ++   D S+PS   A      WST
Sbjct: 323 LGDVFLSSAYVVFDLDNYKISLAQANWNASNDSKQLVNIPTDGSIPSGKSATA--QPWST 380

>ZYRO0F07392g Chr6 (598584..599840) [1257 bp, 418 aa] {ON} highly
           similar to uniprot|P07267 Saccharomyces cerevisiae
           YPL154C PEP4 Vacuolar aspartyl protease (proteinase A)
           required for the posttranslational precursor maturation
           of vacuolar proteinases synthesized as a zymogen
           self-activates
          Length = 418

 Score =  100 bits (249), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 114/419 (27%), Positives = 169/419 (40%), Gaps = 116/419 (27%)

Query: 72  VELTNQ-NSFYSVELDIGTPPQKVTVLVDTGSSDLWVTGSDNPYCFTEGEDTSGSSFKHV 130
           V LTN  N+ Y  E+ +GTPPQ   V++DTGSS+LWV                       
Sbjct: 95  VPLTNYLNAQYYTEVSLGTPPQNFKVILDTGSSNLWVP---------------------- 132

Query: 131 NKDNLVSVVESVFTEISYDTTMVTSVATATIGNTASTSQAMNCTTYGTFDTSKSSTFESN 190
                              +T  +S+A               C  +  +D   SS+++ N
Sbjct: 133 -------------------STECSSLA---------------CFLHSKYDHDSSSSYKPN 158

Query: 191 KTEFSITYGDSTFASGTWGHDRLSLNNLNVTGLSFAVANETNSTV-------GVLGIGLP 243
            TEF+I YG  +   G    D L+L +L++T   FA A              G+LG+G  
Sbjct: 159 GTEFAIRYGSGSL-EGYISQDTLNLGDLSITKQDFAEATSEPGLQFAFGKFDGILGLG-- 215

Query: 244 GLESTYSGVSLSSAQKSYTYNNFPMILKNSGAIKSTAYSLFTNHSDSKHGTILFGAVDHG 303
                Y  +S+      + YN +   L +       A+ L  +      G   FG VD  
Sbjct: 216 -----YDTISVDGVVPPF-YNAWKQGLLDEPKF---AFYLGRDGESQDGGVATFGGVDDS 266

Query: 304 KYAGDLYTIPIINTLQNRGYKDPIQFQVTLQGIGVSHGERDENMTTLTTTKIPVLLDSGT 363
           KY G++  +PI    + + Y     ++V   GIG+  GE    +           +D+GT
Sbjct: 267 KYEGEITWLPI----RRKAY-----WEVKFDGIGL--GEEYAELENHGAA-----IDTGT 310

Query: 364 TISYMPADLVEMIASEVGATYSPDYGYYIMDCINEMEEESSL---IFDFGGFYIANWLSN 420
           ++  +P+ L E+I +E+GA  S   G Y ++C    E  SSL    F  GG        N
Sbjct: 311 SLIALPSGLAEIINAEIGAKKSWT-GQYTVEC----EARSSLPNMTFTLGG-------HN 358

Query: 421 FQLLTDSR----SNVCILGIAPQS-----DPAIILGDNFLVSTYVVYDLDNMEISMAHA 470
           F+L         S  CI  I P        P  I+GD+FL   Y +YDL N  + +A A
Sbjct: 359 FELTAYDYILEVSGQCISAIFPMDFPEPVGPLAIIGDSFLRKYYSIYDLGNNAVGLADA 417

>Smik_6.351 Chr6 (563275..564492) [1218 bp, 405 aa] {ON} YPL154C
           (REAL)
          Length = 405

 Score = 97.8 bits (242), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 120/476 (25%), Positives = 193/476 (40%), Gaps = 109/476 (22%)

Query: 12  ALLLHSSMVFADSIISQSSEINDGYVKMNFQRKYGDSFESATND---TKARARLVTRGDD 68
           A  +H + ++   +  +  E+       +  +KY   FE A  +   ++        G D
Sbjct: 21  AAKVHKAKIYKHKLSDEMKEVTFDQHLAHLGQKYLTQFEKANPEVVFSREHPFFTEGGHD 80

Query: 69  YELVELTNQ-NSFYSVELDIGTPPQKVTVLVDTGSSDLWVTGSDNPYCFTEGEDTSGSSF 127
              V LTN  N+ Y  ++ +GTPPQ   V++D        TGS N +             
Sbjct: 81  ---VPLTNYLNAQYYTDITLGTPPQNFKVILD--------TGSSNLW------------- 116

Query: 128 KHVNKDNLVSVVESVFTEISYDTTMVTSVATATIGNTASTSQAMNCTTYGTFDTSKSSTF 187
                                       V +   G+ A       C  +  +D   SS++
Sbjct: 117 ----------------------------VPSNECGSLA-------CFLHSKYDHEASSSY 141

Query: 188 ESNKTEFSITYGDSTFASGTWGHDRLSLNNLNVTGLSFAVA-NETNSTV------GVLGI 240
           ++N TEF+I YG  +   G    D LS+ +L +    FA A +E   T       G+LG+
Sbjct: 142 KANGTEFAIQYGTGSL-EGYISQDTLSIGDLTIPKQDFAEATSEPGLTFAFGKFDGILGL 200

Query: 241 GLPGLESTYSGVSLSSAQKSYTYNNFPMILKNSGAIKSTAYSLFTNHSDSKH-GTILFGA 299
           G       Y  +S+      + YN     L +    K  A+ L     DS++ G   FG 
Sbjct: 201 G-------YDTISVDKVVPPF-YNAIQQDLLDE---KKFAFYLGDTSKDSENGGEATFGG 249

Query: 300 VDHGKYAGDLYTIPIINTLQNRGYKDPIQFQVTLQGIGVSHGERDENMTTLTTTKIPVLL 359
           +D  K+ GD+  +P+    + + Y     ++V  +GIG+  G+    + +         +
Sbjct: 250 IDESKFKGDITWLPV----RRKAY-----WEVKFEGIGL--GDEYAELESHGAA-----I 293

Query: 360 DSGTTISYMPADLVEMIASEVGATYSPDYGYYIMDCINEMEEESSLIFDFGGFYIANWLS 419
           D+GT++  +P+ L EMI +E+GA      G Y +DC N  +    LIF+F G+   N+  
Sbjct: 294 DTGTSLITLPSGLAEMINAELGAKKGWT-GQYTLDC-NTRDSLPDLIFNFNGY---NYTI 348

Query: 420 NFQLLTDSRSNVCILGIAPQS-----DPAIILGDNFLVSTYVVYDLDNMEISMAHA 470
                T   S  CI  I P        P  I+GD FL   Y +YDL N  + +A A
Sbjct: 349 GPYDYTLEVSGSCISAITPMDFPEPVGPLAIIGDAFLRKYYSIYDLGNNAVGLAKA 404

>Suva_16.156 Chr16 complement(268862..270082) [1221 bp, 406 aa] {ON}
           YPL154C (REAL)
          Length = 406

 Score = 96.7 bits (239), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 118/476 (24%), Positives = 188/476 (39%), Gaps = 109/476 (22%)

Query: 12  ALLLHSSMVFADSIISQSSEINDGYVKMNFQRKYGDSFESATND---TKARARLVTRGDD 68
           A  +H + ++   +  +  E+       +  +KY   FE A  +   ++        G D
Sbjct: 22  AAKVHKAKIYKHKLTDEMKEVTFDQHLAHLGQKYLTQFEKANPEIAFSREHPFFTEGGHD 81

Query: 69  YELVELTNQ-NSFYSVELDIGTPPQKVTVLVDTGSSDLWVTGSDNPYCFTEGEDTSGSSF 127
              V LTN  N+ Y  ++ +G PPQ   V++D        TGS N +             
Sbjct: 82  ---VPLTNYLNAQYYTDISLGNPPQNFKVILD--------TGSSNLW------------- 117

Query: 128 KHVNKDNLVSVVESVFTEISYDTTMVTSVATATIGNTASTSQAMNCTTYGTFDTSKSSTF 187
                                       V +   G+ A       C  +  +D   SS++
Sbjct: 118 ----------------------------VPSTECGSLA-------CFLHSKYDHEASSSY 142

Query: 188 ESNKTEFSITYGDSTFASGTWGHDRLSLNNLNVTGLSFAVA-NETNSTV------GVLGI 240
           + N TEF+I YG  +   G    D LS+ +L +    FA A +E   T       G+LG+
Sbjct: 143 KPNGTEFAIQYGTGSL-EGYISQDTLSIGDLTIPKQDFAEATSEPGLTFAFGKFDGILGL 201

Query: 241 GLPGLESTYSGVSLSSAQKSYTYNNFPMILKNSGAIKSTAYSLFTNHSDSKHG-TILFGA 299
           G       Y  +S+      + YN     L +    K  A+ L     DS++G    FG 
Sbjct: 202 G-------YDTISVDKVVPPF-YNAIQQDLLDE---KKFAFYLGDTSKDSENGGEATFGG 250

Query: 300 VDHGKYAGDLYTIPIINTLQNRGYKDPIQFQVTLQGIGVSHGERDENMTTLTTTKIPVLL 359
           +D  K+ GD+  +P+    + + Y     ++V  +GIG+ H         L        +
Sbjct: 251 IDKSKFKGDVTWLPV----RRKAY-----WEVKFEGIGLGH-----EFAELEGHG--AAI 294

Query: 360 DSGTTISYMPADLVEMIASEVGATYSPDYGYYIMDCINEMEEESSLIFDFGGFYIANWLS 419
           D+GT++  +P+ L EMI +E+GA      G Y +DC N  +    L F+F G+       
Sbjct: 295 DTGTSLITLPSGLAEMINAEIGAKKGWS-GQYALDC-NTRDGLPDLTFNFNGYNFTIGPY 352

Query: 420 NFQLLTDSRSNVCILGIAPQS-----DPAIILGDNFLVSTYVVYDLDNMEISMAHA 470
           ++ L     S  CI  I P        P  I+GD FL   Y +YDL N  + +A A
Sbjct: 353 DYTL---EVSGSCISAITPMDFPEPVGPLAIIGDAFLRKYYSIYDLGNDAVGLAEA 405

>YPL154C Chr16 complement(259714..260931) [1218 bp, 405 aa] {ON}
           PEP4Vacuolar aspartyl protease (proteinase A), required
           for the posttranslational precursor maturation of
           vacuolar proteinases; important for protein turnover
           after oxidative damage; synthesized as a zymogen,
           self-activates
          Length = 405

 Score = 96.7 bits (239), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 118/476 (24%), Positives = 193/476 (40%), Gaps = 109/476 (22%)

Query: 12  ALLLHSSMVFADSIISQSSEINDGYVKMNFQRKYGDSFESATND---TKARARLVTRGDD 68
           A  +H + ++   +  +  E+       +  +KY   FE A  +   ++        G D
Sbjct: 21  AAKVHKAKIYKHELSDEMKEVTFEQHLAHLGQKYLTQFEKANPEVVFSREHPFFTEGGHD 80

Query: 69  YELVELTNQ-NSFYSVELDIGTPPQKVTVLVDTGSSDLWVTGSDNPYCFTEGEDTSGSSF 127
              V LTN  N+ Y  ++ +GTPPQ   V++D        TGS N +             
Sbjct: 81  ---VPLTNYLNAQYYTDITLGTPPQNFKVILD--------TGSSNLW------------- 116

Query: 128 KHVNKDNLVSVVESVFTEISYDTTMVTSVATATIGNTASTSQAMNCTTYGTFDTSKSSTF 187
                                       V +   G+ A       C  +  +D   SS++
Sbjct: 117 ----------------------------VPSNECGSLA-------CFLHSKYDHEASSSY 141

Query: 188 ESNKTEFSITYGDSTFASGTWGHDRLSLNNLNVTGLSFAVA-NETNSTV------GVLGI 240
           ++N TEF+I YG  +   G    D LS+ +L +    FA A +E   T       G+LG+
Sbjct: 142 KANGTEFAIQYGTGSL-EGYISQDTLSIGDLTIPKQDFAEATSEPGLTFAFGKFDGILGL 200

Query: 241 GLPGLESTYSGVSLSSAQKSYTYNNFPMILKNSGAIKSTAYSLFTNHSDSKH-GTILFGA 299
           G       Y  +S+      + YN     L +    K  A+ L     D+++ G   FG 
Sbjct: 201 G-------YDTISVDKVVPPF-YNAIQQDLLDE---KRFAFYLGDTSKDTENGGEATFGG 249

Query: 300 VDHGKYAGDLYTIPIINTLQNRGYKDPIQFQVTLQGIGVSHGERDENMTTLTTTKIPVLL 359
           +D  K+ GD+  +P+    + + Y     ++V  +GIG+  G+    + +         +
Sbjct: 250 IDESKFKGDITWLPV----RRKAY-----WEVKFEGIGL--GDEYAELESHGAA-----I 293

Query: 360 DSGTTISYMPADLVEMIASEVGATYSPDYGYYIMDCINEMEEESSLIFDFGGFYIANWLS 419
           D+GT++  +P+ L EMI +E+GA      G Y +DC N  +    LIF+F G+       
Sbjct: 294 DTGTSLITLPSGLAEMINAEIGAKKGWT-GQYTLDC-NTRDNLPDLIFNFNGYNFTIGPY 351

Query: 420 NFQLLTDSRSNVCILGIAPQS-----DPAIILGDNFLVSTYVVYDLDNMEISMAHA 470
           ++ L     S  CI  I P        P  I+GD FL   Y +YDL N  + +A A
Sbjct: 352 DYTL---EVSGSCISAITPMDFPEPVGPLAIVGDAFLRKYYSIYDLGNNAVGLAKA 404

>Skud_16.128 Chr16 complement(231348..232565) [1218 bp, 405 aa] {ON}
           YPL154C (REAL)
          Length = 405

 Score = 96.3 bits (238), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 119/476 (25%), Positives = 192/476 (40%), Gaps = 109/476 (22%)

Query: 12  ALLLHSSMVFADSIISQSSEINDGYVKMNFQRKYGDSFESATND---TKARARLVTRGDD 68
           A  +H + ++   +  +  E+       +  +KY   FE A  +   ++        G D
Sbjct: 21  AAKVHKAKIYKHKLSDEMKEVTFDQHLAHLGQKYLTQFEKANPEVVFSREHPFFTEGGHD 80

Query: 69  YELVELTNQ-NSFYSVELDIGTPPQKVTVLVDTGSSDLWVTGSDNPYCFTEGEDTSGSSF 127
              V LTN  N+ Y  ++ +GTPPQ   V++D        TGS N +             
Sbjct: 81  ---VPLTNYLNAQYYTDITLGTPPQNFKVILD--------TGSSNLW------------- 116

Query: 128 KHVNKDNLVSVVESVFTEISYDTTMVTSVATATIGNTASTSQAMNCTTYGTFDTSKSSTF 187
                                       V +   G+ A       C  +  +D   SS++
Sbjct: 117 ----------------------------VPSNECGSLA-------CFLHSKYDHEASSSY 141

Query: 188 ESNKTEFSITYGDSTFASGTWGHDRLSLNNLNVTGLSFAVA-NETNSTV------GVLGI 240
           ++N TEF+I YG  +   G    D LS+ +L +    FA A +E   T       G+LG+
Sbjct: 142 KANGTEFAIQYGTGSL-EGYISQDTLSIGDLTIPKQDFAEATSEPGLTFAFGKFDGILGL 200

Query: 241 GLPGLESTYSGVSLSSAQKSYTYNNFPMILKNSGAIKSTAYSLFTNHSDSKH-GTILFGA 299
           G       Y  +S+      + YN     L +    K  A+ L     DS++ G   FG 
Sbjct: 201 G-------YDTISVDKVVPPF-YNAIQQDLLDE---KKFAFYLGDTSKDSENGGEATFGG 249

Query: 300 VDHGKYAGDLYTIPIINTLQNRGYKDPIQFQVTLQGIGVSHGERDENMTTLTTTKIPVLL 359
           +D  K+ GD+  +P+    + + Y     ++V  +GIG+  G+    +           +
Sbjct: 250 IDESKFKGDITWLPV----RRKAY-----WEVKFEGIGL--GDEYAELEGHGAA-----I 293

Query: 360 DSGTTISYMPADLVEMIASEVGATYSPDYGYYIMDCINEMEEESSLIFDFGGFYIANWLS 419
           D+GT++  +P+ L EMI +E+GA      G Y +DC N  +    LIF+F G+       
Sbjct: 294 DTGTSLITLPSGLAEMINAELGAKKGWT-GQYTLDC-NTRDSLPDLIFNFNGYNFTIGPY 351

Query: 420 NFQLLTDSRSNVCILGIAPQS-----DPAIILGDNFLVSTYVVYDLDNMEISMAHA 470
           ++ L     S  CI  I P        P  I+GD FL   Y +YDL N  + +A A
Sbjct: 352 DYTL---EVSGSCISAITPMDFPEPVGPLAIVGDAFLRKYYSIYDLGNDAVGLAKA 404

>Suva_62.1 Chr62 complement(3..758) [756 bp, 252 aa] {ON} YIR039C
           (REAL)
          Length = 252

 Score = 93.2 bits (230), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 67/188 (35%), Positives = 105/188 (55%), Gaps = 31/188 (16%)

Query: 81  YSVELDIGTPPQKVTVLVDTGSSDLWVTGSDNPYCFTEGEDTSGSSFKHVNKDNLVSVVE 140
           Y VE+ IGTPPQ   + +DTGSSD+ V  +D+ +C            K +  DN      
Sbjct: 94  YVVEMQIGTPPQTAYLELDTGSSDMCVNEADSAHC------------KSLADDN------ 135

