Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Smik_4.3648.273ON65653315e-42
YDR119W-A (COX26)8.273ON66653151e-39
Skud_4.3808.273ON66653115e-39
Suva_2.2808.273ON66652924e-36
SAKL0H16786g8.273ON74681363e-12
ZYRO0D06908g8.273ON77681224e-10
CAGL0B01875g8.273ON74411145e-09
TBLA0F030308.273ON75571094e-08
NDAI0J012908.273ON75721085e-08
Kpol_YGOB_YDR119W-A8.273ON75701077e-08
KLLA0F19371g8.273ON80631052e-07
TDEL0F040008.273ON62641024e-07
TPHA0A017408.273ON79561034e-07
Ecym_42978.273ON7462921e-05
Kwal_YGOB_YDR119W-A8.273ON7466912e-05
KNAG0H031708.273ON7158842e-04
KLTH0G13442g8.273ON7430790.001
KLLA0F19382gsingletonON7564750.005
KAFR0B054408.273ON6637660.094
NOTE: 2 genes in the same pillar as Smik_4.364 were not hit in these BLAST results
LIST: NCAS0B03770 KAFR0B02760

BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Smik_4.364
         (65 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Smik_4.364 Chr4 (652275..652469) [195 bp, 65 aa] {ON} YDR119W-A ...   132   5e-42
YDR119W-A Chr4 (691014..691214) [201 bp, 66 aa] {ON}  COX26Putat...   125   1e-39
Skud_4.380 Chr4 (662624..662821) [198 bp, 66 aa] {ON} YDR119W-A ...   124   5e-39
Suva_2.280 Chr2 (485753..485950) [198 bp, 66 aa] {ON} YDR119W-A ...   117   4e-36
SAKL0H16786g Chr8 complement(1476277..1476501) [225 bp, 74 aa] {...    57   3e-12
ZYRO0D06908g Chr4 complement(594305..594538) [234 bp, 77 aa] {ON...    52   4e-10
CAGL0B01875g Chr2 (172117..172341) [225 bp, 74 aa] {ON} similar ...    49   5e-09
TBLA0F03030 Chr6 complement(734693..734920) [228 bp, 75 aa] {ON}...    47   4e-08
NDAI0J01290 Chr10 (302793..303020) [228 bp, 75 aa] {ON} Anc_8.27...    46   5e-08
Kpol_YGOB_YDR119W-A s543 (101757..101984) [228 bp, 75 aa] {ON} A...    46   7e-08
KLLA0F19371g Chr6 (1794714..1794956) [243 bp, 80 aa] {ON} some s...    45   2e-07
TDEL0F04000 Chr6 (742747..742935) [189 bp, 62 aa] {ON} Anc_8.273...    44   4e-07
TPHA0A01740 Chr1 complement(352238..352477) [240 bp, 79 aa] {ON}...    44   4e-07
Ecym_4297 Chr4 complement(635853..636077) [225 bp, 74 aa] {ON} s...    40   1e-05
Kwal_YGOB_YDR119W-A s56 complement(689535..689759) [225 bp, 74 a...    40   2e-05
KNAG0H03170 Chr8 complement(594939..595154) [216 bp, 71 aa] {ON}...    37   2e-04
KLTH0G13442g Chr7 complement(1152840..1153064) [225 bp, 74 aa] {...    35   0.001
KLLA0F19382g Chr6 (1795951..1796178) [228 bp, 75 aa] {ON} some s...    33   0.005
KAFR0B05440 Chr2 complement(1115807..1116007) [201 bp, 66 aa] {O...    30   0.094

>Smik_4.364 Chr4 (652275..652469) [195 bp, 65 aa] {ON} YDR119W-A
          (REAL)
          Length = 65

 Score =  132 bits (331), Expect = 5e-42,   Method: Compositional matrix adjust.
 Identities = 65/65 (100%), Positives = 65/65 (100%)

Query: 1  MFFSEVLRSSARAAPIKRYTGGRVGESWVITEGRRLIPEVFQWSATLSICLGWPSAVYFF 60
          MFFSEVLRSSARAAPIKRYTGGRVGESWVITEGRRLIPEVFQWSATLSICLGWPSAVYFF
Sbjct: 1  MFFSEVLRSSARAAPIKRYTGGRVGESWVITEGRRLIPEVFQWSATLSICLGWPSAVYFF 60

Query: 61 SKARK 65
          SKARK
Sbjct: 61 SKARK 65

>YDR119W-A Chr4 (691014..691214) [201 bp, 66 aa] {ON}
          COX26Putative protein of unknown function; copurifies
          with respiratory chain supercomplexes composed of
          Complex III (ubiquinol-cytochrome c reductase) and
          Complex IV (cytochrome c oxidase)
          Length = 66

