Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Smik_4.3618.269ON56555727710.0
Suva_2.2768.269ON56555723270.0
YDR117C (TMA64)8.269ON56555723260.0
Skud_4.3778.269ON56256322840.0
NCAS0B038008.269ON56556317150.0
TDEL0F039608.269ON55855816550.0
ZYRO0C01496g8.269ON56756115540.0
TPHA0J007808.269ON58357915410.0
CAGL0B01837g8.269ON56956415340.0
NDAI0J013108.269ON57958015230.0
KAFR0B054708.269ON56256415150.0
Kpol_392.28.269ON56656914910.0
KLTH0G13530g8.269ON57456414910.0
SAKL0H16874g8.269ON56356414650.0
Kwal_56.237718.269ON56255814380.0
KLLA0F19294g8.269ON57056312221e-162
TBLA0I032008.269ON56357612161e-161
KNAG0H032008.269ON56156811861e-157
Ecym_43018.269ON56457511681e-154
AGR079W8.269ON54256510941e-143
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Smik_4.361
         (565 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Smik_4.361 Chr4 complement(645227..646924) [1698 bp, 565 aa] {ON...  1071   0.0  
Suva_2.276 Chr2 complement(478604..480301) [1698 bp, 565 aa] {ON...   900   0.0  
YDR117C Chr4 complement(683946..685643) [1698 bp, 565 aa] {ON}  ...   900   0.0  
Skud_4.377 Chr4 complement(655577..657265) [1689 bp, 562 aa] {ON...   884   0.0  
NCAS0B03800 Chr2 (678984..680681) [1698 bp, 565 aa] {ON} Anc_8.2...   665   0.0  
TDEL0F03960 Chr6 complement(733512..735188) [1677 bp, 558 aa] {O...   642   0.0  
ZYRO0C01496g Chr3 (108150..109853) [1704 bp, 567 aa] {ON} simila...   603   0.0  
TPHA0J00780 Chr10 complement(180939..182690) [1752 bp, 583 aa] {...   598   0.0  
CAGL0B01837g Chr2 complement(166953..168662) [1710 bp, 569 aa] {...   595   0.0  
NDAI0J01310 Chr10 (306474..308213) [1740 bp, 579 aa] {ON} Anc_8....   591   0.0  
KAFR0B05470 Chr2 (1120794..1122482) [1689 bp, 562 aa] {ON} Anc_8...   588   0.0  
Kpol_392.2 s392 (1564..3264) [1701 bp, 566 aa] {ON} (1564..3264)...   578   0.0  
KLTH0G13530g Chr7 (1161702..1163426) [1725 bp, 574 aa] {ON} simi...   578   0.0  
SAKL0H16874g Chr8 (1484425..1486116) [1692 bp, 563 aa] {ON} simi...   568   0.0  
Kwal_56.23771 s56 (698257..699945) [1689 bp, 562 aa] {ON} YDR117...   558   0.0  
KLLA0F19294g Chr6 complement(1784664..1786376) [1713 bp, 570 aa]...   475   e-162
TBLA0I03200 Chr9 complement(769960..771651) [1692 bp, 563 aa] {O...   473   e-161
KNAG0H03200 Chr8 (599611..601296) [1686 bp, 561 aa] {ON} Anc_8.2...   461   e-157
Ecym_4301 Chr4 (644340..646034) [1695 bp, 564 aa] {ON} similar t...   454   e-154
AGR079W Chr7 (879417..881045) [1629 bp, 542 aa] {ON} Syntenic ho...   426   e-143

>Smik_4.361 Chr4 complement(645227..646924) [1698 bp, 565 aa] {ON}
           YDR117C (REAL)
          Length = 565

 Score = 1071 bits (2771), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 535/557 (96%), Positives = 535/557 (96%)

Query: 1   MFKKEPHIKALSNLKNSERKKLLQTCIKQTNNEEYTFPTSIIKQTNFGGQKSVGTVYTDE 60
           MFKKEPHIKALSNLKNSERKKLLQTCIKQTNNEEYTFPTSIIKQTNFGGQKSVGTVYTDE
Sbjct: 1   MFKKEPHIKALSNLKNSERKKLLQTCIKQTNNEEYTFPTSIIKQTNFGGQKSVGTVYTDE 60

Query: 61  NNIPILFKEKHCEQLYPTVYSCWKNPSLLPIVLTHGFVIEEHLFNGANLMISGSIPPFDS 120
           NNIPILFKEKHCEQLYPTVYSCWKNPSLLPIVLTHGFVIEEHLFNGANLMISGSIPPFDS
Sbjct: 61  NNIPILFKEKHCEQLYPTVYSCWKNPSLLPIVLTHGFVIEEHLFNGANLMISGSIPPFDS 120

Query: 121 RCNVGTLCGVAGKQSPKVVLAIGVVELDLPSYDRVIGETGVAVKVIHHFNDGLFKAFKVK 180
           RCNVGTLCGVAGKQSPKVVLAIGVVELDLPSYDRVIGETGVAVKVIHHFNDGLFKAFKVK
Sbjct: 121 RCNVGTLCGVAGKQSPKVVLAIGVVELDLPSYDRVIGETGVAVKVIHHFNDGLFKAFKVK 180

Query: 181 LEPPVVLNTESEDENINSKQTETPEQVKSADKSQESIKKTAPDLEEVAEVLDHLTVSDVD 240
           LEPPVVLNTESEDENINSKQTETPEQVKSADKSQESIKKTAPDLEEVAEVLDHLTVSDVD
Sbjct: 181 LEPPVVLNTESEDENINSKQTETPEQVKSADKSQESIKKTAPDLEEVAEVLDHLTVSDVD 240

Query: 241 YFITRALYYSLTQDKGLILPISASKFISNHIMRNLPPIDHNEVNVKKSSWKKSAKFLKHF 300
           YFITRALYYSLTQDKGLILPISASKFISNHIMRNLPPIDHNEVNVKKSSWKKSAKFLKHF
Sbjct: 241 YFITRALYYSLTQDKGLILPISASKFISNHIMRNLPPIDHNEVNVKKSSWKKSAKFLKHF 300

Query: 301 EKEGIXXXXXXXXXXTIVGKNTDKDELKNFVPYKLGCSSPSKGSGENATSKDRTSGMMHS 360
           EKEGI          TIVGKNTDKDELKNFVPYKLGCSSPSKGSGENATSKDRTSGMMHS
Sbjct: 301 EKEGILKLKGKGDDLTIVGKNTDKDELKNFVPYKLGCSSPSKGSGENATSKDRTSGMMHS 360

Query: 361 LTLYKPFSLAKDLLREAKLGCDTYYTSQDVRNAVSEYISVKNLAXXXXXXXXXXXXLLFN 420
           LTLYKPFSLAKDLLREAKLGCDTYYTSQDVRNAVSEYISVKNLA            LLFN
Sbjct: 361 LTLYKPFSLAKDLLREAKLGCDTYYTSQDVRNAVSEYISVKNLADKKDKRKVVMDDLLFN 420

Query: 421 MVNKKKKTPDTTRIIARSEILQPLLSNNFTEFYQIFRNDDTLLFRVPMKGCPPRIKIVTE 480
           MVNKKKKTPDTTRIIARSEILQPLLSNNFTEFYQIFRNDDTLLFRVPMKGCPPRIKIVTE
Sbjct: 421 MVNKKKKTPDTTRIIARSEILQPLLSNNFTEFYQIFRNDDTLLFRVPMKGCPPRIKIVTE 480

Query: 481 MKIGRKVITKVSNFEVFHIDPELLAADLRKICSGSTTIGESQTFKSAEVQVQGPHGQFII 540
           MKIGRKVITKVSNFEVFHIDPELLAADLRKICSGSTTIGESQTFKSAEVQVQGPHGQFII
Sbjct: 481 MKIGRKVITKVSNFEVFHIDPELLAADLRKICSGSTTIGESQTFKSAEVQVQGPHGQFII 540

Query: 541 DYLNKSGIPSKWIDFEN 557
           DYLNKSGIPSKWIDFEN
Sbjct: 541 DYLNKSGIPSKWIDFEN 557

>Suva_2.276 Chr2 complement(478604..480301) [1698 bp, 565 aa] {ON}
           YDR117C (REAL)
          Length = 565

 Score =  900 bits (2327), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 424/557 (76%), Positives = 482/557 (86%)

Query: 1   MFKKEPHIKALSNLKNSERKKLLQTCIKQTNNEEYTFPTSIIKQTNFGGQKSVGTVYTDE 60
           MFKKEPHIKALSNLKNSERKKLLQTC KQTNNEEYTFPTS IKQTNF GQKS+GTVYTDE
Sbjct: 1   MFKKEPHIKALSNLKNSERKKLLQTCKKQTNNEEYTFPTSTIKQTNFSGQKSLGTVYTDE 60

Query: 61  NNIPILFKEKHCEQLYPTVYSCWKNPSLLPIVLTHGFVIEEHLFNGANLMISGSIPPFDS 120
           NN PILFKEKH EQL+PTVYSCW+N +LLPIVLTHGFVIEEHLFNGANLMISGSIPPFD 
Sbjct: 61  NNTPILFKEKHNEQLFPTVYSCWENHTLLPIVLTHGFVIEEHLFNGANLMISGSIPPFDP 120

Query: 121 RCNVGTLCGVAGKQSPKVVLAIGVVELDLPSYDRVIGETGVAVKVIHHFNDGLFKAFKVK 180
           RC +GTLCGVA +Q+PK+VLA+G+VE+DLPSY RVIGETGVAVK++HHFNDGL KAFKVK
Sbjct: 121 RCKIGTLCGVASRQAPKIVLAVGIVEMDLPSYSRVIGETGVAVKIVHHFNDGLSKAFKVK 180

Query: 181 LEPPVVLNTESEDENINSKQTETPEQVKSADKSQESIKKTAPDLEEVAEVLDHLTVSDVD 240
           LEPP   +  SEDE+I++ Q E  E  K+ +K++E++++   ++EE+AEVLDHL+VSDVD
Sbjct: 181 LEPPAAFDVASEDEDIDNTQIEIQEGTKTTEKTRENVQEANINIEEIAEVLDHLSVSDVD 240

Query: 241 YFITRALYYSLTQDKGLILPISASKFISNHIMRNLPPIDHNEVNVKKSSWKKSAKFLKHF 300
           YFITRALYY+LTQDK L LPISAS FISNHIMRNLPPIDHNEVNVK++SWKKSAKFLKHF
Sbjct: 241 YFITRALYYTLTQDKSLALPISASNFISNHIMRNLPPIDHNEVNVKRTSWKKSAKFLKHF 300

Query: 301 EKEGIXXXXXXXXXXTIVGKNTDKDELKNFVPYKLGCSSPSKGSGENATSKDRTSGMMHS 360
           EKEG           TIVGKNTDKDELKNFVPYKLG ++ +K  GEN  SK++TSGMM+S
Sbjct: 301 EKEGFLKLKGKGDDLTIVGKNTDKDELKNFVPYKLGVNNSAKEKGENTNSKEKTSGMMYS 360

Query: 361 LTLYKPFSLAKDLLREAKLGCDTYYTSQDVRNAVSEYISVKNLAXXXXXXXXXXXXLLFN 420
           LTLYKPF+LAKDL++EA L   TYYTSQD+R+A+++YIS+KNL             LL+N
Sbjct: 361 LTLYKPFNLAKDLVKEANLPFQTYYTSQDIRSAITQYISIKNLVDAKDKGKVVMDDLLYN 420

Query: 421 MVNKKKKTPDTTRIIARSEILQPLLSNNFTEFYQIFRNDDTLLFRVPMKGCPPRIKIVTE 480
           MVNKKKK PD  R+I R++IL PLL+NNFTEFYQI++NDDTLL R PMKG PPRIKI+TE
Sbjct: 421 MVNKKKKDPDVARVIPRAQILDPLLANNFTEFYQIYKNDDTLLSRTPMKGSPPRIKIITE 480