Query: 141 SVFTEISYDTTMVTSVATATIGNT-ASTSQAMNCTTYGTFDTSKSSTFESNKTEFSITYG 199
           +++T  +Y+   +T+ AT T+     S     +C+ +GTF+ + SSTF+ N+T F +TYG
Sbjct: 136 NIWTS-NYE---LTATATETLSTPLPSVHHITSCSYWGTFNPNISSTFKYNETIFDLTYG 191

Query: 200 DSTFASGTWGHDRLSLNNLNVTGLSFAVANETNSTVGVLGIGLPGLESTYSGV-SLSSAQ 258
                  T+G D +SL N+ ++  +F V+N+T  + G+LGI LP  E T  G  +LSS +
Sbjct: 192 -------TYGTDVVSLGNITLSNYTFGVSNDTTMSYGILGISLPSEEITDRGQDALSSNK 244

Query: 259 KSYTYNNF 266
             + Y+NF
Sbjct: 245 TPFAYDNF 252

>KNAG0J01710 Chr10 (312872..314119) [1248 bp, 415 aa] {ON} Anc_8.677
           YPL154C
          Length = 415

 Score = 95.1 bits (235), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 116/473 (24%), Positives = 194/473 (41%), Gaps = 100/473 (21%)

Query: 15  LHSSMVFADSIISQSSEINDGYVKMNFQRKYGDSFESATNDTK-ARARLVTRG---DDYE 70
           +H + +F   I  +   I       +  +KY + +E A  +   ++     +G   D +E
Sbjct: 25  VHKAKLFKREITEEMEAIPFEQHVQHLGQKYLNQYEKAFPEVSFSKHHPFFKGSAQDSFE 84

Query: 71  L-----VELTNQ-NSFYSVELDIGTPPQKVTVLVDTGSSDLWVTGSDNPYCFTEGEDTSG 124
           +     V L+N  N+ Y  ++ +GTPPQ+  V++D        TGS N +          
Sbjct: 85  VAKGHEVPLSNYLNAQYYTDITLGTPPQQFKVILD--------TGSSNLW---------- 126

Query: 125 SSFKHVNKDNLVSVVESVFTEISYDTTMVTSVATATIGNTASTSQAMNCTTYGTFDTSKS 184
                                          V ++  G+ A       C  +  +D S S
Sbjct: 127 -------------------------------VPSSECGSLA-------CFLHEKYDHSAS 148

Query: 185 STFESNKTEFSITYGDSTFASGTWGHDRLSLNNLNVTGLSFAVANETNSTVGVLGI--GL 242
           S++++N T+FSI YG  +   G    D LS+ +L +    FA A          G   G+
Sbjct: 149 SSYKANGTDFSIQYGSGSL-EGYISQDTLSIGDLTIPKQDFAEATSEPGLAFAFGKFDGI 207

Query: 243 PGLESTYSGVSLSSAQKSYTYNNFPMILKNSGAIKSTAYSLFTNHSDSKHGTILFGAVDH 302
            GL   Y  +S+      + YN     L +    K   Y   TN      G  +FG VD 
Sbjct: 208 LGL--AYDTISVDKVVPPF-YNALEQDLLDEA--KFAFYLGDTNKDAEDGGEAIFGGVDK 262

Query: 303 GKYAGDLYTIPIINTLQNRGYKDPIQFQVTLQGIGVSHGERDENMTTLTTTKIPVLLDSG 362
            KY GD+  +P+    + + Y     ++V L+G+G+  G+    + +         +D+G
Sbjct: 263 SKYTGDVTWLPV----RRKAY-----WEVKLEGLGL--GDEYAELESHGAA-----IDTG 306

Query: 363 TTISYMPADLVEMIASEVGATYSPDYGYYIMDCINEMEEESSLIFDFGGFYIANWLSNFQ 422
           T++  +P+ L E+I SE+GA      G Y ++C N  ++   L F+F G+       ++ 
Sbjct: 307 TSLITLPSGLAEIINSEIGAKKGWT-GQYTLEC-NTRDQLPDLTFNFNGYNFTIGPYDYT 364

Query: 423 LLTDSRSNVCILGIAPQS-----DPAIILGDNFLVSTYVVYDLDNMEISMAHA 470
           L     S  CI  I P        P  I+GD FL   Y +YDL++  + +A A
Sbjct: 365 L---EVSGSCISAITPMDFPEPVGPLAIVGDAFLRKYYSIYDLEHNAVGLAKA 414

>Kwal_26.8802 s26 (949063..950301) [1239 bp, 412 aa] {ON} YPL154C
           (PEP4) - vacuolar proteinase A [contig 68] FULL
          Length = 412

 Score = 94.4 bits (233), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 117/489 (23%), Positives = 192/489 (39%), Gaps = 134/489 (27%)

Query: 15  LHSSMVFADSI----ISQSSEINDGYVKMNFQRKYGDSFESA-------TNDTKARARLV 63
           +H + V+ D      ++ ++++N  Y+      ++  ++  A       T D++    ++
Sbjct: 24  VHKAKVYKDKKTSNDMAANAQLNAAYLGQKVMAQFAKAYPEAGFDQQVLTADSEGEFDIL 83

Query: 64  TRGDDYELVELTNQ-NSFYSVELDIGTPPQKVTVLVDTGSSDLWVTGSDNPYCFTEGEDT 122
              D    V L+N  N+ Y  E+ +GTPPQ   V++DTGSS+LWV               
Sbjct: 84  GGHD----VPLSNYLNAQYFTEISLGTPPQSFKVILDTGSSNLWVP-------------- 125

Query: 123 SGSSFKHVNKDNLVSVVESVFTEISYDTTMVTSVATATIGNTASTSQAMNCTTYGTFDTS 182
                     D   S+   + ++ S+D               AS+S   N T+       
Sbjct: 126 ---------SDECGSLACFLHSKYSHD---------------ASSSYKANGTS------- 154

Query: 183 KSSTFESNKTEFSITYGDSTFASGTWGHDRLSLNNLNVTGLSFAVANETNSTV------- 235
                      F+I YG  +   G    D LS+ +L +    FA A              
Sbjct: 155 -----------FAIQYGSGSL-EGYISQDTLSIGDLTIPKQDFAEATSEPGLAFAFGKFD 202

Query: 236 GVLGIGLPGLESTYSGVSLSSAQKSYTYNNFPMILK--NSGAIKSTAYSLFTNHSDSKH- 292
           G+LG+G       Y  +S+            P + K  N G +    ++ + N++D    
Sbjct: 203 GILGLG-------YDTISVDKV--------VPPVYKAINDGLLDEPRFAFYLNNADDSEE 247

Query: 293 --GTILFGAVDHGKYAGDLYTIPIINTLQNRGYKDPIQFQVTLQGIGVSHGERDENMTTL 350
             G + FG +D  KY GD+  +P+    + + Y     ++V   GIG+     DE     
Sbjct: 248 STGEVTFGGIDSSKYKGDITWLPV----RRKAY-----WEVKFDGIGLG----DEYAELQ 294

Query: 351 TTTKIPVLLDSGTTISYMPADLVEMIASEVGATYSPDYGYYIMDCINEMEEESSLIFDFG 410
            T      +D+GT++  +P+ L E++ SE+GA      G Y +DC    ++   L F F 
Sbjct: 295 GTG---AAIDTGTSLIALPSGLAEVLNSEIGAKKGWT-GQYTVDC-ESRDQLPDLTFTFN 349

Query: 411 GFYIANWLSNFQL----LTDSRSNVCILGIAPQS-----DPAIILGDNFLVSTYVVYDLD 461
           G        NF +     T   S  CI    P        P  I+GD FL   Y +YDL 
Sbjct: 350 G-------KNFTITAYDYTLEVSGSCISAFTPMDFPEPVGPLAIIGDAFLRKFYSIYDLG 402

Query: 462 NMEISMAHA 470
           N  + +A A
Sbjct: 403 NNAVGLAQA 411

>Ecym_2396 Chr2 complement(769479..770726) [1248 bp, 415 aa] {ON}
           similar to Ashbya gossypii ACR144W ACR143W
          Length = 415

 Score = 89.4 bits (220), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 102/436 (23%), Positives = 168/436 (38%), Gaps = 108/436 (24%)

Query: 47  DSFESATNDTKARARLVTRGDDYELVELTNQNSFYSVELDIGTPPQKVTVLVDTGSSDLW 106
           +  + A N    RA   + G    L    N N +YS E+ +GTPPQ   V++DTGSS+LW
Sbjct: 71  EKLKGAANGEVERAS--SNGHPIALDNFVN-NQYYS-EIGLGTPPQSFKVVMDTGSSNLW 126

Query: 107 VTGSDNPYCFTEGEDTSGSSFKHVNKDNLVSVVESVFTEISYDTTMVTSVATATIGNTAS 166
           V    N  C +E                                                
Sbjct: 127 VP---NKNCVSEA----------------------------------------------- 136

Query: 167 TSQAMNCTTYGTFDTSKSSTFESNKTEFSITYGDSTFASGTWGHDRLSLNNLNVTGLSFA 226
                 C  +  FD  +SS++  N + FS++YG  +   G   +D L + +L +    FA
Sbjct: 137 ------CLNHARFDHDRSSSYAKNDSRFSVSYGKGSM-EGFVSYDTLKIGDLTIKNQGFA 189

Query: 227 VANETNSTVGVLGI--GLPGLESTYSGVSLSSAQKSYTYNNFPMILKNSGAIKSTAYSLF 284
            A     +  V G   G+ GL   Y G++++     + Y        + G +    ++ +
Sbjct: 190 EATVEPGSAFVYGQFDGILGL--AYDGLAVNHIVPPF-YEAV-----HQGLLDEPVFAFY 241

Query: 285 ---TNHSDSKHGTILFGAVDHGKYAGDLYTIPIINTLQNRGYKDPIQFQVTLQGIGVSHG 341
                  DS  G ++FG  D  K+ G++  +P+I                       ++ 
Sbjct: 242 LSDEKKGDSLAGEVVFGGYDETKFTGEISWLPVIRK---------------------AYW 280

Query: 342 ERDENMTTLTTTKIPV-----LLDSGTTISYMPADLVEMIASEVGATYSPDYGYYIMDCI 396
           E + N  TL + K  +      LD+GT+    P++L +   S+ GAT  PD G+ I  C 
Sbjct: 281 EVELNSITLGSQKFQLQNYGGALDTGTSFITFPSELYQEFVSKTGATVDPDDGHIIAPCS 340

Query: 397 NEMEEESSLIFDFGGFYIANWLSNFQLLTDSRSNVCILGIAP----QSDPAIILGDNFLV 452
                +  L F+  G       S++ +  D  +  C + I P     +   +I+GD FL 
Sbjct: 341 GSGFPD--LTFELAGRSFTISSSDYVVQWDDTT--CAVAITPLDLGGAGKMVIIGDVFLR 396

Query: 453 STYVVYDLDNMEISMA 468
             Y +YDL    + +A
Sbjct: 397 RWYSIYDLSKNAVGLA 412

>KLLA0D05929g Chr4 (507555..508784) [1230 bp, 409 aa] {ON} highly
           similar to uniprot|P07267 Saccharomyces cerevisiae
           YPL154C PEP4 Vacuolar aspartyl protease (proteinase A)
           required for the posttranslational precursor maturation
           of vacuolar proteinases synthesized as a zymogen
           self-activates
          Length = 409

 Score = 89.0 bits (219), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 111/476 (23%), Positives = 185/476 (38%), Gaps = 99/476 (20%)

Query: 8   FVVNALLLHSSMVFADSIISQSSEINDGYVKMNFQRKYGDSFESATND---TKARARLVT 64
           F V    +H + +    +  Q  ++           KY +SF+ A      +K    +  
Sbjct: 19  FDVAEAKIHKAKIQKHKLEDQLKDVPFAEHVAQLGEKYLNSFQRAYPQESFSKDNVDVFV 78

Query: 65  RGDDYELVELTNQ-NSFYSVELDIGTPPQKVTVLVDTGSSDLWVTGSDNPYCFTEGEDTS 123
             +    V LTN  N+ Y  E+ +G+PPQ   V++DTGSS+LW                 
Sbjct: 79  APEGSHSVPLTNYLNAQYFTEITLGSPPQSFKVILDTGSSNLW----------------- 121

Query: 124 GSSFKHVNKDNLVSVVESVFTEISYDTTMVTSVATATIGNTASTSQAMNCTTYGTFDTSK 183
                                           V +A  G+ A       C  +  +D   
Sbjct: 122 --------------------------------VPSAECGSLA-------CFLHTKYDHEA 142

Query: 184 SSTFESNKTEFSITYGDSTFASGTWGHDRLSLNNLNVTGLSFAVANETNSTVGVLGI--G 241
           SST+++N +EF+I YG  +   G    D L++ +L +    FA A          G   G
Sbjct: 143 SSTYKANGSEFAIQYGSGSL-EGYVSRDLLTIGDLVIPDQDFAEATSEPGLAFAFGKFDG 201

Query: 242 LPGLESTYSGVSLSSAQKSYTYNNFPMILKNSGAIKSTAYSLFTNHSDSKH--GTILFGA 299
           + GL   Y  +S++       YN     +KN   +    ++ +   SD     G   FG 
Sbjct: 202 ILGL--AYDSISVNRIVPP-VYN----AIKNK-LLDDPVFAFYLGDSDKSEDGGEASFGG 253

Query: 300 VDHGKYAGDLYTIPIINTLQNRGYKDPIQFQVTLQGIGVSHGERDENMTTLTTTKIPVLL 359
           +D  KY G++  +P+    + + Y     ++V  +GIG+      E   TL        +
Sbjct: 254 IDEEKYTGEITWLPV----RRKAY-----WEVKFEGIGLG-----EEYATLEGHG--AAI 297

Query: 360 DSGTTISYMPADLVEMIASEVGATYSPDYGYYIMDCINEMEEESSLIFDFGGFYIANWLS 419
           D+GT++  +P+ L E++ +E+GA      G Y +DC    +    L  +F G+       
Sbjct: 298 DTGTSLIALPSGLAEILNAEIGAKKGWS-GQYSVDC-ESRDSLPDLTLNFNGYNFTITAY 355

Query: 420 NFQLLTDSRSNVCILGIAPQS-----DPAIILGDNFLVSTYVVYDLDNMEISMAHA 470
           ++ L     S  CI    P        P  I+GD FL   Y +YD+ +  + +A A
Sbjct: 356 DYTL---EVSGSCISAFTPMDFPEPVGPLAIIGDAFLRKYYSIYDIGHDAVGLAKA 408

>Kpol_1072.15 s1072 complement(35798..36997) [1200 bp, 399 aa] {ON}
           complement(35798..36997) [1200 nt, 400 aa]
          Length = 399

 Score = 88.2 bits (217), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 108/440 (24%), Positives = 177/440 (40%), Gaps = 101/440 (22%)

Query: 43  RKYGDSFESATNDTKARARLVTRGDDYEL----VELTNQ-NSFYSVELDIGTPPQKVTVL 97
           RKY + FE A  +       +++ D + +    V L N  N+ Y  ++ IGTPPQK  V+
Sbjct: 48  RKYLNQFEKAFPEVH-----ISKKDQFTIESHDVPLDNYLNAQYYTDVSIGTPPQKFKVI 102

Query: 98  VDTGSSDLWVTGSDNPYCFTEGEDTSGSSFKHVNKDNLVSVVESVFTEISYDTTMVTSVA 157
           +DTGSS+LW                                              V SV 
Sbjct: 103 LDTGSSNLW----------------------------------------------VPSVG 116

Query: 158 TATIGNTASTSQAMNCTTYGTFDTSKSSTFESNKTEFSITYGDSTFASGTWGHDRLSLNN 217
            +++           C  +  +D S SST+ SN ++F I YG  +   G    D L++ +
Sbjct: 117 CSSLA----------CYLHSKYDHSLSSTYRSNGSDFVIQYGSGSL-KGYISQDTLTIGD 165

Query: 218 LNVTGLSFAVANETNSTVGVLGI--GLPGLESTYSGVSLSSAQKSYTYNNFPMILKNSGA 275
           L +    FA A          G   G+ GL   Y  +S++ A     YN     L +   
Sbjct: 166 LIIPQQDFAEATAEPGLAFAFGKFDGILGL--AYDSISVNKAVPP-LYNAIHRGLLDKPM 222

Query: 276 IKSTAYSLFTNHSDSKHGTILFGAVDHGKYAGDLYTIPIINTLQNRGYKDPIQFQVTLQG 335
               A+ L    S    G   FG  D  ++ G++  +P+    + + Y + +QF      
Sbjct: 223 F---AFYLGDEKSSKNGGEATFGGYDPSRFEGEIKWLPV----RRKAYWE-VQFD----- 269

Query: 336 IGVSHGERDENMTTLTTTKIPVLLDSGTTISYMPADLVEMIASEVGATYSPDYGYYIMDC 395
            G+  G++   +           +D+GT++  +P+ + + + +E+GA  S + G Y +DC
Sbjct: 270 -GIKLGDKFMKLEGHGAA-----IDTGTSLITLPSQIADFLNNEIGAKKSWN-GQYTIDC 322

Query: 396 INEMEEESSLIFDFGGFYIANWLSNFQLLTDSRSNVCILGIAPQS-----DPAIILGDNF 450
             + E    L  +   FY  N+  +    T   S  CI  I P        P  I+GD F
Sbjct: 323 -KKRESLPKLTLN---FYNHNFTIDPFDYTLEISGSCISAITPMDFPQPVGPLSIIGDAF 378