 Score =  125 bits (315), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 59/65 (90%), Positives = 63/65 (96%)

Query: 1  MFFSEVLRSSARAAPIKRYTGGRVGESWVITEGRRLIPEVFQWSATLSICLGWPSAVYFF 60
          MFFS+VLRSSARAAPIKRYTGGR+GESWVITEGRRLIPE+FQWSA LS+CLGWP AVYFF
Sbjct: 1  MFFSQVLRSSARAAPIKRYTGGRIGESWVITEGRRLIPEIFQWSAVLSVCLGWPGAVYFF 60

Query: 61 SKARK 65
          SKARK
Sbjct: 61 SKARK 65

>Skud_4.380 Chr4 (662624..662821) [198 bp, 66 aa] {ON} YDR119W-A
          (REAL)
          Length = 66

 Score =  124 bits (311), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 60/65 (92%), Positives = 61/65 (93%)

Query: 1  MFFSEVLRSSARAAPIKRYTGGRVGESWVITEGRRLIPEVFQWSATLSICLGWPSAVYFF 60
          MFFS+VLRSSARAAPIKRYTGGRVGESWVITEGRRLIPEV QWSA LSICLGWP AVYF 
Sbjct: 1  MFFSQVLRSSARAAPIKRYTGGRVGESWVITEGRRLIPEVLQWSAALSICLGWPGAVYFL 60

Query: 61 SKARK 65
          SKARK
Sbjct: 61 SKARK 65

>Suva_2.280 Chr2 (485753..485950) [198 bp, 66 aa] {ON} YDR119W-A
          (REAL)
          Length = 66

 Score =  117 bits (292), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 55/65 (84%), Positives = 59/65 (90%)

Query: 1  MFFSEVLRSSARAAPIKRYTGGRVGESWVITEGRRLIPEVFQWSATLSICLGWPSAVYFF 60
          MFFS+VLRSSARAAPIKRYTGGRVGE+W+ITE RRLIPEVFQW A +  CLGWP AVYFF
Sbjct: 1  MFFSQVLRSSARAAPIKRYTGGRVGEAWMITESRRLIPEVFQWGAVICTCLGWPGAVYFF 60

Query: 61 SKARK 65
          SKARK
Sbjct: 61 SKARK 65

>SAKL0H16786g Chr8 complement(1476277..1476501) [225 bp, 74 aa]
          {ON} similar to uniprot|Q2V2P9 Saccharomyces cerevisiae
          YDR119W-A Pi
          Length = 74

 Score = 57.0 bits (136), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 31/68 (45%), Positives = 43/68 (63%), Gaps = 11/68 (16%)

Query: 1  MFFSEVLRSSA---RAAP--------IKRYTGGRVGESWVITEGRRLIPEVFQWSATLSI 49
          MF S+VLRS+A   R+A         + R + GR+GE W ITE +RL+P +F W A+++ 
Sbjct: 1  MFSSQVLRSTAAISRSAVASKGASKVLLRASHGRLGEPWAITEAKRLVPTIFLWGASMAA 60

Query: 50 CLGWPSAV 57
           LGWP AV
Sbjct: 61 VLGWPFAV 68

>ZYRO0D06908g Chr4 complement(594305..594538) [234 bp, 77 aa] {ON}
          similar to uniprot|Q2V2P9 Saccharomyces cerevisiae
          YDR119W-A
          Length = 77

 Score = 51.6 bits (122), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 26/68 (38%), Positives = 41/68 (60%), Gaps = 3/68 (4%)

Query: 1  MFFSEVLRSSARAA---PIKRYTGGRVGESWVITEGRRLIPEVFQWSATLSICLGWPSAV 57
          MFF++VLR+SA +A     K+ +    GE W + E RRL     +W+ +LS+ L WP+A+
Sbjct: 1  MFFTQVLRNSAVSATKQAAKQISKSSAGEQWGLLEARRLSRGAVEWAVSLSLILAWPAAI 60

Query: 58 YFFSKARK 65
            FS+  +
Sbjct: 61 IKFSEHNR 68

>CAGL0B01875g Chr2 (172117..172341) [225 bp, 74 aa] {ON} similar
          to uniprot|Q2V2P9 Saccharomyces cerevisiae YDR119wa
          Length = 74

 Score = 48.5 bits (114), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 19/41 (46%), Positives = 28/41 (68%)

Query: 22 GRVGESWVITEGRRLIPEVFQWSATLSICLGWPSAVYFFSK 62
          GR+G SW I E +RL P +  W++ L++ LGWP  +YF+ K
Sbjct: 32 GRIGPSWTIAEIKRLTPTLIGWASFLTVTLGWPFGIYFWKK 72