Query: 481 MKIGRKVITKVSNFEVFHIDPELLAADLRKICSGSTTIGESQTFKSAEVQVQGPHGQFII 540
           MKIGRKVITKVSNFE   IDPELLAADLRKICSGSTTIGESQTFKSAEVQVQGPHGQ II
Sbjct: 481 MKIGRKVITKVSNFEALQIDPELLAADLRKICSGSTTIGESQTFKSAEVQVQGPHGQLII 540

Query: 541 DYLNKSGIPSKWIDFEN 557
           D+LNKSG+P+KWIDFEN
Sbjct: 541 DHLNKSGVPNKWIDFEN 557

>YDR117C Chr4 complement(683946..685643) [1698 bp, 565 aa] {ON}
           TMA64Protein of unknown function that associates with
           ribosomes; has a putative RNA binding domain; in mammals
           the corresponding protein, eIF2D, has been shown to
           possess translation initiation factor activity
          Length = 565

 Score =  900 bits (2326), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 433/557 (77%), Positives = 482/557 (86%)

Query: 1   MFKKEPHIKALSNLKNSERKKLLQTCIKQTNNEEYTFPTSIIKQTNFGGQKSVGTVYTDE 60
           MFKKEPHIKALSNLKNSERKKLLQT  KQTNNEEY+F TS IKQTNF GQKSVGTVYTDE
Sbjct: 1   MFKKEPHIKALSNLKNSERKKLLQTFQKQTNNEEYSFRTSTIKQTNFNGQKSVGTVYTDE 60

Query: 61  NNIPILFKEKHCEQLYPTVYSCWKNPSLLPIVLTHGFVIEEHLFNGANLMISGSIPPFDS 120
           NN PILFKEKH EQL+PTVYSCW+ P+LLPIVLTHGFVIEEHLFNGANLMISGSIPPFD 
Sbjct: 61  NNTPILFKEKHKEQLFPTVYSCWEYPALLPIVLTHGFVIEEHLFNGANLMISGSIPPFDP 120

Query: 121 RCNVGTLCGVAGKQSPKVVLAIGVVELDLPSYDRVIGETGVAVKVIHHFNDGLFKAFKVK 180
           RC +GTLCG+A KQ+P+ VLAIG+VELDLPS+D+VIGETGVAVK+IHHFNDGL K FK+K
Sbjct: 121 RCKIGTLCGIASKQAPETVLAIGIVELDLPSFDKVIGETGVAVKIIHHFNDGLSKVFKMK 180

Query: 181 LEPPVVLNTESEDENINSKQTETPEQVKSADKSQESIKKTAPDLEEVAEVLDHLTVSDVD 240
           LEPP VL+T+S+D NI+SKQ E+ EQ+K+ +K QE +K+ + D+EE+AEVLDH TVSDVD
Sbjct: 181 LEPPFVLSTQSKDNNISSKQIESSEQIKAVEKEQEDVKEASVDVEEIAEVLDHFTVSDVD 240

Query: 241 YFITRALYYSLTQDKGLILPISASKFISNHIMRNLPPIDHNEVNVKKSSWKKSAKFLKHF 300
           YFITRALYY+LTQDKGL LPISAS FISNHIMRNLPPIDHNEVNVKK+SWKKSAKFLKHF
Sbjct: 241 YFITRALYYTLTQDKGLELPISASNFISNHIMRNLPPIDHNEVNVKKTSWKKSAKFLKHF 300

Query: 301 EKEGIXXXXXXXXXXTIVGKNTDKDELKNFVPYKLGCSSPSKGSGENATSKDRTSGMMHS 360
           EKEG           TIVGKNTDKDELKNFVPYKLGCS  +  S E+ TSK++TSGMM+S
Sbjct: 301 EKEGFLKLKGKGDDLTIVGKNTDKDELKNFVPYKLGCSKSATESRESTTSKEKTSGMMYS 360

Query: 361 LTLYKPFSLAKDLLREAKLGCDTYYTSQDVRNAVSEYISVKNLAXXXXXXXXXXXXLLFN 420
           LTLYKPF+LAKDLL+E  L   TYYTSQD+R+AVS+YISVKNLA            LLF+
Sbjct: 361 LTLYKPFNLAKDLLKEVNLASHTYYTSQDIRSAVSQYISVKNLADTKDKGKVIMDDLLFD 420

Query: 421 MVNKKKKTPDTTRIIARSEILQPLLSNNFTEFYQIFRNDDTLLFRVPMKGCPPRIKIVTE 480
           MVNKKKK  + +RIIAR EIL PLL+NNFTEFYQIF++DDTLLF+ PMKG  P IKI+TE
Sbjct: 421 MVNKKKKVLNASRIIARGEILHPLLTNNFTEFYQIFKSDDTLLFKAPMKGSLPHIKIITE 480

Query: 481 MKIGRKVITKVSNFEVFHIDPELLAADLRKICSGSTTIGESQTFKSAEVQVQGPHGQFII 540
           MKIGRKVIT+VSNFEVF +DPE LAADLRKICSGSTTI ESQTFK AEVQVQGPHGQ II
Sbjct: 481 MKIGRKVITRVSNFEVFQVDPESLAADLRKICSGSTTISESQTFKCAEVQVQGPHGQSII 540

Query: 541 DYLNKSGIPSKWIDFEN 557
           D+LNK GIPSKWIDFEN
Sbjct: 541 DHLNKLGIPSKWIDFEN 557

>Skud_4.377 Chr4 complement(655577..657265) [1689 bp, 562 aa] {ON}
           YDR117C (REAL)
          Length = 562

 Score =  884 bits (2284), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 423/563 (75%), Positives = 480/563 (85%), Gaps = 3/563 (0%)

Query: 1   MFKKEPHIKALSNLKNSERKKLLQTCIKQTNNEEYTFPTSIIKQTNFGGQKSVGTVYTDE 60
           MFKKEPHIKALSNLKNSERKKLLQTC KQTNN+EYTFPTS IKQTNF  QKSVG VYTDE
Sbjct: 1   MFKKEPHIKALSNLKNSERKKLLQTCKKQTNNDEYTFPTSTIKQTNFCSQKSVGVVYTDE 60

Query: 61  NNIPILFKEKHCEQLYPTVYSCWKNPSLLPIVLTHGFVIEEHLFNGANLMISGSIPPFDS 120
           NN PILFKEKH EQL+PTVYSCW+NP+LLPI+LTHGFVIEEHLFNGANLMISGSIPPFD 
Sbjct: 61  NNTPILFKEKHNEQLFPTVYSCWENPTLLPIILTHGFVIEEHLFNGANLMISGSIPPFDP 120

Query: 121 RCNVGTLCGVAGKQSPKVVLAIGVVELDLPSYDRVIGETGVAVKVIHHFNDGLFKAFKVK 180
           R  VGTLCGVA +++PKVVLAIG+VE+DLPSYDRV+GETGVAVKVIHHFNDGL KA KVK
Sbjct: 121 RSKVGTLCGVASREAPKVVLAIGIVEMDLPSYDRVLGETGVAVKVIHHFNDGLSKALKVK 180

Query: 181 LEPPVVLNTESEDENINSKQTETPEQVKSADKSQESIKKTAPDLEEVAEVLDHLTVSDVD 240
           L+PP+    +S DE+INSKQ + PE+ K  + +QE+++K    +EE+AEVLDH +VSDVD
Sbjct: 181 LDPPIA---KSGDEDINSKQVQPPEEAKIVENAQENMQKAQVHVEELAEVLDHFSVSDVD 237

Query: 241 YFITRALYYSLTQDKGLILPISASKFISNHIMRNLPPIDHNEVNVKKSSWKKSAKFLKHF 300
           YFITRALYY+LTQDK L+LPIS S FISNHIMRNLPPIDHNEVNVKK+SW+KSAKFLKHF
Sbjct: 238 YFITRALYYTLTQDKSLVLPISPSNFISNHIMRNLPPIDHNEVNVKKTSWRKSAKFLKHF 297

Query: 301 EKEGIXXXXXXXXXXTIVGKNTDKDELKNFVPYKLGCSSPSKGSGENATSKDRTSGMMHS 360
           EKEG           TIVGK  DKDELKNFVPYK+G S+ ++ SGE+A SK++T GMM+S
Sbjct: 298 EKEGFLKLKGKGDDLTIVGKTIDKDELKNFVPYKVGSSTSAQESGEHANSKEKTPGMMYS 357

Query: 361 LTLYKPFSLAKDLLREAKLGCDTYYTSQDVRNAVSEYISVKNLAXXXXXXXXXXXXLLFN 420
           +TLYKPFS+AKD L+EA LG  TYYTSQD+R+A+S+YIS  NLA            LLFN
Sbjct: 358 MTLYKPFSIAKDFLKEANLGFRTYYTSQDIRSALSQYISTNNLADTKDKGKVVMDDLLFN 417

Query: 421 MVNKKKKTPDTTRIIARSEILQPLLSNNFTEFYQIFRNDDTLLFRVPMKGCPPRIKIVTE 480
           MVNKKKK  +  RI+ R++IL PLL+NNFTEFYQIF+NDD+LLF+ P+KG PPRIKI TE
Sbjct: 418 MVNKKKKNLNAARIMPRAQILDPLLANNFTEFYQIFKNDDSLLFKAPIKGSPPRIKITTE 477

Query: 481 MKIGRKVITKVSNFEVFHIDPELLAADLRKICSGSTTIGESQTFKSAEVQVQGPHGQFII 540
           MKIGRKVIT+VSNFEVF IDPE LA DLRKICSGSTTIGESQTFKSAEVQVQGPHGQ II
Sbjct: 478 MKIGRKVITRVSNFEVFQIDPESLAGDLRKICSGSTTIGESQTFKSAEVQVQGPHGQLII 537

Query: 541 DYLNKSGIPSKWIDFENKLKKKK 563
           D+LN  G+P+KWIDFENKLKKKK
Sbjct: 538 DHLNNLGVPNKWIDFENKLKKKK 560

>NCAS0B03800 Chr2 (678984..680681) [1698 bp, 565 aa] {ON} Anc_8.269
           YDR117C
          Length = 565

 Score =  665 bits (1715), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 336/563 (59%), Positives = 421/563 (74%), Gaps = 13/563 (2%)

Query: 1   MFKKEPHIKALSNLKNSERKKLLQTCIKQTNNEEYTFPTSIIKQTNFGGQKSVGTVYTDE 60
           MF+KEPHIKALSNLKNS+RKKL QT   QT N++YT P SI+KQTNF    ++GT+YTDE
Sbjct: 1   MFRKEPHIKALSNLKNSDRKKLAQTIHAQTGNDKYTCP-SIVKQTNFQTPTTIGTIYTDE 59

Query: 61  NNIPILFKEKHCEQLYPTVYSCWKNPSLLPIVLTHGFVIEEHLFNGANLMISGSIPPFDS 120
            NIPI FKEKH  +LY TVY+CW    LLPI L+H FVI+E LFNGANLMISG+IPPFD 
Sbjct: 60  KNIPIWFKEKHDPRLYATVYTCWNCEDLLPICLSHDFVIQEKLFNGANLMISGTIPPFDE 119

Query: 121 RCNVGTLCGVAGKQSP-KVVLAIGVVELDLPSYDRVIGETGVAVKVIHHFNDGLFKAFKV 179
           +  VGTLCGVA  Q P +VV AIG+V +DLP +++V+GE+GVAV++IHHF D LFK+FK+
Sbjct: 120 KLKVGTLCGVASCQDPGRVVYAIGIVMMDLPKFEKVVGESGVAVQIIHHFEDELFKSFKI 179