Query: 451 LVSTYVVYDLDNMEISMAHA 470
           L   Y +YDL+N  + +A +
Sbjct: 379 LRRFYSIYDLENNAVGLAKS 398

>NCAS0C01360 Chr3 complement(249141..250361) [1221 bp, 406 aa] {ON}
           Anc_8.677
          Length = 406

 Score = 88.2 bits (217), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 109/442 (24%), Positives = 174/442 (39%), Gaps = 102/442 (23%)

Query: 43  RKYGDSFESATNDTK-ARARLVTRGDDYELVELTNQ-NSFYSVELDIGTPPQKVTVLVDT 100
            KY + FE A  +   +R        D   V LTN  N+ Y  ++ +GTPPQ   V++D 
Sbjct: 52  HKYMNHFERANPEVSFSRDHPFFAEGDGHNVPLTNYLNAQYFADISVGTPPQNFKVILD- 110

Query: 101 GSSDLWVTGSDNPYCFTEGEDTSGSSFKHVNKDNLVSVVESVFTEISYDTTMVTSVATAT 160
                  TGS N +                                              
Sbjct: 111 -------TGSSNLWV--------------------------------------------- 118

Query: 161 IGNTASTSQAMNCTTYGTFDTSKSSTFESNKTEFSITYGDSTFASGTWGHDRLSLNNLNV 220
               +S   ++ C  +  +D   SS++++N T+F+I YG  +   G    D L++ +L +
Sbjct: 119 ---PSSECNSLACFLHSKYDHDASSSYKANGTKFAIQYGSGSL-EGYISQDTLNIGDLTI 174

Query: 221 TGLSFAVANETNSTVGVLGI--GLPGLESTYSGVSLSSAQKSYTYNNFPMILKNSGAIKS 278
               FA A          G   G+ GL   Y  +S+      + YN     L +    K 
Sbjct: 175 PKQDFAEATSEPGLTFAFGKFDGILGL--AYDTISVDKVVPPF-YNAIEQGLLDE---KK 228

Query: 279 TAYSLFTNHSDSKHG-TILFGAVDHGKYAGDLYTIPIINTLQNRGYKDPIQFQVTLQGIG 337
            A+ L     D K+G  I  G +D  K+ GD+  +P+    + + Y     ++V  +GI 
Sbjct: 229 FAFYLGDTKKDEKNGGEITIGGIDESKFKGDIEWLPV----RRKAY-----WEVKFEGIA 279

Query: 338 VSHGERDENMTTLTTTKIPVLLDSGTTISYMPADLVEMIASEVGATYSPDYGYYIMDCIN 397
           +  G++   +           +D+GT++  +P+ L E+I +E+GA      G Y +DC +
Sbjct: 280 L--GDQYAALENHGAA-----IDTGTSLITLPSGLAEIINTEIGAKKGWT-GQYTLDC-D 330

Query: 398 EMEEESSLIFDFGGFYIANWLSNFQL----LTDSRSNVCILGIAPQS-----DPAIILGD 448
             +    L F+F G        NF +     T   S  CI  I P        P  I+GD
Sbjct: 331 TRDGLPDLTFNFNG-------KNFTISPFDYTLEVSGSCISAIMPMDFPEPMGPMAIVGD 383

Query: 449 NFLVSTYVVYDLDNMEISMAHA 470
            FL   Y +YDLDN  + +A A
Sbjct: 384 AFLRKYYSIYDLDNHAVGLAEA 405

>KLTH0D11264g Chr4 (920981..922234) [1254 bp, 417 aa] {ON} highly
           similar to uniprot|P07267 Saccharomyces cerevisiae
           YPL154C PEP4 Vacuolar aspartyl protease (proteinase A)
           required for the posttranslational precursor maturation
           of vacuolar proteinases synthesized as a zymogen
           self-activates
          Length = 417

 Score = 86.7 bits (213), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 104/419 (24%), Positives = 166/419 (39%), Gaps = 115/419 (27%)

Query: 72  VELTNQ-NSFYSVELDIGTPPQKVTVLVDTGSSDLWVTGSDNPYCFTEGEDTSGSSFKHV 130
           V L+N  N+ Y  E+ +GTPPQ   V++DTGSS+LWV                       
Sbjct: 93  VPLSNYLNAQYFTEITLGTPPQSFKVILDTGSSNLWVP---------------------- 130

Query: 131 NKDNLVSVVESVFTEISYDTTMVTSVATATIGNTASTSQAMNCTTYGTFDTSKSSTFESN 190
             D   S+   + ++ S+D               AS+S   N T                
Sbjct: 131 -SDECGSLACFLHSKYSHD---------------ASSSYKANGTN--------------- 159

Query: 191 KTEFSITYGDSTFASGTWGHDRLSLNNLNVTGLSFAVANETNSTV-------GVLGIGLP 243
              F+I YG  +   G    D LS+ +L +    FA A              G+LG+G  
Sbjct: 160 ---FAIQYGSGSL-EGYISQDTLSIGDLTIPKQDFAEATSEPGLAFAFGKFDGILGLG-- 213

Query: 244 GLESTYSGVSLSSAQKSYTYNNFPMILK--NSGAIKSTAYSLFTNHSDSKH---GTILFG 298
                Y  +++            P + K  N G +    ++ + N++D      G + FG
Sbjct: 214 -----YDTIAVDKV--------VPPVYKAINDGLLDEPRFAFYLNNADDSEESTGEVTFG 260

Query: 299 AVDHGKYAGDLYTIPIINTLQNRGYKDPIQFQVTLQGIGVSHGERDENMTTLTTTKIPVL 358
            +D  KY G++  +P+    + + Y     ++V   GIG+      +    L  T   + 
Sbjct: 261 GIDSSKYKGNITWLPV----RRKAY-----WEVKFDGIGLG-----DEYAELEGTGAAI- 305

Query: 359 LDSGTTISYMPADLVEMIASEVGATYSPDYGYYIMDCINEMEEESSLIFDFGG--FYIAN 416
            D+GT++  +P+ L E++ +E+GA      G Y +DC    ++   L F F G  F I+ 
Sbjct: 306 -DTGTSLIALPSGLAEVLNAEIGAKKGWS-GQYTVDC-ESRDQLPDLTFTFNGKNFTISA 362

Query: 417 WLSNFQLLTDSRSNVCILGIAPQS-----DPAIILGDNFLVSTYVVYDLDNMEISMAHA 470
           +    ++     S  CI    P        P  I+GD FL   Y VYDL N  + +A A
Sbjct: 363 YDYTLEV-----SGSCISAFTPMDFPEPVGPLAIIGDAFLRKFYSVYDLGNNAVGLAQA 416

>KLLA0F22088g Chr6 (2064310..2065986) [1677 bp, 558 aa] {ON} weakly
           similar to uniprot|Q66RD4 Saccharomyces cerevisiae
           YDR349C YPS7 Putative GPI-anchored aspartic protease
           located in the cytoplasm and endoplasmic reticulum
          Length = 558

 Score = 86.7 bits (213), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 90/303 (29%), Positives = 144/303 (47%), Gaps = 41/303 (13%)

Query: 201 STFASGTWGHDRLSLNN-----LNVTGLSFAVANETNSTV-GVLGIGLPGLESTYSGVSL 254
           ST  +GT  +D   L N     L +   SF +ANET S V G LG+  P        VS 
Sbjct: 126 STLKNGTSLNDSNVLWNETQGWLTINSTSFILANETGSLVHGALGLSGPISVPASDSVSS 185

Query: 255 SSAQKSYTYNNFPMILKNSGAIKSTAYSLFTNHSDSKH-----------GTILFGAVDHG 303
            +   SY    F   LKN+G I++++YSL+ N++ S H           GT+L G+VD  
Sbjct: 186 LNFDDSYY---FLTHLKNAGVIETSSYSLWVNNA-SNHSVDGQINRANAGTLLLGSVDPK 241

Query: 304 KYAGDLYT---IPIINTLQNRGYKDPIQFQVTLQGIGVSHGERDENMTTLTTTKIPVLLD 360
            Y GDL +   IP  +  ++ GY       V +  + +++ E++    T ++   PV + 
Sbjct: 242 YYDGDLISFGSIPFKD--ESSGYLSTGYPIVPMSRVSIANSEQEAVNLTDSSFLQPVFIH 299

Query: 361 SGTTISYMPADLVEMIASEVGATYSPDYGYYIMDC-INEMEEESSLIFDFGGFYIA---- 415
           S    SY+P  L+  ++ +  A Y      +++ C I +M   S+LIF+FG   I+    
Sbjct: 300 SRYLYSYLPLSLIIQVSIQTNAVYVESLDRWLVACDIGDMG--SNLIFEFGNLNISVPTV 357

Query: 416 -------NWLSNFQLLTDSRSNVCILGIAPQSDPAI-ILGDNFLVSTYVVYDLDNMEISM 467
                  N  SN  L   +    C L + P    +  +LG +F+ + Y+V+D+DN  I++
Sbjct: 358 DFLGATYNMYSNSSLRFTNGKEACYLKMYPNYATSFSVLGQSFIKNAYIVHDVDNSNIAL 417

Query: 468 AHA 470
           A A
Sbjct: 418 AQA 420

>NDAI0E02105 Chr5 complement(429293..430519) [1227 bp, 408 aa] {ON}
          Length = 408

 Score = 85.1 bits (209), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 84/313 (26%), Positives = 138/313 (44%), Gaps = 44/313 (14%)

Query: 170 AMNCTTYGTFDTSKSSTFESNKTEFSITYGDSTFASGTWGHDRLSLNNLNVTGLSFAVAN 229
           ++ C  +  +D  KSS+++ N T+F+I YG  +   G    D L++ +LN+    FA A 
Sbjct: 127 SLACYLHSKYDHDKSSSYKPNGTDFAIRYGTGSL-EGYISQDTLNIGDLNIPKQDFAEAT 185

Query: 230 ETNSTVGVLGI--GLPGLESTYSGVSLSSAQKSYTYNNFPMILKNSGAIKSTAYSLF-TN 286
                    G   G+ GL   Y  +S++     + YN     L +    K  A+ L   N
Sbjct: 186 SEPGLTFAFGKFDGILGL--AYDSISVNKVVPPF-YNAIEQELLDE---KKFAFYLGDAN 239

Query: 287 HSDSKHGTILFGAVDHGKYAGDLYTIPIINTLQNRGYKDPIQFQVTLQGIGVSHGERDEN 346
                 G I  G +D  K+ GD+  +P+    + + Y     ++V  +GIG+  G++   
Sbjct: 240 KKSEDGGEITIGGIDKTKFKGDIDWLPV----RRKAY-----WEVKFEGIGL--GDQFAE 288

Query: 347 MTTLTTTKIPVLLDSGTTISYMPADLVEMIASEVGATYSPDYGYYIMDCINEMEEESSLI 406
           +           +D+GT++  +P+ L E+I +E+GA      G Y ++C +       L 
Sbjct: 289 LENHGAA-----IDTGTSLIALPSGLAEIINTEIGAKKGWT-GQYTVEC-DARPNLPDLT 341

Query: 407 FDFGGFYIANWLSNFQL----LTDSRSNVCILGIAPQS-----DPAIILGDNFLVSTYVV 457
           F+F G        NF +     T   S  CI  I P        P  I+GD FL   Y +
Sbjct: 342 FNFNG-------KNFTIGPYDYTLEVSGSCISAIMPMDFPEPVGPMAIIGDAFLRKYYSI 394

Query: 458 YDLDNMEISMAHA 470
           YDL+N  + +A A
Sbjct: 395 YDLENNAVGLAEA 407

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 33/108 (30%), Positives = 51/108 (47%), Gaps = 5/108 (4%)

Query: 78  NSFYSVELDIGTPPQKVTVLVDTGSSDLWV----TGSDNPYCFTEGEDTSGSSFKHVNKD 133
           N+ Y  ++ +GTPPQ   V++DTGSS+LWV     GS   Y  ++ +    SS+K    D
Sbjct: 91  NAQYFADITLGTPPQSFKVILDTGSSNLWVPSVECGSLACYLHSKYDHDKSSSYKPNGTD 150

Query: 134 NLVSV-VESVFTEISYDTTMVTSVATATIGNTASTSQAMNCTTYGTFD 180
             +     S+   IS DT  +  +         +TS+      +G FD
Sbjct: 151 FAIRYGTGSLEGYISQDTLNIGDLNIPKQDFAEATSEPGLTFAFGKFD 198

>TBLA0B03830 Chr2 complement(880233..881474) [1242 bp, 413 aa] {ON}
           Anc_8.677 YPL154C
          Length = 413

 Score = 84.0 bits (206), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 108/451 (23%), Positives = 180/451 (39%), Gaps = 115/451 (25%)

Query: 44  KYGDSFESATNDT---------KARARLVTRGDDYELVELTN-QNSFYSVELDIGTPPQK 93
           KY + +E A  +          K  + +V++   +E V L+N  N+ Y  ++ IGTPPQ 
Sbjct: 53  KYLNQYERANPEVEFSREHPFYKISSEIVSKNGGHE-VPLSNYMNAQYFADIKIGTPPQS 111

Query: 94  VTVLVDTGSSDLWVTGSDNPYCFTEGEDTSGSSFKHVNKDNLVSVVESVFTEISYDTTMV 153
             V++DT        GS N +                                       
Sbjct: 112 FKVVLDT--------GSSNLW--------------------------------------- 124

Query: 154 TSVATATIGNTASTSQAMNCTTYGTFDTSKSSTFESNKTEFSITYGDSTFASGTWGHDRL 213
             V +   G+ A       C  +  ++  +SST+++N + F+I YG  +   G    D +
Sbjct: 125 --VPSKECGSLA-------CYLHSKYNHDESSTYKANGSAFAIQYGSGSL-EGYISQDVM 174

Query: 214 SLNNLNVTGLSFAVANETNSTVGVLGI--GLPGLESTYSGVSLSSAQKSYTYNNFPMILK 271
            + +L +T   FA A          G   G+ GL   Y  ++++       YN       
Sbjct: 175 EIGDLKITKQDFAEATSEPGISFAFGKFDGILGL--AYDTIAVNRVVPP-VYNAI----- 226

Query: 272 NSGAIKSTAYSLF---TNHSDSKHGTILFGAVDHGKYAGDLYTIPIINTLQNRGYKDPIQ 328
           N G +    ++ +    + S    G  +FG +D  K+ GD+  +P+    + + Y     
Sbjct: 227 NQGLLDEPKFAFYLGDASKSKDNGGEAVFGGIDETKFEGDITWLPV----RRKAY----- 277

Query: 329 FQVTLQGIGVSHGERDENMTTLTTTKIPVLLDSGTTISYMPADLVEMIASEVGATYSPDY 388
           ++V L+G+G+      E  T L        +D+GT++  +P+ L E+I SE+GA      
Sbjct: 278 WEVKLEGLGLG-----EEYTELENHG--AAIDTGTSLITLPSGLAEIINSEIGAKKGWT- 329

Query: 389 GYYIMDCINEMEEESSLIFDFGGFYIANWLSNFQL----LTDSRSNVCILGIAPQS---- 440
           G Y ++C ++      + F F G+       NF +     T   S  CI  I P      
Sbjct: 330 GQYTIEC-DKRASLPDMTFTFDGY-------NFTISPYDYTLEVSGSCISAITPMDFPEP 381

Query: 441 -DPAIILGDNFLVSTYVVYDLDNMEISMAHA 470
             P  I+GD FL   Y VYDL N  + +A A
Sbjct: 382 VGPMAIIGDAFLRKYYSVYDLGNDAVGLAPA 412

>TPHA0D01260 Chr4 (262523..263782) [1260 bp, 419 aa] {ON} Anc_8.677
           YPL154C
          Length = 419

 Score = 84.0 bits (206), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 100/411 (24%), Positives = 165/411 (40%), Gaps = 98/411 (23%)

Query: 72  VELTNQ-NSFYSVELDIGTPPQKVTVLVDTGSSDLWVTGSDNPYCFTEGEDTSGSSFKHV 130
           V L+N  N+ Y  ++ +GTP Q   V++DTGSS+LWV   D                   
Sbjct: 94  VPLSNYLNAQYYTDISLGTPKQNFKVILDTGSSNLWVPSKD------------------- 134

Query: 131 NKDNLVSVVESVFTEISYDTTMVTSVATATIGNTASTSQAMNCTTYGTFDTSKSSTFESN 190
                                  TS+A               C  +  +D  +S+T+E N
Sbjct: 135 ----------------------CTSLA---------------CYLHSKYDHDESTTYEKN 157

Query: 191 KTEFSITYGDSTFASGTWGHDRLSL-NNLNVTGLSFAVANETNSTVGVLGI--GLPGLES 247
            T+F+I YG  +   G    D L + ++L +    FA A          G   G+ GL  
Sbjct: 158 GTKFTIQYGSGSM-DGYISRDTLIIGDDLVIPEQDFAEATSEPGLAFAFGKFDGILGL-- 214

Query: 248 TYSGVSLSSAQKSYTYNNFPMILKNSGAIKSTAYSLF---TNHSDSKHGTILFGAVDHGK 304
            Y  ++++     + YN         G +    ++ +   TN  +   G   FG  D  K
Sbjct: 215 AYDTIAVNKVVPPF-YNAI-----KQGILDENKFAFYLGDTNKDNKSGGEATFGGYDKSK 268

