Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Smik_4.3608.268ON28528514990.0
YDR116C (MRPL1)8.268ON28528513680.0
Skud_4.3768.268ON28528513410.0
Suva_2.2758.268ON28528513090.0
KLLA0F19272g8.268ON2662638721e-118
NCAS0B038108.268ON3142778711e-117
ZYRO0C01518g8.268ON2772708581e-115
SAKL0H16896g8.268ON2852828581e-115
Kpol_392.38.268ON2812728561e-115
TDEL0F039508.268ON2762768451e-113
KLTH0G13552g8.268ON2812738381e-112
Kwal_56.237758.268ON2812648241e-110
TPHA0J007708.268ON2782708181e-109
CAGL0B01815g8.268ON2902487811e-103
NDAI0J013308.268ON3142617791e-103
AGR080W8.268ON2752707671e-102
Ecym_43028.268ON2752827452e-98
KNAG0H032108.268ON2852447201e-94
KAFR0B054808.268ON2802616889e-90
TBLA0I031908.268ON2412144763e-58
KAFR0E034405.500ON154988750.80
Skud_15.495na 1ON156493731.1
NDAI0C030605.162ON416124721.3
Smik_12.595.213ON617121711.8
Kwal_27.116388.446ON723103711.9
YOR328W (PDR10)na 1ON156491702.6
TBLA0D017805.500ON159588702.7
NDAI0A042005.500ON155193684.3
Ecym_71737.483ON20649657.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Smik_4.360
         (285 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Smik_4.360 Chr4 complement(644029..644886) [858 bp, 285 aa] {ON}...   582   0.0  
YDR116C Chr4 complement(682724..683581) [858 bp, 285 aa] {ON}  M...   531   0.0  
Skud_4.376 Chr4 complement(654375..655232) [858 bp, 285 aa] {ON}...   521   0.0  
Suva_2.275 Chr2 complement(477386..478243) [858 bp, 285 aa] {ON}...   508   0.0  
KLLA0F19272g Chr6 complement(1783497..1784297) [801 bp, 266 aa] ...   340   e-118
NCAS0B03810 Chr2 (680870..681814) [945 bp, 314 aa] {ON} Anc_8.26...   340   e-117
ZYRO0C01518g Chr3 (110061..110894) [834 bp, 277 aa] {ON} similar...   335   e-115
SAKL0H16896g Chr8 (1486354..1487211) [858 bp, 285 aa] {ON} simil...   335   e-115
Kpol_392.3 s392 (3674..4519) [846 bp, 281 aa] {ON} (3674..4519) ...   334   e-115
TDEL0F03950 Chr6 complement(732544..733374) [831 bp, 276 aa] {ON...   330   e-113
KLTH0G13552g Chr7 (1163624..1164469) [846 bp, 281 aa] {ON} simil...   327   e-112
Kwal_56.23775 s56 (700146..700991) [846 bp, 281 aa] {ON} YDR116C...   322   e-110
TPHA0J00770 Chr10 complement(179754..180590) [837 bp, 278 aa] {O...   319   e-109
CAGL0B01815g Chr2 complement(165648..166520) [873 bp, 290 aa] {O...   305   e-103
NDAI0J01330 Chr10 (309586..310530) [945 bp, 314 aa] {ON} Anc_8.2...   304   e-103
AGR080W Chr7 (881213..882040) [828 bp, 275 aa] {ON} Syntenic hom...   300   e-102
Ecym_4302 Chr4 (646221..647048) [828 bp, 275 aa] {ON} similar to...   291   2e-98
KNAG0H03210 Chr8 (601470..602327) [858 bp, 285 aa] {ON} Anc_8.26...   281   1e-94
KAFR0B05480 Chr2 (1122727..1123569) [843 bp, 280 aa] {ON} Anc_8....   269   9e-90
TBLA0I03190 Chr9 complement(768942..769667) [726 bp, 241 aa] {ON...   187   3e-58
KAFR0E03440 Chr5 complement(684043..688692) [4650 bp, 1549 aa] {...    33   0.80 
Skud_15.495 Chr15 (871539..876233) [4695 bp, 1564 aa] {ON} YOR32...    33   1.1  
NDAI0C03060 Chr3 (696404..697654) [1251 bp, 416 aa] {ON} Anc_5.1...    32   1.3  
Smik_12.59 Chr12 (128051..129904) [1854 bp, 617 aa] {ON} YLL004W...    32   1.8  
Kwal_27.11638 s27 (886806..888977) [2172 bp, 723 aa] {ON} YDL199...    32   1.9  
YOR328W Chr15 (931803..936497) [4695 bp, 1564 aa] {ON}  PDR10ATP...    32   2.6  
TBLA0D01780 Chr4 complement(438830..443617) [4788 bp, 1595 aa] {...    32   2.7  
NDAI0A04200 Chr1 complement(948224..952879) [4656 bp, 1551 aa] {...    31   4.3  
Ecym_7173 Chr7 complement(356629..357249) [621 bp, 206 aa] {ON} ...    30   7.3  