Query: 180 KLEPPVV-LNTESEDENINSKQTETPEQVKSADKSQESIKKTAPDLEEVAEVLDHLTVSD 238
            L+PPVV +   S ++    ++ +  E+    D++ + +  TA ++E++AEVLDHL+V D
Sbjct: 180 DLKPPVVDVQKGSVNDEEEEEEEKEQEKANEEDETTKEMS-TATNVEDLAEVLDHLSVQD 238

Query: 239 VDYFITRALYYSLTQDKGLILPISASKFISNHIMRNLPPIDHNEVNVKKSSWKKSAKFLK 298
           VDYFITRALYY++T D  L LPISAS FIS HI +NLP +DHNEVN+KKSSWKK+AKFLK
Sbjct: 239 VDYFITRALYYTITTDTKLSLPISASNFISQHINKNLPDVDHNEVNIKKSSWKKTAKFLK 298

Query: 299 HFEKEGIXXXXXXXXXXTIVGKNTDKDELKNFVPYKLGCSSPSKGSGENATSK---DRTS 355
           HFEKEG           T+VG N  KDELKNFVPYKLG S     +GEN  +K   D  S
Sbjct: 299 HFEKEGFLKLKGKGDDLTVVGMNKTKDELKNFVPYKLGSS-----NGENKGAKKEGDSQS 353

Query: 356 GMMHSLTLYKPFSLAKDLLREAKLGCDTYYTSQDVRNAVSEYISVKNLAXXXXXXXXXXX 415
           GMM+S+T YKP +LAKDL++E+ +     Y   ++R+ V+ YI++KNL            
Sbjct: 354 GMMYSITFYKPINLAKDLIKESGMPMKNLYLPTEIRDGVNNYITLKNLVDNKNKKMVLLD 413

Query: 416 XLLFNMVNKKKKTPDTTRIIARSEILQPLLSNNFTEFYQIFRNDDTLLFRVPMKGCPPRI 475
            LLF MVNKK+  P  +R I+R++IL+P L NNFTE +QI+ +  T LF+ PM+G PPRI
Sbjct: 414 DLLFGMVNKKRTDPTVSRSISRAQILEPTLKNNFTEHFQIYDSQGTPLFKSPMRGSPPRI 473

Query: 476 KIVTEMKIGRKVITKVSNFEVFHIDPELLAADLRKICSGSTTIGESQTF-KSAEVQVQGP 534
           KI+TEMKIGRKVITKVSNFE F I+PE LAADLRK+CSGSTTIGE+ T  K+AEVQVQGP
Sbjct: 474 KILTEMKIGRKVITKVSNFEQFGINPETLAADLRKMCSGSTTIGETMTSPKTAEVQVQGP 533

Query: 535 HGQFIIDYLNKSGIPSKWIDFEN 557
           HGQ IID+LNK G+P+KWID+EN
Sbjct: 534 HGQIIIDHLNKLGVPTKWIDYEN 556

>TDEL0F03960 Chr6 complement(733512..735188) [1677 bp, 558 aa] {ON}
           Anc_8.269 YDR117C
          Length = 558

 Score =  642 bits (1655), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 320/558 (57%), Positives = 414/558 (74%), Gaps = 11/558 (1%)

Query: 1   MFKKEPHIKALSNLKNSERKKLLQTCIKQTNNEEYTFPTSIIKQTNFGGQKSVGTVYTDE 60
           MFKKEPHIKALSNLKNSERKKLLQ+C +QT   +Y F TSI+KQTN+ GQ S GTVYTD+
Sbjct: 1   MFKKEPHIKALSNLKNSERKKLLQSCKEQTGASDYNFSTSIVKQTNYKGQHSDGTVYTDQ 60

Query: 61  NNIPILFKEKHCEQLYPTVYSCWKNPSLLPIVLTHGFVIEEHLFNGANLMISGSIPPFDS 120
           NN+PI FKEKH E L+PTVYSCW  P+LLPIVLTH FVIEE LFNGANLM++G++PPFD 
Sbjct: 61  NNVPIWFKEKHGELLFPTVYSCWTAPNLLPIVLTHDFVIEERLFNGANLMLAGTLPPFDE 120

Query: 121 RCNVGTLCGVAGKQSPKVVLAIGVVELDLPSYDRVIGETGVAVKVIHHFNDGLFKAFKVK 180
           RC    +CG+A +  PKV+LAIGVV+L+LPSY  VIG+ G+AVKV+H+F DGL +AFK+ 
Sbjct: 121 RCVPAKVCGIASRTDPKVILAIGVVQLNLPSYSSVIGQPGIAVKVMHYFTDGLCQAFKID 180

Query: 181 LEPPVVLNTESEDENINSKQTETPEQVKSADKSQESIKKTAPDLEEVAEVLDHLTVSDVD 240
           +EP V+ +   E+E     + +  E  K     +E+   T   +E+VA+VLD L+V DVD
Sbjct: 181 IEPAVLSSEPVEEEEEEEGKEKLTESPK-----RETF-HTEISIEDVAQVLDELSVEDVD 234

Query: 241 YFITRALYYSLTQDKGLILPISASKFISNHIMRNLPPIDHNEVNVKKSSWKKSAKFLKHF 300
           +F TRALYY+ T D GL +PI+AS FISNHI+ NLPP+D ++VN+KK+SWKK+AKFLKHF
Sbjct: 235 HFFTRALYYTFTHDTGLNIPINASNFISNHILPNLPPVDQSQVNMKKTSWKKTAKFLKHF 294

Query: 301 EKEGIXXXXXXXXXXTIVGKNTDKDELKNFVPYKLGCSSPSKGSGENATSKDRTSGMMHS 360
           EK G            IVG N +KDELKNFVPYK    + SK +    ++KD + GMM+S
Sbjct: 295 EKVGFLQLKGKGDDLVIVGVNKNKDELKNFVPYKTSGQTASKKN----SNKDSSPGMMYS 350

Query: 361 LTLYKPFSLAKDLLREAKLGCDTYYTSQDVRNAVSEYISVKNLAXXXXXXXXXXXXLLFN 420
             LYKP +L KD ++ + L     YT  +++++V++YI+ K L             LLF+
Sbjct: 351 EKLYKPINLGKDFIQCSDLPPKNLYTVTELKDSVNQYITAKKLVDSKNKKMVLLDDLLFD 410

Query: 421 MVNKKKKTPDTTRIIARSEILQPLLSNNFTEFYQIFRNDDTLLFRVPMKGCPPRIKIVTE 480
           M  +KKKT +T R ++R++I+ P ++NNFTEFYQ+F+++DT LF+ P++G  PR+KIVTE
Sbjct: 411 MFYRKKKTQETPRCVSRAQIMDPFIANNFTEFYQLFKDEDTPLFKNPIRGPLPRVKIVTE 470

Query: 481 MKIGRKVITKVSNFEVFHIDPELLAADLRKICSGSTTIGESQTF-KSAEVQVQGPHGQFI 539
           MKIGRKV+T+VS+FE F +DPE LAA+LRK+CSGSTTIGE+ T  K AEVQVQG HG  I
Sbjct: 471 MKIGRKVVTRVSHFETFKLDPEDLAANLRKLCSGSTTIGETVTSPKVAEVQVQGAHGPLI 530

Query: 540 IDYLNKSGIPSKWIDFEN 557
           IDYLNK GIP+KWIDFE+
Sbjct: 531 IDYLNKQGIPTKWIDFES 548

>ZYRO0C01496g Chr3 (108150..109853) [1704 bp, 567 aa] {ON} similar
           to uniprot|Q04600 Saccharomyces cerevisiae YDR117C RBF64
           Hypothetical ORF
          Length = 567

 Score =  603 bits (1554), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 310/561 (55%), Positives = 400/561 (71%), Gaps = 9/561 (1%)

Query: 1   MFKKEPHIKALSNLKNSERKKLLQTCIKQTNNEEYTFPTSIIKQTNFGGQKSVGTVYTDE 60
           MFKK+PH+KALSNLKNSE KKLL TC  QT N+EY+FPT +IKQTNF  Q  +GTVYTD 
Sbjct: 1   MFKKDPHVKALSNLKNSEAKKLLATCRAQTGNQEYSFPTGVIKQTNFQAQSGIGTVYTDA 60

Query: 61  NNIPILFKEKHCEQLYPTVYSCWKNPSLLPIVLTHGFVIEEHLFNGANLMISGSIPPFDS 120
           +N PI FKEKH   LYPTV++CW +P LLP+VLTHGFV+EE LFNGANLM++G++ PFDS
Sbjct: 61  DNKPIWFKEKHGNLLYPTVFACWSHPGLLPVVLTHGFVVEERLFNGANLMLAGTVLPFDS 120

Query: 121 RCNVGTLCGVAGKQSPKVVLAIGVVELDLPSYDRVIGETGVAVKVIHHFNDGLFKAFKVK 180
           R   GT+CG+A K +P VV+A+GVV+LDLPSYD V+G+TGVAV+++H+  DGL K FKV 
Sbjct: 121 RLKPGTVCGIASKNAPDVVMAVGVVQLDLPSYDSVLGKTGVAVQLVHYLPDGLSKVFKVN 180

Query: 181 LEPPVVLNTESEDENINSKQTETPEQVKSADK--SQESIKKTAPDLEEVAEVLDHLTVSD 238
            EPPV L    E+E    +  E   Q  S+ +  SQE     A D++++AEVLD   + D
Sbjct: 181 AEPPVSLEDSDEEEEEEEEVLEESAQQPSSQEIPSQEK----AVDIDDIAEVLDEFRLED 236

Query: 239 VDYFITRALYYSLTQDKGLILPISASKFISNHIMRNLPPIDHNEVNVKKSSWKKSAKFLK 298
           VD F+TRALYY+LT D  L LPISAS FISNHI  NLP +DH +VNVKKSSWKK+AKFLK
Sbjct: 237 VDQFLTRALYYTLTHDTKLELPISASNFISNHINHNLPSVDHEKVNVKKSSWKKTAKFLK 296

Query: 299 HFEKEGIXXXXXXXXXXTIVGKNTDKDELKNFVPYKLGCSSPSKGSGENATSKDRTSGMM 358
           +FEKEG           TI+G N  K EL+NF PY++   S   G+  +  +K   S  +
Sbjct: 297 NFEKEGFLKLKGKGDDLTIIGINKQKPELQNFQPYQISGGSGGGGNSSSNNNKKDGSPQL 356

Query: 359 HSLTLYKPFSLAKDLLREAKLGC-DTYYTSQDVRNAVSEYISVKNLAXXXXXXXXXXXXL 417
              TLYKP +LAKD +++  L   D  YT+Q+++NA+++YI+  NLA            L
Sbjct: 357 RCETLYKPINLAKDFIQQTDLNPQDILYTAQELKNALNDYIASNNLADSKNKKMVILDDL 416

Query: 418 LFNMVNKKKKTPDTTRIIARSEILQPLLSNNFTEFYQIFRNDDTLLFRVPMKGCPPRIKI 477
           L+++VNKK+K     R+++R+ I++PLL+N+FT  +QI++  D  LF+ P +G  P I+I
Sbjct: 417 LYHLVNKKQKDTTAPRLVSRATIIEPLLANSFTPHFQIYKG-DIPLFKNPSRGNLPNIEI 475

Query: 478 VTEMKIGRKVITKVSNFEVFHIDPELLAADLRKICSGSTTIGESQTF-KSAEVQVQGPHG 536
           VTEMKIGRKVIT+VS FE+FHID + LAA LR++CSGSTTIGE+ T  K  EV VQGPHG
Sbjct: 476 VTEMKIGRKVITRVSRFEIFHIDEDELAATLRRLCSGSTTIGETMTSPKYKEVTVQGPHG 535

