Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Smik_4.3628.270ON64864833610.0
Skud_4.3788.270ON65264925560.0
YDR118W (APC4)8.270ON65264925430.0
Suva_2.2778.270ON64964224840.0
TDEL0F039708.270ON6195559131e-114
KAFR0B054608.270ON6105228451e-104
ZYRO0C01474g8.270ON5994488381e-103
Kpol_392.18.270ON4244197765e-96
TPHA0J007908.270ON6854456796e-79
KNAG0H031908.270ON6224286731e-78
NCAS0B037908.270ON6125836143e-70
NDAI0J012708.270ON7356275689e-63
CAGL0B01859g8.270ON6224355575e-62
TBLA0C045708.270ON6084035251e-57
KLTH0G13508g8.270ON6454194902e-52
Kwal_56.237668.270ON7404224712e-49
SAKL0H16852g8.270ON6444364646e-49
Ecym_43008.270ON7154271879e-14
AGR078C8.270ON7154351752e-12
KLLA0F19316g8.270ON6713941234e-06
CAGL0M13409g5.49ON152758810.38
NDAI0C035405.49ON155858790.81
SAKL0D02640gna 1ON112746752.3
KLTH0G19008g8.15ON99587716.9
TBLA0C053103.479ON676124707.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Smik_4.362
         (648 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Smik_4.362 Chr4 (647135..649081) [1947 bp, 648 aa] {ON} YDR118W ...  1299   0.0  
Skud_4.378 Chr4 (657502..659460) [1959 bp, 652 aa] {ON} YDR118W ...   989   0.0  
YDR118W Chr4 (685882..687840) [1959 bp, 652 aa] {ON}  APC4Subuni...   984   0.0  
Suva_2.277 Chr2 (480574..481624,481684..482579) [1947 bp, 649 aa...   961   0.0  
TDEL0F03970 Chr6 (735393..737252) [1860 bp, 619 aa] {ON} Anc_8.2...   356   e-114
KAFR0B05460 Chr2 complement(1118755..1120587) [1833 bp, 610 aa] ...   330   e-104
ZYRO0C01474g Chr3 complement(106209..108008) [1800 bp, 599 aa] {...   327   e-103
Kpol_392.1 s392 complement(1..1272) [1272 bp, 424 aa] {ON} compl...   303   5e-96
TPHA0J00790 Chr10 (182991..185048) [2058 bp, 685 aa] {ON} Anc_8....   266   6e-79
KNAG0H03190 Chr8 complement(597550..599418) [1869 bp, 622 aa] {O...   263   1e-78
NCAS0B03790 Chr2 complement(676973..678811) [1839 bp, 612 aa] {O...   241   3e-70
NDAI0J01270 Chr10 (297256..299463) [2208 bp, 735 aa] {ON} Anc_8....   223   9e-63
CAGL0B01859g Chr2 (168976..170844) [1869 bp, 622 aa] {ON} weakly...   219   5e-62
TBLA0C04570 Chr3 (1107010..1108836) [1827 bp, 608 aa] {ON} Anc_8...   206   1e-57
KLTH0G13508g Chr7 complement(1159671..1161608) [1938 bp, 645 aa]...   193   2e-52
Kwal_56.23766 s56 complement(695943..698165) [2223 bp, 740 aa] {...   186   2e-49
SAKL0H16852g Chr8 complement(1482321..1484255) [1935 bp, 644 aa]...   183   6e-49
Ecym_4300 Chr4 complement(642023..644170) [2148 bp, 715 aa] {ON}...    77   9e-14
AGR078C Chr7 complement(877135..879282) [2148 bp, 715 aa] {ON} S...    72   2e-12
KLLA0F19316g Chr6 (1786659..1788674) [2016 bp, 671 aa] {ON} cons...    52   4e-06
CAGL0M13409g Chr13 complement(1317818..1322401) [4584 bp, 1527 a...    36   0.38 
NDAI0C03540 Chr3 complement(810904..815580) [4677 bp, 1558 aa] {...    35   0.81 
SAKL0D02640g Chr4 (215909..219292) [3384 bp, 1127 aa] {ON} simil...    33   2.3  
KLTH0G19008g Chr7 complement(1641134..1644121) [2988 bp, 995 aa]...    32   6.9  
TBLA0C05310 Chr3 (1286959..1288989) [2031 bp, 676 aa] {ON} Anc_3...    32   7.4  

>Smik_4.362 Chr4 (647135..649081) [1947 bp, 648 aa] {ON} YDR118W
           (REAL)
          Length = 648

 Score = 1299 bits (3361), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 637/648 (98%), Positives = 637/648 (98%)

Query: 1   MPPPGNDYFIDYNPRFPIFATRTAKGLAINRVSDHARLAAIPIRNINLVANYNWDTVTGK 60
           MPPPGNDYFIDYNPRFPIFATRTAKGLAINRVSDHARLAAIPIRNINLVANYNWDTVTGK
Sbjct: 1   MPPPGNDYFIDYNPRFPIFATRTAKGLAINRVSDHARLAAIPIRNINLVANYNWDTVTGK 60

Query: 61  FLSIFFKDGTIRIHDIFKDGRLVSFLRIPSTKISKGTWDRIPLESESGNGNLAYNIIDYL 120
           FLSIFFKDGTIRIHDIFKDGRLVSFLRIPSTKISKGTWDRIPLESESGNGNLAYNIIDYL
Sbjct: 61  FLSIFFKDGTIRIHDIFKDGRLVSFLRIPSTKISKGTWDRIPLESESGNGNLAYNIIDYL 120

Query: 121 PKLIRYVKDSKRINIVPYTPPNSLWRGPDEDEPENNEKLDIHIIFNEGHDKITVFFNGDY 180
           PKLIRYVKDSKRINIVPYTPPNSLWRGPDEDEPENNEKLDIHIIFNEGHDKITVFFNGDY
Sbjct: 121 PKLIRYVKDSKRINIVPYTPPNSLWRGPDEDEPENNEKLDIHIIFNEGHDKITVFFNGDY 180

Query: 181 AIFVPVGADENERFVKSIVKIQDGFYHCFYDDGTVRTLNLGPLLRSEPSMNILKYIMAIK 240
           AIFVPVGADENERFVKSIVKIQDGFYHCFYDDGTVRTLNLGPLLRSEPSMNILKYIMAIK
Sbjct: 181 AIFVPVGADENERFVKSIVKIQDGFYHCFYDDGTVRTLNLGPLLRSEPSMNILKYIMAIK 240

Query: 241 ELIGYLLNHIEFINRELVTPYLEFVNRLCDEAYGYDKLISELECLFLLGEVSCDLEDWLC 300
           ELIGYLLNHIEFINRELVTPYLEFVNRLCDEAYGYDKLISELECLFLLGEVSCDLEDWLC
Sbjct: 241 ELIGYLLNHIEFINRELVTPYLEFVNRLCDEAYGYDKLISELECLFLLGEVSCDLEDWLC 300

Query: 301 NSVGEKNFKRWKCLGCEAYQKTTQILTLIFVPACERIIIFVEKLRGILEAFSIQNKFNDS 360
           NSVGEKNFKRWKCLGCEAYQKTTQILTLIFVPACERIIIFVEKLRGILEAFSIQNKFNDS
Sbjct: 301 NSVGEKNFKRWKCLGCEAYQKTTQILTLIFVPACERIIIFVEKLRGILEAFSIQNKFNDS 360

Query: 361 SDLTAVDTLLKNSQELLTITLKSIVDLGKDETLFETFFIWLNDRIHEVLDEDYKLKVQFE 420
           SDLTAVDTLLKNSQELLTITLKSIVDLGKDETLFETFFIWLNDRIHEVLDEDYKLKVQFE
Sbjct: 361 SDLTAVDTLLKNSQELLTITLKSIVDLGKDETLFETFFIWLNDRIHEVLDEDYKLKVQFE 420

Query: 421 DDPYFGYDLLTYFHNISNRGAETSPVLNMKLYRDLINSMSDMEKEIAESNVNSHIQQHIL 480
           DDPYFGYDLLTYFHNISNRGAETSPVLNMKLYRDLINSMSDMEKEIAESNVNSHIQQHIL
Sbjct: 421 DDPYFGYDLLTYFHNISNRGAETSPVLNMKLYRDLINSMSDMEKEIAESNVNSHIQQHIL 480

Query: 481 VESRTDVYSKEYPSSQIYVFDAVKLPKHNYILYLIQVTEQKHTQEAPSEGSIEKLYIGTL 540
           VESRTDVYSKEYPSSQIYVFDAVKLPKHNYILYLIQVTEQKHTQEAPSEGSIEKLYIGTL
Sbjct: 481 VESRTDVYSKEYPSSQIYVFDAVKLPKHNYILYLIQVTEQKHTQEAPSEGSIEKLYIGTL 540

Query: 541 KDDNLDVISRESSIKIPELFEFYSFSGARFVLKKVPNLIREIELSDGNYDCEHNVEYKXX 600
           KDDNLDVISRESSIKIPELFEFYSFSGARFVLKKVPNLIREIELSDGNYDCEHNVEYK  
Sbjct: 541 KDDNLDVISRESSIKIPELFEFYSFSGARFVLKKVPNLIREIELSDGNYDCEHNVEYKEG 600

Query: 601 XXXXXXXXXAITIPTYITYNEKSEDFIACTAKISVDGRSASLVFPKGK 648
                    AITIPTYITYNEKSEDFIACTAKISVDGRSASLVFPKGK
Sbjct: 601 DDENGEDDGAITIPTYITYNEKSEDFIACTAKISVDGRSASLVFPKGK 648

>Skud_4.378 Chr4 (657502..659460) [1959 bp, 652 aa] {ON} YDR118W
           (REAL)
          Length = 652

 Score =  989 bits (2556), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 471/649 (72%), Positives = 552/649 (85%), Gaps = 1/649 (0%)

Query: 1   MPPPGNDYFIDYNPRFPIFATRTAKGLAINRVSDHARLAAIPIRNINLVANYNWDTVTGK 60
           M PP NDYFIDYNPRFPIFATR  KGLAI+RVSDHAR+A IP+RNI LVANY+WD  +GK
Sbjct: 1   MSPPINDYFIDYNPRFPIFATRITKGLAIHRVSDHARIAIIPVRNIALVANYSWDRTSGK 60

Query: 61  FLSIFFKDGTIRIHDIFKDGRLVSFLRIPSTKISKGTWDRIPLESESGNGNLAYNIIDYL 120
           FLSIFFKDGT+RIHDIFKDGRLVSFLR+PSTKIS+G WDRIPL+ E  +   AYN+ID L
Sbjct: 61  FLSIFFKDGTVRIHDIFKDGRLVSFLRVPSTKISRGIWDRIPLKREYDSETFAYNVIDIL 120

Query: 121 PKLIRYVKDSKRINIVPYTPPNSLWRGPDEDEPENNEKLDIHIIFNEGHDKITVFFNGDY 180
           PKLIR+VKDSKR++IVPYTPPN LWRGPDED+PE+ E LD+H+IFNEG+DKIT+FFNGDY
Sbjct: 121 PKLIRFVKDSKRVSIVPYTPPNGLWRGPDEDDPESGEILDVHVIFNEGNDKITIFFNGDY 180