Query: 305 YAGDLYTIPIINTLQNRGYKDPIQFQVTLQGIGVSHGERDENMTTLTTTKIPVLLDSGTT 364
           + GD+  +P+    + + Y     ++V    I +     DE     +       +D+GT+
Sbjct: 269 FTGDITWLPV----RRKAY-----WEVKFDSIALG----DE---VASLDGYGAAIDTGTS 312

Query: 365 ISYMPADLVEMIASEVGATYSPDYGYYIMDCINEMEEESSLIFDFGGFYIANWLSNFQLL 424
           +  +P+ L E+I +++GA  S   G Y +DC +  +    + F+F G+   N+  +    
Sbjct: 313 LITLPSGLAEVINTQIGAKKSWS-GQYTIDC-DTRDALPDMTFNFNGY---NFTVSPYDY 367

Query: 425 TDSRSNVCILGIAPQS-----DPAIILGDNFLVSTYVVYDLDNMEISMAHA 470
           T   S  CI  I P        P  I+GD FL   Y +YDLDN  + +A +
Sbjct: 368 TLEMSGSCISAITPMDFPEPVGPLAIIGDAFLRKYYSIYDLDNNAVGLAKS 418

>Smik_5.6 Chr5 (4120..4488) [369 bp, 123 aa] {ON} YIR039C (REAL)
          Length = 123

 Score = 77.4 bits (189), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 46/105 (43%), Positives = 62/105 (59%), Gaps = 5/105 (4%)

Query: 165 ASTSQAMNCTTYGTFDTSKSSTFESNKTEFSITYGDSTFASGTWGHDRLSLNNLNVTGLS 224
           +S S +  C  +GTF    SSTF+ N T+F  TYGD T+  GT+G D +SL N+ +   S
Sbjct: 22  SSESYSTLCAYWGTFSARNSSTFKCNDTQFDETYGDGTYYRGTYGTDVVSLGNITLESFS 81

Query: 225 FAVANETNSTVGVLGIGLPGLESTYSGVSLSSAQKS--YTYNNFP 267
           F VAN T +  G+LGI LP  E+T+   SL  A  +  + Y NFP
Sbjct: 82  FGVANNTENQGGILGISLPAGENTH---SLGGAYNTTPFEYENFP 123

>SAKL0H06512g Chr8 complement(573927..575141) [1215 bp, 404 aa] {ON}
           highly similar to uniprot|P07267 Saccharomyces
           cerevisiae YPL154C PEP4 Vacuolar aspartyl protease
           (proteinase A) required for the posttranslational
           precursor maturation of vacuolar proteinases synthesized
           as a zymogen self-activates
          Length = 404

 Score = 80.5 bits (197), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 101/413 (24%), Positives = 163/413 (39%), Gaps = 104/413 (25%)

Query: 72  VELTNQ-NSFYSVELDIGTPPQKVTVLVDTGSSDLWVTGSDNPYCFTEGEDTSGSSFKHV 130
           V LTN  N+ Y  E+ +GTPPQ   V++DT        GS N +                
Sbjct: 81  VPLTNYLNAQYYTEISLGTPPQNFKVILDT--------GSSNLW---------------- 116

Query: 131 NKDNLVSVVESVFTEISYDTTMVTSVATATIGNTASTSQAMNCTTYGTFDTSKSSTFESN 190
                                    V +A  G+ A       C  +  +D   SS++++N
Sbjct: 117 -------------------------VPSAECGSLA-------CFLHAKYDHDSSSSYKAN 144

Query: 191 KTEFSITYGDSTFASGTWGHDRLSLNNLNVTGLSFAVANETNSTVGVLGI--GLPGLEST 248
            + F+I YG  +   G    D LS+ +L +    FA A          G   G+ GL   
Sbjct: 145 GSSFAIQYGSGSL-EGYISQDTLSIGDLTIPKQDFAEATSEPGLAFAFGKFDGILGL--A 201

Query: 249 YSGVSLSSAQKSYTYNNFPMILKNSGAIKSTAYSLFTNHSD--SKHGTILFGAVDHGKYA 306
           Y  +S+        YN       ++G +    +S +  ++D  +  G   FG +D  KY 
Sbjct: 202 YDSISVDKVVPP-VYNAI-----HNGLLDEPKFSFYLGNADKSTDGGEATFGGIDSSKYE 255

Query: 307 GDLYTIPIINTLQNRGYKDPIQFQVTLQGIGVSHGERDENMTTLTTTKIPVLLDSGTTIS 366
           G++  +P+    + + Y     ++V   GIG+      +    L      +  D+GT++ 
Sbjct: 256 GNITWLPV----RRKAY-----WEVKFDGIGLG-----DEYAILDGHGAAI--DTGTSLI 299

Query: 367 YMPADLVEMIASEVGATYSPDYGYYIMDCINEMEEESSLIFDFGGFYIANWLSNFQL--- 423
            +P+ L E++ +E+GA      G Y ++C +  +    L  +FGG+       NF +   
Sbjct: 300 ALPSGLAEILNAEIGAKKGWS-GQYSVEC-DTRDSLPDLTLNFGGY-------NFTITPY 350

Query: 424 -LTDSRSNVCILGIAPQS-----DPAIILGDNFLVSTYVVYDLDNMEISMAHA 470
             T   S  CI    P        P  I+GD FL   Y VYDL N  + +A A
Sbjct: 351 DYTLEVSGSCISAFTPMDFPEPVGPLAIIGDAFLRKHYSVYDLGNDAVGLAKA 403

>KAFR0H02420 Chr8 complement(462759..464009) [1251 bp, 416 aa] {ON}
           Anc_8.677 YPL154C
          Length = 416

 Score = 80.5 bits (197), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 122/493 (24%), Positives = 192/493 (38%), Gaps = 121/493 (24%)

Query: 1   MKLSTIKFVVNALL-LHSSMVFADSIISQSSEINDGYVKMNFQR-------KYGDSFESA 52
           MKL     +  AL+ L S+      I  Q  E+ D   K++F +       KY  +FE A
Sbjct: 1   MKLQLSSLLPLALVVLDSANAEPHRIKLQKQELTDDISKLSFDQHMAHLGSKYVTAFEKA 60

Query: 53  TNDTKAR------ARLVTRGDDYEL---VELTNQ-NSFYSVELDIGTPPQKVTVLVDTGS 102
             DT            + +  D +    V L N  N+ Y  ++ IG+P Q   V++DTGS
Sbjct: 61  HPDTVLSRDHPFFKNFIDKHFDAQQNHEVPLNNYLNAQYFADISIGSPGQTFRVIMDTGS 120

Query: 103 SDLWVTGSDNPYCFTEGEDTSGSSFKHVNKDNLVSVVESVFTEISYDTTMVTSVATATIG 162
           S+LWV   D   C       S + F H   D+ V                          
Sbjct: 121 SNLWVPSVD---C------NSLACFLHNKYDHRV-------------------------- 145

Query: 163 NTASTSQAMNCTTYGTFDTSKSSTFESNKTEFSITYGDSTFASGTWGHDRLSLNNLNVTG 222
                                SST+  N T F+I YG      G   +D +++ +L +  
Sbjct: 146 ---------------------SSTYVRNGTRFAIRYGSGAL-EGYMSNDTVTVGDLQIPK 183

Query: 223 LSFAVANETNSTVGVLGI--GLPGLESTYSGVSLSSAQKSYTYNNFPMILKNSGAIKSTA 280
             FA A          G   G+ GL   +  +S++ A   + YN       N G + +  
Sbjct: 184 QDFAEATSEPGLAFAFGKFDGIFGL--AFDTISVNRAVPPF-YNAV-----NRGLLDAPQ 235

Query: 281 YSLFTNHSDSKH--GTILFGAVDHGKYAGDLYTIPIINTLQNRGYKDPIQFQVTLQGIGV 338
           ++ +      +   G + FG  D  ++ G++  +P+    +   Y     ++V   GI  
Sbjct: 236 FAFYLGDKRLRKEGGEVTFGGYDETRFTGNITWLPV----RREAY-----WEVDFNGI-- 284

Query: 339 SHGERDENMTTLTTTKIPVLLDSGTTISYMPADLVEMIASEVGATYSPDYGYYIMDCINE 398
           S G +      LT T   +  D+GT++  +P+ L E++ +++GA  +   G Y++DC + 
Sbjct: 285 SFGSQ---YAPLTATGAAI--DTGTSLITLPSGLAEILNAQIGARKNWS-GQYVLDC-SR 337

Query: 399 MEEESSLIFDFGGFYIANWLSNFQL----LTDSRSNVCILGIAPQS-----DPAIILGDN 449
                 + F+ GG       SNF +     T   S  CI  I P        P  I+GD 
Sbjct: 338 RSTLPDITFNLGG-------SNFSIGPYDYTLEASGTCISAIVPMDFPEPVGPLAIIGDA 390

Query: 450 FLVSTYVVYDLDN 462
           FL   Y VYDL N
Sbjct: 391 FLRRWYSVYDLGN 403

>TPHA0E01920 Chr5 (393982..395856) [1875 bp, 624 aa] {ON} Anc_5.401
           YDR349C
          Length = 624

 Score = 76.6 bits (187), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 95/364 (26%), Positives = 156/364 (42%), Gaps = 65/364 (17%)

Query: 166 STSQAMNCTTYGTFD--TSKSSTFESNKTEFSITYGDSTFASGTWGHDRLSLNNL----- 218
           ST +  +C    +F+  TS SS    +   FS+ + DS   +GT+  D L+ +NL     
Sbjct: 83  STCETSSCVVTSSFNNQTSNSSVLLQDGQIFSLDFIDSISLNGTFYKDDLTCSNLVQPLK 142

Query: 219 ---------------------NVTGLSFAVANETNS-TVGVLGIGLPGLESTYSGVSLSS 256
                                 +  LSF  A +    T+G LG+      S  SG SL  
Sbjct: 143 LNESLKSPDGLYTTNTTDDSITLVALSFINAIDYQGLTIGSLGLA-SSTTSDLSGASLDF 201

Query: 257 AQKSYTYNNFPMILKNSGAIKSTAYSL--------FTNHSDSKH------GTILFGAVDH 302
              S+++  +   L NS  I + +YSL        +TN +          G ++ GAVD 
Sbjct: 202 VDDSFSFLTY---LSNSEVIDTPSYSLWLGGDTLPYTNMTSINSTTIDYCGNLVLGAVDQ 258

Query: 303 GKYAGDLYTIPIINTLQNRGYKDPIQFQVTLQGIGVSHGERDE-NMTTLTTTKI--PVLL 359
             Y G L    ++  L N    + + + + +  +G  + E        LTTT    PVLL
Sbjct: 259 RYYEGRLVQFDMLPALLNN-VTEAVTYGLPIIPMGPIYIENSSGTQLNLTTTNFLEPVLL 317

Query: 360 DSGTTISYMPADLVEMIASEVGATYSPDYGYYIMDCINEMEEESSLIFDFGGFYIANWLS 419
           DS  T + +P + V  IA+++ A Y  ++G +I++C +  E   +L F+F G  I   L+
Sbjct: 318 DSRYTNARLPLNTVIQIATQLNAAYVEEFGSWIVEC-SLAEMNVNLNFNFQGLTIPVSLN 376

Query: 420 NFQ------------LLTDSRSNVCILGIAPQSDPAI-ILGDNFLVSTYVVYDLDNMEIS 466
           +F               ++S  + C L + P +D    ILG  FL + Y+  D +   ++
Sbjct: 377 DFLSRVINSTTGEPIKFSESSEDACALAVYPNTDIGFNILGGPFLKNIYLAIDNEGRSVA 436

Query: 467 MAHA 470
           +A A
Sbjct: 437 IAKA 440

>Kpol_1013.6 s1013 (10059..11267) [1209 bp, 402 aa] {ON}
           (10059..11267) [1209 nt, 403 aa]
          Length = 402

 Score = 75.9 bits (185), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 102/414 (24%), Positives = 161/414 (38%), Gaps = 106/414 (25%)

Query: 72  VELTNQ-NSFYSVELDIGTPPQKVTVLVDTGSSDLWVTGSDNPYCFTEGEDTSGSSFKHV 130
           + L+N  N+ Y  ++ +GTP Q   V++DTGSS+LWV   D   C       S + + H 
Sbjct: 79  IPLSNYLNAQYYTDITLGTPAQSFKVILDTGSSNLWVPSVD---C------NSLACYLHA 129

Query: 131 NKDNLVSVVESVFTEISYDTTMVTSVATATIGNTASTSQAMNCTTYGTFDTSKSSTFESN 190
             D+                                               S SST++ N
Sbjct: 130 KYDH-----------------------------------------------SDSSTYKKN 142

Query: 191 KTEFSITYGDSTFASGTWGHDRLSLNNLNVTGLSFAVANETNSTVGVLGI--GLPGLEST 248
            T FSI YG  +   G    D L + +L + G  FA A          G   G+ GL   
Sbjct: 143 GTTFSIQYGSGSM-EGYISQDVLQIGDLVIPGQDFAEATSEPGLAFAFGKFDGILGL--A 199

Query: 249 YSGVSLSSAQKSYTYNNFPMILKNSGAIKSTAYSLFTNHSDSKH---GTILFGAVDHGKY 305
           Y  ++++     + YN       N   +    +S +    D+K    G + FG  D   +
Sbjct: 200 YDTIAVNRVVPPF-YNAI-----NKKLVDEPIFSFYLG-DDTKSEDGGQVTFGGYDSSLF 252

Query: 306 AGDLYTIPIINTLQNRGYKDPIQFQVTLQGIGVSHGERDENMTTLTTTKIPVLLDSGTTI 365
            GD+  +P+    + + Y     ++V    I + +   D              +D+GT++
Sbjct: 253 TGDITWLPV----RRKAY-----WEVKFDAIALGNEVAD-------LVNHGAAIDTGTSL 296

Query: 366 SYMPADLVEMIASEVGATYSPDYGYYIMDCINEMEEESSLIFDFGGFYIANWLSNFQL-- 423
             +P+ L E+I S++GA  S   G +I+DC    +    + F F G+       NF +  
Sbjct: 297 ITLPSGLAEVINSQIGAKKSWS-GQWIVDC-KTRDTLPDMTFTFDGY-------NFTITP 347

Query: 424 --LTDSRSNVCILGIAPQSDPA-----IILGDNFLVSTYVVYDLDNMEISMAHA 470
              T   S  CI  I P   PA      I+GD FL   Y +YD+ N  + +A A
Sbjct: 348 YDYTLEVSGSCISAITPMDFPAPVGPLAIVGDAFLRRYYSIYDVGNNAVGLAAA 401

>Ecym_1324 Chr1 complement(662306..664036) [1731 bp, 576 aa] {ON}
           similar to Ashbya gossypii ACR150W
          Length = 576

 Score = 76.3 bits (186), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 91/325 (28%), Positives = 138/325 (42%), Gaps = 50/325 (15%)

Query: 176 YGT--FDTSKSSTFESNKTEFSITYGDSTFASGTWGHDRLSLNNLNVTGLSFAVANETNS 233
           YG+   D +  ++ ES+ TE     GD T     W       + L++   SF  A  +N 
Sbjct: 122 YGSAGIDIANFTSVESSGTE-----GDPTNTQVQW----FGKHTLSIPEFSFFRAEHSNI 172

Query: 234 TVGVLGIGLPGLESTYSGVSLSSAQKSYTYNNFPMILKNSGAIKSTAYSLFTNHSDSKH- 292
             G LG+G        SG +  S+    ++    M LKN+  IKST+YS++  + +S   
Sbjct: 173 VDGSLGLG----ARILSGTAEDSSGFDSSFFFLDM-LKNANFIKSTSYSIWLGNDNSTLN 227

Query: 293 ---------GTILFGAVDHGKYAGDLYTIPIINTLQNRGYKDPIQFQ----VTLQGIGVS 339
                    GT+L GAVD   + G+ Y   +   L  R  K    F     V L  + + 
Sbjct: 228 ASRLASSDVGTLLLGAVDPNYFIGNFYRFKM---LPFRDSKTETTFNSLPIVPLTKVDIV 284

Query: 340 HGERDENMTTLTTTKIPVLLDSGTTISYMPADLVEMIASEVGATYSPDYGYYIMDCINEM 399
           + +      T      PVLLD   TISY+P +L+  IA +  A Y      +++DC +  
Sbjct: 285 NAKGTAVNVTQPGFMEPVLLDPRYTISYLPIELILQIAMQTNAVYVKSLDLWLVDC-DVA 343

Query: 400 EEESSLIFDFGGFYIANWLSNF-------------QLLTDSRSNVCILGIAPQSDPAI-I 445
             ++ + F FG   I   LS+F             QL   + +  C L + P       I
Sbjct: 344 NFDAKIRFQFGDLKIDVPLSHFVSSGYVGSPIASTQL--GASNMTCQLNVYPNYSSGFSI 401

Query: 446 LGDNFLVSTYVVYDLDNMEISMAHA 470
           LG  FL S Y+  DL+   ++MA A
Sbjct: 402 LGGTFLRSVYLSVDLEGNSVAMAQA 426

>TDEL0A06230 Chr1 (1091257..1092483) [1227 bp, 408 aa] {ON}
           Anc_8.677 YPL154C
          Length = 408

 Score = 75.1 bits (183), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 86/312 (27%), Positives = 133/312 (42%), Gaps = 39/312 (12%)