Query: 537 QFIIDYLNKSGIPSKWIDFEN 557
             IID+LN  GIP+KWI F+N
Sbjct: 536 PLIIDHLNSLGIPTKWIKFDN 556

>TPHA0J00780 Chr10 complement(180939..182690) [1752 bp, 583 aa] {ON}
           Anc_8.269 YDR117C
          Length = 583

 Score =  598 bits (1541), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 301/579 (51%), Positives = 402/579 (69%), Gaps = 25/579 (4%)

Query: 1   MFKKEPHIKALSNLKNSERKKLLQTCIKQTNNEEYTFPTSIIKQTNFGGQKSVGTVYTDE 60
           MFKK P++KA SNLKNSERKKLLQ+C +Q N+ +Y FP+SIIKQ N+ GQ S GTVYTDE
Sbjct: 1   MFKKTPNVKASSNLKNSERKKLLQSCKEQRNSSDYNFPSSIIKQANYKGQTSAGTVYTDE 60

Query: 61  NNIPILFKEKHCEQLYPTVYSCWKNPSLLPIVLTHGFVIEEHLFNGANLMISGSIPPFDS 120
            N+PI FKEKH + L+P+VY+CWKNP LLPI++T+ +VIEE + NGANLMISG++ PFD 
Sbjct: 61  QNVPIWFKEKHSDMLFPSVYTCWKNPKLLPIIVTNSYVIEEKILNGANLMISGTLLPFDE 120

Query: 121 RCNVGTLCGVAGKQSPKVVLAIGVVELDLPSYDRVIGETGVAVKVIHHFNDGLFKAFKVK 180
           R   G LCG+A  + P VV+AIG+V+LDL SY +V+GETGVAV V+H+  DGL  +FK+ 
Sbjct: 121 RLICGALCGIASYKKPNVVMAIGIVQLDLQSYTKVVGETGVAVNVLHYLGDGLSDSFKMN 180

Query: 181 LEPPVVLNTESEDENINSKQTETPEQVKSADKSQ------ESIKKTAPDL---EEVAEVL 231
           LEPP             ++  ET E + + DK         S K  APD    +++AEVL
Sbjct: 181 LEPP----------ETGAEVDETNEMLLNQDKQDVNNELTNSNKDLAPDARPNDDLAEVL 230

Query: 232 DHLTVSDVDYFITRALYYSLTQDKGLILPISASKFISNHIMRNLPPIDHNEVNVKKSSWK 291
           + L V  +D FIT++LYYSLT D  L  PISAS FISN+IM NLPP+D++ VN+KKSSWK
Sbjct: 231 ETLPVDIIDDFITKSLYYSLTNDPKLEFPISASNFISNYIMSNLPPVDNDMVNLKKSSWK 290

Query: 292 KSAKFLKHFEKEGIXXXXXXXXXXTIVGKNTDKDELKNFVPYKLGCSSPSKGSGENATSK 351
           K+AKFL+HFEKEG            I G N +K ELK+FVPY+ G  + +K   +     
Sbjct: 291 KTAKFLRHFEKEGFIKLKGKNDDLVITGFNKEKTELKSFVPYRTGNGNSTKSKKDKTNDT 350

Query: 352 DRTSGMMHSLTLYKPFSLAKDLLREAKLGCDTYYTSQDVRNAVSEYISVKNLAXXXXXXX 411
                MM S++ YKP SL KDL+RE+     + YT+ ++R+ ++EYI+ KNL        
Sbjct: 351 SDNGDMMQSVSYYKPISLGKDLIRESVAPEKSLYTAHELRDFITEYINKKNLVDSKNKKM 410

Query: 412 XXXXXLLFNMVNKKKKTPDTTRIIARSEILQPLLSNNFTEFYQIFRNDDTL----LFRVP 467
                L++++V KKK + +  R+I+R+++++P+  NNF E +QI++  D      LF+ P
Sbjct: 411 ILMDDLMYSLVYKKKNSAE-PRLISRADVIEPITKNNFNEHFQIYKKGDNETAVPLFKKP 469

Query: 468 MKGCPPRIKIVTEMKIGRKVITKVSNFEVFHIDPELLAADLRKICSGSTTIGESQTF-KS 526
           ++G  P+++IVTEMKIGRKVIT+VSNFEVFHID E LAADLRK+C+G+TTIGE+ T  K+
Sbjct: 470 IRGSIPKVEIVTEMKIGRKVITRVSNFEVFHIDAETLAADLRKLCNGATTIGETLTSPKT 529

Query: 527 AEVQVQGPHGQFIIDYLNKSGIPSKWIDFENKLKKKKSK 565
           AEVQVQGPH Q II +LN   IP+KWIDF+N +K K+ K
Sbjct: 530 AEVQVQGPHSQVIIKHLNSLSIPTKWIDFKNSVKPKRKK 568

>CAGL0B01837g Chr2 complement(166953..168662) [1710 bp, 569 aa] {ON}
           similar to uniprot|Q04600 Saccharomyces cerevisiae
           YDR117c
          Length = 569

 Score =  595 bits (1534), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 306/564 (54%), Positives = 397/564 (70%), Gaps = 13/564 (2%)

Query: 1   MFKKEPHIKALSNLKNSERKKLLQTCIKQTNNEEYTFPTSIIKQTNFGGQKSVGTVYTDE 60
           MFKKEPHIKALSNLKNSERKKL + C  QT+NEEY+F ++ IKQTNF G  ++GT+YTDE
Sbjct: 1   MFKKEPHIKALSNLKNSERKKLQEKCRIQTSNEEYSFGSNTIKQTNFKGITTIGTIYTDE 60

Query: 61  NNIPILFKEKHCEQLYPTVYSCWKNPSLLPIVLTHGFVIEEHLFNGANLMISGSIPPFDS 120
            N PI FKEKH E+LYPTV +CW+ P+L+P+VLTH  V+E+H+FNGANLMISG+IPPFD 
Sbjct: 61  GNAPIWFKEKHDEKLYPTVLACWRCPNLIPVVLTHSIVLEDHIFNGANLMISGTIPPFDE 120

Query: 121 RCNVGTLCGVAGKQSPKVVLAIGVVELDLPSYDRVIGETGVAVKVIHHFNDGLFKAFKVK 180
           R  VGT+CG+A K++P +++A+G+V+++LPS+ RVIGETGVAV+++HH  D LFK FKVK
Sbjct: 121 RLTVGTVCGIADKRTPNLIVAVGIVQMNLPSFTRVIGETGVAVQIVHHLEDELFKVFKVK 180

Query: 181 LEPPV-VLNTESEDENINSKQTETPEQVKSADKSQESIKKTAPDLEEVAEVLDHLTVSDV 239
            EPP  +L T+S        + +  E  ++  +S    +K   +L+++AEVLD L + D+
Sbjct: 181 EEPPAELLQTQSSSSEELELEADIHED-ETKVESNSDTEKEKSNLDDMAEVLDELRLEDI 239

Query: 240 DYFITRALYYSLTQDKGLILPISASKFISNHIMRNLPP-IDHNEVNVKKSSWKKSAKFLK 298
           DYFITRALYY+++QD  L  P SAS F+SNHI  NLP   +  EVN+KKSSWKK+AKFLK
Sbjct: 240 DYFITRALYYTISQDTKLETPTSASNFVSNHINHNLPKGTNLAEVNIKKSSWKKTAKFLK 299

Query: 299 HFEKEGIXXXXXXXXXXTIVGKNTDKDELKNFVPYKLGCSSPSKGSGENATSKDRTSGMM 358
           HFEKEG           TIV  N DKDE+K F+PY +  +  S    E   +K      +
Sbjct: 300 HFEKEGFLKLKGVGDDLTIVEVNKDKDEIKQFLPYPVIGNQGSNTGSEGGNAKT----TI 355

Query: 359 HSLTLYKPFSLAKDLLREAKLGCDTYYTSQDVRNAVSEYISVKNLAXXXXXXXXXXXXLL 418
             +TLYKP +LAKD +   K+     Y   +++  +++YI++K+L             +L
Sbjct: 356 KIVTLYKPINLAKDFISSNKVPLKQLYMEPEIKELINKYITMKDLVDKKDKKCVLVDDML 415

Query: 419 FNMVNKKKKTPDT-TRIIARSEILQPLLSNNFTEFYQIFR---NDDTLLFRVPMKGCPPR 474
             M+ KKK+   T +R+I R+ ILQP+L NNF + Y +FR   N+ T L + P+KG PP+
Sbjct: 416 MTMIYKKKEDQATKSRVIPRANILQPVLQNNFNKNYHLFRITGNEQTPLTKTPLKGEPPK 475

Query: 475 IKIVTEMKIGRKVITKVSNFEVFHIDPELLAADLRKICSGSTTIGE--SQTFKSAEVQVQ 532
           I IVTEMKIGRKVITKVSNFEVF IDPE  AAD+RK CSGSTTIGE  S   K+AEVQVQ
Sbjct: 476 INIVTEMKIGRKVITKVSNFEVFQIDPEEFAADIRKKCSGSTTIGETTSSAKKTAEVQVQ 535

Query: 533 GPHGQFIIDYLNKSGIPSKWIDFE 556
           GPHGQ I+ YLN  GIP+KWIDFE
Sbjct: 536 GPHGQLIMSYLNDLGIPNKWIDFE 559

>NDAI0J01310 Chr10 (306474..308213) [1740 bp, 579 aa] {ON} Anc_8.269
           YDR117C
          Length = 579

 Score =  591 bits (1523), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 325/580 (56%), Positives = 399/580 (68%), Gaps = 37/580 (6%)

Query: 1   MFKKEPHIKALSNLKNSERKKLLQTCIKQTNNEEYTFPTS-IIKQTNFGGQK--SVGTVY 57
           MFKKEPHIKALSNLKNS+RKKLLQT   QTN E Y F  S IIKQTNF      S+GT++
Sbjct: 1   MFKKEPHIKALSNLKNSDRKKLLQTIKTQTNLETYNFNNSNIIKQTNFQTTNPPSIGTIF 60

Query: 58  TDENNIPILFKEKHCEQLYPTVYSCWKNPSLLPIVLTHGFVIEEHLFNGANLMISGSIPP 117
           T+++NIPI FK KH + LYPTV++CW N  +LP +L+H FVI+E LFNGANLMISG+IPP
Sbjct: 61  TNDSNIPIWFKSKHNDLLYPTVFTCWNNHDILPTLLSHDFVIQEKLFNGANLMISGTIPP 120

Query: 118 FDSRCNVGTLCGVAGKQSPK-VVLAIGVVELDLPSYDRVIGETGVAVKVIHHFNDGLFKA 176
           FDSR   GTLCG+A  Q PK +V AIGVV++++PS+D+V+GETGVAV+VIHHF D LFK 
Sbjct: 121 FDSRLIPGTLCGIASVQDPKRIVWAIGVVKMNMPSFDKVVGETGVAVEVIHHFEDELFKI 180

Query: 177 FKVK-LEPPVVLNTESEDENINSKQTETPEQVKSAD-----KSQESIKKTAPDLEEVAEV 230
           FK   L+P      E   E +N   TE P+    AD     K +E+ +   PD E    V
Sbjct: 181 FKCNDLKP-----DEFVKEQLN---TEHPQDNDVADEDTTRKKEENRESNEPDFE----V 228

Query: 231 LDHLTVSDVDYFITRALYYSLTQDKGLILPISASKFISNHIMRNLPPIDHNEVNVKKSSW 290
           LDH    DVDYFITR+LYY++TQD  + LPISAS FIS HI +NLP I HNEVN+KK+SW
Sbjct: 229 LDHFKTEDVDYFITRSLYYTITQDTKVELPISASNFISQHINKNLPDISHNEVNIKKTSW 288