>TBLA0F03030 Chr6 complement(734693..734920) [228 bp, 75 aa] {ON}
          Anc_8.273 YDR119W-A
          Length = 75

 Score = 46.6 bits (109), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 22/57 (38%), Positives = 32/57 (56%), Gaps = 3/57 (5%)

Query: 1  MFFSEVLRSSARAAPI---KRYTGGRVGESWVITEGRRLIPEVFQWSATLSICLGWP 54
          M F    RSSA  A +   + +T     ESW +TE +R++P +  W+  LS+ LGWP
Sbjct: 1  MLFQHAARSSASMARMQLRRSFTRSYTQESWAVTEVKRIVPNIAFWATLLSVSLGWP 57

>NDAI0J01290 Chr10 (302793..303020) [228 bp, 75 aa] {ON} Anc_8.273
          YDR119W-A
          Length = 75

 Score = 46.2 bits (108), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 23/72 (31%), Positives = 39/72 (54%), Gaps = 8/72 (11%)

Query: 1  MFFSEVLRSSARAAPIKRY-TGGRV-------GESWVITEGRRLIPEVFQWSATLSICLG 52
          M F+ VL+ S R   ++++ T G         G  WV +E +R+ P + +WS  L + LG
Sbjct: 1  MLFNSVLKRSIRNTAVRQFVTNGAAHTIRPVRGLPWVSSEIQRVAPTILRWSTFLVVVLG 60

Query: 53 WPSAVYFFSKAR 64
          WP+  Y++ K +
Sbjct: 61 WPAPFYYYHKIK 72

>Kpol_YGOB_YDR119W-A s543 (101757..101984) [228 bp, 75 aa] {ON}
          ANNOTATED BY YGOB -
          Length = 75

 Score = 45.8 bits (107), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 24/70 (34%), Positives = 37/70 (52%), Gaps = 11/70 (15%)

Query: 2  FFSEVL-RSSARAAPIK--RYTG--------GRVGESWVITEGRRLIPEVFQWSATLSIC 50
           FS +L R++AR   ++  RY          G +GESW +TE +R+ P +  W  TL+  
Sbjct: 1  MFSRILARTTARVGRVQAVRYASTANQAAAAGHIGESWAVTEAKRVFPTIIGWGTTLTAI 60

Query: 51 LGWPSAVYFF 60
          L WP  +Y +
Sbjct: 61 LSWPFIIYHY 70

>KLLA0F19371g Chr6 (1794714..1794956) [243 bp, 80 aa] {ON} some
          similarities with uniprot|Q2V2P9 Saccharomyces
          cerevisiae YDR119W-A Pi
          Length = 80

 Score = 45.1 bits (105), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 24/63 (38%), Positives = 33/63 (52%), Gaps = 9/63 (14%)

Query: 1  MFFSEVLRSSARAA---------PIKRYTGGRVGESWVITEGRRLIPEVFQWSATLSICL 51
          MFF++ LRS+A  A              +G RVGE+W +TE RRL P +  +   +   L
Sbjct: 1  MFFTKALRSTATIAMNHATQTTTKTAVRSGRRVGEAWAVTEARRLGPTILMYGTFIVSVL 60

Query: 52 GWP 54
          GWP
Sbjct: 61 GWP 63

>TDEL0F04000 Chr6 (742747..742935) [189 bp, 62 aa] {ON} Anc_8.273
          YDR119W-A
          Length = 62

 Score = 43.9 bits (102), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 25/64 (39%), Positives = 36/64 (56%), Gaps = 2/64 (3%)

Query: 1  MFFSEVLRSSARAAPIKRYTGGRVGESWVITEGRRLIPEVFQWSATLSICLGWPSAVYFF 60
          MF+++VLRS+A AA           +SW ++E +RL P +  W   L+ CLGWP A+  F
Sbjct: 1  MFYTQVLRSAAAAARATSRN--HNSQSWAVSEAKRLTPAILGWGGFLAGCLGWPFAIKHF 58

Query: 61 SKAR 64
            A 
Sbjct: 59 MSAN 62

>TPHA0A01740 Chr1 complement(352238..352477) [240 bp, 79 aa] {ON}
          Anc_8.273 YDR119W-A
          Length = 79

 Score = 44.3 bits (103), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 19/56 (33%), Positives = 34/56 (60%), Gaps = 2/56 (3%)

Query: 5  EVLRSSARAAPIKRYTGGRVGESWVITEGRRLIPEVFQWSATLSICLGWPSAVYFF 60
          +++R S+ AA  K      +GESW++TE +R+ P +  W + ++  L WPS + +F
Sbjct: 17 QIIRHSSNAA--KTPGSSHLGESWILTEAKRVGPNLLFWGSAMTTVLLWPSFIKYF 70