Query: 170 AMNCTTYGTFDTSKSSTFESNKTEFSITYGDSTFASGTWGHDRLSLNNLNVTGLSFAVAN 229
           ++ C  +  +D S SS+++ N T+F+I YG  +   G    D LS+ +L +    FA A 
Sbjct: 124 SLACFLHSKYDHSASSSYKPNGTDFAIQYGSGSL-EGYISQDTLSVGDLVIPKQDFAEAT 182

Query: 230 ETNSTVGVLGI--GLPGLESTYSGVSLSSAQKSYTYNNFPM-ILKNSGAIKSTAYSLFTN 286
                    G   G+ GL   Y+ +S+      + YN     +L           S  + 
Sbjct: 183 SEPGLAFAFGKFDGILGL--AYNTISVDKVVPPF-YNAIDQDLLDEPRFAFYLGDSSDSE 239

Query: 287 HSDSKHGTILFGAVDHGKYAGDLYTIPIINTLQNRGYKDPIQFQVTLQGIGVSHGERDEN 346
            S    G   FG +D  K+ G++  +P+    + + Y     ++V  +GIG+      + 
Sbjct: 240 DSSVSGGVATFGGIDKSKFKGEISWLPV----RRKAY-----WEVKFEGIGLG-----DE 285

Query: 347 MTTLTTTKIPVLLDSGTTISYMPADLVEMIASEVGATYSPDYGYYIMDCINEMEEESSL- 405
              L      +  D+GT++  +P+ L E+I SE+GA      G Y +DC    E  SSL 
Sbjct: 286 FAILDGHGAAI--DTGTSLITLPSGLAEIINSEIGAKKGWS-GQYTVDC----ETRSSLP 338

Query: 406 --IFDFGGFYIANWLSNFQLLTDSRSNVCILGIAPQS-----DPAIILGDNFLVSTYVVY 458
              F+F G    N+       T   S  CI  I P        P  I+GD FL   Y VY
Sbjct: 339 DLTFNFSG---KNYTIGPYDYTLEVSGSCISAITPMDFPEPVGPLAIVGDTFLRRFYSVY 395

Query: 459 DLDNMEISMAHA 470
           DL N  + +A A
Sbjct: 396 DLGNNAVGLAKA 407

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 42/144 (29%), Positives = 67/144 (46%), Gaps = 6/144 (4%)

Query: 43  RKYGDSFESATNDTKARARLVTRGDDYELVELTNQ-NSFYSVELDIGTPPQKVTVLVDTG 101
           +KY   +E A  +     +     +D   V LTN  N+ Y  ++ +GTP Q   V++DTG
Sbjct: 52  QKYLTQYEKAYPEISFSRKHPFFAEDNHDVPLTNYLNAQYYTDISLGTPAQNFKVILDTG 111

Query: 102 SSDLWVTGSD--NPYCF--TEGEDTSGSSFKHVNKDNLVSVVE-SVFTEISYDTTMVTSV 156
           SS+LWV   D  +  CF  ++ + ++ SS+K    D  +     S+   IS DT  V  +
Sbjct: 112 SSNLWVPSVDCGSLACFLHSKYDHSASSSYKPNGTDFAIQYGSGSLEGYISQDTLSVGDL 171

Query: 157 ATATIGNTASTSQAMNCTTYGTFD 180
                    +TS+      +G FD
Sbjct: 172 VIPKQDFAEATSEPGLAFAFGKFD 195

>ACR144W Chr3 (603306..604532) [1227 bp, 408 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPL154C (PEP4);
           Tandem gene duplication in this genome
          Length = 408

 Score = 72.0 bits (175), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 72/335 (21%), Positives = 135/335 (40%), Gaps = 45/335 (13%)

Query: 149 DTTMVTSVATATIGNTASTSQAMNCTTYGTFDTSKSSTFESNKTEFSITYGDSTFASGTW 208
           D  +V    ++T+       +AM C  +  +D  +SST++ N T   +TYG  +   G  
Sbjct: 105 DFRVVVDTGSSTLWVPGKECRAMACRLHKRYDHDRSSTYKENGTLTGVTYGSGSIM-GYV 163

Query: 209 GHDRLSLNNLNVTGLSFAVANETNSTV-------GVLGIGLPGLESTYSGVSLSSAQKSY 261
             D   +++L + G  F    +   +V       G+LG+  P L     GV+    Q   
Sbjct: 164 SEDTFRISDLEIPGQQFTETTDEPGSVFVFAAFDGILGLAYPSLG---YGVTPPFQQ--- 217

Query: 262 TYNNFPMILKNSGAIKSTAYSLFTN--HSDSKHGTILFGAVDHGKYAGDLYTIPIINTLQ 319
                   L     +K   + ++ +   +   +G ++ G  D  K+ G++  +P+    +
Sbjct: 218 --------LMEKKLVKEPVFGMYLDDMKTGEGNGQLVLGGYDETKFKGEIAWLPV----R 265

Query: 320 NRGYKDPIQFQVTLQGIGVSHGERDENMTTLTTTKIPVLLDSGTTISYMPADLVEMIASE 379
            + Y     ++V    + V     D+N   +        +DSGT++   P++L     S+
Sbjct: 266 RQAY-----WEVVFDSVTVG----DDN---IPLENYGAAIDSGTSLITFPSELFNQFISK 313

Query: 380 VGATYSPDYGYYIMDCINEMEEESSLIFDFGGFYIANWLSNFQLLTDSRSNVCILGIAP- 438
           +        G   +DC N+ +    L F FGG   +    ++ +    +S  C+  I   
Sbjct: 314 LSGVTKDRQGNVYVDCANK-QTAPPLTFGFGGHKFSISGEDYIISVPGQSARCMPAIVQL 372

Query: 439 ---QSDPAIILGDNFLVSTYVVYDLDNMEISMAHA 470
               +    I+GD FL   Y +YD  N  + +A A
Sbjct: 373 DIDSAGKVAIIGDVFLRRYYSIYDFGNNAVGLATA 407

 Score = 49.3 bits (116), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 33/51 (64%), Gaps = 1/51 (1%)

Query: 62  LVTRGDDYELVELTN-QNSFYSVELDIGTPPQKVTVLVDTGSSDLWVTGSD 111
           L  + +D  + EL N  N+ Y+ ++ IGTPPQ   V+VDTGSS LWV G +
Sbjct: 73  LFAKNNDGHVSELANLANNIYAADVTIGTPPQDFRVVVDTGSSTLWVPGKE 123

>ACR150W Chr3 (614407..616068) [1662 bp, 553 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR349C (YPS7)
          Length = 553

 Score = 69.7 bits (169), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 86/344 (25%), Positives = 150/344 (43%), Gaps = 55/344 (15%)

Query: 172 NCTTYGTFDTSKSSTFESNKTE-FSITYGDSTFASGTWGHDRLSLNNLNVTGLSFAVANE 230
           NC T   +    S T+ +   E +++T  D    SG  G++ ++ N  +V      V   
Sbjct: 85  NCLTGNLYFPKASETYHAGDGETYNLTMADGIQISGLLGYEEVNFNRSDVRVRDGNVHLA 144

Query: 231 TNSTVGVLGIGLPGLEST-----YSGVSLS-----------SAQKSYTYNNFPMILKNSG 274
               V V  +G   LE+T     ++G+ LS           +A+ S  +  F   ++++G
Sbjct: 145 PREGVKVERMGF--LEATTMTDIHAGLGLSGRVNNPDPLGDAARGSEFF--FLDKMRDAG 200

Query: 275 AIKSTAYSLFTNHSDSKH----------GTILFGAVDHGKYAGDLYT---IPIINTLQNR 321
            I S +YSL+  + ++            GT++ GAVD   Y G+ Y    +P ++    +
Sbjct: 201 LISSRSYSLWFGNDNTSAVDLPTVLEDIGTLMLGAVDPRLYYGNFYQYDGVPSVDIASGQ 260

Query: 322 ----GYKDPIQFQVTLQGIGVSHGERDENMTTLTTTKIPVLLDSGTTISYMPADLVEMIA 377
               GY  PI     +Q +G     R  N+T  T  + PVLL+S    S++P  +V+ IA
Sbjct: 261 HTRGGY--PIVPLTRVQLLGTEG--RQLNLTDDTFAE-PVLLNSRFMTSFLPKSIVQQIA 315

Query: 378 SEVGATYSPDYGYYIMDCINEMEEESSLIFDFGGFYIANWLSNF----------QLLTDS 427
            +  A ++      I++C + ++EE+S  F FG   +   LS+F           +L   
Sbjct: 316 RQTNAVFTKSSNRLIVEC-SLLKEEASFRFHFGELVVEVPLSDFIGPTNLRAGTSILAPD 374

Query: 428 RSNVCILGIAPQSDPAI-ILGDNFLVSTYVVYDLDNMEISMAHA 470
            +  C L + P +     +LG   L   Y+  D ++  + MA A
Sbjct: 375 TNETCYLKLMPSTGMGFSMLGMPILRKLYIAADTESGAVGMALA 418

>CAGL0M02211g Chr13 complement(264202..265449) [1248 bp, 415 aa]
           {ON} similar to uniprot|P07267 Saccharomyces cerevisiae
           YPL154c PEP4 aspartyl protease Saccharopepsin precursor
          Length = 415

 Score = 68.6 bits (166), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 120/498 (24%), Positives = 193/498 (38%), Gaps = 115/498 (23%)

Query: 1   MKLSTIKFVVNALLLHSSMVFADSIISQSS----EINDGYVKMNFQ-------RKYGDSF 49
           M+LS    +  AL+L     +AD+ + Q+     ++    +++ F+        KY   +
Sbjct: 1   MRLSLSVLMPLALMLLGD--YADAKVFQAELKKEKLTKEMLELGFEAHVQQLGHKYVSQY 58

Query: 50  ESATNDTKARARLVTRGDDYELVELTN-QNSFYSVELDIGTPPQKVTVLVDTGSSDLWVT 108
           E A   T      +   D    V L+N  ++ Y  ++ +GTPPQK  V++DT        
Sbjct: 59  EKANPGTVLPRDHLFYPDQVHNVPLSNYMDAQYFADISLGTPPQKFKVILDT-------- 110

Query: 109 GSDNPYCFTEGEDTSGSSFKHVNKDNLVSVVESVFTEISYDTTMVTSVATATIGNTASTS 168
           GS N +                                         V +   G+ A   
Sbjct: 111 GSSNLW-----------------------------------------VPSVDCGSLA--- 126

Query: 169 QAMNCTTYGTFDTSKSSTFESNKTEFSITYGDSTFASGTWGHDRLSLNNLNVT------- 221
               C  +  +D S+SST+  +    SI+YG  +   G    D L + +L +        
Sbjct: 127 ----CFLHNKYDHSQSSTYIKDGRPLSISYGSGSI-EGYISEDNLQIGDLTIQNQKFGET 181

Query: 222 ----GLSFAVANETNSTVGVLGIGLPGLESTYSGVSLSSAQKSYTYNNFPMILKNSGAIK 277
               GL+FA         G+LG+    +          SA + +  +      K S  +K
Sbjct: 182 TSEPGLAFAFGKFD----GILGLAYDTIAQDDITPPFYSAIQQHLLDES----KFSFYLK 233

Query: 278 STAYSLFTNHSDSKHGTILFGAVDHGKYAGDLYTIPIINTLQNRGYKDPIQFQVTLQGIG 337
           S         S S  G    G VD  K+ GDL  IP+   ++ + Y     ++V L  I 
Sbjct: 234 SVNDPAAEGGSASDGGVFTLGGVDSSKFKGDL--IPL--HVRRQAY-----WEVPLNAIK 284

Query: 338 VSHGERDENMTTLTTTKIPVLLDSGTTISYMPADLVEMIASEVGATYSPDYGYYIMDCIN 397
           +     D++   L  T   +  D+GT++  +P+D+ E+I +++GA      G Y ++C +
Sbjct: 285 LG----DQSTGKLENTGAAI--DTGTSLITLPSDMAEIINAQIGAKKGWT-GQYTLEC-S 336

Query: 398 EMEEESSLIFDFGGFYIANWLSNFQLLTDSRSNVCILGIAPQSDPA-----IILGDNFLV 452
              +   L F   G      LS F+  T   S  CI  I P   P       ILGD FL 
Sbjct: 337 TRAKLPDLTFTLDGHDFV--LSPFE-YTLEVSGSCISVITPMDFPEPIGRMAILGDAFLR 393

Query: 453 STYVVYDLDNMEISMAHA 470
             Y V+DLD   +S+A A
Sbjct: 394 RYYSVFDLDANVVSLAEA 411

>Kwal_55.20034 s55 (223867..225648) [1782 bp, 593 aa] {ON} YDR349C
           (YPS7) - GPI-anchored aspartic protease [contig 157]
           FULL
          Length = 593

 Score = 66.2 bits (160), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 62/197 (31%), Positives = 98/197 (49%), Gaps = 26/197 (13%)

Query: 293 GTILFGAVDHGKYAGDLY---TIPIINT---LQNRGYKDPIQFQVTLQGIGV-SHGERDE 345
           G ++FG VD   Y GDL    T+P  N    + +RGY  PI   V L  + V S   + +
Sbjct: 241 GILIFGGVDRSLYTGDLVKIDTLPYYNVRTGVTSRGY--PI---VPLVKVDVKSKSGQVK 295

Query: 346 NMTTLTTTKIPVLLDSGTTISYMPADLVEMIASEVGATYSPDYGYYIMDCINEMEEESSL 405
           N+T+    + PVLLD+    +Y+P DL+  IA++  A Y      +++ C +  +  +S+
Sbjct: 296 NLTSEYFLE-PVLLDTRYRYNYLPLDLIVKIATQANAYYVESLNRWLLAC-DVGKLGASI 353

Query: 406 IFDFGGFYIANWLSNFQLLT-DSRSN----------VCILGIAPQSDPAI-ILGDNFLVS 453
           +FDFG   I   LS+    T DS +N           C L   P SD    ILG  F+ +
Sbjct: 354 LFDFGEVVIDVPLSDLMGPTYDSTTNGTLYFSNADQACELRFLPNSDLGFSILGGPFIKN 413

Query: 454 TYVVYDLDNMEISMAHA 470
            Y+  +L + ++++A A
Sbjct: 414 VYLAAELQSNQVALAQA 430

>Skud_4.618 Chr4 complement(1101382..1103142) [1761 bp, 586 aa] {ON}
           YDR349C (REAL)
          Length = 586

 Score = 65.1 bits (157), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 75/283 (26%), Positives = 127/283 (44%), Gaps = 43/283 (15%)

Query: 241 GLPGL--ESTYSGVSLSSAQKSYT-YNNFPMILKNSGAIKSTAYSLFTNHSDSKH----- 292
           GL GL  + T  G  + S+Q  YT Y+ F  +LK++  I+S +YSL+     S +     
Sbjct: 180 GLLGLSGKVTNPGTDIDSSQ--YTEYSYFLSLLKDANFIESPSYSLWLAGDTSTYKTYRD 237

Query: 293 -----GTILFGAVDHGKYAGDLYTIPIINTLQNRGYKDPIQFQVTL----QGIG----VS 339
                G +L G VD   + G L    +I       Y DP+   +T+      +G    VS
Sbjct: 238 PILNCGKLLLGGVDPSLFTGTLGQFDLI------PYADPVTNAITIGYPIVPLGPIYIVS 291

Query: 340 HGERDENMTTLTTTKIPVLLDSGTTISYMPADLVEMIASEVGATYSPDYGYYIMDCINEM 399
           +     NMT+      P LLDS +++SY+P   +  IA ++ ATY      +++ C +  
Sbjct: 292 NSGESLNMTSKDFLS-PALLDSTSSVSYLPTSTIIQIAVQIAATYVESLDRWLVQC-SMA 349

Query: 400 EEESSLIFDFGGFYIANWL-----------SNFQLLTDSRSNVCILGIAPQSDPAI-ILG 447
           +   +L F     +I   L           +N  +L  S    C L +   ++  + ILG
Sbjct: 350 DMGVTLAFRLRDLFIEIPLRDLLSSTYDTSTNSSMLFSSGQEACFLTLYANTNTGLNILG 409

Query: 448 DNFLVSTYVVYDLDNMEISMAHADFSDGGEYIDTIKDSVPSAL 490
           + F+ + Y+  DL++  I++A A   +    ID   ++  SA+
Sbjct: 410 EAFMKNIYMAMDLEDNTIAIAQAKKVEDDAVIDDANETTTSAV 452

>TDEL0E02230 Chr5 (427831..429552) [1722 bp, 573 aa] {ON} Anc_5.401
           YDR349C
          Length = 573

 Score = 64.7 bits (156), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 85/311 (27%), Positives = 146/311 (46%), Gaps = 41/311 (13%)

Query: 189 SNKTEFSITYGDSTFASGTWGHDRLSLNNLNVTGLSFAVANETNSTVGVLGIGLPGLEST 248
           +N ++ S TY   + ++   G D +S++N++    ++A    +  T G LG+G       
Sbjct: 126 TNISDVSGTYSIDSSSTAIIGSDYMSISNISFFETNYA----SFYTAGSLGLG----GRI 177

Query: 249 YSGVSLSSAQKSYTYNNFPMILKNSGAIKSTAYSLF----TNHSDSKH---------GTI 295
             G +   ++K  +   F   L N G IK+ +YSL+    T   D +          G +
Sbjct: 178 SDGSAAIDSEKFDSSFFFLDRLMNLGIIKTPSYSLWFGADTVPYDRRKLASGTMADCGKL 237