Query: 291 KKSAKFLKHFEKEGIXXXXXXXXXXTIVGKNTDKDELKNFVPYKLGCS-SPSKG-SGENA 348
           KK+AKFLKHFEKEG           T+VG N  KDELKNFVPYK+G S +PS   S  N 
Sbjct: 289 KKTAKFLKHFEKEGFLKLKGKGDDLTVVGMNKTKDELKNFVPYKIGKSTTPSFSLSSPNT 348

Query: 349 TSKDRTSGMMHSLTLYKPFSLAKDLLREA-KLGCDTYYTSQDVRNAVSEYISVKNLAXXX 407
             K  T GMM+S T YKP + AKDLL+    +     YT Q++R+ V+ YI+ KNL    
Sbjct: 349 NDKSDTKGMMYSETFYKPINHAKDLLKAVPTIPTKPLYTQQEIRDIVTSYINSKNLIDMK 408

Query: 408 XXXXXXXXXLLFNMVNKKKKTPDTT-RIIARSEILQPLLSNNFTEFYQIFR--------- 457
                    LLFNMV+K++   +   R + R  IL+P+L+NNFTE YQI+R         
Sbjct: 409 NKKMILLDDLLFNMVHKRQSEANAAPRTMMRGTILEPILANNFTEHYQIYRKRNGKGELM 468

Query: 458 NDDTLLFRVPMKGCPPRIKIVTEMKIGRKVITKVSNFEVFHIDPELLAADLRKICSGSTT 517
            D   LF+ P +G  P+I I+TEMKIGRKVITKVSNFE+F I  + LAADLRK+CSGSTT
Sbjct: 469 EDVEPLFKSPQRGHLPQIDILTEMKIGRKVITKVSNFEIFGISSDFLAADLRKLCSGSTT 528

Query: 518 IGESQTF-KSAEVQVQGPHGQFIIDYLNKS-GIPSKWIDF 555
           IGE+ T  K+ EVQVQGPHGQ IID+LNK  G+P+KWI++
Sbjct: 529 IGETMTSPKTPEVQVQGPHGQIIIDHLNKKFGVPTKWINY 568

>KAFR0B05470 Chr2 (1120794..1122482) [1689 bp, 562 aa] {ON}
           Anc_8.269 YDR117C
          Length = 562

 Score =  588 bits (1515), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 293/564 (51%), Positives = 391/564 (69%), Gaps = 18/564 (3%)

Query: 1   MFKKEPHIKALSNLKNSERKKLLQTCIKQT-NNEEYTFPTSIIKQTNFGGQKSVGTVYTD 59
           MFKKEP IKALS LKNS+RKKL+Q+   Q  ++E+ +     I QTNF    + GT+YTD
Sbjct: 1   MFKKEPRIKALSKLKNSDRKKLVQSLKAQLKSDEDISVAGDSIMQTNFISTTAAGTIYTD 60

Query: 60  ENNIPILFKEKHCEQLYPTVYSCWKNPSLLPIVLTHGFVIEEHLFNGANLMISGSIPPFD 119
            N+IPI+FK KH + LYPT +  W N  LL  V TH  V+E ++FNGA+LMI+G++PPFD
Sbjct: 61  SNSIPIMFKTKHSDTLYPTSFLLWSNNGLLSTVRTHSVVVENYIFNGADLMIAGTVPPFD 120

Query: 120 SRCNVGTLCGVAGKQSPKVVLAIGVVELDLPSYDRVIGETGVAVKVIHHFNDGLFKAFKV 179
           S   +GT+C VA K++P V +A+G+V+L+LP Y +V+G+TGVAV+++HHF D LF  FK 
Sbjct: 121 STLTIGTICAVATKEAPDVAIAVGIVKLNLPEYQQVLGKTGVAVEILHHFEDALFSTFKA 180

Query: 180 KLEPPVVLNTESEDENINSKQTETPEQVKSADKSQESIKKTAP-----DLEEVAEVLDHL 234
           KLE P  + +  ++E        T +  K +D  QES   T P       +++AEVLD L
Sbjct: 181 KLEIPASVKSILQEET-------TADVAKESDAEQESQSVTEPPSGSEGPDDIAEVLDEL 233

Query: 235 TVSDVDYFITRALYYSLTQDKGLILPISASKFISNHIMRNLPPIDHNEVNVKKSSWKKSA 294
           TV DVDYFI RALY+++ QD  L LP+ AS F+SNHIMRNLP +DH +VN+K++SWKK+A
Sbjct: 234 TVEDVDYFIRRALYFTMVQDNTLTLPVVASAFMSNHIMRNLPDVDHKKVNIKRTSWKKTA 293

Query: 295 KFLKHFEKEGIXXXXXXXXXXTIVGKNTDKDELKNFVPYKLGCSSPSKGSGENATSKDRT 354
           KFLK+FEKEG            IVG N DKDELKNFVPYK+G ++    S  ++T   +T
Sbjct: 294 KFLKYFEKEGFLKLKGKGDDLIIVGMNKDKDELKNFVPYKIGNTAKKAASKSDST---QT 350

Query: 355 SGM-MHSLTLYKPFSLAKDLLREAKLGCDTYYTSQDVRNAVSEYISVKNLAXXXXXXXXX 413
            G+ + S+ LYKP +L +  ++E+ +     YTS ++RN +++YI  KNL          
Sbjct: 351 QGVSVSSVNLYKPINLGQKFIKESNISGGPMYTSLEIRNCINDYIIKKNLVDEKDKKMVM 410

Query: 414 XXXLLFNMVNKKKKTPDTTRIIARSEILQPLLSNNFTEFYQIFRNDDTLLFRVPMKGCPP 473
              LLF MVN+K + P   RII R+ IL+PL++NNF E++Q+++ D+T LF+ P+KG  P
Sbjct: 411 LDDLLFAMVNRKIQNPIFPRIIPRANILEPLIANNFNEYFQLYKGDNTPLFKNPIKGQTP 470

Query: 474 RIKIVTEMKIGRKVITKVSNFEVFHIDPELLAADLRKICSGSTTIGESQTFKSAEVQVQG 533
           +I IVTEMKIGRKV+T+VSNFE F I PE LAADLRK+CSGSTTI E+   K +EVQVQG
Sbjct: 471 KIDIVTEMKIGRKVVTRVSNFENFRISPEELAADLRKLCSGSTTISETPK-KVSEVQVQG 529

Query: 534 PHGQFIIDYLNKSGIPSKWIDFEN 557
           PHGQ IID+ NKSGIPSK+I FEN
Sbjct: 530 PHGQLIIDHFNKSGIPSKFIQFEN 553

>Kpol_392.2 s392 (1564..3264) [1701 bp, 566 aa] {ON} (1564..3264)
           [1701 nt, 567 aa]
          Length = 566

 Score =  578 bits (1491), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 306/569 (53%), Positives = 406/569 (71%), Gaps = 12/569 (2%)

Query: 1   MFKKEPHIKALSNLKNSERKKLLQTCIKQTNNEEYTFPTSIIKQTNFGGQKSVGTVYTDE 60
           MFKK PHIK+LSNLKNSERKKLLQ+C  QT + +Y FPTS+IKQTNF  Q SVG +YTDE
Sbjct: 1   MFKKTPHIKSLSNLKNSERKKLLQSCKAQTGSTDYNFPTSVIKQTNFNAQTSVGVIYTDE 60

Query: 61  NNIPILFKEKHCEQLYPTVYSCWKNPSLLPIVLTHGFVIEEHLFNGANLMISGSIPPFDS 120
              P+ FKEKH E L+PTVY+CW++P+LLPIVLTH  VI EH+FNGANLMISG++PPFDS
Sbjct: 61  EGSPLWFKEKHSELLFPTVYTCWEDPTLLPIVLTHDIVINEHIFNGANLMISGTLPPFDS 120

Query: 121 RCNVGTLCGVAGKQSPKVVLAIGVVELDLPSYDRVIGETGVAVKVIHHFNDGLFKAFKVK 180
           R    T+CG+A + +P  ++A+GVV+LD+PSY  VIG+TGVAV V+H++ DG+  AFK+K
Sbjct: 121 RLVPATICGIATRNNPNTIVAVGVVQLDMPSYSSVIGKTGVAVNVLHYWGDGMSVAFKMK 180

Query: 181 LEPPVVLNTESEDENINSKQT-ETP----EQVKSADKSQESIKKTAPDLEEVAEVLDHLT 235
            + P ++    +D+++++ +  ++P    E+ K+ D S   I  ++ D+ E+A+    LT
Sbjct: 181 RDIPTIVG--GKDKSVDATENDQSPVIITEEEKTEDDSIPEI--SSNDVSELAQEESALT 236

Query: 236 VSDVDYFITRALYYSLTQDKGLILPISASKFISNHIMRNLPPIDHNEVNVKKSSWKKSAK 295
           V D+D+FITR+LYY+LT D  L  PI +S FISNHIMRNLPP+DHN VN+KK+SWKKS+K
Sbjct: 237 VEDIDHFITRSLYYTLTNDLKLAFPIPSSSFISNHIMRNLPPVDHNLVNIKKTSWKKSSK 296

Query: 296 FLKHFEKEGIXXXXXXXXXXTIVGKNTDKDELKNFVPYKLGCSSPSKGSGENATSKDRTS 355
           FLKHFEKEG           TIVG N +K+ELK F PY++  SS + G   N+ ++  + 
Sbjct: 297 FLKHFEKEGFIKLKGKGEDLTIVGSNKEKEELKKFEPYRISNSSSNSGKKINS-NRQESE 355

Query: 356 GMMHSLTLYKPFSLAKDLLREAKLGCDTYYTSQDVRNAVSEYISVKNLAXXXXXXXXXXX 415
            MM+SL  Y P   AK  +   +L    +YT+ +++NAV+EYI  K L            
Sbjct: 356 NMMYSLVFYSPKGSAKQFMTLTELPYKNWYTAIELKNAVTEYIKKKELVDKKNPKMANLD 415

Query: 416 XLLFNMVNKKKKTPDTTRIIARSEILQPLLSNNFTEFYQIFRNDDTLLFRVPMKGCPPRI 475
             L++M   KK T +  R I R+ +++   +NNFTE YQ+F+NDDT L + P++G PPRI
Sbjct: 416 DRLYDMCYTKKST-NPPRHITRAAVIESFTTNNFTELYQLFKNDDTPLTKNPVRGSPPRI 474

Query: 476 KIVTEMKIGRKVITKVSNFEVFHIDPELLAADLRKICSGSTTIGESQTF-KSAEVQVQGP 534
           KIVTEMKIGRK++T+VSNFE F ID + LA DLR++CSGSTTIGE+ T  K+ EVQVQGP
Sbjct: 475 KIVTEMKIGRKIVTRVSNFESFGIDADALAGDLRRLCSGSTTIGETTTSPKTTEVQVQGP 534

Query: 535 HGQFIIDYLNKSGIPSKWIDFENKLKKKK 563
           H + IID+LN   IP+KWIDFENKLK KK
Sbjct: 535 HSKIIIDHLNSLSIPTKWIDFENKLKPKK 563

>KLTH0G13530g Chr7 (1161702..1163426) [1725 bp, 574 aa] {ON} similar
           to uniprot|Q04600 Saccharomyces cerevisiae YDR117C RBF64
           Hypothetical ORF
          Length = 574

 Score =  578 bits (1491), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 289/564 (51%), Positives = 385/564 (68%), Gaps = 10/564 (1%)

Query: 1   MFKKEPHIKALSNLKNSERKKLLQTCIKQTNNEEYTFPTSIIKQTNFGGQKSVGTVYTDE 60
           MFKKEP IKALSNLKNSERK +   C +QT + EY FP+ +IKQT F    + GTV+TD+
Sbjct: 1   MFKKEPQIKALSNLKNSERKNIQSQCKEQTGSSEYAFPSQVIKQTTFKTPFTTGTVFTDQ 60