Query: 181 AIFVPVGADENERFVKSIVKIQDGFYHCFYDDGTVRTLNLGPLLRSEPSMNILKYIMAIK 240
            I +P+   ENER ++S+VK+QDGFYHCFY+DG+VRTLNL PLLRS+PS+++L YIM IK
Sbjct: 181 TILLPMDDIENERILESVVKVQDGFYHCFYNDGSVRTLNLQPLLRSKPSVDLLHYIMVIK 240

Query: 241 ELIGYLLNHIEFINRELVTPYLEFVNRLCDEAYGYDKLISELECLFLLGEVSCDLEDWLC 300
           ELIGYLL H+E INREL+TPYL+FV R+CDEAYGY+KL SELECLFLLGEVSCDLEDWLC
Sbjct: 241 ELIGYLLAHVELINRELITPYLDFVKRICDEAYGYNKLKSELECLFLLGEVSCDLEDWLC 300

Query: 301 NSVGEKNFKRWKCLGCEAYQKTTQILTLIFVPACERIIIFVEKLRGILEAFSIQNKFNDS 360
           NSVGEKN K+WK LGCEAYQKTTQILTL+FVP CERIIIFVEKLRG LEAFS+QNK N++
Sbjct: 301 NSVGEKNLKKWKFLGCEAYQKTTQILTLVFVPTCERIIIFVEKLRGTLEAFSVQNKSNNT 360

Query: 361 SDLTAVDTLLKNSQELLTITLKSIVDLGKDETLFETFFIWLNDRIHEVLDEDYKLKVQFE 420
           SDLTAV+ LLKNSQELL  TLKSI+ LG++ETLFE FFIW NDRIHE LDEDYKLK +FE
Sbjct: 361 SDLTAVELLLKNSQELLNNTLKSIIALGRNETLFEKFFIWFNDRIHEGLDEDYKLKFEFE 420

Query: 421 DDPYFGYDLLTYFHNI-SNRGAETSPVLNMKLYRDLINSMSDMEKEIAESNVNSHIQQHI 479
           DDPYFGYDLLTYF  I S R  E+S V+NMKLYR+LIN+MSDMEK+IA++NV+ HIQQ +
Sbjct: 421 DDPYFGYDLLTYFDKILSYRSTESSSVINMKLYRELINNMSDMEKDIAKNNVSQHIQQQL 480

Query: 480 LVESRTDVYSKEYPSSQIYVFDAVKLPKHNYILYLIQVTEQKHTQEAPSEGSIEKLYIGT 539
           L+  R DVYS+ YPSSQ+ + DA+KLP  +YI+YLI+VT+  +T+E  S  +  KLY+GT
Sbjct: 481 LINIRKDVYSQMYPSSQVRLLDAIKLPNQSYIVYLIEVTKLMNTKEVSSGENTPKLYVGT 540

Query: 540 LKDDNLDVISRESSIKIPELFEFYSFSGARFVLKKVPNLIREIELSDGNYDCEHNVEYKX 599
           LKD++LD+ISRESSI+IPE F+ YSFS ARF LK VPN IRE+ELS  NY    N EY  
Sbjct: 541 LKDESLDIISRESSIRIPEAFKNYSFSNARFALKMVPNFIREVELSRSNYTVSRNSEYTE 600

Query: 600 XXXXXXXXXXAITIPTYITYNEKSEDFIACTAKISVDGRSASLVFPKGK 648
                     +ITIPTY+T NEK+E +IACT+KISVDGRSASLVFPKG+
Sbjct: 601 EENDNGEDDGSITIPTYLTENEKNEVYIACTSKISVDGRSASLVFPKGR 649

>YDR118W Chr4 (685882..687840) [1959 bp, 652 aa] {ON}  APC4Subunit
           of the Anaphase-Promoting Complex/Cyclosome (APC/C),
           which is a ubiquitin-protein ligase required for
           degradation of anaphase inhibitors, including mitotic
           cyclins, during the metaphase/anaphase transition;
           component of the platform domain of the APC/C, based on
           structural analysis
          Length = 652

 Score =  984 bits (2543), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 477/649 (73%), Positives = 548/649 (84%), Gaps = 1/649 (0%)

Query: 1   MPPPGNDYFIDYNPRFPIFATRTAKGLAINRVSDHARLAAIPIRNINLVANYNWDTVTGK 60
           M  P NDYFIDYNP FPIFATR AKGLAI RVSDHARLA IPIRNINLVANY+WDT TGK
Sbjct: 1   MSSPINDYFIDYNPLFPIFATRIAKGLAIYRVSDHARLAVIPIRNINLVANYDWDTTTGK 60

Query: 61  FLSIFFKDGTIRIHDIFKDGRLVSFLRIPSTKISKGTWDRIPLESESGNGNLAYNIIDYL 120
           FLSIFFKDGTIRIHDIFKDGRLVSFLRIPSTKISKG WDRIPL  E  N + A NIID L
Sbjct: 61  FLSIFFKDGTIRIHDIFKDGRLVSFLRIPSTKISKGIWDRIPLRYEPNNRDFACNIIDDL 120

Query: 121 PKLIRYVKDSKRINIVPYTPPNSLWRGPDEDEPENNEKLDIHIIFNEGHDKITVFFNGDY 180
           PKLIR+VKDSKRINIVPYT PNSLWRGPDED+ ++NEKLD+H++FNEG+DKITVFFNGDY
Sbjct: 121 PKLIRFVKDSKRINIVPYTQPNSLWRGPDEDDLDSNEKLDVHVVFNEGNDKITVFFNGDY 180

Query: 181 AIFVPVGADENERFVKSIVKIQDGFYHCFYDDGTVRTLNLGPLLRSEPSMNILKYIMAIK 240
           A+F+ V   ENE  +KSI+K+QDGFY CFY+DGTV+TLNLGPLL+S+ S+N+L YIM IK
Sbjct: 181 AVFLSVDNIENENSLKSIIKVQDGFYQCFYEDGTVQTLNLGPLLQSKSSVNLLNYIMVIK 240

Query: 241 ELIGYLLNHIEFINRELVTPYLEFVNRLCDEAYGYDKLISELECLFLLGEVSCDLEDWLC 300
           ELIGY+L H+EFINREL TPYL+FV RLCDEAYGY KL SELE LFLLGE+SCDLEDWLC
Sbjct: 241 ELIGYMLTHLEFINRELATPYLDFVKRLCDEAYGYGKLKSELEALFLLGEISCDLEDWLC 300

Query: 301 NSVGEKNFKRWKCLGCEAYQKTTQILTLIFVPACERIIIFVEKLRGILEAFSIQNKFNDS 360
           NSVGEKNFKRWK LGCEAYQKT QILTLIFVPACERIII+VEKLR IL+AFSIQNK + +
Sbjct: 301 NSVGEKNFKRWKYLGCEAYQKTVQILTLIFVPACERIIIYVEKLRAILQAFSIQNKLSYT 360

Query: 361 SDLTAVDTLLKNSQELLTITLKSIVDLGKDETLFETFFIWLNDRIHEVLDEDYKLKVQFE 420
           SDLTAV+ LLK+SQ+LLT+TL SI+ LG+DETLFE FFIW NDR+HE LDEDYKLK QFE
Sbjct: 361 SDLTAVEVLLKSSQKLLTMTLNSIIGLGRDETLFEKFFIWFNDRLHEALDEDYKLKFQFE 420

Query: 421 DDPYFGYDLLTYFHNI-SNRGAETSPVLNMKLYRDLINSMSDMEKEIAESNVNSHIQQHI 479
           DD YFGYDLL+YF  I S +G E S ++++KLYRDLINSMSDMEK+IA+SNVNSHIQQHI
Sbjct: 421 DDLYFGYDLLSYFDRILSKKGTEPSSIIDVKLYRDLINSMSDMEKDIAQSNVNSHIQQHI 480

Query: 480 LVESRTDVYSKEYPSSQIYVFDAVKLPKHNYILYLIQVTEQKHTQEAPSEGSIEKLYIGT 539
           LV+ +TDV++++YPSSQI + DA+KLPKHNYI+YLIQVT+    QE  SE + +KLYIGT
Sbjct: 481 LVDLKTDVFAQKYPSSQINLLDAIKLPKHNYIVYLIQVTKHNSAQEPFSEENKKKLYIGT 540

Query: 540 LKDDNLDVISRESSIKIPELFEFYSFSGARFVLKKVPNLIREIELSDGNYDCEHNVEYKX 599
           LKD+NL +IS+ESS+KIP LF+ Y  S  RFV  +V +L+R+I LSD NY   H  +Y+ 
Sbjct: 541 LKDENLGIISKESSVKIPALFKSYRLSSTRFVPNRVHSLLRDIGLSDSNYHSSHVTDYRG 600

Query: 600 XXXXXXXXXXAITIPTYITYNEKSEDFIACTAKISVDGRSASLVFPKGK 648
                      I IP YI  N +++DFIACTAK+SVDGRSASLVFPK K
Sbjct: 601 ENYENEEDDGTIAIPAYIRENRENDDFIACTAKVSVDGRSASLVFPKEK 649

>Suva_2.277 Chr2 (480574..481624,481684..482579) [1947 bp, 649 aa]
           {ON} YDR118W (REAL)
          Length = 649

 Score =  961 bits (2484), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 461/642 (71%), Positives = 531/642 (82%), Gaps = 1/642 (0%)

Query: 6   NDYFIDYNPRFPIFATRTAKGLAINRVSDHARLAAIPIRNINLVANYNWDTVTGKFLSIF 65
           NDYFIDYNPRFPIFA R  KGLAI+RVSDHARLA IP+RNI LVANYNWD  TGKFLSIF
Sbjct: 2   NDYFIDYNPRFPIFAIRVVKGLAIHRVSDHARLAVIPVRNIALVANYNWDVSTGKFLSIF 61

Query: 66  FKDGTIRIHDIFKDGRLVSFLRIPSTKISKGTWDRIPLESESGNGNLAYNIIDYLPKLIR 125
           FKDGTIRIHDIFKDGRLVSFLRIP TKIS+G WDRIPL+ ES N N A N+ID LPKLIR
Sbjct: 62  FKDGTIRIHDIFKDGRLVSFLRIPRTKISRGIWDRIPLKYESSNRNFANNVIDVLPKLIR 121

Query: 126 YVKDSKRINIVPYTPPNSLWRGPDEDEPENNEKLDIHIIFNEGHDKITVFFNGDYAIFVP 185
           +VKDSKR+ I PYTPPNSLWRGPDED+PEN E LDIH+IFNEG+DKITVFFNGDYAI +P
Sbjct: 122 FVKDSKRVTIAPYTPPNSLWRGPDEDDPENCENLDIHVIFNEGNDKITVFFNGDYAILLP 181