Query: 296 LFGAVDHGKYAGDLYT---IPIINTL-QNRGYKDPIQFQVTLQGIGVSHGERDENMTTLT 351
           + GAVD   Y G L +   IP I+ + Q +    PI    T+  I  ++G +  NMT+  
Sbjct: 238 ILGAVDPSLYTGILRSFKMIPFIDPVSQAQSNNYPILPLGTIY-INSANG-KSLNMTSEE 295

Query: 352 TTKIPVLLDSGTTISYMPADLVEMIASEVGATYSPDYGYYIMDCINEMEEESSLIFDFGG 411
             + PVLLDS  + +Y+P D +  IA ++GAT+      +++ C +  + + SL F FG 
Sbjct: 296 FVE-PVLLDSRYSTTYLPIDAIVQIAVQIGATFVESLDKWLVAC-SVAKLDVSLDFTFGN 353

Query: 412 FYIANWLSNFQLLT-DSRSN----------VCILGIAPQSDPAI-ILGDNFLVSTYVVYD 459
             I   L +F + T D +SN           C L +  +      +LG  FL + Y+  D
Sbjct: 354 IEIRVPLEDFLVTTYDPKSNTSLHFSTGEEACFLAMVSKDKTGYNVLGGPFLKNLYMAVD 413

Query: 460 LDNMEISMAHA 470
           +++  I++A A
Sbjct: 414 IEDSSIAIAQA 424

>KLTH0E02596g Chr5 (235803..237593) [1791 bp, 596 aa] {ON} weakly
           similar to uniprot|Q66RD4 Saccharomyces cerevisiae
           YDR349C YPS7 Putative GPI-anchored aspartic protease
           located in the cytoplasm and endoplasmic reticulum
          Length = 596

 Score = 64.3 bits (155), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 55/198 (27%), Positives = 94/198 (47%), Gaps = 26/198 (13%)

Query: 293 GTILFGAVDHGKYAGDLY---TIPIINTLQ---NRGYKDPIQFQVTLQGIGV-SHGERDE 345
           G ++FGAVD   Y GD     TIP  N      +RGY  PI   + L  + V S     +
Sbjct: 241 GKVIFGAVDTSLYTGDFVKFDTIPFHNARTGETSRGY--PI---IPLTKVNVQSKSGETK 295

Query: 346 NMTTLTTTKIPVLLDSGTTISYMPADLVEMIASEVGATYSPDYGYYIMDCINEMEEESSL 405
           NMT+ +  + PVL+DS    +Y+P +++  IA +  A Y      +++ C +     +S+
Sbjct: 296 NMTSDSFLE-PVLIDSRFRYNYLPLEIIVQIAMQANAYYVESLNRWLLAC-DVGRLGASI 353

Query: 406 IFDFGGFYIANWLSNFQ-----------LLTDSRSNVCILGIAPQSDPAI-ILGDNFLVS 453
           IF+FG   I   L+N             L   ++   C L + P +     +LG  F+ +
Sbjct: 354 IFEFGNLSINVPLNNLMGPTFDSDTNGTLHFSNKQQACELKLLPSTASGFNVLGGAFIKN 413

Query: 454 TYVVYDLDNMEISMAHAD 471
            Y+  +L++ ++++A A 
Sbjct: 414 VYMAAELESNQVALAQAQ 431

>Smik_4.613 Chr4 complement(1098592..1100382) [1791 bp, 596 aa] {ON}
           YDR349C (REAL)
          Length = 596

 Score = 61.6 bits (148), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 85/337 (25%), Positives = 147/337 (43%), Gaps = 57/337 (16%)

Query: 169 QAMNCTT----YGTFDTSKSSTFESNKTEFSITYGDSTFASGTWGHDRLSLNNLNVTGLS 224
           +A+NCT         D S  ++  +  TE   T G+  F SG+     LS++N++     
Sbjct: 128 RAVNCTLITDDMNFTDISSENSSGTLVTELLKTRGNVQFNSGS-----LSISNVSF---- 178

Query: 225 FAVANETNSTVGVLGIGLPGLESTYSGVSLSSAQKSYTYNNFPMILKNSGAIKSTAYSL- 283
           F+V +    T G+LG+         +  S    ++SY    F  +LK+   I+S +YSL 
Sbjct: 179 FSVESSNFKTSGLLGLSGKITNPGSAADSSHYTEQSY----FLSLLKDVNLIESPSYSLW 234

Query: 284 -------FTNHSDSKH--GTILFGAVDHGKYAGDLYTIPIINTLQNRGYKDPIQFQVT-- 332
                  +  H D  +  G +L G VD   + G L    +I       Y DP+   V+  
Sbjct: 235 LAGDTSTYQTHRDPIYNCGKLLLGGVDPSLFTGTLGKFDLI------PYVDPVSSAVSTG 288

Query: 333 --LQGIG----VSHGERDENMTTLTTTKIPVLLDSGTTISYMPADLVEMIASEVGATYSP 386
             +  +G    VS+  +  NMT+      P LLDS +++SY+P + +  IA ++ ATY  
Sbjct: 289 YPIVPLGPIYIVSNSGQSLNMTSKDFLS-PALLDSTSSVSYLPTNTIIQIAVQIAATYVE 347

Query: 387 DYGYYIMDC------------INEMEEESSLIFDFGGFYIANWLSNFQLLTDSRSNVCIL 434
               +++ C            + E+  E  L       Y  +  +N  +   S    C L
Sbjct: 348 SLDRWLVQCSMANMGVSLGFTLRELVIEIPLRDLLSSTYDTS--TNSSMFFSSGQEACFL 405

Query: 435 GIAPQSDPAI-ILGDNFLVSTYVVYDLDNMEISMAHA 470
            +   ++  + ILG+ F+ + Y+  DL++  I++A A
Sbjct: 406 TLYANTNTGLNILGEAFMKNIYMAMDLEDNTIAIAQA 442

>ZYRO0A06578g Chr1 (533368..535530) [2163 bp, 720 aa] {ON} similar
           to uniprot|Q66RD4 Saccharomyces cerevisiae YDR349C YPS7
           Putative GPI-anchored aspartic protease located in the
           cytoplasm and endoplasmic reticulum
          Length = 720

 Score = 60.8 bits (146), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 103/429 (24%), Positives = 180/429 (41%), Gaps = 71/429 (16%)

Query: 76  NQNSFYSVELDIGTPPQKVTVLVDTGSSDLWVTGSDNPYCFTEGEDTSGSSFKHVNKDNL 135
           + NS Y   + IGTP QK  +++D      WVT     +   E  D   S+     + NL
Sbjct: 171 DNNSLYYTNVSIGTPGQKQPLVIDIVEPYNWVT-----HNHFESHDPISSNSSGSYQSNL 225

Query: 136 VSVVESVFTEISYDTTMVTSVATATIGNTASTSQAMNCTTYGTFDTSKSSTFESNKTEFS 195
               + V      D + V  +    + +  +T+  M+  ++ +      S+   N T+  
Sbjct: 226 SRTSQQV------DGSHVFHLDFVDLDDINATAM-MDKISFESLSLKNQSSHTINNTQ-- 276

Query: 196 ITYGDSTFASGTWGHDRLSLNNLNVTGLSFAVANETNSTVGVLGIGLPGLESTYSGVSLS 255
               D + A   +    L+L+N      SF   N+T S+ GVLG+G    +    G  + 
Sbjct: 277 ---NDGSGA--LYNSHSLTLSNS-----SFFEINDTTSSKGVLGLGG---KINDKGTDID 323

Query: 256 SAQKSYTYNNFPM-ILKNSGAIKSTAYSLFTNHSDSKH-------------GTILFGAVD 301
           S+Q   ++  F +  L+++G I+S +YSL+       +             G ++ G VD
Sbjct: 324 SSQFDSSF--FLLESLRDNGIIESLSYSLWLGGDTRPYYDVGRNVPDEINCGKLILGGVD 381

Query: 302 HGKYAGDLYTIPII------NTLQNRGYKD-PIQFQVTLQGIGVSHGERDENMTTLTTTK 354
              Y+G L     +        + +RGY   P++    +   G S    +EN  T     
Sbjct: 382 PYYYSGPLKKFNNLIFLDSRTDMLSRGYPVLPMRTINVVSATGNSINVTNENFLT----- 436

Query: 355 IPVLLDSGTTISYMPADLVEMIASEVGATYSPDYGYYIMDC-INEMEEESSLIFDFGGFY 413
            PVLLDS  + S++PA+ +  IA +V A Y  +   +++ C I +M    ++ F+FG   
Sbjct: 437 -PVLLDSRYSFSHLPAETIVQIAVQVNAIYMKEVDMFVVSCKIADM--GVNIQFEFGDVS 493

Query: 414 IANWLSNFQLLTDSRS-----------NVCILGIAPQSDPAI-ILGDNFLVSTYVVYDLD 461
           I     +F + T +               C + +    +    ILG +FL + Y+  D D
Sbjct: 494 IDVPFKDFLMSTHNPETNSTMKFSGGDEACFMTMVSSEETGFNILGTSFLRNVYLAVDHD 553

Query: 462 NMEISMAHA 470
           +  I++A A
Sbjct: 554 DQSIAIAQA 562

>AGR407C Chr7 complement(1475317..1476123) [807 bp, 268 aa] {ON}
           Non-syntenic homolog of Saccharomyces cerevisiae YPL154C
           (PEP4)
          Length = 268

 Score = 58.9 bits (141), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 73/297 (24%), Positives = 128/297 (43%), Gaps = 40/297 (13%)

Query: 182 SKSSTFESNKTEFSITYGDSTFASGTWGHDRLSLNNLNVTGLSFAVANETNSTVGVLGIG 241
           + SST++S+  E  +  G  +   G    D L + +  +    FA   E  S+V      
Sbjct: 3   ANSSTYKSSGEEVELASGTGSM-QGYLSTDVLGMGDAVLGEQGFA---EATSSV------ 52

Query: 242 LPGLESTYSGVSLSSAQKSYTYNNFPMI--LKNSGAIKSTAYSLF--TNHSDSKHGTILF 297
           LP + S Y GV     ++       P I  +   G +K   + +F   N +    G I+F
Sbjct: 53  LPFIAS-YQGVFGLGHRELAKGGQVPPIYNMMERGQLKDPMFGIFLPKNLAHINEGEIIF 111

Query: 298 GAVDHGKYAGDLYTIPIINTLQNRGYKDPIQFQVTLQGIGVSHGERDENMTTLTTTKIPV 357
           G  D  K+AG L  +PI      +G+ + ++F        +S GE     +T+    +  
Sbjct: 112 GGYDSTKFAGSLEWLPIT----KKGFWE-VEFN------SISTGE-----STVQGEGLGA 155

Query: 358 LLDSGTTISYMPADLVEMIASEVGATYSPDYGYYIMDCINEMEEESSLIFDFGGFYIANW 417
           +LD+G++++ +P ++ +     + A      G  +     E   E  ++F+ GG   A  
Sbjct: 156 ILDTGSSLTLLPTEIFDKFNGALEAALGSKTGGRVSCSARETAPE--IVFELGGKKFAIT 213

Query: 418 LSNFQLLTDSRSNVCILGIAPQSDPA----IILGDNFLVSTYVVYDLDNMEISMAHA 470
            + + +   S    C++ I PQ+  A    +ILG  FL   Y VYDL +  + +A A
Sbjct: 214 GNEYIMPAGSE---CMVTIRPQASGAQSNVVILGTPFLRKFYSVYDLGSDRVGLAEA 267

>YDR349C Chr4 complement(1172386..1174176) [1791 bp, 596 aa] {ON}
           YPS7Putative GPI-anchored aspartic protease, member of
           the yapsin family of proteases involved in cell wall
           growth and maintenance; located in the cytoplasm and
           endoplasmic reticulum
          Length = 596

 Score = 59.7 bits (143), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 88/340 (25%), Positives = 154/340 (45%), Gaps = 63/340 (18%)

Query: 169 QAMNCT------TYGTFDTSKSSTFESNKTEFSITYGDSTFASGTWGHDRLSLNNLNVTG 222
           +A+NCT       +    +  SST  +  T+  +T  +  F SG+     LS++N++   
Sbjct: 128 RAVNCTLVTDDMNFTNVSSENSST--ALITDLMVTRDNVQFNSGS-----LSISNVSF-- 178

Query: 223 LSFAVANETNSTVGVLGIGLPGLESTYSGVSLSSAQKSYTYNN-FPMILKNSGAIKSTAY 281
             F + +    T G+LG  L G + T  G ++ S+Q  YT  + F  +LK++  I+S++Y
Sbjct: 179 --FDIQSSNFKTSGLLG--LSG-KVTNPGNAIDSSQ--YTEQSYFLSLLKDADIIESSSY 231

Query: 282 SL--------FTNHSD--SKHGTILFGAVDHGKYAGDLYTIPIINTLQNRGYKDPIQFQV 331
           SL        +  + D  S  G +L G VD   + G L    +I       Y DP+   V
Sbjct: 232 SLWLAGDTSTYKTYRDPISNCGKLLLGGVDPSLFTGTLGKFDLI------PYVDPVSNAV 285

Query: 332 T----LQGIG----VSHGERDENMTTLTTTKIPVLLDSGTTISYMPADLVEMIASEVGAT 383
           +    +  +G    VS+  +  NMT+      P LLDS +++SY+P   +  IA ++ AT
Sbjct: 286 SVGYPIVPLGPIYIVSNSGQSLNMTSKDFLS-PALLDSTSSVSYLPTSTIIQIAVQIAAT 344

Query: 384 YSPDYGYYIMDC------------INEMEEESSLIFDFGGFYIANWLSNFQLLTDSRSNV 431
           Y      +++ C            + E+  E  L       Y  +  +N  +   S    
Sbjct: 345 YVESLDRWLVQCSIADMGVSLGFRLRELTIEIPLRDLLSSTYDTS--TNSSMFFSSGQEA 402

Query: 432 CILGIAPQSDPAI-ILGDNFLVSTYVVYDLDNMEISMAHA 470
           C L +   ++  + ILG+ F+ + Y+  DL++  I++A A
Sbjct: 403 CFLTLYANTNTGVNILGEAFIKNIYMAMDLEDNTIAIAQA 442

>ACR143W Chr3 (601369..602550) [1182 bp, 393 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPL154C (PEP4);
           Tandem gene duplication in this genome
          Length = 393

 Score = 57.4 bits (137), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 72/314 (22%), Positives = 124/314 (39%), Gaps = 56/314 (17%)

Query: 173 CTTYGTFDTSKSSTFESNKTEFSITY--GDSTFASGTWGHDRLSLNNLNVTGLSFAVANE 230
           C T   + +  SSTF++      + Y  GD   A     +D L      +    F  A  
Sbjct: 119 CRTRNRYRSGASSTFKATDKTLRLQYVKGD---AKARVSYDTLYFAGAKIENQGFGEAEA 175

Query: 231 TNSTV------GVLGIGLPGLESTYSGVSLSSAQKSYTYNNFPMI--LKNSGAIKSTAYS 282
                      G++GIG P                S  Y   P I  L +SG +K   + 
Sbjct: 176 IGDDFSGARFDGIIGIGYP----------------SIGYGIKPPINTLIDSGGLKDPMFG 219

Query: 283 LFTNHSDSKH---GTILFGAVDHGKYAGDLYTIPIINTLQNRGYKDPIQFQVTLQGIGVS 339
           ++ +++ +++   G I+ G  +  K+ GD+  +P++             ++  L    V 
Sbjct: 220 IYISNAQNRNSPVGEIVLGGYNTQKFKGDIKWLPVLRKAF---------WETDLSAFKVG 270

Query: 340 HGERDENMTTLTTTKIPVLLDSGTTISYMPAD-LVEMIASEVGATYSPDYGYYIMDCINE 398
           +         L    +  + D+G++   MP D   + ++   GA++  D G   +DC + 
Sbjct: 271 N-------FALDVQGLTAVFDTGSSFIIMPEDTYTDFVSQFPGASH--DDGTDYVDC-ST 320

Query: 399 MEEESSLIFDFGGFYIANWLSNFQLLTDSRSNVCILGIAPQSD--PAIILGDNFLVSTYV 456
           +     L  DFGG  +A  LS    +     N CIL ++  S     +ILGD FL   Y 
Sbjct: 321 VNSGPDLTLDFGG--VALKLSARDYVMQLGRNTCILAVSGNSRVTGEVILGDTFLRRYYT 378

Query: 457 VYDLDNMEISMAHA 470
           +Y+  +  I +A A
Sbjct: 379 IYNFGDNTIGVASA 392

 Score = 41.6 bits (96), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 30/79 (37%), Positives = 40/79 (50%), Gaps = 5/79 (6%)

Query: 77  QNSFYSVELDIGTPPQKVTVLVDTGSSDLWVTGSD--NPYCFTEGEDTSGSS--FKHVNK 132
           +N  YSV++ +GTP Q   V +DTGSS LW+      +  C T     SG+S  FK  +K
Sbjct: 79  ENFQYSVDITLGTPAQNFRVALDTGSSLLWIPSDRCTSQICRTRNRYRSGASSTFKATDK 138

Query: 133 D-NLVSVVESVFTEISYDT 150
              L  V       +SYDT
Sbjct: 139 TLRLQYVKGDAKARVSYDT 157

>NDAI0C04610 Chr3 complement(1052297..1054126) [1830 bp, 609 aa]
           {ON} Anc_5.401 YDR349C
          Length = 609

 Score = 56.6 bits (135), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 100/418 (23%), Positives = 171/418 (40%), Gaps = 56/418 (13%)