Query: 61  NNIPILFKEKHCEQLYPTVYSCWKNPSLLPIVLTHGFVIEEHLFNGANLMISGSIPPFDS 120
            N+PI FKEK  + LYPTV++CW N  LLPIVL H +V+EE L  GANLM+ G++PPFD 
Sbjct: 61  KNVPIWFKEKFSDLLYPTVFTCWSNSKLLPIVLAHEYVVEEKLLKGANLMLPGTVPPFDE 120

Query: 121 RCNVGTLCGVAGKQSPKVVLAIGVVELDLPSYDRVIGETGVAVKVIHHFNDGLFKAFKVK 180
           RC    +  VA   +P VV AIG+V+++LP Y RVIGE+GVAV+++H F D L K FKVK
Sbjct: 121 RCVKTRMVSVASTAAPDVVKAIGIVQINLPQYSRVIGESGVAVEIVHTFGDELCKVFKVK 180

Query: 181 LEPP----VVLNTESEDENINSKQTETPEQVKS--ADKSQESIKKTAPDLEEVAEVLDHL 234
           L+PP     +L++ESE+E      T  P   +S  A KS + +++   ++E+++E L  L
Sbjct: 181 LQPPEGSAAILDSESEEEADIEDDTGVPSAPESLAAPKSLQDVQEPLVNVEDISEQLTEL 240

Query: 235 TVSDVDYFITRALYYSLTQDKGLILPISASKFISNHIMRNLPPIDHNEVNVKKSSWKKSA 294
            V DVD+F TR+LYYSL  D  L  PISAS F+SNHI+RNLPPIDH +VN+KK+SWKK+A
Sbjct: 241 RVEDVDHFFTRSLYYSLAHDAKLETPISASNFVSNHILRNLPPIDHTQVNMKKTSWKKTA 300

Query: 295 KFLKHFEKEGIXXXXXXXXXXTIVGKNTDKDELKNFVPYKL--GCSSPSKGSGENATSKD 352
           KFLK+FEKEG           TI+G +  K ELKNF PY++  G SS  KG+   A  K+
Sbjct: 301 KFLKYFEKEGFLKLKGKGDDLTIIGVDRTKSELKNFAPYRIGGGASSSEKGASSVANEKE 360

Query: 353 RTSGMMHSLTLYKPFSLAKDLLREAKLGCDTYYTSQDVRNAVSEYISVKNLAXXXXXXXX 412
           + S +M +++LY+P S  K  L    L  +  +T QD+++AV +YIS KNL         
Sbjct: 361 QAS-VMKAVSLYRPISSTKAFLSATDLPPNQMFTQQDIKSAVDKYISAKNLVSPDNKSAV 419

Query: 413 XXXXLLFNMVNKKKKTPDTTRIIARSEILQPLLSNNFTEFYQIFRNDDTLLFRVPMKGCP 472
               LL+++VN+  K  +  R IAR++I+ P+L  NF+E + I + D T LF+ P+KG  
Sbjct: 420 RLDDLLYDLVNRSSKKENAVRTIARAQIMAPVLKGNFSEHFLILKADGTPLFKHPVKGSI 479

Query: 473 PRIKIVTEMKIGRKVITKVSNFEVFHIDPELLAADLRKICSGSTTIGESQTF-KSAEVQV 531
           P+++IVTEMKIGRKV+TKVSNFE F +D + LA  LRK CSGSTTIGE+ T  K+ EV V
Sbjct: 480 PQVQIVTEMKIGRKVVTKVSNFEKFQVDADELAEALRKKCSGSTTIGEANTSPKTLEVTV 539

Query: 532 QGPHGQFIIDYLNKSGIPSKWIDF 555
           QGPHG  +I+ LN+SGIP+KWI+F
Sbjct: 540 QGPHGPAVIELLNESGIPTKWINF 563

>SAKL0H16874g Chr8 (1484425..1486116) [1692 bp, 563 aa] {ON} similar
           to uniprot|Q04600 Saccharomyces cerevisiae YDR117C RBF64
           Hypothetical ORF
          Length = 563

 Score =  568 bits (1465), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 295/564 (52%), Positives = 389/564 (68%), Gaps = 21/564 (3%)

Query: 1   MFKKEPHIKALSNLKNSERKKLLQTCIKQTNNEEYTFPTSIIKQTNFGGQKSVGTVYTDE 60
           MFKK+PHIKALSNLKNSERKKLL +  +Q    +Y FPT ++KQT F GQ S GTVYTDE
Sbjct: 1   MFKKDPHIKALSNLKNSERKKLLASVREQREVSDYQFPTQVVKQTTFKGQTSAGTVYTDE 60

Query: 61  NNIPILFKEKHCEQLYPTVYSCWKNPSLLPIVLTHGFVIEEHLFNGANLMISGSIPPFDS 120
            N+PI FKEKH   ++PTV++CW NP +LP+V TH  V+EE L  GA+LM+ G +PPF S
Sbjct: 61  QNVPIWFKEKHGSLMFPTVFTCWSNPDILPVVQTHKHVVEEKLLKGADLMLPGMVPPFSS 120

Query: 121 RCNVGTLCGVAGKQSPKVVLAIGVVELDLPSYDRVIGETGVAVKVIHHFNDGLFKAFKVK 180
           +C+ G+L GVA  +SP+V+ AIG+V+LDLPSY RVIGETGVAV +IH F+DGL KAFK+K
Sbjct: 121 KCSKGSLVGVASTRSPRVIKAIGIVQLDLPSYTRVIGETGVAVNIIHTFDDGLCKAFKMK 180

Query: 181 LEPPVVLNTESEDENINSKQTETPEQ-VKSADKSQESIKKTAPDL---EEVAEVLDHLTV 236
           LEPP  +      E+ +SK  E  E+ V SAD+++     T   +   E+ +E L+ L+ 
Sbjct: 181 LEPPEAI------EDTSSKTEEQEEEHVDSADEAKAIATTTQARMVNTEDASEQLNELSA 234

Query: 237 SDVDYFITRALYYSLTQDKGLILPISASKFISNHIMRNLPPIDHNEVNVKKSSWKKSAKF 296
            D+D+F+TR+LYY+LTQD  L LP++AS F+SNHI+ NLPP+DHN++N+KKSSWKKSAKF
Sbjct: 235 EDIDHFLTRSLYYTLTQDDRLQLPVNASNFVSNHILHNLPPVDHNQINMKKSSWKKSAKF 294

Query: 297 LKHFEKEGIXXXXXXXXXXTIVGKNTDKDELKNFVPYKLGCSSPSKGSGENATSKDRT-- 354
           LKHFEK              +VG N DKDELK FVPY++G        GE   +K +   
Sbjct: 295 LKHFEKANFLKLKGKGDDLVVVGINKDKDELKKFVPYRIGS------HGEPTQTKAKAQE 348

Query: 355 -SGMMHSLTLYKPFSLAKDLLREAKLGCDTYYTSQDVRNAVSEYISVKNLAXXXXXXXXX 413
            S MM +++LYKP S AK+  +   L  +  +T+Q+++ A+  YI  KNL          
Sbjct: 349 NSNMMQAVSLYKPISSAKEFSKAVDLPPNKIFTAQELKAALDSYILKKNLVNKDDKKMVL 408

Query: 414 XXXLLFNMVNKKKKTPDTTRIIARSEILQPLLSNNFTEFYQIFRNDDTLLFRVPMKGCPP 473
               LF M+N+  K  +  R I+R++I+ P L+NNFTE +QI +  D  LF+  +KG  P
Sbjct: 409 LDDTLFPMINRSTKKENALRTISRAQIMPPFLANNFTEHFQILKG-DVPLFKTALKGAIP 467

Query: 474 RIKIVTEMKIGRKVITKVSNFEVFHIDPELLAADLRKICSGSTTIGESQTF-KSAEVQVQ 532
            I+IVTEMKIGRKV+TKVSNFE F +D E LAA+LRK CSGSTTIGE+ +  K+ EV VQ
Sbjct: 468 EIQIVTEMKIGRKVVTKVSNFEKFQLDAETLAAELRKRCSGSTTIGETMSSPKTLEVTVQ 527

Query: 533 GPHGQFIIDYLNKSGIPSKWIDFE 556
           GPHG  +I  LN+ GIP+KWI+F+
Sbjct: 528 GPHGAIVIGMLNEYGIPTKWINFQ 551

>Kwal_56.23771 s56 (698257..699945) [1689 bp, 562 aa] {ON} YDR117C -
           Hypothetical ORF [contig 173] FULL
          Length = 562

 Score =  558 bits (1438), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 284/558 (50%), Positives = 374/558 (67%), Gaps = 6/558 (1%)

Query: 1   MFKKEPHIKALSNLKNSERKKLLQTCIKQTNNEEYTFPTSIIKQTNFGGQKSVGTVYTDE 60
           MFKKEP IKALSNLKNSERKKL   C +Q    +Y+FP+ +IKQT F    + GTVYTD+
Sbjct: 1   MFKKEPQIKALSNLKNSERKKLQSQCREQVQPSDYSFPSQVIKQTTFKTPFTTGTVYTDD 60

Query: 61  NNIPILFKEKHCEQLYPTVYSCWKNPSLLPIVLTHGFVIEEHLFNGANLMISGSIPPFDS 120
            NIPI FKEK  + LYPTV+SCW N  L+PIVL H +V+EE L  GANLM+ G++PPFD 
Sbjct: 61  KNIPIWFKEKFSDLLYPTVFSCWSNKDLVPIVLAHEYVVEEKLLKGANLMLPGTVPPFDE 120

Query: 121 RCNVGTLCGVAGKQSPKVVLAIGVVELDLPSYDRVIGETGVAVKVIHHFNDGLFKAFKVK 180
           RC    + GVA   SP VV AIG+V+L+LP Y RVIGE+GVAV+++H F+D L KAFKVK
Sbjct: 121 RCVKTKMVGVASTHSPDVVKAIGIVQLNLPQYSRVIGESGVAVEIVHTFDDELCKAFKVK 180

Query: 181 LEPPVVLNTESEDENINSKQTETPEQVKSADKSQESIKKTAPDLEEVAEVLDHLTVSDVD 240
           L+PP   +  +E ++  +   E    +K   K    +++   ++++ AE L  L+V DVD
Sbjct: 181 LQPPEGADGIAESDSEENSDAEVSGAIKIEPKPSAPLQEPIVNIDDAAEQLSQLSVEDVD 240

Query: 241 YFITRALYYSLTQDKGLILPISASKFISNHIMRNLPPIDHNEVNVKKSSWKKSAKFLKHF 300
           +F TRALYY+LTQD  L +P SAS F+SNHI+RNLPP+DH +VN+KK+SWKK+AKFLKHF
Sbjct: 241 HFFTRALYYTLTQDSKLEVPCSASNFVSNHILRNLPPLDHTQVNMKKTSWKKTAKFLKHF 300

Query: 301 EKEGIXXXXXXXXXXTIVGKNTDKDELKNFVPYKLGCSSPSKGSGENATSKDRTSGMMHS 360
           EKEG           TIVG +  KDELK+FVPY+         SG +  S+   + MM +
Sbjct: 301 EKEGFLKLKGKGDDLTIVGLDKTKDELKHFVPYRT-----GGNSGGSTGSESEQNSMMKA 355

Query: 361 LTLYKPFSLAKDLLREAKLGCDTYYTSQDVRNAVSEYISVKNLAXXXXXXXXXXXXLLFN 420
           L +YKP S AK  L    L  ++ ++ Q+++ AV  YI+ K L             LLF+
Sbjct: 356 LVIYKPMSSAKPFLCATDLSPNSMFSPQELKGAVDAYIASKGLVSQDNKAAVRLDDLLFS 415