Query: 186 VGADENERFVKSIVKIQDGFYHCFYDDGTVRTLNLGPLLRSEPSMNILKYIMAIKELIGY 245
           V   ENE+ +KS+VK+Q+GFYHCFY+DGTV T NL  LL+SEPS+++L+Y+M IKELIGY
Sbjct: 182 VSDIENEKILKSVVKVQNGFYHCFYNDGTVSTFNLERLLQSEPSVDLLRYMMVIKELIGY 241

Query: 246 LLNHIEFINRELVTPYLEFVNRLCDEAYGYDKLISELECLFLLGEVSCDLEDWLCNSVGE 305
           LL HIEFINREL TPY++FV R+CDEAYGY KL SEL+CLFLLGEV  DL+DWLCN+VGE
Sbjct: 242 LLAHIEFINRELTTPYMDFVKRICDEAYGYSKLKSELKCLFLLGEVPSDLDDWLCNAVGE 301

Query: 306 KNFKRWKCLGCEAYQKTTQILTLIFVPACERIIIFVEKLRGILEAFSIQNKFNDSSDLTA 365
           KNFKRWK LGCEAYQKT Q+ TL FVP CERIIIFV+KL+GILEAFSIQ       DLTA
Sbjct: 302 KNFKRWKVLGCEAYQKTVQVFTLAFVPTCERIIIFVQKLKGILEAFSIQXXXXXXXDLTA 361

Query: 366 VDTLLKNSQELLTITLKSIVDLGKDETLFETFFIWLNDRIHEVLDEDYKLKVQFEDDPYF 425
           V+ LLK SQELL ITLKSI+DLGKDETLFE F +W NDRIHEVLDEDYK K +FEDDPYF
Sbjct: 362 VELLLKQSQELLNITLKSIIDLGKDETLFEKFLMWFNDRIHEVLDEDYKPKFEFEDDPYF 421

Query: 426 GYDLLTYFHN-ISNRGAETSPVLNMKLYRDLINSMSDMEKEIAESNVNSHIQQHILVESR 484
           GYDLL +F   +S+R  E+S V++MKLYRDLINSM+ MEK+IA++NVN HIQ+ +LV+SR
Sbjct: 422 GYDLLNFFEKFLSDRNTESSSVIDMKLYRDLINSMTAMEKDIAKNNVNPHIQRQVLVQSR 481

Query: 485 TDVYSKEYPSSQIYVFDAVKLPKHNYILYLIQVTEQKHTQEAPSEGSIEKLYIGTLKDDN 544
            DV+S+ YPSS+I + DA+KL K NYI+YLIQVTE+K  QEA  E + +KLYIGTLKD++
Sbjct: 482 ADVFSQRYPSSKINLLDAIKLSKQNYIVYLIQVTEKKDIQEASLERNTQKLYIGTLKDES 541

Query: 545 LDVISRESSIKIPELFEFYSFSGARFVLKKVPNLIREIELSDGNYDCEHNVEYKXXXXXX 604
           LD++SRESSIK+PELF+ Y  + ARF  K VPN IRE E  + +Y+  HN  +       
Sbjct: 542 LDIVSRESSIKMPELFKSYDLNSARFAPKMVPNFIRESEQLNSDYNYSHNTNFGGEEDDD 601

Query: 605 XXXXXAITIPTYITYNEKSEDFIACTAKISVDGRSASLVFPK 646
                 ITIPTYIT NEK+E FIACT KISVDGR ASLVFPK
Sbjct: 602 EEDDGTITIPTYITENEKTEGFIACTTKISVDGRGASLVFPK 643

>TDEL0F03970 Chr6 (735393..737252) [1860 bp, 619 aa] {ON} Anc_8.270
           YDR118W
          Length = 619

 Score =  356 bits (913), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 198/555 (35%), Positives = 327/555 (58%), Gaps = 29/555 (5%)

Query: 12  YNPRFPIFATRTAKGLAINRVSDHARLAAIPIRNINLVANYNWDTVTGKFLSIFFKDGTI 71
           YNP + ++A +  KGL+I RV+D+A++A + +R++N++A + WD +TGK +++F+KDG  
Sbjct: 11  YNPLYSLYAKKFNKGLSICRVADNAKIATVAVRDLNVLAQFQWDPITGKRMTVFYKDGNA 70

Query: 72  RIHDIFKDGRLVSFLRIPSTKISKGTWDRIPLESESGNGNLAYNIIDYLPKLIRYVKDSK 131
           RI+D F+ G+L++ LRI  T++    WDRI L  +       + +++ +PK+IR+ +D++
Sbjct: 71  RIYDAFQAGKLLALLRISKTRVDGAIWDRIELSRQEVTFKFDHFVLNSMPKMIRFARDTR 130

Query: 132 RINIVPYTPPNSLWRGPDEDE---PENNEKLDIHIIFNEGHDKITVFFNGDYAIFVPVGA 188
           +I I+PY PPN  WR   E+E       E LD+H++  E  + + +  +GD+ + +  G 
Sbjct: 131 QIFILPYEPPNKTWRLATEEEDGVKREKEILDVHLVHQED-NGLVLMLDGDFILRLAAGP 189

Query: 189 DENERFVKSIVKIQDGFYHCFYDDGTVRTLNLGPLLRSEPSMNILKYIMAIKELIGYLLN 248
                 +K IV    G YHCFY+D TV +L+L  L++ + ++ ++++ +AIK+L  YL +
Sbjct: 190 SGPA--LKDIVVADRGLYHCFYEDATVESLSLDQLIQCDATIQLIQHFIAIKQLNHYLQD 247

Query: 249 HIEFINRELVTPYLEFVNRLCDEAYGYDKLISELECLFLLGEVSCDLEDWLCNSVGEKNF 308
           H++ I R+LV PY EF+ ++CD A+GY+ L  ELE L L G +S +LE+W C +VGEKNF
Sbjct: 248 HLDLIKRDLVAPYTEFLTKICDAAFGYEILHEELESLLLGGGLSVELENWFCYTVGEKNF 307

Query: 309 KRWKCLGCEAYQKTTQILTLIFVPACERIIIFVEKLRGILEAFSI--QNKFNDSSDLTAV 366
           K+WK +G E YQKT QILTL F+PACER+I+  E+ R  L+A  +   +   DSS+   +
Sbjct: 308 KKWKKMGLEMYQKTIQILTLSFIPACERVILLSERCRACLKALQLIESSTTTDSSEFANL 367

Query: 367 DTLLKNSQELLTITLKSIVDLGKDETLFETFFIWLNDRIHEVLDEDYKLKVQFEDDPYFG 426
            +L   SQ  L  T+++I  +   E LF+TF  W +DR+HE LDEDYK K+  + +   G
Sbjct: 368 TSL---SQTYLRSTVETIQGVSAQEVLFQTFLQWFDDRLHEALDEDYKQKLSIDSNCKIG 424

Query: 427 YDLLTYFH---NISNRGAETSPVLNMKLYRDLINSMSDMEKEIAESNVNSHIQQHILVES 483
           Y + TY     N   +    +  L ++ +++++++MS   + I +  +   + Q I    
Sbjct: 425 YQIATYLDLRINPDKQSEYDNKFLKLQTFQEILDTMSQNLQLIRDREIEPKVLQKI---- 480

Query: 484 RTDVYSKEYPSSQIYVFDAVK-LPKHNYILYLIQVTEQKHTQEAPSEGSIEKLYIGTLKD 542
            T V     P+S+  +  AV  +P  + I   I      +  + P+       Y  TL  
Sbjct: 481 -TRVNRHNLPNSENQILLAVAPIPSQSNI---ISFFSSSNAAQQPT------FYTRTLDK 530

Query: 543 DNLDVISRESSIKIP 557
            +L  IS E  I++P
Sbjct: 531 SSLAQISSEVPIELP 545

>KAFR0B05460 Chr2 complement(1118755..1120587) [1833 bp, 610 aa]
           {ON} Anc_8.270 YDR118W
          Length = 610

 Score =  330 bits (845), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 170/522 (32%), Positives = 303/522 (58%), Gaps = 11/522 (2%)

Query: 4   PGNDYFIDYNPRFPIFATRTAKGLAINRVSDHARLAAIPIRNINLVANYNWDTVTGKFLS 63
           P    +  YN + P++  +  KGL + R SD+  +A   I+   LVA   WD ++GK+LS
Sbjct: 6   PKERSYCVYNKKLPLYTEKGPKGLMVYRRSDNTAIAHTIIKKWELVAGIYWDKISGKYLS 65

Query: 64  IFFKDGTIRIHDIFKDGRLVSFLRIPSTKISKGTWDRIPLESESGNGNLAYNIIDYLPKL 123
           IFF+DG+IRI D+FKDG+LV+FLR     +    WDRI  ++ +       NI+D +P L
Sbjct: 66  IFFRDGSIRIIDVFKDGKLVAFLRTQFKNVDCTYWDRIEEQTTNEMKQFNKNIVDLMPSL 125

Query: 124 IRYVKDSKRINIVPYTPPNSLWRGPDEDEPENNEKLDIHIIFNEGHDKITVFFNGDYAIF 183
           I++V  + +++++PYTP N+ WR  D  + + N  +D+H +     D   +  NGDY + 
Sbjct: 126 IQFVSSANKLSLIPYTPSNANWRELDA-KWKKNRVIDMHCLHQSETDSFLMVLNGDYYLT 184

Query: 184 VPV-GADENERF-VKSIVKIQDGFYHCFYDDGTVRTLNLGPLLRSEPSMNILKYIMAIKE 241
           +     D +E+    S++K  +  Y C Y DG+ R ++    L S+  +++L+ I+++K+
Sbjct: 185 LKTPETDLSEKVPACSLIKSANSLYQCIYKDGSARKIDTSSFLSSKSCIDLLECILSLKD 244

Query: 242 LIGYLLNHIEFINRELVTPYLEFVNRLCDEAYGYDKLISELECLFLLGEVSCDLEDWLCN 301
           +  Y  NH++ + R ++ PYL+F+ ++CD A+G +KLI+EL+  FLLG +S +L+DWL  
Sbjct: 245 MSKYTRNHLDLLERVIIKPYLDFLEKICDGAFGREKLINELKITFLLGTISDELQDWLHY 304

Query: 302 SVGEKNFKRWKCLGCEAYQKTTQILTLIFVPACERIIIFVEKLRGILEAFSIQNKFNDSS 361
           SVG+KN  +W+ L  +AYQ+TT++ T+  + ACER+I+  E+  G++ AF  ++  +D+S
Sbjct: 305 SVGDKNVTQWRTLCHDAYQQTTELFTIALMCACERMILLSERCFGLIMAFQFESGADDNS 364

Query: 362 DLTAVDTLLKNSQELLTITLKSIVDLGKDETLFETFFIWLNDRIHEVLDEDYKLKVQFED 421
            L  ++ L+ N Q++L   + +  +      + + F  WLNDR+HE LD+DYK ++    
Sbjct: 365 RLHELNELMSNLQDMLKSIIYTAEESANKFEMLKIFLSWLNDRVHEELDDDYKPQLSITQ 424

Query: 422 DPYFGYDLLTYFHNISNRGAETSP-VLNMKLYRDLINSMSDMEKEIAESN---VNSHIQQ 477
           +    Y L   F  +   G + S  +LN  + +   +++  +E  I+  N   +   ++ 
Sbjct: 425 NSNTCYKLGKSFEYLLQEGKKDSEDILNFDIIK---HTLEKIEANISRMNTKYIEPILEN 481