Query: 81  YSVELDIGTPPQKVTVLVDTGSSDLW-VTGSDNPYCFTEGEDTSGSSFKHVNKDNLVSVV 139
           Y + + +GTP Q+  +++DT     W ++GS +  C          S  +V K++  ++ 
Sbjct: 45  YYINITMGTPEQQQELMIDTSQPYTWLLSGSQDLQCNRLNSGCLSGSLYYV-KESTSAIC 103

Query: 140 ESVFTEISYDTTMVTSVATATIGNTASTSQAMNCTTYGTFDTSKSSTFESNKTEFSITYG 199
                 I+ + T   +    +  N       MN T                  + +  Y 
Sbjct: 104 ------INPNRTYHMAFIDQSEINGTHVIDMMNFT----------------NVDVNTAYA 141

Query: 200 DSTF-ASGTWGHDRLSLNNLNVTGLSFAVANETNSTVGVLGIGLPGLESTYSGVSLSSAQ 258
            ST+      G   L  N L V+ +SF  A++T     +  +GL G + T +G  + S+ 
Sbjct: 142 HSTYNTKNNKGLINLGTNYLGVSNVSFINADDT-VPYAMGSLGLSG-KITGTGTDIDSSN 199

Query: 259 KSYTYNNFPMILKNSGAIKSTAYSLF------------TNHSDSKHGTILFGAVDHGKYA 306
              +Y +F   L  +  I S +YSL+             N   S  G ++ GAVD   + 
Sbjct: 200 FDNSY-DFLDRLYQTNLIDSHSYSLWLAMNQTYNGTRVQNSVTSSFGKLILGAVDPTLFT 258

Query: 307 GDLYTIPIINTLQNRGYKDPIQFQVTLQG--IGVSHGERDENMTTLTTTKIPVLLDSGTT 364
           G      ++  L++    + I + +   G    VS      N+T+    + PV LDS  T
Sbjct: 259 GSFLQFEMLPALESDSATETIGYPIIPMGPIYVVSKSGEMANVTSKDFLE-PVFLDSTYT 317

Query: 365 ISYMPADLVEMIASEVGATYSPDYGYYIMDCINEMEEESSLIFDFGGFYIANWLSNFQLL 424
            +Y+P +++  +A ++GA Y      +++ C N   + ++L F F    I   L++    
Sbjct: 318 STYLPLNMIIQVAIQIGAMYVESLERWLVPC-NIANQHATLDFTFQDVSIRVPLTDLLGT 376

Query: 425 T-DSRSN----------VCILGI-APQSDPAIILGDNFLVSTYVVYDLDNMEISMAHA 470
           T DS +N           C L I + Q     ILG  FL   Y+  DLD   I++A A
Sbjct: 377 TYDSSTNTSMHFSTGDEACYLKIFSNQMTGYNILGRPFLKHVYMAVDLDGNNIAIAQA 434

>Suva_2.520 Chr2 complement(929574..931370) [1797 bp, 598 aa] {ON}
           YDR349C (REAL)
          Length = 598

 Score = 55.8 bits (133), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 67/264 (25%), Positives = 117/264 (44%), Gaps = 41/264 (15%)

Query: 248 TYSGVSLSSAQKSYTYNNFPM-ILKNSGAIKSTAYSLFTNHSDSKH----------GTIL 296
           T SG    S+Q  +T N+F + +L ++  I+  +YSL+     S +          G +L
Sbjct: 200 TDSGTDYDSSQ--FTENSFFLSLLTDASFIECPSYSLWLAGDTSTYQSYKESIPDCGKLL 257

Query: 297 FGAVDHGKYAGDLYTIPIINTLQNRGYKDPIQFQVT----LQGIG----VSHGERDENMT 348
            G VD   + G L    +I       Y DP+   V+    +  +G    +S+  +  NMT
Sbjct: 258 LGGVDPSLFTGTLGKFDLI------PYVDPVSNVVSTGYPIVPLGPIYIISNSGQSMNMT 311

Query: 349 TLTTTKIPVLLDSGTTISYMPADLVEMIASEVGATYSPDYGYYIMDCINEMEEESSLIFD 408
           +      P LLDS +++SY+P   +  IA ++ ATY      ++++C +  +   +L F 
Sbjct: 312 SKDFLS-PALLDSTSSVSYLPTSTIIQIAVQIAATYVESLDRWLVEC-SMADMGVTLGFM 369

Query: 409 FGGFYIANWLS-----------NFQLLTDSRSNVCILGIAPQSDPAI-ILGDNFLVSTYV 456
           F    I   LS           N  +   S    C L +   ++  + ILG+ F+ + Y+
Sbjct: 370 FRSLTIKIPLSDLLSSTYDTTTNSSMFFSSGQEACFLTLYANTNTGVNILGEAFMKNIYM 429

Query: 457 VYDLDNMEISMAHADFSDGGEYID 480
             DL++  I++A A   + G   D
Sbjct: 430 AVDLEDNSIAIAQAKNIEDGAITD 453

>KAFR0E04080 Chr5 (818320..820110) [1791 bp, 596 aa] {ON} Anc_5.401
           YDR349C
          Length = 596

 Score = 55.8 bits (133), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 112/466 (24%), Positives = 195/466 (41%), Gaps = 81/466 (17%)

Query: 65  RGDDYELVEL-TNQNSFYSVELDIGTPPQKVTVLVDTGSSDLWV-TGSDNPYCFTEGEDT 122
           RG +Y  + +  N    Y V   +G P Q+ ++++DT    LWV +G+    C       
Sbjct: 57  RGIEYVALGVGKNLQGRYYVNASVGEPQQEQSLVLDTTEPYLWVISGNVEMNCTDTNNVC 116

Query: 123 SGSSFKHVNKDNLVSVVESVFTEISYDTTMVTSVATATIGNTASTSQAMNCTTYGTFDTS 182
           + +S  + N+                        +++ +    +    M+   Y +F  +
Sbjct: 117 NANSLYYYNE------------------------SSSAVAIDENADYQMDFLNYVSF--A 150

Query: 183 KSSTFES-NKTEFSI--TYGDSTFASGTWGHDRLSLNNLNVTGLSFAVANETNSTV-GVL 238
            SS  ++ N T+ SI   Y ++   S    +  L+ ++L V  +SF  +    S   GVL
Sbjct: 151 GSSYMDTINFTDISIKNNYTNTLLQSNLSAYVNLTNDHLWVKNVSFLDSTTATSLYSGVL 210

Query: 239 GIGLPGLESTYSGVSLSSAQKSYTYNNFPMILKNSGAIKSTAYSLFTNHSDSK------- 291
           G+G     S     S +     + +N F    K +   +S +YSL+    +S        
Sbjct: 211 GLGGSITSSNEYENSGNYDSSYFIFNKF----KEANITQSNSYSLWLVEDESSLTTTSTK 266

Query: 292 ------HGTILFGAVDHGKYAGDLYTIPIINTLQNRGYKDPIQFQVTLQG-----IGVSH 340
                  G +L G +D   Y G LY   +I       Y DP +  V+ QG     +GV +
Sbjct: 267 FEEEGTFGKLLLGVIDPALYRGSLYQFDMI------PYVDP-ESLVSSQGYPILPMGVIY 319

Query: 341 GERDENMTTLTTTK---IPVLLDSGTTISYMPADLVEMIASEVGATYSPDYGYYIMDCIN 397
            + +       T+K    PVLLDS    +Y+P + +  IA ++GATY      +++ C +
Sbjct: 320 VKSESGARLNVTSKDFLEPVLLDSSQQGNYLPENAIIQIAIQIGATYIESMDRWLVSC-D 378

Query: 398 EMEEESSLIFDFGGFYIANWLSNFQLLTD-----SRSNV--------CILGIAPQSDPAI 444
                +S++F F G  I   L N  LLT+     S S++        C L I   ++   
Sbjct: 379 MASYGASVLFTFDGLEIDVPLEN--LLTNTFETGSNSSIYYSDGETACALTIYDNANMGY 436

Query: 445 -ILGDNFLVSTYVVYDLDNMEISMAHADFSDGGEYIDTIKDSVPSA 489
            +LG  F  +TY+  DL+   +++A A  SD  +  +    ++P+A
Sbjct: 437 NLLGSAFFRNTYIAVDLEGNTVAIAQAKPSDEDDSSNLSATTLPAA 482

>Smik_67.1 Chr67 (653..982) [330 bp, 110 aa] {ON} YGL259W (REAL)
          Length = 110

 Score = 51.2 bits (121), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 24/53 (45%), Positives = 34/53 (64%)

Query: 63  VTRGDDYELVELTNQNSFYSVELDIGTPPQKVTVLVDTGSSDLWVTGSDNPYC 115
           V + DD     L N    Y V+++IGTPPQ   + +DTGSSD++V  +D+PYC
Sbjct: 49  VFKRDDVLNSTLINAVGMYVVKVEIGTPPQTAYLQLDTGSSDMYVNDADSPYC 101

>TBLA0H01680 Chr8 (385315..387144) [1830 bp, 609 aa] {ON} Anc_5.401
           YDR349C
          Length = 609

 Score = 53.9 bits (128), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 65/237 (27%), Positives = 103/237 (43%), Gaps = 46/237 (19%)

Query: 270 LKNSGAIKSTAYSL-FTNHS---DSKH----------GTILFGAVDHGKYAGDLYTIPII 315
           L NSG I++ +YS+ F N S   D+KH          G I+FG VD     G   +  +I
Sbjct: 229 LLNSGVIQTASYSMWFANGSSYIDTKHFPYEEKKSDYGLIVFGGVDSSLIDGTFQSFTMI 288

Query: 316 ------NTLQNRGYK----DPIQFQVTLQGIGVSHGERDENMTTLTTTKIPVLLDSGTTI 365
                 + L   GY      PI          +++  R  N+TTL   + PVLLDS  T 
Sbjct: 289 PYEDTSDGLTTSGYPILPMGPIYI--------IANSGRTLNLTTLDFLE-PVLLDSRITN 339

Query: 366 SYMPADLVEMIASEVGATYSPDYGYYIMDCINEMEEESSLIFDFGGFYIANWLSNFQ--- 422
           S +PA  +  +A ++ A Y      +++ C +  +   +  F FG   I   L +F    
Sbjct: 340 SRLPASFIIQVAIQLEAMYLESLDRWVVPC-SLADYNVNFDFSFGSVRIRVPLEDFLVPS 398

Query: 423 -LLTDSRS-------NVCILGIAPQSDPAI-ILGDNFLVSTYVVYDLDNMEISMAHA 470
            L  D+++       + C L + P +D    ILG  FL +  +  D  + +I++  A
Sbjct: 399 GLTGDNKTIHFSQNEDACYLAMYPNTDIGFNILGTPFLKNAVIAVDHSSSQIAIGKA 455

>NCAS0F03150 Chr6 complement(630327..632264) [1938 bp, 645 aa] {ON}
           Anc_5.401 YDR349C
          Length = 645

 Score = 51.2 bits (121), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 100/423 (23%), Positives = 167/423 (39%), Gaps = 63/423 (14%)

Query: 81  YSVELDIGTPPQKVTVLVDTGSSDLWV-TGSDNPYC-FTEGEDTSGSSFKHVNKDNLVSV 138
           Y V + IG+PPQ+  + +DT    +WV +G+D+  C   +    SG+ F         S 
Sbjct: 51  YYVNVTIGSPPQQEMLRIDTSQPFVWVLSGADDKQCNRLDSGCLSGNRFYPEESTTGESA 110

Query: 139 VESVFTEISYDTTMVTSVATATIGNTASTSQAMNCTTYGTFDTSKSSTFESNKTEFSITY 198
             S    +++  T   + +        + +       Y TF++SK+++         I  
Sbjct: 111 TNSTIYSLNFLDTFRVNGSIVVDNLNFTNTDITAALDYTTFNSSKNNSI--------IDI 162

Query: 199 GDSTFASGTWGHDRLSLNNLNVTGLSFAVANETNSTVGVLGIGLPGLESTYSGVSLSSAQ 258
           GD          D L + N       F  A ++  T     +G  GL ST++     S  
Sbjct: 163 GD----------DFLVIKN-----FGFINAEDSYPT----DMGSLGLSSTFNETLNYSPS 203

Query: 259 KSYTYNNFPMI--LKNSGAIKSTAYSLFTNHSDSK---------------HGTILFGAVD 301
            ++   +F M+  L  SG I S +YSL+  +   +               +G +L G+VD
Sbjct: 204 GNFN-TSFSMLAMLAESGLIDSQSYSLWLGNGAERDTQLSSQRTPDPQYNNGKLLLGSVD 262

Query: 302 HGKYAGDLYTIPIINTLQNRGYKDPIQFQVT-LQGIG-VSHGERDENMTTLTTTKIPVLL 359
              +    Y   ++  +      +   F V  +  I  VS      N+T+    + PVLL
Sbjct: 263 PSLFKEPFYQFDVLPYVDPNTQIESFSFPVIPMNAIYIVSKTGTGTNVTSEDFLE-PVLL 321

Query: 360 DSGTTISYMPADLVEMIASEVGATYSPDYGYYIMDCINEMEEESSLIFDFGGFYIANWLS 419
           +S    +Y+P + +  IA +VGATY      +++ C +   E     F F    I   L 
Sbjct: 322 NSNFRSNYLPLNSIIQIAIQVGATYVESLDRWLLPC-SIANENVHFEFTFDKLNIKAPLI 380

Query: 420 NFQLLT-DSRSN----------VCILGIAPQSDPAI-ILGDNFLVSTYVVYDLDNMEISM 467
           +F   T DS +N           C L + P +      LG  FL S Y+  + +   + M
Sbjct: 381 DFLESTFDSTTNTSMHFSDNSEACFLKLYPNTYVGFNALGRPFLKSVYLAVEQEGRIVGM 440

Query: 468 AHA 470
           A A
Sbjct: 441 AQA 443

>YGL259W Chr7 (8470..8967) [498 bp, 165 aa] {ON}  YPS5Protein with
           similarity to GPI-anchored aspartic proteases such as
           Yap1p and Yap3p
          Length = 165

 Score = 47.8 bits (112), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 31/88 (35%), Positives = 45/88 (51%), Gaps = 7/88 (7%)

Query: 36  YVKMNFQRKYGDSFESATNDTKARARLVTRGDDYELVELTNQNSFYSVELDIGTPPQKVT 95
           YVK   Q K+ D     T D       V + ++     + N    Y V+++IGTPPQ V 
Sbjct: 27  YVKFPVQ-KFADIINIGTQDVST----VFKRNEVLNTTVINGIGVYVVKMEIGTPPQTVY 81

Query: 96  VLVDTGSSDLWVTGSDNPYC--FTEGED 121
           + +DTGSSD+ V  +D  YC   ++G D
Sbjct: 82  LQLDTGSSDMIVNNADIAYCKSMSDGSD 109

>CAGL0A02431g Chr1 complement(261812..263575) [1764 bp, 587 aa] {ON}
           similar to uniprot|Q06325 Saccharomyces cerevisiae
           YDR349c YPS7
          Length = 587

 Score = 50.1 bits (118), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 63/238 (26%), Positives = 101/238 (42%), Gaps = 28/238 (11%)

Query: 270 LKNSGAIKSTAYSL---------FTNHSDSKH-GTILFGAVDHGKYAGDLYTIPIINTLQ 319
           LK +  I S++YSL         F + SD+   G ++FGAVD     G+     +I  + 
Sbjct: 204 LKEARLINSSSYSLWLGSQKRNGFADTSDANEAGYLIFGAVDPNLVEGEFRKFDMIPYIH 263

Query: 320 NRGYKDPIQFQVTLQG---IGVSHGERDENMTTLTTTKIPVLLDSGTTISYMPADLVEMI 376
            +  K    + V   G   I  S G R  N+TT      PVLLD    +SY+P   +  I
Sbjct: 264 PQTGKVAYGYPVVPMGPIYITSSSG-RSLNVTT-DGFSAPVLLDPSFALSYLPTKAIIQI 321

Query: 377 ASEVGATYSPDYGYYIMDCINEMEEESSLIFDFGGFYIANWLSNFQLLTDSRS------- 429
           A ++ A Y      +++ C +     +++ F FG   I   LS+    T  +S       
Sbjct: 322 AIQIAAVYVESLDLWLVSC-DVASSGATVDFSFGDLTIKVPLSDLLASTHDQSTNTTLHF 380

Query: 430 ----NVCILGIAPQSDPAI-ILGDNFLVSTYVVYDLDNMEISMAHADFSDGGEYIDTI 482
                 C+L + P +     +LG  F+ + Y+  DL+   ++M  A     GE  + I
Sbjct: 381 NTGQEACVLQLYPNTFTGYNVLGQAFMKNAYLAVDLEGKGVAMGQAANFKSGERKEII 438

>YGL258W-A Chr7 (9162..9395) [234 bp, 77 aa] {ON} Putative protein
           of unknown function
          Length = 77

 Score = 43.5 bits (101), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 29/79 (36%), Positives = 42/79 (53%), Gaps = 9/79 (11%)

Query: 268 MILKNSGAI-KSTAYSLFTNHSDSKHGTILFGAVDHGKYAGDLYTIPI---INTLQNRGY 323
           M  +  G I K  +YSLF N  +   G+ILFGAVD  KYA +L T P+    NTL +   
Sbjct: 1   MAFERQGKIEKKISYSLFLNGPNVHFGSILFGAVDKSKYAEELCTHPMRQAYNTLDSNS- 59