>Ecym_4297 Chr4 complement(635853..636077) [225 bp, 74 aa] {ON}
          similar to Saccharomyces cerevisiae YDR119W-A
          Length = 74

 Score = 40.0 bits (92), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 19/62 (30%), Positives = 33/62 (53%), Gaps = 8/62 (12%)

Query: 1  MFFSEVLR--SSARAAPIKRY------TGGRVGESWVITEGRRLIPEVFQWSATLSICLG 52
          M +S +L+  S+   +P+         T   +GE W++TE +RL+P +  W  T++  L 
Sbjct: 1  MLYSRILKAVSTIPKSPMSNIGARRAATSKHIGEPWMVTETKRLVPTILIWGGTMTGILL 60

Query: 53 WP 54
          WP
Sbjct: 61 WP 62

>Kwal_YGOB_YDR119W-A s56 complement(689535..689759) [225 bp, 74
          aa] {ON} ANNOTATED BY YGOB -
          Length = 74

 Score = 39.7 bits (91), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 22/66 (33%), Positives = 32/66 (48%), Gaps = 12/66 (18%)

Query: 1  MFFSEVLRSSAR----AAPIKRYTGGRV--------GESWVITEGRRLIPEVFQWSATLS 48
          M  S++LRS A     AA      G RV           W + E +R++P V  W+ +++
Sbjct: 1  MLSSQILRSVAALQGVAATSASKAGSRVMFKAPSSRARQWAVIEAKRIVPTVAMWATSMT 60

Query: 49 ICLGWP 54
          I LGWP
Sbjct: 61 IMLGWP 66

>KNAG0H03170 Chr8 complement(594939..595154) [216 bp, 71 aa] {ON}
          Anc_8.273 YDR119W-A
          Length = 71

 Score = 37.0 bits (84), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 26/58 (44%), Positives = 35/58 (60%), Gaps = 4/58 (6%)

Query: 1  MFFSEVLRSSAR-AAPIK-RY--TGGRVGESWVITEGRRLIPEVFQWSATLSICLGWP 54
          MF S+V +S  R + PI  RY  +GGRVG  +  TE +R IP+V  W + L + L WP
Sbjct: 1  MFRSQVSKSLQRMSKPIGLRYASSGGRVGPGFYRTEIKRRIPQVALWGSGLFLVLEWP 58

>KLTH0G13442g Chr7 complement(1152840..1153064) [225 bp, 74 aa]
          {ON} conserved hypothetical protein
          Length = 74

 Score = 35.0 bits (79), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 13/30 (43%), Positives = 18/30 (60%)

Query: 28 WVITEGRRLIPEVFQWSATLSICLGWPSAV 57
          W + E +RL+P +  W A +   LGWP AV
Sbjct: 40 WAVIEAKRLVPAIGMWGAFMGAVLGWPFAV 69

>KLLA0F19382g Chr6 (1795951..1796178) [228 bp, 75 aa] {ON} some
          similarities with uniprot|Q2V2P9 Saccharomyces
          cerevisiae YDR119W-A Pi
          Length = 75

 Score = 33.5 bits (75), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 20/64 (31%), Positives = 30/64 (46%), Gaps = 4/64 (6%)

Query: 2  FFSEVLRSSARAAPIKR----YTGGRVGESWVITEGRRLIPEVFQWSATLSICLGWPSAV 57
           F  +LR+    A   R     +G  VGESW  +E RRL P +  ++  +   + WP  V
Sbjct: 1  MFIRLLRAGKEHATTARRVVYASGHHVGESWTKSETRRLAPNLITYALFIGTMVTWPYWV 60

Query: 58 YFFS 61
            +S
Sbjct: 61 KEYS 64

>KAFR0B05440 Chr2 complement(1115807..1116007) [201 bp, 66 aa]
          {ON} Anc_8.273 YDR119W-A
          Length = 66

 Score = 30.0 bits (66), Expect = 0.094,   Method: Compositional matrix adjust.
 Identities = 9/37 (24%), Positives = 20/37 (54%)

Query: 23 RVGESWVITEGRRLIPEVFQWSATLSICLGWPSAVYF 59
           +G  ++  + ++ +  +  W   L + LGWPS +Y+
Sbjct: 26 HIGPPYLYLKAKQDVKTIAAWGTFLLVALGWPSVIYY 62

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.325    0.136    0.439 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 6,113,113
Number of extensions: 174040
Number of successful extensions: 420
Number of sequences better than 10.0: 19
Number of HSP's gapped: 418
Number of HSP's successfully gapped: 19
Length of query: 65
Length of database: 53,481,399
Length adjustment: 38
Effective length of query: 27
Effective length of database: 49,124,091
Effective search space: 1326350457
Effective search space used: 1326350457
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 59 (27.3 bits)