Query: 478 HILVESRTDVYSKEY-PSSQIYVFDAVKLPKHNYILYLIQVT 518
            I ++++   +   Y P   + V D VK+ +  Y+LY++Q++
Sbjct: 482 KIAIDTKIPFFKANYSPELTVTVRDIVKISQIPYVLYVVQLS 523

>ZYRO0C01474g Chr3 complement(106209..108008) [1800 bp, 599 aa] {ON}
           weakly similar to uniprot|Q04601 Saccharomyces
           cerevisiae YDR118W APC4 Subunit of the
           Anaphase-Promoting Complex/Cyclosome (APC/C) which is a
           ubiquitin-protein ligase required for degradation of
           anaphase inhibitors including mitotic cyclins during the
           metaphase/anaphase transition
          Length = 599

 Score =  327 bits (838), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 169/448 (37%), Positives = 270/448 (60%), Gaps = 23/448 (5%)

Query: 9   FIDYNPRFPIFATRTAKGLAINRVSDHARLAAIPIRNINLVANYNWDTVTGKFLSIFFKD 68
           ++DYNP +P++  +  +G +++R++D AR+A I +R+++ VA Y WD +TGKFLSIF+KD
Sbjct: 5   YVDYNPVYPLYVKQFTRGFSVHRMADDARIATIIVRDMSQVAGYQWDPITGKFLSIFYKD 64

Query: 69  GTIRIHDIFKDGRLVSFLRIPSTKISKGTWDRIPL---ESESGNGNLAYNIIDYLPKLIR 125
           GT+RI+D F+ GRLVS LR  S     G WDRI L   E    + ++ +++ + +PK+++
Sbjct: 65  GTVRIYDGFRSGRLVSLLRASSNGAVSGIWDRIELLHSEENIKDWSIDHDVTEMMPKMVK 124

Query: 126 YVKDSKRINIVPYTPPNSLWRGPDEDEPENNEKLDIHIIFNEGHDKITVFFNGDYAIFVP 185
           + +DS+++ +VPYT P+ +WR    D  + N  LD H+I    HD ++V F+G++ I + 
Sbjct: 125 FARDSRQLCVVPYTLPSDVWRPQAAD--DTNALLDAHVI--RCHDSLSVMFDGEFTISIQ 180

Query: 186 VGADENE--RFVKSIVKIQDGFYHCFYDDGTVRTLNLGPLLRSEPSMNILKYIMAIKELI 243
           + A  +   +FV +  +     Y  FY DG+V   +L  L++   S+ +LK ++ +++L 
Sbjct: 181 LAAIPSPLVKFVSAQHQ-----YLAFYQDGSVERFDLANLVKDPFSLRLLKNVITMRQLH 235

Query: 244 GYLLNHIEFINRELVTPYLEFVNRLCDEAY-GYDKLISELECLFLLGEVSCDLEDWLCNS 302
            YL +HIE I R+L+ PY EF+ R C  A+ GYD L  +L  L L+G+V+ +LEDWL NS
Sbjct: 236 RYLQDHIELIQRDLLQPYDEFLERCCQGAFGGYDLLREQLIDLMLVGDVTPELEDWLVNS 295

Query: 303 VGEKNFKRWKCLGCEAYQKTTQILTLIFVPACERIIIFVEKLRGILEAFSIQNKFNDSSD 362
           +GEKN KRW+ LG +AY KT Q+LTL  +PACER+I   ++  G L +  +  +      
Sbjct: 296 MGEKNLKRWRKLGTDAYHKTLQVLTLACLPACERLISLGQRCTGNLLSRQLTLQLPLLPP 355

Query: 363 LTAVDTLLKNSQELLTITLKSIVDLGKDETLFETFFIWLNDRIHEVLDEDYKLKVQFEDD 422
           +  +   LKN        L++I  L   + L  +F  W +DR+ E +DEDYKL+    D+
Sbjct: 356 IDCLQFFLKN-------VLEAIASLSSQQRLLGSFLDWFDDRVRESIDEDYKLRFNLHDN 408

Query: 423 PYFGYDLLTYFH-NISNRGAETSPVLNM 449
              G D  +Y    + N   E S V ++
Sbjct: 409 SSLGPDTASYLQLRLRNSSPEFSSVSDL 436

>Kpol_392.1 s392 complement(1..1272) [1272 bp, 424 aa] {ON}
           complement(1..1272) [1272 nt, 424 aa]
          Length = 424

 Score =  303 bits (776), Expect = 5e-96,   Method: Compositional matrix adjust.
 Identities = 162/419 (38%), Positives = 249/419 (59%), Gaps = 14/419 (3%)

Query: 8   YFIDYNPRFPIFATRTAKGLAINRVSDHARLAAIPIRNINLVANYNWDTVTGKFLSIFFK 67
           Y+  YNP F ++ TR+ +GLA+ R+ D ++LA I I++ + VA Y WD  +G+F+S+F  
Sbjct: 10  YYSKYNPCFQLYVTRSDQGLAVYRIKDSSQLAHIFIKDFDTVAGYEWDNYSGRFISVFLT 69

Query: 68  DGTIRIHDIFKDGRLVSFLRIPSTK-ISKGTWDRIPLESESGNGNLAYNIIDYLPKLIRY 126
           DGTIRI+DIFK+GRLVS++R  S K +    WDR      S       NII+ LP LI++
Sbjct: 70  DGTIRIYDIFKNGRLVSYIRSSSQKNVDSCLWDRAEFSIPSKLQLFDSNIIECLPTLIKF 129

Query: 127 VKDSKRINIVPYTPPNSLWRGPDEDEPENNEK------LDIHIIFNEGHDKITVFFNGDY 180
           VKDS+ INI+ Y PPN  WR  D++  + +++      LD+HI  N   D  T+  NG Y
Sbjct: 130 VKDSRNINIIDYYPPNHSWRHVDKESQDTDKEIDFRNLLDVHIQHNPNEDNFTIILNGVY 189

Query: 181 AIFVPVGADENERFVKSIVKIQDGFYHCFYDDGTVRTLNLGPLLRSEPSMNILKYIMAIK 240
            I   V  D ++  V  ++K+ +G Y  FY +G  R +N   LL    S  +L  I+ I+
Sbjct: 190 EINGIVMPDISKSEVYQLLKLHNGEYMSFYKNGHYRKINFNNLLSCNVSNGLLSNILEIR 249

Query: 241 ELIGYLLNHIEFINRELVTPYLEFVNRLCDEAY--GYDKLISELECLFLLGEVSCDLEDW 298
            L  Y+ +H++ I REL+ PY +FV ++C +AY  G  KL  ELE L L GE++ + +DW
Sbjct: 250 NLNRYVNDHLDLIKRELIIPYSDFVKKICIDAYAGGMTKLNDELESLLLTGEINNEFKDW 309

Query: 299 LCNSVGEKNFKRWKCLGCEAYQKTTQILTLIFVPACERIIIFVEKLRGILEAFSIQNKFN 358
           L N +G++N K+W+ LG + ++K  +ILTL  +P+CER +I++E+  G L  +       
Sbjct: 310 LVNIIGDRNGKKWRKLGMDMFEKIVKILTLAIIPSCERFMIYLERTDGYLNGY-----MK 364

Query: 359 DSSDLTAVDTLLKNSQELLTITLKSIVDLGKDETLFETFFIWLNDRIHEVLDEDYKLKV 417
             +D   + +L +   +L+  ++  I  L      FE F  W+ND+I+E+ DEDYK +V
Sbjct: 365 TDTDFYDIISLREYFSKLIRNSITIINSLNNQLKYFEIFSEWINDKINEITDEDYKNRV 423

>TPHA0J00790 Chr10 (182991..185048) [2058 bp, 685 aa] {ON} Anc_8.270
           YDR118W
          Length = 685

 Score =  266 bits (679), Expect = 6e-79,   Method: Compositional matrix adjust.
 Identities = 152/445 (34%), Positives = 251/445 (56%), Gaps = 22/445 (4%)

Query: 8   YFIDYNPRFPIFATRTAKGLAINRVSDHARLAAIPIRNINLVANYNWDTVTGKFLSIFFK 67
           Y+   NP + ++  ++ KGLAI  +SDH+ LA I I++ +LV ++ WD++TGKFL   F 
Sbjct: 10  YYYKLNPIYQLYTFKSDKGLAICTISDHSILATIFIKDFSLVVDFFWDSITGKFLLFAFN 69

Query: 68  DGTIRIHDIFKDGRLVSFLRIPSTKISKGTWDRIPLESESGNGNLA---YNIIDYLPKLI 124
           DG+IR++DIFK GRLVSF R P  +I    WDRI + +E+ +  L    Y++ + +P L+
Sbjct: 70  DGSIRVYDIFKLGRLVSFFRSPLKQIKCVYWDRIII-TETLDQQLKIFDYDLTNSMPTLV 128

Query: 125 RYVKDSKRINIVPYTPPNSLWRGPDED----------EPENNEKLDIHIIFNE-GHDKIT 173
           ++VKD + + +VP       WR  D D          E   ++ LDIH+++ E G D   
Sbjct: 129 KFVKDPQGLQLVPVLKNTQAWRQIDVDLNLKLENSKTEVSTDDVLDIHLLYTESGMDNFA 188

Query: 174 VFFNGDYA---IFVPVGADENERFVKSIVKIQDGFYHCFYDDGTVRTLNLGPLLRSEPSM 230
           V  NG Y    I VP   + +   V  +VK   G Y  FY++ + R +++ P   ++  +
Sbjct: 189 VLVNGVYDLSDIHVP---NRSPNKVIKLVKASQGKYLGFYENASYRLIDVTPFSSNDIRV 245

Query: 231 NILKYIMAIKELIGYLLNHIEFINRELVTPYLEFVNRLCDEAY-GYDKLISELECLFLLG 289
           N+L   + ++  +  L   IE I +EL++P+  F+N +C +AY GYD L   +  L L G
Sbjct: 246 NLLNNSIDLRNSVSLLKEQIEIIKKELISPFESFINLVCVDAYEGYDNLYRSMTNLLLTG 305

Query: 290 EVSCDLEDWLCNSVGEKNFKRWKCLGCEAYQKTTQILTLIFVPACERIIIFVEKLRGILE 349
           E+S + EDWL N++GE+N ++WK LG E   K  QIL+LIF+P  E+ II  E+++  + 
Sbjct: 306 EISEEFEDWLINTIGERNLRKWKNLGIELLDKLVQILSLIFIPITEKFIITAERIQNYIT 365

Query: 350 AFSIQNKFNDSSDLTAVDTLLKNSQELLTITLKSIVDLGKDETLFETFFIWLNDRIHEVL 409
           A  + +      + + ++ L+ N   +L  ++K I  L  D+  FE F  W+ + I+ ++
Sbjct: 366 AMRLSDNSKILENDSEINDLILNLSNILKTSIKQIPILNNDKMAFEIFIDWIRNTIYLII 425