Query: 421 MVNKKKKTPDTTRIIARSEILQPLLSNNFTEFYQIFRNDDTLLFRVPMKGCPPRIKIVTE 480
           +VN+  K  +  R I R++I+ P+L  NF E + + + D T LF+ P+KG  P+I+IVTE
Sbjct: 416 LVNRSTKKENAVRTILRAQIMPPILKGNFAEHFLVLKPDGTPLFKHPVKGDIPQIQIVTE 475

Query: 481 MKIGRKVITKVSNFEVFHIDPELLAADLRKICSGSTTIGESQTF-KSAEVQVQGPHGQFI 539
           MKIGRKV+TKVSNFE F +D + LA  LRK CSGSTTIGE+ T  K+ EV VQGPHG  +
Sbjct: 476 MKIGRKVVTKVSNFEKFQVDADELAEALRKKCSGSTTIGETTTSPKTTEVTVQGPHGPAV 535

Query: 540 IDYLNKSGIPSKWIDFEN 557
           I+ LN+  IP+KWI+F N
Sbjct: 536 IELLNQLAIPTKWINFVN 553

>KLLA0F19294g Chr6 complement(1784664..1786376) [1713 bp, 570 aa]
           {ON} similar to uniprot|Q04600 Saccharomyces cerevisiae
           YDR117C RBF64 Hypothetical ORF
          Length = 570

 Score =  475 bits (1222), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 256/563 (45%), Positives = 351/563 (62%), Gaps = 9/563 (1%)

Query: 1   MFKKEPHIKALSNLKNSERKKLLQTCIKQTNNEEYTFPTSIIKQTNFGGQKSVGTVYTDE 60
           MF KEPHIK LSNLKNS+RKKL Q+ IK+  NEEY  PT++IKQT+F      G++YTDE
Sbjct: 1   MFAKEPHIKPLSNLKNSDRKKL-QSTIKRQINEEYNLPTAVIKQTSFQVANVAGSIYTDE 59

Query: 61  NNIPILFKEKHCEQLYPTVYSCWK-NPSLLPIVLTHGFVIEEHLFNGANLMISGSIPPFD 119
           +N PI FK K  +QLYPT++S W     LLPI+LTH FVIE+H+  GA LM+ G++PPF 
Sbjct: 60  SNKPIWFKTKFEDQLYPTIFSLWNLQMQLLPIILTHDFVIEKHILGGAQLMLPGTVPPFP 119

Query: 120 SRCNVGTLCGVAGKQSPKVVLAIGVVELDLPSYDRVIGETGVAVKVIHHFNDGLFKAFKV 179
           S    G++ G+A  + P +V AIG+ E+DL     VIG  G+AV+V+H+ +DGLFKAFK+
Sbjct: 120 SNVKRGSIVGIASTKDPLLVKAIGIAEMDLCGISHVIGTKGIAVRVVHYLDDGLFKAFKL 179

Query: 180 KLEPP-VVLNTES-EDENINSKQTETPEQVKSADKSQESIKKTAPDLEEVAEVLDHLTVS 237
           +LEPP VV N+E  E   I ++ ++  EQ+       E     +P + E+A+ L+ +++ 
Sbjct: 180 ELEPPAVVYNSEPIETTAIETQTSKYGEQLDEESNHLERSSSQSP-VNEIADELEEMSIE 238

Query: 238 DVDYFITRALYYSLTQDKGLILPISASKFISNHIMRNLPPIDHNEVNVKKSSWKKSAKFL 297
           DVD+ + RA+ YS+  D  + LPI AS FISNH+M+NLP +D N VN+KKSSWKK+ K L
Sbjct: 239 DVDHMLMRAVKYSIKFDDKITLPIVASTFISNHVMKNLPDVDTNMVNIKKSSWKKATKLL 298

Query: 298 KHFEKEGIXXXXXXXXXXTIVGKNTDKDELKNFVPYKLGCSSPSKGSGENATSKDRTSGM 357
           K+ E EG           T++  N +  +L N   YK   +   K SG+     ++    
Sbjct: 299 KYLEDEGFLKLKGKNDSCTVISLNKNHKDLTNMEAYKTLATIAKKSSGDTTNQSNKNKIT 358

Query: 358 MHS-LTLYKPFSLAKDLLREAKLGC-DTYYTSQDVRNAVSEYISVKNLAXXXXXXXXXXX 415
            +S   LYKP S  +  +         +YYT Q+++  +  Y++  NL            
Sbjct: 359 AYSGENLYKPMSACQRFITGITADVPQSYYTQQELKKLLDLYVANNNLIDPENKSLVKYD 418

Query: 416 XLLFNMVNKKKKTPDTTRIIARSEILQP-LLSNNFTEFYQIFRNDDTLLFRVPMKGCPPR 474
             L+ M N+  +     +I AR  I+ P  LS NF  ++QI++ +   L +VP KG  P 
Sbjct: 419 DTLYQMSNRAPQNGGIQKI-ARGLIVSPTFLSKNFNTYHQIYKPNGEPLLKVPEKGPIPT 477

Query: 475 IKIVTEMKIGRKVITKVSNFEVFHIDPELLAADLRKICSGSTTIGESQTFKSAEVQVQGP 534
           ++IVTE KIGRKVIT+V+NFE F ID E LAA LRK CSGSTTIGES++ K+AEVQVQGP
Sbjct: 478 LEIVTEKKIGRKVITRVTNFEKFKIDSEELAAALRKKCSGSTTIGESKSTKTAEVQVQGP 537

Query: 535 HGQFIIDYLNKSGIPSKWIDFEN 557
           HG  +I  LN  GIP+KWI FEN
Sbjct: 538 HGSIVISILNDYGIPTKWISFEN 560

>TBLA0I03200 Chr9 complement(769960..771651) [1692 bp, 563 aa] {ON}
           Anc_8.269 YDR117C
          Length = 563

 Score =  473 bits (1216), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 245/576 (42%), Positives = 359/576 (62%), Gaps = 25/576 (4%)

Query: 1   MFKKEPHIKALSNLKNSERKKLLQTCIKQTNNEEYTFPTSIIKQTNFGGQKSVGTVYTDE 60
           MFKK   I  LSNLKNSE + + QTC    +N EY FP S +KQT F    + G +YTD 
Sbjct: 1   MFKKNLTITTLSNLKNSESRNIRQTCRDALSNNEYEFPGSQVKQTTFESTVANGVIYTDS 60

Query: 61  NNIPILFKEKHCEQLYPTVYSCWKNPSLLPIVLTHGFVIEEHLFNGANLMISGSIPPFDS 120
           NN+PI FK+K+   + PTVY+ W+ P+ +PI+ TH F+IE  +FNGANLMI G++ P D 
Sbjct: 61  NNVPIWFKQKYSNTIVPTVYTAWEYPNNIPIIRTHDFIIETKIFNGANLMIPGTVGPHDE 120

Query: 121 RCNVGTLCGVAGKQSPKVVLAIGVVELDLPSYDRVIGETGVAVKVIHHFNDGLFKAFKVK 180
           R   G +CG+A  + P  +LAIG+   D+ + D  +G+TGVAV+V+H ++D L   FK+K
Sbjct: 121 RLKPGKICGIASTKVPGTILAIGLCTFDMSTVDTPLGKTGVAVEVLHWYSDELTNIFKIK 180

Query: 181 LEPPVVLNTESEDENINSKQTETPEQV-KSADKSQESIKKTAP-------DLEEVAEVLD 232
           L PP ++NT     N+ + ++ T E + +   +++  +K  AP       + +++AE L+
Sbjct: 181 LNPPTIMNT----SNLKTLESMTQESMTQEISEAESEVKPDAPFNDTFTSNADDLAETLE 236

Query: 233 HLTVSDVDYFITRALYYSLTQDKGLILPISASKFISNHIMRNLPPIDHNEVNVKKSSWKK 292
            L V D+D F+T++LYY++TQ+  L LPI +S F+S ++M+NLP +DHN+VN+KKSSWKK
Sbjct: 237 QLRVEDIDNFLTQSLYYTITQETSLQLPIISSTFVSGYLMKNLPNVDHNQVNIKKSSWKK 296

Query: 293 SAKFLKHFEKEGIXXXXXXXXXXTIVGKNTDKDELKNFVPYKLGCSS---PSKGSGENAT 349
           +AKFLKHFEKEG           TI G N +K +LK FVPY++G  +   PSK   +N  
Sbjct: 297 TAKFLKHFEKEGFLKLKGKGDDLTITGFNKEKPQLKTFVPYRIGKPAGALPSKDKQDN-- 354

Query: 350 SKDRTSGMMHSLTLYKPFSLAKDLLREAKLGCDTYYTSQDVRNAVSEYISVKNLAXXXXX 409
                   +  +TLY P            L   +Y+TS ++ +A+  YI+ KNLA     
Sbjct: 355 -----KNFLKVVTLYSPKKKNDSCWTALGLTSKSYFTSAEITSAIQGYIAKKNLANPKDK 409

Query: 410 XXXXXXXLLFNMVNKKKKTPDTTRIIARSEILQPLLSNNFTEFYQIFRNDDTLLFRVPMK 469
                  +LF++V    K  +  R I RS++++P+L NNF  ++Q+F +D+  L + P K
Sbjct: 410 AKISMDDVLFDLVITNNKA-NANRNIMRSQVVEPVLVNNFLLYHQLFTHDNISLSKHPKK 468

Query: 470 GCPPRIKIVTEMKIGRKVITKVSNFEVFHIDPELLAADLRKICSGSTTIGESQTFKSAEV 529
           G PP +K+VTE     KVIT+VSNFEVF+ID + ++ +L+ +CSGST+I E      +EV
Sbjct: 469 GSPPTVKMVTEKVKRGKVITRVSNFEVFNIDAKDMSNELKVLCSGSTSIEELPN--GSEV 526

Query: 530 QVQGPHGQFIIDYLNKSGIPSKWIDFENKLKKKKSK 565
           QVQGPHG  +++Y  K GIP KW D+ NK+K KK +
Sbjct: 527 QVQGPHGDIVMEYFEKHGIPRKWFDYTNKVKPKKRR 562

>KNAG0H03200 Chr8 (599611..601296) [1686 bp, 561 aa] {ON} Anc_8.269
           YDR117C
          Length = 561

 Score =  461 bits (1186), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 258/568 (45%), Positives = 354/568 (62%), Gaps = 27/568 (4%)

Query: 1   MFKKEPHIKALSNLKNSERKKLLQTCIKQTNNEEYTFPTSIIKQTNFGGQKSVGTVYTDE 60
           MFKK PHIK LSNLKNSE++KL Q   KQ   +E+ F  + +KQTNF    SVGT+Y ++
Sbjct: 1   MFKKTPHIKPLSNLKNSEQRKLQQEVQKQFGVDEFVFSGNTVKQTNFQSTTSVGTIYLND 60

Query: 61  NNIPI--LFKEKHCE-QLYPTVYSCWKNPSLLPIVLTHGFVIEEHLFNGANLMISGSIPP 117
             IP+   FKEKH    L+P+VY+CW +P LLPI+LTH  VIE+HLFNGANLMISG++PP
Sbjct: 61  EKIPVPLFFKEKHGSGPLWPSVYACWSHPGLLPIILTHSVVIEDHLFNGANLMISGTMPP 120

Query: 118 FD-SRCNVGTLCGVAGKQSPKVVLAIGVVELDLPSYDRVIGETGVAVKV--IHHFNDGLF 174
           FD +  + G  CG+A  +SP V++A+G +++DL  ++         V V   HHF DGL 
Sbjct: 121 FDVAHLHKGRPCGIANYKSPDVIIAVGTLKMDLEPFNTTGVVGHSGVVVEVAHHFADGLA 180