Query: 324 KDPIQFQVTLQGIGVSHGE 342
               +  +T+Q + +  G+
Sbjct: 60  ----RIIITVQSVAILDGK 74

>SAKL0G07524g Chr7 (624810..626708) [1899 bp, 632 aa] {ON} similar
           to uniprot|Q66RD4 Saccharomyces cerevisiae YDR349C YPS7
           Putative GPI-anchored aspartic protease located in the
           cytoplasm and endoplasmic reticulum
          Length = 632

 Score = 47.8 bits (112), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 100/417 (23%), Positives = 165/417 (39%), Gaps = 70/417 (16%)

Query: 80  FYSVELDIGTPPQKVTVLVDTGSSDLWV-TGSDNPYCFTEGEDTSGSSFKHVNKDNLVSV 138
            Y V   +GTP Q+  + VD     LWV +GS+   C          S  +V +    + 
Sbjct: 45  LYYVNTTLGTPGQEQMLRVDISQPYLWVLSGSEYAQCNRLDSGCLTGSLYYVRQS---TT 101

Query: 139 VESVFTEISYDTTMVTSVATATIGNTASTSQAMNCTTYGTFDTSKSSTFESNKTEFSITY 198
             ++  +  YD   +  ++     N  +    +N T+    D S       N T  ++  
Sbjct: 102 AMNLTRDRVYDMQFMDYISI----NGTAVMDTLNLTS--VIDNSLGKNILENLTNSTV-- 153

Query: 199 GDSTFASGTWGHDRLSLNNLNVTGLSFAVANETNS-TVGVLGIGLPGLESTYSGVSLSSA 257
                      H  L  + L++T +SF   + + S T G LG+G      T  G  ++S 
Sbjct: 154 -----------HWDLDSDTLSMTNVSFINVDYSGSITQGALGLGG---RITAPGEDINSD 199

Query: 258 QKSYTYNNFPMILKNSGAIKSTAYSLFTN------------HSDSKHGTILFGAVDHGKY 305
               ++     ++ N+  I S++YSL+              +++   G ++ GAVD   Y
Sbjct: 200 GFDGSFFFLEQLVANN-VIDSSSYSLWLGQDVGQEDDEDEYYTEENCGKLVLGAVDPSLY 258

Query: 306 AGDLY---TIPIINT---LQNRGYKDPIQFQVTLQGIGVSHGERDENMTTLTTTKIPVLL 359
            GD     TIP  +      + GY  PI   V L  + V          T      PVLL
Sbjct: 259 TGDFVRFDTIPFHDVDTGATSFGY--PI---VPLTKVSVKASSGQTLNVTSPDFAEPVLL 313

Query: 360 DSGTTISYMPADLVEMIASEVGATYSPDYGYYIMDCINEMEEESSLIFDFGGFY----IA 415
           D+    S++P  L+  IA +  A Y      +++ C +  +  +S+IF+F G      I 
Sbjct: 314 DTRYLYSFLPLKLIIQIAIQTNAYYVESLDRWLVSC-SVGDLNASMIFEFNGLSIDVPIK 372

Query: 416 NWLSNFQLLTDSRSN----------VCILGIAPQSDPAI-ILGDNFLVSTYVVYDLD 461
           ++LSN     DS SN           C L + P       +LG  F+ + Y+  DL+
Sbjct: 373 DFLSNSY---DSVSNSTLHFSNGNSACYLKMYPNYATGFSVLGAAFVKNAYIAADLE 426

>Kpol_1059.33 s1059 (70588..72576) [1989 bp, 662 aa] {ON}
           (70588..72576) [1989 nt, 663 aa]
          Length = 662

 Score = 44.3 bits (103), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 88/362 (24%), Positives = 148/362 (40%), Gaps = 80/362 (22%)

Query: 173 CTTYGTFDTSKSST---FESNKTEFSITYGDSTFASGTWGHDRLSLNN------------ 217
           C     +D S S+T   + S    F   + D+ FA+G+   DR S  N            
Sbjct: 92  CNERTVYDPSSSNTSIPYRSGHV-FDFEFIDALFANGSAYTDRFSFPNILGSTESYSYGN 150

Query: 218 -----------LNVTGLSF-AVANETNSTVGVLGIGLPGLESTYSGVSLSSAQKSYTYNN 265
                      LN++ +SF +  N    ++G LG+G   +ES  S   L S Q      +
Sbjct: 151 HSGLVEVDHGHLNISSMSFFSTYNSGGLSIGSLGLG-GNVESRNS--DLDSGQYD---GS 204

Query: 266 FPMI--LKNSGAIKSTAYSLFTN--------------HSDSKHGTILFGAVDHGKYAGDL 309
           F ++  LK +G I+   YSL+                 S+S  G ++ GAV+     G  
Sbjct: 205 FFLLEELKEAGLIEGRGYSLWLGGDNTSLVEQEGTVYSSESIAGRLILGAVNPNLIDGKF 264

Query: 310 YTIPIINTLQNRGYKDPIQFQVT----LQGIG----VSHGERDENMTTLTTTKIPVLLDS 361
            +  ++       Y++P   +++    +  +G    +S      NMT+    + PVLLDS
Sbjct: 265 VSFNML------PYQNPDTLEMSNGYPILPMGPINIISKSGASLNMTSNNYLQ-PVLLDS 317

Query: 362 GTTISYMPADLVEMIASEVGATYSPDYGYYIMDCINEMEEESSLIFDFGGFYIANWLSNF 421
             T S +P + +  IA ++ A+Y      +++ C + ++E   L F FG   I   L  F
Sbjct: 318 RYTNSRLPIEAIIQIAIQIDASYVEQLNSWVVSC-SILKESVVLEFSFGPLRIKVPLKQF 376

Query: 422 ------------QLLTDSRSNVCILGIAPQSDPAI-ILGDNFLVSTYVVYDLDNMEISMA 468
                       + L++     CIL + P  D    ILG  F+ S Y+  D +   I++ 
Sbjct: 377 LKKAIDPDTGNARTLSNG-DQACILSLYPNHDIGYNILGAPFMKSIYLAVDNEGGTIALG 435

Query: 469 HA 470
            +
Sbjct: 436 QS 437

>KNAG0C05140 Chr3 (999304..1001100) [1797 bp, 598 aa] {ON} Anc_5.401
           YDR349C
          Length = 598

 Score = 41.6 bits (96), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 76/342 (22%), Positives = 141/342 (41%), Gaps = 66/342 (19%)

Query: 189 SNKTEFSITYGDSTFASGTWGHDRLSLNNLNVTG-----------------------LSF 225
           SN  E+++ + D+   +GT   D ++  + ++ G                       +SF
Sbjct: 108 SNSYEYNMNFIDNVRVNGTLFMDTMNFTDTSMLGNLSNTVQNNSMLTMTSDYLALRNISF 167

Query: 226 AVANETNSTVGVLGIGLPGLESTYSGVSLSSAQKSYTYNNFPMILK---NSGAIKSTAYS 282
              + + + +G LG+G   + S+   +   + Q ++       +LK   N   IKS +YS
Sbjct: 168 VTTSSSTTDLGSLGLG-GSIHSSVFDIDSENFQDTF------FLLKTMANLNLIKSKSYS 220

Query: 283 LFTNHSD-------------SKHGTILFGAVDHGKYAGDLYTIPIINTLQNRGYKDPIQF 329
           L+  +               S  G ++ GAVD   Y G+ +    I+ ++         +
Sbjct: 221 LWLGNCRRTIDTITPDADNGSVAGKLILGAVDPSLYEGEFFQFNTISYIEPSHNLSTFGY 280

Query: 330 QVTLQG--IGVSHGERDENMTTLTTTKIPVLLDSGTTISYMPADLVEMIASEVGATYSPD 387
            +   G     S   R  NMT+    + P LLDS    S++PA+ +  IA ++GA Y   
Sbjct: 281 PILPMGPIYMTSQAGRRLNMTSEQYLQ-PALLDSSFVGSFLPANTIIQIAIQIGAIYIES 339

Query: 388 YGYYIMDCINEMEEESSLIFDFGGFYIANWLSNFQLLTDSR-------------SNVCIL 434
              +++ C +     + + F F G  I   LS+  LLT S+              + C L
Sbjct: 340 LNRWVVPC-SVASMGAHIDFTFDGLDIKVPLSD--LLTSSKDPATNSTMHFAEGESACFL 396

Query: 435 GIAPQSDPAI-ILGDNFLVSTYVVYDLDNMEISMAHADFSDG 475
            +   +     +LG +F+ + Y+  DLD  ++++A A  + G
Sbjct: 397 MLYSNNAMGFNVLGTSFIKNAYIAVDLDGTKVAIAQAKNTTG 438

>SAKL0D01408g Chr4 (112123..113643) [1521 bp, 506 aa] {ON} weakly
           similar to uniprot|P07267 Saccharomyces cerevisiae
           YPL154C PEP4 Vacuolar aspartyl protease (proteinase A),
           required for the posttranslational precursor maturation
           of vacuolar proteinases; synthesized as a zymogen,
           self-activates
          Length = 506

 Score = 39.3 bits (90), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 79/315 (25%), Positives = 115/315 (36%), Gaps = 70/315 (22%)

Query: 194 FSITYGDSTFASGTWGHDRLSLNNLNVT-GLSFAVANETNSTVGVLGIGLPGLESTY--S 250
           FS+ Y  S  A G   HDR+ +N L  T   +F VA+E           +P +   Y  S
Sbjct: 150 FSLAY-TSGVAVGDVYHDRIIVNELATTDNFTFGVASE-----------VPDIFENYPAS 197

Query: 251 GVSLSSAQKSYTYNNFPMILKNSGAIKSTAYSLFTNHSD---------------SKHGTI 295
           G+    +  S +  N    L++S AI    +S+   H +               S  G  
Sbjct: 198 GIFGLPSDNSQSIENIISKLRSSNAISMEKFSILIGHINAEVSEEEDGDVQDLTSNKGIF 257

Query: 296 LFGAVDHGKYAGDLY---TIP--------IINTLQNRGYKDPIQFQVTLQGIGVSHGERD 344
             G    G Y G++Y    IP         IN L    YK          G   SH  R 
Sbjct: 258 AIGDELEGLYKGEIYYNSLIPDKNSYWSLKINNLYVNDYKVNFTNYENFTG-SKSHNTRS 316

Query: 345 ENMTTLTTTKIPVLLDSGTTISYMPADLVEMIASEVGATYSPDYGYYIMDCINEMEEESS 404
                        ++DSGTT+  +P      I +  G + +    + IM C        +
Sbjct: 317 S------------IIDSGTTLLILPKQDALDIHTYFGNSITDGTNFAIM-C----NSTQT 359

Query: 405 LIFDFGGFYIANW-LSNFQLLTDSRSN------VCILGIAPQS-DPAIILGDNFLVSTYV 456
           L  +F      NW + + + L D  S        C+  I     D A ILGD FL   Y 
Sbjct: 360 LTLEFDN---KNWTIPSEKYLGDKYSQDSAYYGYCVSNIQGLDIDDAWILGDVFLEGIYA 416

Query: 457 VYDLDNMEISMAHAD 471
           V+D++N  +  A  +
Sbjct: 417 VFDVENQRLGFAEGN 431

>ABL123C Chr2 complement(164739..166223) [1485 bp, 494 aa] {ON}
           Non-syntenic homolog of Saccharomyces cerevisiae YPL154C
          Length = 494

 Score = 37.7 bits (86), Expect = 0.085,   Method: Compositional matrix adjust.
 Identities = 62/263 (23%), Positives = 106/263 (40%), Gaps = 47/263 (17%)

Query: 130 VNKDNL--VSVVESVFTEISYDTTMVTSVATATIGNTASTSQAMNCTTYGTFDTSKSSTF 187
           + +D L  V ++++ F  +SY   + T  A + +    S+S A +         S S T 
Sbjct: 88  LKRDPLSRVHIIQATFGGVSYPLVLDTGSAISWVYGVNSSSSANHKARQAFVAHSNSCTV 147

Query: 188 ESNKTEFSITYGDSTFASGTWGHDRLSLNNLNVTGLSFAVANETNSTVGVLGIGLPGLES 247
               + F+I Y   T A G      LS+N L +    F VA           IG+P L  
Sbjct: 148 --TDSIFTIFYRSGT-AHGPLYTGTLSINGLKIQDFRFGVA-----------IGVPSLLD 193

Query: 248 TY--SGVSLSSAQKSYTYNNFPMILKNSGAIKSTAYSLFTNH-------SDSKHGTILFG 298
            Y  SG+    +  + +  +   +L+ S  I   ++S+  +H        D  +G I+FG
Sbjct: 194 AYALSGIFGLPSDPTDSDTSVVGLLQGSKLINKKSFSVLLSHIPSESRNLDDNNGLIVFG 253

Query: 299 AVDHGKYAGDLYTIPIINTLQNRGYKDPIQFQVTLQGIGVSHGERDENMTTLTTTKIPV- 357
                 Y G+L   P++   QN        + V ++   +   ER E    L T K P  
Sbjct: 254 EPLGALYEGELSYTPLVPNPQN-------HWLVAIKAAYIG-SERVE----LPTAKNPSI 301

Query: 358 ---------LLDSGTTISYMPAD 371
                    ++D+G+T+  +P +
Sbjct: 302 DKNIGIRSGIIDTGSTLVVLPQE 324

>Suva_2.472 Chr2 complement(838549..839988) [1440 bp, 479 aa] {ON}
          YDR306C (REAL)
          Length = 479

 Score = 35.4 bits (80), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 21/41 (51%), Positives = 25/41 (60%), Gaps = 3/41 (7%)

Query: 43 RKY--GDSFESATNDTKARARLVTRGDDYELVELTNQNSFY 81
          RKY  G+ F S  ND KA+   VT  DD EL+E T Q S+Y
Sbjct: 15 RKYVAGEGFSSTRNDNKAKEATVTVPDDAELIE-TPQGSYY 54

>Ecym_4614 Chr4 complement(1197114..1198559) [1446 bp, 481 aa] {ON}
           similar to Ashbya gossypii ABL123C
          Length = 481

 Score = 33.5 bits (75), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 72/290 (24%), Positives = 118/290 (40%), Gaps = 55/290 (18%)

Query: 205 SGTWGHDRLSLNNLNVTG-LSFAVAN------ETNSTVGVLGIGLPGLESTYSGVSLSSA 257
           SG    D   +NNLN +   +F VA       E     G+LG  LP         +LS  
Sbjct: 160 SGAIFQDSFIINNLNTSETFAFGVATSVPQMFENYPVSGILG--LPANSPGTVEPALS-- 215

Query: 258 QKSYTYNNFPMILKNSGAIKSTAYSLFTNHSDSKHGTI-----LF--GAVDHGKYAGDLY 310
                      +L  S +I+S  ++L+ +H +S++ T+     LF  G      Y GD+Y
Sbjct: 216 -----------VLYRSKSIRSQKFTLYLDHIESENTTLNANSGLFAIGEPITELYKGDIY 264

Query: 311 TIPIINTLQNRGYK--DPIQFQVTLQGIGVSHGERDENMT-TLTTTKIPVLLDSGTTISY 367
              ++    N      D I    TL        +  EN T   + +K   ++DSG+T   
Sbjct: 265 YSELVVNPNNYWLIAIDRIFCNSTLVTF-----QNPENFTGAQSRSKRSGIIDSGSTFLV 319

Query: 368 MP-ADLVEMIASEVGATYSPDYGYYIMDCINEMEEESSLIFDFGGFYIANW-------LS 419
           +P  D +++ +   G+    D  Y+ + C + ++    L F+ G     NW       L 
Sbjct: 320 LPKVDALDIHSYLPGSI--TDGNYFAVFCNSTVD----LTFELGN---KNWTIPASSYLG 370

Query: 420 NFQLLTDSRSNVCILGIAPQS-DPAIILGDNFLVSTYVVYDLDNMEISMA 468
                       C+  I  Q+   + ILGD F+ + Y V+D+DN ++  A
Sbjct: 371 EPYQEGSKYYGYCVSNIEGQAIHSSWILGDVFIKNFYTVFDMDNQQVGFA 420

>Smik_4.555 Chr4 complement(1005283..1006722) [1440 bp, 479 aa]
          {ON} YDR306C (REAL)
          Length = 479

 Score = 32.7 bits (73), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 19/41 (46%), Positives = 25/41 (60%), Gaps = 3/41 (7%)

Query: 43 RKY--GDSFESATNDTKARARLVTRGDDYELVELTNQNSFY 81
          RKY  G+ F S  ND KA+   +T  D+ EL+E T Q S+Y
Sbjct: 15 RKYVAGEGFSSTRNDNKAKEFTITVPDNAELIE-TPQGSYY 54

>YDR306C Chr4 complement(1073735..1075171) [1437 bp, 478 aa] {ON}
          F-box protein of unknown function; interacts with Sgt1p
          via a Leucine-Rich Repeat (LRR) domain
          Length = 478

 Score = 32.7 bits (73), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 19/41 (46%), Positives = 25/41 (60%), Gaps = 3/41 (7%)

Query: 43 RKY--GDSFESATNDTKARARLVTRGDDYELVELTNQNSFY 81
          RKY  G+ F S  ND KA+   +T  +D EL+E T Q S+Y
Sbjct: 15 RKYVAGEGFSSTRNDNKAKEFTITIPEDAELIE-TPQGSYY 54

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.314    0.130    0.372 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 59,939,183
Number of extensions: 2565826
Number of successful extensions: 8729
Number of sequences better than 10.0: 339
Number of HSP's gapped: 8096
Number of HSP's successfully gapped: 533
Length of query: 597
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 482
Effective length of database: 40,294,809
Effective search space: 19422097938
Effective search space used: 19422097938
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 69 (31.2 bits)