Query: 410 DEDYKLKVQFEDDPYFGYDLLTYFH 434
           DE+YK K+       + +D+  Y +
Sbjct: 426 DENYKSKLSLSSSNSYPFDIQKYIN 450

>KNAG0H03190 Chr8 complement(597550..599418) [1869 bp, 622 aa] {ON}
           Anc_8.270 YDR118W
          Length = 622

 Score =  263 bits (673), Expect = 1e-78,   Method: Compositional matrix adjust.
 Identities = 136/428 (31%), Positives = 237/428 (55%), Gaps = 7/428 (1%)

Query: 5   GNDYFIDYNPRFPIFATRTAKGLAINRVSDHARLAAIPIRNINLVANYNWDTVTGKFLSI 64
              ++ + N   P++ TR  K L +NR +D + +A+  IR+ + V +Y WDT+ G+ +S+
Sbjct: 8   ARQFYTEVNNVLPLYVTRGTKQLVVNRDTDDSTIASTFIRDPSQVVSYQWDTIGGEIISV 67

Query: 65  FFKDGTIRIHDIFKDGRLVSFLRIPSTKISKGTWDRIPLESESGNGNLAYNII-DYLPKL 123
            F+DG+IRI+D+  D +LV+ LR   T +    WDRI L S + +     +II   LP+L
Sbjct: 68  MFQDGSIRINDVMYDAKLVALLRTQRTGLDCVLWDRIRLPSRAQSMEWDPDIITQSLPRL 127

Query: 124 IRYVKDSKRINIVPYTPPNSLWRGPDEDEPENNEKLDIHIIFNEGHDKITVFFNGDYAIF 183
           ++++      ++ PY P N  WR P+         LD+H +  +  D +    NG+Y + 
Sbjct: 128 VKFMGSDASPSMSPYLPTNHSWRFPNSGAAGG--ILDVHFLHQKLGDTLVALLNGEYQLQ 185

Query: 184 VPVGADENERFVKSIVKIQDG---FYHCFYDDGTVRTLNLGPLLRSEPSMNILKYIMAIK 240
           +     E++  ++ I+   D     Y+C+Y  G VR ++L   +  + ++ +L+  +  +
Sbjct: 186 LTGPHQEDQSELRKIIARTDSKRHVYNCYYKTGPVRQVDLTGFVEDKDTIKLLERFLLFQ 245

Query: 241 ELIGYLLNHIEFINRELVTPYLEFVNRLCDEAYGYDKLISELECLFLLGEVSCDLEDWLC 300
           + +GY L H+E I  E V PY EF+ RLC++A+G +KL   L   FL+G +  +L DWL 
Sbjct: 246 DYLGYFLAHLEPIQTECVEPYQEFIERLCEDAFGKEKLQESLTDHFLVGSMDEELRDWLV 305

Query: 301 NSVGEKNFKRWKCLGCEAYQKTTQILTLIFVPACERIIIFVEKLRG-ILEAFSIQNKFND 359
            S+GE+N + WK L   AY++T+Q++ +  VP  ER+II  E+L+  +L A   +    D
Sbjct: 306 YSLGERNLEEWKSLMNTAYRRTSQVVLMCLVPVSERLIILCEQLQALVLTAQLSEGMVGD 365

Query: 360 SSDLTAVDTLLKNSQELLTITLKSIVDLGKDETLFETFFIWLNDRIHEVLDEDYKLKVQF 419
           S +++    LL+N QELL + L+++  L KD    + F +WL + +   +++DY      
Sbjct: 366 SLEISEFTDLLENCQELLQLVLQTVKQLAKDIKDIKVFLLWLENVLKTTINKDYPPNFNV 425

Query: 420 EDDPYFGY 427
            +   FG+
Sbjct: 426 SECGKFGF 433

>NCAS0B03790 Chr2 complement(676973..678811) [1839 bp, 612 aa] {ON}
           Anc_8.270 YDR118W
          Length = 612

 Score =  241 bits (614), Expect = 3e-70,   Method: Compositional matrix adjust.
 Identities = 155/583 (26%), Positives = 282/583 (48%), Gaps = 23/583 (3%)

Query: 9   FIDYNPRFPIFATRTAKGLAINRVSDHARLAAIPIRNINLVANYNWDTVTGKFLSIFFKD 68
            + YNP +P    +T+ G A+ R  D  ++  I IRN++ V    W++    +L++ F D
Sbjct: 8   LVSYNPSYPAKLYKTSYGFAVRRTRDDTQIVKIVIRNMDAVIATCWNSFGSNYLTVMFND 67

Query: 69  GTIRIHDIFKDGRLVSFLRIP---STKISKGTWDRIPLESESGNGNLAYNIIDYLPKLIR 125
           G+ RIHDIF++G+L++ LR+       +  G W ++ +  +   G    +I   +P  I+
Sbjct: 68  GSARIHDIFREGKLMTLLRLQDGFQKCMDTGIWSKLEVRQKPNEGEFDRDISGLMPSPIK 127

Query: 126 YVKDSKRINIVPYTPPNSLWRGPDEDEPENNEKLDIHIIFNEGHDKITVFFNGDYAIFV- 184
           +V ++ ++ +VPY    + WR  D+   E N+ +DIH+  N   D+  +  NG Y + + 
Sbjct: 128 FVNNAGQLEVVPYVVTQTQWRNVDK-PLEVNDIIDIHMAHNSNTDEYLLMINGVYKLTIQ 186

Query: 185 PVGADEN--ERFVKSIVKIQDGFYHCFYDDGTVRTLNLGPLLRSEPSMNILKYIMAIKEL 242
           P   DEN   +  K I   +   +HCFY D    T++L  L+ S P +++L  +  +K+L
Sbjct: 187 PNSTDENASNQLHKIIHLEKTAIFHCFYKDRKTSTIDLTTLMESTPHVSLLNVLTEMKQL 246

Query: 243 IGYLLNHIEFINRELVTP---YLEFVNRLCDEAYGYDKLISELECLFLLGEVSCDLEDWL 299
             Y+++H++ I+ +L  P   +LE  N L         L   L+   L G ++  L  WL
Sbjct: 247 HRYIVDHLDIIDNDLKKPLDDFLEVTNIL-----NIKDLSKSLKSFILYGLMAKSLNHWL 301

Query: 300 CNSVGEKNFKRWKCLGCEAYQKTTQILTLIFVPACERIIIFVEKLRGILEAFSIQNKFND 359
           CN VGEKN K+WK L    YQK  QI++L  +PA E++ +   +   ++ A ++      
Sbjct: 302 CNVVGEKNLKKWKRLSETKYQKIIQIISLAVLPALEKLSLLSIRCEALVVAIALPAS-GH 360

Query: 360 SSDLTAVDTLLKNSQELLTITLKSIVDLGKDETLFETFFIWLNDRIHEVLDEDYKLKVQF 419
             +L   D+L + +  L    L       ++E     F +W+ D I E +DEDY  K+  
Sbjct: 361 MQELEYFDSLKRTTAALCNQALNITQKTSEEEKKCSVFILWIQDLIFECVDEDYVPKLNI 420

Query: 420 EDDPYFGYDLLTYFHNISNRGAETSPVLNMKLYRDLINSMSDMEKEIAESNVNSHIQQHI 479
            +D      L+           +        L ++L+ S+SD  + I  S V + + + +
Sbjct: 421 CEDGSVVPTLMEIIDQFFQDTTKEKSTDGTDLSKNLLKSISDTLENIDSSYVRNMLLKTM 480

Query: 480 LVESRTDVYSKEYPSSQIYVFDAVKLPKHNYILYLIQVTEQKHTQEAPSEGSIEKLYIGT 539
            +      +++ +    + + D     K+ +++YL++  ++ +TQ+   + S++  YIGT
Sbjct: 481 KIRGTARSFTENF-DEDVTILDIFYCAKYPFLVYLVE--KRSNTQDV--KASVK--YIGT 533

Query: 540 LKDDNLDVISRESSIKIPELFEFYSFSGARFVLKKVPNLIREI 582
               NL  IS    +  P   +  S    +F+ +K  N +  I
Sbjct: 534 ANSINLRTISAAKKVNYPLSIDSASIQKVKFLFEKQNNCLTLI 576

>NDAI0J01270 Chr10 (297256..299463) [2208 bp, 735 aa] {ON} Anc_8.270
           YDR118W
          Length = 735

 Score =  223 bits (568), Expect = 9e-63,   Method: Compositional matrix adjust.
 Identities = 174/627 (27%), Positives = 292/627 (46%), Gaps = 91/627 (14%)

Query: 13  NPRFPIFATRTAKGLAINRVSDHARLAAIPIRNINLVANYNWDTVTGKFLSIFFKDGTIR 72
           NP FP++ T+T+  +   R  D  +++ I IRN+  V   +WD+ TGK+L+I F DGT R
Sbjct: 28  NPSFPLYLTKTSNSIIARRTLDGFQISNIIIRNMQNVIAIDWDSKTGKYLTINFDDGTFR 87

Query: 73  IHDIFKDGRLVSFLRIP--------STKISKGTWDRIPLESESGNGNLAYNIIDYLPKLI 124
           I+DIF+DG+L++ +R           TK+    WDR+ + +        ++I   +P LI
Sbjct: 88  IYDIFQDGKLITLVRPQRNLLDIHRKTKVDNAIWDRLIILNSIQELEFNHDITKLMPTLI 147

Query: 125 RYVKDSKRINIVPYT--PPNSLWR--------------------GPDEDEPENNEKLDIH 162
           ++VKDS  I IVPY+     ++WR                      +++  ++   LD+H
Sbjct: 148 KFVKDSTNIYIVPYSHNEKQNIWREFQPVSSYKPISTNMDAIDMTTNQEVEKSMRYLDLH 207

Query: 163 IIFNEGHDKITVFFNGDYAIFV---PVGADENERFVKSIVKIQDGFYHCFYDDGTVRTLN 219
           II     D  T+  NG Y I +    +      + V+ +     G YHCF+++G++R+L 
Sbjct: 208 IIHVIDPDCFTIAINGTYQINLVRKTINTTNRNKIVRILKSTVHGVYHCFHENGSIRSLY 267

Query: 220 LGPLLRSEPSMNILKYIMAIKELIGYLLNHIEFINRELVTPYLEFVNRLCDEAY---GYD 276
                 S   + +L+  M I E+I Y   H++ IN+ L+  + +F+     E     G +
Sbjct: 268 FSHFTSSTLHVELLEIFMEINEMIKYFQYHLDLINKHLLKTFTDFLYPTIFEEKQNGGGN 327

Query: 277 KLISELECLFLLGEVSCDLEDWLCNSVGEKNFKRWKCLGCEAYQKTTQILTLIFVPACER 336
            ++ +L+   L GE+S +L +WL  S+GEKN K+WK L  E Y K+ QI +L  +PACE 
Sbjct: 328 SMLQQLKLSLLSGEMSEELIEWLTLSIGEKNLKKWKRLSEELYSKSIQIFSLALIPACEL 387