Query: 175 KAFKVKLEPPVVLNTESEDENINSKQTETPEQVKSADKSQESIKKTAPDLEEVAEVLDHL 234
            AF++KL+ P  L + +  E       E P + K        +      ++++AEVL+ L
Sbjct: 181 DAFRLKLDIPDKLESATTQEVAE----EPPVEAKPTSPVTNPVA-----VDDLAEVLETL 231

Query: 235 TVSDVDYFITRALYYSLTQDKGLILPISASKFISNHIMRNLPP-IDHNEVNVKKSSWKKS 293
           +V DVDYF+TRALYY+LTQ+  L LPI+AS F+S H+M+ LP  ID  EVNVKKSSWKK+
Sbjct: 232 SVEDVDYFMTRALYYTLTQEPKLALPINASNFMSMHLMKCLPKGIDATEVNVKKSSWKKT 291

Query: 294 AKFLKHFEKEGIXXXXXXXXXXTIVGKNTDKDE--LKNFVPYKLGCSSPSKGSGENATSK 351
           AK+LKHFEKEG+           +VG    K    LK+FVPY +G S    G     T+ 
Sbjct: 292 AKYLKHFEKEGLLKLKGKGDDLVVVGSTDSKTHAGLKDFVPYLVGNSIAESGPKSQTTN- 350

Query: 352 DRTSGMMHSLTLYKPFSLAKDLLREAKLGCDTYYTSQDVRNAVSEYISVKNLAXXXXXXX 411
                +M ++T ++P S A+  L    LG   Y++  ++R  ++EYI+   LA       
Sbjct: 351 ---GPVMFAVTSFQPDSTAQTAL---PLGGQRYFSGPEIREVLNEYITANKLAQPNNPKM 404

Query: 412 XXXXXLLFNMVNKKKKTPDTT-RIIARSEILQPLLSNNFTEFYQIFRNDDTLLFRVPMKG 470
                 LF MV K  +   TT RI+AR EIL+ ++  +F   YQ+F++ DT L + P KG
Sbjct: 405 VLLNDTLFGMVTKGNEEKQTTKRIMARPEILERVMKYHFKTLYQLFKDKDTPLTKHPQKG 464

Query: 471 CPPRIKIVTEMKIGRKVITKVSNFEVFHIDPELLAADLRKICSGSTTIGES-QTFKSAEV 529
            PP++ I+TEMKIGRKV+T+V NF+  +I     AADLRK+CS STTIG++  T   +E+
Sbjct: 465 EPPKVHIITEMKIGRKVVTRVYNFDHLNIRDTEFAADLRKLCSASTTIGKTVSTPVVSEI 524

Query: 530 QVQGPHGQFIIDYLNKSGIPSKWIDFEN 557
           QVQG HG  IID+L + G+PS W+ FEN
Sbjct: 525 QVQGAHGPLIIDHLRELGVPSSWVVFEN 552

>Ecym_4301 Chr4 (644340..646034) [1695 bp, 564 aa] {ON} similar to
           Ashbya gossypii AGR079W
          Length = 564

 Score =  454 bits (1168), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 249/575 (43%), Positives = 353/575 (61%), Gaps = 24/575 (4%)

Query: 1   MFKKEPHIKALSNLKNSERKKLLQTCIKQTNNEEYTFPTSIIKQTNFGGQKSVGTVYTDE 60
           MFKK+P IK+ SNLKNSERKKLL     Q  N+E+ F T+I+KQ  F    + GT++TDE
Sbjct: 1   MFKKKPTIKSASNLKNSERKKLLGNVRAQCANQEFQFSTTIVKQATFKTPTATGTIFTDE 60

Query: 61  NNIPILFKEKHCEQLYPTVYSCWKNPSLLPIVLTHGFVIEEHLFNGANLMISGSIPPFDS 120
           +N PI FKEKH E L PT+ +CW+ P LL +VLTH  V++  L NGA+LM+ G+IPPF  
Sbjct: 61  DNKPIFFKEKHSEFLIPTILTCWQYPGLLHVVLTHKHVLDNKLKNGADLMLPGTIPPFSD 120

Query: 121 RCNVGTLCGVAGKQSPKVVLAIGVVELDLPSYDRVIGETGVAVKVIHHFNDGLFKAFKVK 180
            C  G L GVA  ++P VV AIGV +L+L    +V+GETGVAVKV+H  NDGL++ FK+ 
Sbjct: 121 NCTRGKLVGVASSETPFVVEAIGVCQLNLAGIVKVVGETGVAVKVLHTINDGLWEVFKMS 180

Query: 181 LEPPVVLNTESEDENINSKQTETPEQVKSADKSQES----IKKTAP-------DLEEVAE 229
           +EPP  L    + E     + E   Q   A   QE       KTA         L EVAE
Sbjct: 181 VEPPSQLLVSQKHE----VELEALAQADDAGGIQEDEDLPTAKTASGPLEEPNSLSEVAE 236

Query: 230 VLDHLTVSDVDYFITRALYYSLTQDKGLILPISASKFISNHIMRNLPPIDHNEVNVKKSS 289
            L+ L++  VD+F+T+A+YY+L  D  L LPI AS FI+NH+M+NLP I   +V++K+SS
Sbjct: 237 QLEELSIETVDHFLTQAVYYTLALDNTLKLPIGASNFIANHVMKNLPRIHKTQVSLKRSS 296

Query: 290 WKKSAKFLKHFEKEGIXXXXXXXXXXTIVGKNTDKDELKNFVPYKLGCSSPSKGSGENAT 349
           W +++KFLK+FE +G           T+V  N DK E+K+F PY+    S S       +
Sbjct: 297 WARASKFLKYFENQGFLKLKGKVENLTVVSVNKDKTEIKSFQPYRTIQKSVS------TS 350

Query: 350 SKDRTSGMMHSLTLYKPFSLAKDLLREAKLGCDTYYTSQDVRNAVSEYISVKNLAXXXXX 409
           SK+     +  +  Y+P + AK  L       +    ++D++  +++Y++ K L      
Sbjct: 351 SKNNDKHDVEVVVYYQPLNTAKATLHALGNNPNAMLKAKDIKAILNKYVTEKKLVNATDE 410

Query: 410 XXXXXXXLLFNMVNKKKKTPDTTRIIARSEILQPLLSNNFTEFYQIFRNDDTLLFRVPMK 469
                   LF++  KK  + D+TR + R+++   +LS +FTE + IF+ D   L   P+K
Sbjct: 411 RIILLDDTLFSLAYKKSAS-DSTRKVLRAKMFDLILSTSFTEVFFIFK-DGKPLSSKPLK 468

Query: 470 GCPPRIKIVTEMKIGRKVITKVSNFEVFHIDPELLAADLRKICSGSTTIGESQTFKS-AE 528
                + ++TEMKI RK++T++SNFE++ +DPE L+ +LRK CSGS+T+ E  T +S  E
Sbjct: 469 SKNRNVSVMTEMKIHRKIVTRISNFEIYGVDPEELSLELRKRCSGSSTVLEPSTLQSTTE 528

Query: 529 VQVQGPHGQFIIDYLNKSGIPSKWIDFENKLKKKK 563
           VQVQGPHG   I+ LN+ GIPSK+IDF+NKL KKK
Sbjct: 529 VQVQGPHGNTAINILNEHGIPSKYIDFDNKLNKKK 563

>AGR079W Chr7 (879417..881045) [1629 bp, 542 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR117C
          Length = 542

 Score =  426 bits (1094), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 231/565 (40%), Positives = 328/565 (58%), Gaps = 23/565 (4%)

Query: 1   MFKKEPHIKALSNLKNSERKKLLQTCIKQTNNEEYTFPTSIIKQTNFGGQKSVGTVYTDE 60
           MFKKEP++   SN KNSERK+L  +  +Q   E Y F ++ IK   F  Q +VGTVYTD 
Sbjct: 1   MFKKEPNLNPTSNTKNSERKRLQASIREQYEYESYQFSSTEIKHGTFKTQSTVGTVYTDP 60

Query: 61  NNIPILFKEKHCEQLYPTVYSCWKNPSLLPIVLTHGFVIEEHLFNGANLMISGSIPPFDS 120
           NNIP+ F+ KH +   PTVYSCW +P LLP+V TH  V+E  L  GA+LM+ G++PPF S
Sbjct: 61  NNIPLWFRGKHDQTYIPTVYSCWDHPDLLPVVHTHEHVVESKLKGGADLMLPGTVPPFSS 120

Query: 121 RCNVGTLCGVAGKQSPKVVLAIGVVELDLPSYDRVIGETGVAVKVIHHFNDGLFKAFKVK 180
               G + G+A  ++P VV A+G+ E+DL     V   TGVAV+V+H + DGL + FKV+
Sbjct: 121 GTRRGRVVGIASTRAPGVVKAVGICEMDLEGVTTVADTTGVAVRVLHTYGDGLCRVFKVQ 180

Query: 181 LEPPVVLNTESEDENINSKQTETPEQVKSADKSQESIKKTAPDLEEVAEVLDHLTVSDVD 240
            E P     +         + E P              KTAP  E +AE L+ LT+ DVD
Sbjct: 181 REAPEASEAKGASPEAREPEAEPP--------------KTAPG-EGLAEELERLTMEDVD 225

Query: 241 YFITRALYYSLTQDKGLILPISASKFISNHIMRNLPPIDHNEVNVKKSSWKKSAKFLKHF 300
           + +TRA+YY++  D  L LP++ASKFI+ H+++NLPP+D ++V VK+SSW K+AK LKHF
Sbjct: 226 HLLTRAVYYTIKADGRLQLPVTASKFIAEHVLKNLPPMDLSQVTVKRSSWGKAAKLLKHF 285

Query: 301 EKEGIXXXXXXXXXXTIVGKNTDKDELKNFVPYKLGCSSPSKGSGENATSKDRTSGMMHS 360
           E +G+          T+V  N+  + LK+F PY+      S GS  ++T++      +  
Sbjct: 286 EAQGLLTLKGKPESFTVVSVNSAHEALKSFEPYRTVSDKASTGSKNSSTTQS-----LEI 340

Query: 361 LTLYKPFSLAKDLLREAKLGCDTYYTSQDVRNAVSEYISVKNLAXXXXXXXXXXXXLLFN 420
           +  Y P       L    +      +++D+R+ + +Y++ +                L  
Sbjct: 341 VYHYVPNRTLLPQLNGLGISGGDALSAKDIRDRLEQYVAARKCVDPYDKSMLRLDDTLAQ 400

Query: 421 MVNKKKKTPDTTRIIARSEILQPLLSNNFTEFYQIFRNDDTLLFRVPMKGCPPRIKIVTE 480
           +++K     DT R + R E L  LLS +F+E++ + R D  L    P KG  P IK+  E
Sbjct: 401 LLHKNVNA-DTPRSLPRPEALAALLSRSFSEYFVVMRGDAPL--SKPQKGRAPPIKVTNE 457

Query: 481 MKIGRKVITKVSNFEVFHIDPELLAADLRKICSGSTTIGESQTFKSAEVQVQGPHGQFII 540
            KI +KV+TKVSNFEV+ +DPE LAA+LR  CSGSTTI +    K+ EVQVQGPH   I+
Sbjct: 458 RKIYKKVVTKVSNFEVYGVDPEELAAELRVRCSGSTTITDVPNTKAVEVQVQGPHEATIV 517

Query: 541 DYLNKSGIPSKWIDFENKLKKKKSK 565
             LNK GIPSK+I  + K++ KK K
Sbjct: 518 SILNKHGIPSKYITLDCKVQPKKKK 542

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.133    0.383 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 61,848,906
Number of extensions: 2745332
Number of successful extensions: 10019
Number of sequences better than 10.0: 43
Number of HSP's gapped: 10276
Number of HSP's successfully gapped: 43
Length of query: 565
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 450
Effective length of database: 40,294,809
Effective search space: 18132664050
Effective search space used: 18132664050
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 68 (30.8 bits)