Query: 337 IIIFVEKLRGILEAFSIQNKFND------SSDLTAVDTLLKNSQ------------ELLT 378
            ++  +K   IL A  I+ K         S++ T  +  L + Q            EL+ 
Sbjct: 388 TLLLSQKCLAILNAIEIEKKARIRAKSKLSTNSTHTNIELNSRQDKILTEFSPSFLELIE 447

Query: 379 I-------TLKSIVDLGKDETLFETFFIWLNDRIHEVLDEDYKLKVQFEDDPYFGYDLLT 431
           I        L+++  +   E     F  WL + I   LDED+  K+    +P    DL  
Sbjct: 448 ILQKFGSRCLQNLRKISYIEKQSSLFLKWLQEMIFHALDEDHVPKLDTYSNPIICLDLSN 507

Query: 432 YFH---------NISNRGAETSPVLNMKLYRDLINSMSD----------MEKEIAESNVN 472
           + +         N  +R  + +P++N     +L  SM +          + + I E  + 
Sbjct: 508 FLNKLIVLSTDKNKEDREEDQNPLVNDDDENELFCSMEETTTMLQRINYLSRSIDEKGIQ 567

Query: 473 SHIQQHILVESRTD-VYSKEY-PSSQIYVFDAVKLPKHNYILYLIQVTEQKHTQEAPSEG 530
             +QQ + +      +  +E+ PS +I V D VK+   + +LYL+QV          S  
Sbjct: 568 PTLQQCLYLGPNIQFITEREFDPSKEITVKDVVKVLNGSILLYLLQV---------KSLD 618

Query: 531 SIEKLYIGTLKDDNLDVISRESSIKIP 557
           S +  Y+GT+   +L  I     I+ P
Sbjct: 619 SRDLFYVGTINVVDLKPICHPKLIQFP 645

>CAGL0B01859g Chr2 (168976..170844) [1869 bp, 622 aa] {ON} weakly
           similar to uniprot|Q04601 Saccharomyces cerevisiae
           YDR118w APC4 subunit of the anaphase promoting complex
          Length = 622

 Score =  219 bits (557), Expect = 5e-62,   Method: Compositional matrix adjust.
 Identities = 130/435 (29%), Positives = 234/435 (53%), Gaps = 53/435 (12%)

Query: 7   DYFIDYNPRFPIFA-TRTAKGLAINRVSDHARLAAIPIRNINLVANYNWDTVTGKFLSIF 65
           D F+ YNP++ +F        L I R SD+  +  I +RNI L+ +Y WD + GK+L++F
Sbjct: 8   DRFLKYNPKYGLFGMNEDNHSLVIRRTSDNVGIVKINVRNIVLLLDYFWDPIDGKYLALF 67

Query: 66  FKDGTIRIHDIFKDGRLVSFLRIPSTKISKGT-------WDRIPLESESGNGNLAY---N 115
            KDG++RI+DIF  G+L+SFLR+    +           WDRI +  +SG+  L     +
Sbjct: 68  LKDGSVRIYDIFNGGKLISFLRVLPVVLGSNKPSLDCCLWDRIII-PKSGSSELRIPNND 126

Query: 116 IIDYLPKLIRYVKDSKRINIVPYTPPNSLWRGPDEDEPENNEK--LDIHIIFNEGHDKIT 173
           + + +P L+++V+D+K+I+I+P      LWR        NNEK  +D+H+ ++    ++T
Sbjct: 127 LTESMPTLVKFVQDAKQIDIIPNRSITKLWRSIG-----NNEKKVVDVHLGYSCSSAQVT 181

Query: 174 VFFNGDYAIFVPVGADENERFVKSIVKIQ-------------DGFYHCFYDDGTVRTLNL 220
           +  NG+Y I         E+ V  I +IQ             +  Y   +DD +   ++L
Sbjct: 182 ILINGEYLI---------EKSVSDINQIQKKIPISLNKKEFCEAIYEIHFDDYSRLQIDL 232

Query: 221 GPLLRSEPSMNILKYIMAIKELIGYLLNHIEFINRELVTPYLEFVNRLCDEAYGYDKLIS 280
             +L ++  +++++  + +      + +H   I + ++ PY EF+     E+ G    + 
Sbjct: 233 TGILLNDDKLDLIETQIKMTNHFDLIKDHFNLIEKSVLAPYYEFL-----ESIGGINDLD 287

Query: 281 ELECLFLLGEVSCDLEDWLCNSVGEKNFKRWKCLGCEAYQKTTQILTLIFVPACERIIIF 340
            LE LFL+GE+   L +W   ++ EKN K+W  LG E Y    Q+L ++FVP CER+++ 
Sbjct: 288 VLERLFLIGELDTKLGNWFKETINEKNLKKWSRLGNEFYSNFKQVLIIVFVPICERLMVL 347

Query: 341 VEKLRGILEAFSIQNKFNDSSDLTAVDTLLKNSQELLTITLKSIVDLGKDETLFETFFI- 399
             ++ G+++   +Q    +S + + +D  +   Q  L + LK + +L +DET F+  F+ 
Sbjct: 348 TNRINGMIKGIDLQ----ESQETSLLD--ISELQSFLNLVLKLLAELNEDETYFKQDFLP 401

Query: 400 WLNDRIHEVLDEDYK 414
           WL D+++E ++ +YK
Sbjct: 402 WLTDKVYESINNEYK 416

>TBLA0C04570 Chr3 (1107010..1108836) [1827 bp, 608 aa] {ON}
           Anc_8.270 YDR118W
          Length = 608

 Score =  206 bits (525), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 118/403 (29%), Positives = 213/403 (52%), Gaps = 7/403 (1%)

Query: 13  NPRFPIFATRTAKGLAINRVSDHARLAAIPIRNINLVANYNWDTVTGKFLSIFFKDGTIR 72
           NP  P+   ++  GL + R +D + +    IRN N +  Y W+   G +++IFF+ GT+ 
Sbjct: 13  NPTLPLTLCKSDSGLKVIRTADKSIIINYKIRNKNDIIYYQWENNIGNYVAIFFQRGTVM 72

Query: 73  IHDIFKDGRLVSFLRIPSTKISKGTWDRIPLESESGNGNLAYNIIDYLPKLIRYVKDSKR 132
           I+D  K  RL++ L      +  G WDR    +++       +I  Y+P LI+ ++D ++
Sbjct: 73  IYDGIKTSRLLAMLNGGKPNVDAGIWDRYYFPNDNEKDIFDSDITLYMPTLIQIIRDKEK 132

Query: 133 INIVPYTPPNSLWRGPDEDEPENNEKLDIHIIFNEGHDKITVFFNGDYAIFVPVGADENE 192
           I    Y PP+S WR   E E   NE LDIH++ +   D  T   NG+  +  P  +    
Sbjct: 133 ICPGTYFPPHSTWRAKKE-ESLKNEFLDIHLLHHSVDDSFTFILNGELKLPFPSNSTSGR 191

Query: 193 RFVKSIVKIQDGFYHCFYDDGTVRTLNLGPLLRSEPSMNILKYIMAIKELIGYLLNHIEF 252
                I+K ++  + CFY D TVR ++   LL+ + +  ++ + + I  L+ YL  HI F
Sbjct: 192 AI--GIIKGENNCFICFYQDLTVRMIDCHDLLQLKGNEILVDHFIRINHLLKYLKEHIMF 249

Query: 253 INRELVTPYLEFVNRLCDEAYGYDKLISELECLFLLGEVSCDLEDWLCNSVGEKNFKRWK 312
           I   + TP+ EF+  +  EA   + ++  L  + + G +S +LE+W+ N++G KN  RW 
Sbjct: 250 IKDNMSTPFNEFLTSVKGEA-TQEMMMENLITMLVSGYISTELEEWIRNTIGIKNLTRWA 308

Query: 313 CLGCEAYQKTTQILTLIFVPACERIIIFVEKLRGILEAFSIQNKFNDSS---DLTAVDTL 369
            LG   Y+K   I+TL+ +PACER +I V +L+G++E   ++N+ ++     + + ++ +
Sbjct: 309 TLGGIFYEKGVDIITLMVIPACERFMILVARLQGLIEYVIVRNRCDNRGVNLNSSYIENV 368

Query: 370 LKNSQELLTITLKSIVDLGKDETLFETFFIWLNDRIHEVLDED 412
              ++  +   L+ +  L   + LFE F  W ++ +  V+ ++
Sbjct: 369 KHAAKRFMKEALRMLEQLQLQKQLFEKFLHWFSENVRGVVQDE 411

>KLTH0G13508g Chr7 complement(1159671..1161608) [1938 bp, 645 aa]
           {ON} some similarities with uniprot|Q04601 Saccharomyces
           cerevisiae YDR118W APC4 Subunit of the
           Anaphase-Promoting Complex/Cyclosome (APC/C)
          Length = 645

 Score =  193 bits (490), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 124/419 (29%), Positives = 203/419 (48%), Gaps = 33/419 (7%)

Query: 12  YNPRFPIFATRTAKGLAINRVSDHARLAAIPIRNINLVANYNWDTVTGKFLSIFFKDGTI 71
           +NPR  ++     K +++NR  D  R+AA+ +R    +    W+   GK  ++FF +G +
Sbjct: 21  WNPRLSLYLVLGDKTVSVNRAIDGQRIAAVNLRGDGQLIGAQWELAEGKLFALFFGNGAV 80

Query: 72  RIHDIFKDGRLVSFL-----------RIPSTKISKGTWDRIPLESESGNGNLAYNIIDYL 120
           RI+D    G L   +            + +   S   W +   E +     L   I   L
Sbjct: 81  RIYDCATGGSLREVVDLVDEGQSADVTVDTAVWSGAQWAQFRQEYK----GLNIEITKQL 136

Query: 121 PKLIRYVKDSKRINIVPYTPPNSLWRG-PDEDEPENNEKLDIHIIFNEGHDKITVFFNGD 179
           P ++R V+D+K++++VP       W   P +D         I +  +E      +  +G 
Sbjct: 137 PGMVRLVRDAKQLSVVPLETGKLRWLADPGKDAA-------IFLGHDEKSGDYLMTVDGL 189

Query: 180 YAIFVPVGADENERFVKSIVKIQDGFYHCFYDDGTVRTLNLGPLLRSEPSMNILKYIMAI 239
            ++ VP G  +  + ++   + +DG +     DGTV+ + L   L S     +++Y   I
Sbjct: 190 LSVRVPSGIKKMHKILR---QGEDGTFVGVGADGTVQWVVL-RFLNSALMRELIRYSGQI 245

Query: 240 KELIGYLLNHIEFINRELVTPYLEFVNRLCDEAYGYDKLISELECLFLLGEVSCDLEDWL 299
           + L  YL  +I     +L+ PY +F+ R+ D AY   +L S    + L G +  DLEDWL
Sbjct: 246 RFLCSYLTENINMCKTDLIEPYRQFLTRIAD-AYEGGELASRFRDIILSGYIPEDLEDWL 304

Query: 300 CNSVGEKNFKRWKCLGCEAYQKTTQILTLIFVPACERIIIFVEKLRGILEAFSIQNKFND 359
           CNS+G+KN+KRWK L    Y     +L L  +PACER+I+  E+L+GI +   +Q +F  
Sbjct: 305 CNSIGDKNYKRWKQLSTRMYGDLNNVLALAVIPACERLILAAEQLQGIHKGLKLQ-EFGL 363

Query: 360 SS----DLTAVDTLLKNSQELLTITLKSIVDLGKDETLFETFFIWLNDRIHEVLDEDYK 414
           +S    +   V  L+   Q LL  +L+ +VDL +D  L   F  W  D + E +DEDYK
Sbjct: 364 ASPQEFESAEVTELITGCQALLHASLELVVDLNRDTRLHAIFADWFYDVVMETVDEDYK 422

>Kwal_56.23766 s56 complement(695943..698165) [2223 bp, 740 aa] {ON}
           YDR118W (APC4) - subunit of the anaphase promoting
           complex (APC) [contig 173] FULL
          Length = 740

 Score =  186 bits (471), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 128/422 (30%), Positives = 206/422 (48%), Gaps = 39/422 (9%)

Query: 12  YNPRFPIFATRTAKGLAINRVSDHARLAAIPIRNINLVANYNWDTVTGKFLSIFFKDGTI 71
           +NPR  ++   T K +A+NRV D  ++AA+ +R+ + +    W+    K  ++F  +G +
Sbjct: 21  WNPRLSLYLVLTDKKIAVNRVIDGQQIAAVNLRDEHEIVGIQWEKNESKLFAVFQSNGVV 80

Query: 72  RIHDIFKDGRLVSFLRI------PSTKISKGTWDRIPLES--ESGNGNLAYNIIDYLPKL 123
           RI+D    G L   + +         K+    W  +      ES  G L ++I   +P +
Sbjct: 81  RIYDCSIGGSLREMVNLVEEGQAAEVKVDAVVWMTVEWAKFPESYRG-LDFDITTLMPGM 139

Query: 124 IRYVKDSKRINIVPYTPPNSLWRGPDEDEPENNEKLDIHIIFNEGHD----KITVFFNGD 179
           +R V+DSK++++ P       W         + +  D  I     HD    +  V  +G 
Sbjct: 140 VRLVRDSKQLSLAPLDLGKLSWL--------DGKYGDAAIFL--AHDCESTEYMVAIDGQ 189

Query: 180 YAIFVPVGADENERFVKSIVKI----QDGFYHCFYDDGTVRTLNLGPLLRSEPSMNILKY 235
            ++  P G       ++++ KI      G +     DGT++ + L   L       ++K 
Sbjct: 190 LSLRFPSG-------IRNVHKILPQGGSGSFLAVGKDGTLQWVTLK-FLECALMRELVKS 241

Query: 236 IMAIKELIGYLLNHIEFINRELVTPYLEFVNRLCDEAYGYDKLISELECLFLLGEVSCDL 295
              I+ L  YL  ++   + EL+ PY  F+ RL   AY  D L + L  + L G +  DL
Sbjct: 242 SGQIRFLCRYLAENVSLCHTELIEPYRVFLTRLMG-AYEGDDLATRLRDILLTGYIPDDL 300

Query: 296 EDWLCNSVGEKNFKRWKCLGCEAYQKTTQILTLIFVPACERIIIFVEKLRGILEAFSIQN 355
           E+WLCNSVG+KN+KRWK L    Y     +LTL  VPACER+I+  E+++GI ++  +Q 
Sbjct: 301 EEWLCNSVGDKNYKRWKQLSTRMYGDLNNVLTLAVVPACERLILAAERMQGIHKSLKLQR 360

Query: 356 KFND-SSDLTAVD--TLLKNSQELLTITLKSIVDLGKDETLFETFFIWLNDRIHEVLDED 412
              D + +LT V+  TL+   Q LL  TL  I +L +D  L + F  W  D + E +DED
Sbjct: 361 FCKDYAGELTTVELQTLISECQTLLEFTLNLITELNRDAALHQVFAEWFYDVVMETVDED 420

Query: 413 YK 414
           YK
Sbjct: 421 YK 422

>SAKL0H16852g Chr8 complement(1482321..1484255) [1935 bp, 644 aa]
           {ON} some similarities with uniprot|Q04601 Saccharomyces
           cerevisiae YDR118W APC4 Subunit of the
           Anaphase-Promoting Complex/Cyclosome (APC/C) which is a
           ubiquitin-protein ligase required for degradation of
           anaphase inhibitors including mitotic cyclins during the
           metaphase/anaphase transition
          Length = 644

 Score =  183 bits (464), Expect = 6e-49,   Method: Compositional matrix adjust.
 Identities = 122/436 (27%), Positives = 210/436 (48%), Gaps = 24/436 (5%)

Query: 4   PGNDYFIDYNPRFPIFATRTAKGLAINRVSDHARLAAIPIRNINLVANYNWDTVTGKFLS 63
           PG    + +NP   +F   T KG+A+NR  D  R+A + +++   + +Y W+   G+  +
Sbjct: 13  PGEQRIV-WNPVLSLFLVPTVKGIAVNRPVDGQRIATVSVKDHGTIVDYQWEQSEGRIFA 71

Query: 64  IFFKDGTIRIHDIFKDGRLVS--FLRIPSTKISKGTWDRIPLESESGNGNL-AYNIIDYL 120
           +   +G IR++D    G+ V    L      + K  W +      S   N+  + I   +
Sbjct: 72  VCHSNGIIRLYDSSLAGKSVGSVILGDSDCDVLKFCWSQDSWTFGSKFSNVFDHEITSLM 131

Query: 121 PKLIRYVKDSKRINIVPYTPPNSLWRGPDEDEPENNEKLDIHIIFNEGHDKITVFFNGDY 180
           P+L+++VKDS+++ ++P    + +   P   + + N+   I + ++    KI +  +G +
Sbjct: 132 PRLVKFVKDSRQLTMLPTDVGDGV---PRWSKLDGNKSF-IFLGYDSKRQKILMAIDGAF 187

Query: 181 AIFVPVGA--------DENERF---VKSIVKIQDGFYHCFYDDGTVRTLNLGPLLRSEPS 229
            +   V A        DE +     V+ I+K  +G Y    DD  ++ +     L    +
Sbjct: 188 KLSFSVAALVAAGERLDEGDSVPNNVRDILKYDNGEYLVITDDWYIQKIKF-DFLNCNLT 246

Query: 230 MNILKYIMAIKELIGYLLNHIEFINRELVTPYLEFVNRLCDEAYGYDKLISELECLFLLG 289
             ++     I+ L   L   +  +  ELV PY +F+ R+   AY  D LI +L  L   G
Sbjct: 247 REMISCCNRIRSLHKQLHESVSLVKTELVEPYTQFIERVLG-AYEGD-LIGDLTELLFTG 304

Query: 290 EVSCDLEDWLCNSVGEKNFKRWKCLGCEAYQKTTQILTLIFVPACERIIIFVEKLRGILE 349
            V  +LEDWL N++G+KN +RWK L    Y+   +I+ L  VP CER+I+  E+L GI++
Sbjct: 305 SVPPELEDWLSNTIGDKNLRRWKKLSSVMYENAVKIMVLTMVPVCERLILCGERLHGIIK 364

Query: 350 AFSI--QNKFNDSSDLTAVDTLLKNSQELLTITLKSIVDLGKDETLFETFFIWLNDRIHE 407
              +    +  D+ ++     L+  SQE L   + SI  +  D  L E F  W +D + E
Sbjct: 365 GLKLIGLKELEDNLEVLEAQKLVCLSQEALENIIVSIKQINVDSNLHEAFIDWFHDMVME 424

Query: 408 VLDEDYKLKVQFEDDP 423
            +DEDYK K  +  DP
Sbjct: 425 AVDEDYKRKTSYNCDP 440

>Ecym_4300 Chr4 complement(642023..644170) [2148 bp, 715 aa] {ON}
           similar to Ashbya gossypii AGR078C
          Length = 715

 Score = 76.6 bits (187), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 88/427 (20%), Positives = 179/427 (41%), Gaps = 45/427 (10%)

Query: 12  YNPRFPIFATRTAKGLAINRVSDHARLAAIPIRNINLVANYNWDTVT-----GKFLSIFF 66
           +N R  ++       + I R  D  ++ +IP+R   L +N    T       G   ++  
Sbjct: 20  WNDRLSLWGIHEKGNVNIFRYIDGRKMGSIPLR---LKSNEEILTCQLEPNDGDLFAVVL 76

Query: 67  KDGTIRIHDIFKD-------------GRLVSFLRIPSTKISKGTWDRIPLESESG-NGNL 112
           + G+++++   +D             G +V   R     + +  W+RI  +S     G+ 
Sbjct: 77  RSGSVKVYKGRQDVDSSDPTDGADMVGTIV-LGRGEWFNMEQFVWNRIKWKSRGAFKGDF 135

Query: 113 AYNIIDYLPKLIRY-VKDSKRINIVPYTPPNSLWRGPDEDEPENNEKLDIHIIFNEGHDK 171
              +  +LPKL    V    ++   P       + GP+ +   +  + ++ + ++    K
Sbjct: 136 DTVLTQWLPKLTEMNVSPQGKLTCTPLE-----FEGPEWNASLSENESNMFLTYDNATRK 190

Query: 172 ITVFFNGDYAIFVPVGADENERFVKSIVKIQDGFYHCFY----DDGTVRTLNLGPLLRSE 227
           + V  +G +         E  +F   +  I  G  + +     +D  ++ + L     S 
Sbjct: 191 VMVSIDGTFNFRY----GEKNKFPTKVTNILSGNANNYVFLNDEDWQLQIIKL-EFTESH 245

Query: 228 PSMNILKYIMAIKELIGYLLNHIEFINRELVTPYLEFVNRLCDEAYGYDKLISELECLFL 287
               ++K    I+ L+ YL ++ + I  +L+ P+  F+N L  +     +L+  L+ +F 
Sbjct: 246 QMHELMKCCSQIQFLMKYLRDNHKIIGVKLMEPHATFINSLFPDEQA-SRLLKGLKDVFY 304

Query: 288 LG-EVSCDLEDWLCNSVGEKNFKRWKCLGCEAYQKTTQILTLIFVPACERIIIFVEKLRG 346
           LG     ++E+W    +G      WK      +  +  IL    +PACER+I+ V++L+G
Sbjct: 305 LGYSAEKNIENWFTLKLGRHGISIWKQRNHLFWSSSQGILVTCMIPACERLIVAVKRLQG 364

Query: 347 ILEAFSIQNKF--NDSSDLTA--VDTLLKNSQELLTITLKSIVDLGKDETLFETFFIWLN 402
           ++++  + N F  +D  +L A  VD LL+   + LT  +K +      E +      W+ 
Sbjct: 365 LIKSLKL-NIFGLDDDEELIAPEVDELLQMGLDTLTEIVKQVEKFHIGENMSIDGLTWIE 423

Query: 403 DRIHEVL 409
             I  +L
Sbjct: 424 YMIDSLL 430

>AGR078C Chr7 complement(877135..879282) [2148 bp, 715 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR118W
           (APC4)
          Length = 715

 Score = 72.0 bits (175), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 91/435 (20%), Positives = 184/435 (42%), Gaps = 52/435 (11%)

Query: 12  YNPRFPIFATRTAKGLAINRVSDHARLAAIPIR---NINLVANYNWDTVTGKFLSIFFKD 68
           +N R  ++     + L+I R  D  R+ AIP+R   N  L+    W+   G+  ++  + 
Sbjct: 20  WNDRLSLWGVLEKEVLSIFRYIDGRRVGAIPLRLRQNEELL-RCQWEPDDGELFAVALRS 78

Query: 69  GTIRIHDIFKDGRL----------------VSFLRIPSTKISKGTWDRIPLE-SESGNGN 111
           G+++I+     GRL                V   R  + ++ +  W+RI     E   G 
Sbjct: 79  GSVKIYR----GRLDPEGTEGSEGAELVGTVVLGRGDAFQMEQFVWNRIKWRVREPFCGE 134

Query: 112 LAYNIIDYLPKLIRY-VKDSKRINIVPYTPPNSLWRGPDEDEPENNEKLDIHIIFNEGHD 170
               ++ +LP+L    +    ++   P       + GP+ +     ++ ++ + F+    
Sbjct: 135 FDSPLVQWLPRLTEMSISAQGKLLCTPLG-----YEGPEWNAGLAADESNMFLTFDNNTR 189

Query: 171 KITVFFNGDYAIFVPVGADENERFVKSIVKIQDGFYHCFY----DDGTVRTLNLGPLLRS 226
           K+ +  +G +         E  +F   +  I  G  + +     +D  ++ + L      
Sbjct: 190 KVVLSIDGTFNFRY----GEKSKFPTKVTSILPGNENHYVFINDEDWQLQVIRL-EFTEY 244

Query: 227 EPSMNILKYIMAIKELIGYLLNHIEFINRELVTPYLEFVNRLCDEAYGYDKLISELECLF 286
                ++K    I+ L+ Y+ ++   I  +L+ P+  F   L  E   + K +  L+ +F
Sbjct: 245 HQVHELMKCCSHIQFLLKYIRDNHRLIGTKLMEPHATFTGSLFPEEQ-FTKFMKGLKDVF 303

Query: 287 LLGEVSCD--LEDWLCNSVGEKNFKRWKCLGCEAYQKTTQILTLIFVPACERIIIFVEKL 344
            LG  S D  +E+W    +G      WK      +  +  +L    +PACER+I+  ++L
Sbjct: 304 YLG-YSDDKTVENWFTLKLGRHGTAIWKQRNHLFWSSSQGVLVTCMIPACERLIVSAKRL 362

Query: 345 RGILEAFSIQNKF--NDSSDLTAVDT--LLKNSQELLTITLKSIVDLGKDETLFETFFIW 400
            G++++  + N F  +D ++LTAV+   LL+ S  LL   ++ +      E + +    W
Sbjct: 363 LGLVKSLKL-NVFGLDDDNELTAVEVQDLLQMSLGLLKGLVEQVEQFHVGENVSKDGLAW 421

Query: 401 LNDRIHEVL---DED 412
           +   +  +L   DED
Sbjct: 422 IEYMMDSLLHNEDED 436

>KLLA0F19316g Chr6 (1786659..1788674) [2016 bp, 671 aa] {ON}
           conserved hypothetical protein
          Length = 671

 Score = 52.0 bits (123), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 92/394 (23%), Positives = 168/394 (42%), Gaps = 69/394 (17%)

Query: 22  RTAKGLAINRVSDHARLAAIPIRNINLVANYNWDTVTGKFLSIFFKDGTIRIHDIFKDGR 81
           RT  G  INR++D        I+N  L+ +  W    G  L   +  GT+    I+++GR
Sbjct: 42  RTNGGYLINRLNDE-------IQNHRLI-DVVWH---GNDLFCCYNSGTV---SIYREGR 87

Query: 82  -LVSFLRIPSTKISKGTWDRIPLESESGNGNLAY-----NIIDYLPKLIRYVKDSKRINI 135
            LV  L    T I KG   +  L       +  Y     N+++ +PKL ++       ++
Sbjct: 88  ELVKQL----TFIPKGAKTKCILCDNLVPSDDRYSLSDGNLLNSMPKLNKW-------DM 136

Query: 136 VPYTPPNSLWRGPDEDEPENNEKLDIHIIFNEGHDKITVFFNGDYAIFVPVGAD-ENERF 194
           +     N L       E    + +DI +  +   +K+ +   G   + + VG   +  + 
Sbjct: 137 IKNELDNELILN---SELGKKKPIDIFMAIDSKTNKLILSIEG--TLNIKVGEKLKLPKD 191

Query: 195 VKSIVKIQDGFYHCFYDDGTVRTLNLGPLLRSEPSMNILKYIMAIKE---LIGYLLNHIE 251
           +K I+K+  G Y C   D + + L+L  L   +P  NI K I   +E   L+ YL     
Sbjct: 192 IKRIIKVSSGKYMCLGKDWSYQVLDLTFL--QDP--NIYKLIKTTQEYSALLRYLKQLHR 247

Query: 252 FINRELVTPYLEFVNRLCDEAYGYDKLISELECLFLLGEVSCDLEDWLCNSVGEKNFK-- 309
            +  +L  PY EFV  L  E +      + L+ LF +G    ++ + L + V  + F+  
Sbjct: 248 HLRMKLTEPYFEFVETLLKEEHK-----NALQELFYIGVTKLEVMEEL-HEVQLQTFRLD 301

Query: 310 RWKCLGCEAYQKTTQILTLIFVPACERIIIFVEKLRGILEAFS---------IQNKFND- 359
           +W  L  +    +  ++    +P  ER+I+    +  + EA +         + +K  + 
Sbjct: 302 KWSALSNDLCSNSIGLMVACTIPLLERMIVLAASIEALCEAITWIKFPNEIWVGSKLRER 361

Query: 360 -----SSDLTAVDTLLKN--SQELLTITLKSIVD 386
                 S  +  D+++KN  +QEL  + ++S+ D
Sbjct: 362 TVETLKSVRSQTDSIMKNKKTQELGLMWIRSLSD 395

>CAGL0M13409g Chr13 complement(1317818..1322401) [4584 bp, 1527 aa]
            {ON} similar to uniprot|P38873 Saccharomyces cerevisiae
            YHR186c
          Length = 1527

 Score = 35.8 bits (81), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 19/58 (32%), Positives = 24/58 (41%)

Query: 41   IPIRNINLVANYNWDTVTGKFLSIFFKDGTIRIHDIFKDGRLVSFLRIPSTKISKGTW 98
            IP +  +L  +   D V G      F DGTIR++D   D RL    R        G W
Sbjct: 1312 IPAKTSSLFTSLTSDQVAGNIFVAGFSDGTIRVYDRRTDPRLAMVRRWRGGGGKPGAW 1369

>NDAI0C03540 Chr3 complement(810904..815580) [4677 bp, 1558 aa] {ON}
            Anc_5.49 YHR186C
          Length = 1558

 Score = 35.0 bits (79), Expect = 0.81,   Method: Compositional matrix adjust.
 Identities = 17/58 (29%), Positives = 28/58 (48%)

Query: 41   IPIRNINLVANYNWDTVTGKFLSIFFKDGTIRIHDIFKDGRLVSFLRIPSTKISKGTW 98
            IP +  +L+ +   D + G   +  F DGT+R++D   D R     R  +   S+G W
Sbjct: 1350 IPAKTSSLITSLTSDQLAGDIFTAGFADGTLRVYDRRMDPRDSMVRRWRAGDGSQGAW 1407

>SAKL0D02640g Chr4 (215909..219292) [3384 bp, 1127 aa] {ON} similar to
            uniprot|P53753 Saccharomyces cerevisiae YNR067C
          Length = 1127

 Score = 33.5 bits (75), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 19/46 (41%), Positives = 24/46 (52%)

Query: 115  NIIDYLPKLIRYVKDSKRINIVPYTPPNSLWRGPDEDEPENNEKLD 160
            NIIDY        +    I+++P TP +S  RGP   E E NEKL 
Sbjct: 1018 NIIDYTTYFGTNTEYKNGIHMLPITPASSCIRGPTFVEEEWNEKLS 1063

>KLTH0G19008g Chr7 complement(1641134..1644121) [2988 bp, 995 aa]
           {ON} similar to uniprot|P19263 Saccharomyces cerevisiae
           YLR071C RGR1 Component of RNA polymerase II
           holoenzyme/mediator complex affects chromatin structure
           and transcriptional regulation of diverse genes required
           for glucose repression HO repression RME1 repression and
           sporulation
          Length = 995

 Score = 32.0 bits (71), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 28/87 (32%), Positives = 41/87 (47%), Gaps = 11/87 (12%)

Query: 505 LPKHNYILYLIQVTEQKHTQEAPSEGSIE---KLYIGTLKDDNLDVISRESSIKIPELFE 561
           LP HN+ L        + T   P  G+     KL +  LKD N+ +  + S +++PE F 
Sbjct: 183 LPTHNFRL------SGEDTNSNPETGAAAIPAKLILKKLKDMNIIMSVKVSLMEVPEQFS 236

Query: 562 FYSFSGARFVLKKVPNLIREIELSDGN 588
            YS    R  + +V N   EI+LS  N
Sbjct: 237 HYSVRDGRLSI-RVENEF-EIQLSTTN 261

>TBLA0C05310 Chr3 (1286959..1288989) [2031 bp, 676 aa] {ON}
           Anc_3.479 YPR141C
          Length = 676

 Score = 31.6 bits (70), Expect = 7.4,   Method: Compositional matrix adjust.
 Identities = 36/124 (29%), Positives = 52/124 (41%), Gaps = 21/124 (16%)

Query: 302 SVGEKNFKRWKCLGCEAYQKTTQILTLIFVPACERIIIFVEKLRGILEAFSIQNKFNDSS 361
           SV + +FK  K + C+ Y+  T+ L L              K   IL     + K    +
Sbjct: 125 SVLQNDFKSEKHVLCKQYKDKTEALRL--------------KYEHILNKMDYEGKIKLEN 170

Query: 362 DLTAVDTLLKN-SQELLTITLKSIVDLGKDETLFETFFIWLND---RIHEVLDEDYKLKV 417
            L      +KN  +E+  I LK   DL   ET+   F  W ND     HE+LD++ K K 
Sbjct: 171 QLNMSHNNIKNVEKEIKAIALKYKDDL---ETINLQFNAWKNDFNNNFHELLDDNIKKKD 227

Query: 418 QFED 421
             E+
Sbjct: 228 TIEN 231

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.321    0.140    0.416 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 74,324,345
Number of extensions: 3564176
Number of successful extensions: 9793
Number of sequences better than 10.0: 42
Number of HSP's gapped: 10053
Number of HSP's successfully gapped: 42
Length of query: 648
Length of database: 53,481,399
Length adjustment: 116
Effective length of query: 532
Effective length of database: 40,180,143
Effective search space: 21375836076
Effective search space used: 21375836076
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 69 (31.2 bits)