>Smik_4.360 Chr4 complement(644029..644886) [858 bp, 285 aa] {ON}
           YDR116C (REAL)
          Length = 285

 Score =  582 bits (1499), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 285/285 (100%), Positives = 285/285 (100%)

Query: 1   MLSVVAIPKICIASSTRRCLSHTAKKLYAEEYKPTAMSSNAPSLTKDQAKKRELKRLAQR 60
           MLSVVAIPKICIASSTRRCLSHTAKKLYAEEYKPTAMSSNAPSLTKDQAKKRELKRLAQR
Sbjct: 1   MLSVVAIPKICIASSTRRCLSHTAKKLYAEEYKPTAMSSNAPSLTKDQAKKRELKRLAQR 60

Query: 61  KAEAKRPAATNPLYMPVTMALRYLRAAEVGRPQSQQTINLTTLVVGERGTAPLSGSVTFP 120
           KAEAKRPAATNPLYMPVTMALRYLRAAEVGRPQSQQTINLTTLVVGERGTAPLSGSVTFP
Sbjct: 61  KAEAKRPAATNPLYMPVTMALRYLRAAEVGRPQSQQTINLTTLVVGERGTAPLSGSVTFP 120

Query: 121 KPLRYIKVAAFTNDENKLEELRKKYPNHLIGGADLVARIKSGEIPVDFDKAFATPDIVPT 180
           KPLRYIKVAAFTNDENKLEELRKKYPNHLIGGADLVARIKSGEIPVDFDKAFATPDIVPT
Sbjct: 121 KPLRYIKVAAFTNDENKLEELRKKYPNHLIGGADLVARIKSGEIPVDFDKAFATPDIVPT 180

Query: 181 LQSQVARILGPRGVLPSLKKGTVSDDINSLLEESLGSMPFRQRGNSISLGVGKCYFSDRE 240
           LQSQVARILGPRGVLPSLKKGTVSDDINSLLEESLGSMPFRQRGNSISLGVGKCYFSDRE
Sbjct: 181 LQSQVARILGPRGVLPSLKKGTVSDDINSLLEESLGSMPFRQRGNSISLGVGKCYFSDRE 240

Query: 241 ILQNIISARSAFKAAVNNQKSKKPNLLSKTTLSSTHGPGIVIDFA 285
           ILQNIISARSAFKAAVNNQKSKKPNLLSKTTLSSTHGPGIVIDFA
Sbjct: 241 ILQNIISARSAFKAAVNNQKSKKPNLLSKTTLSSTHGPGIVIDFA 285

>YDR116C Chr4 complement(682724..683581) [858 bp, 285 aa] {ON}
           MRPL1Mitochondrial ribosomal protein of the large
           subunit
          Length = 285

 Score =  531 bits (1368), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 255/285 (89%), Positives = 271/285 (95%)

Query: 1   MLSVVAIPKICIASSTRRCLSHTAKKLYAEEYKPTAMSSNAPSLTKDQAKKRELKRLAQR 60
           MLSVVAIPKIC+    RRC  HTAKKLYA++YKP AMSSNAPSLTKDQAKKRELKRL QR
Sbjct: 1   MLSVVAIPKICVTGPARRCFFHTAKKLYADDYKPAAMSSNAPSLTKDQAKKRELKRLVQR 60

Query: 61  KAEAKRPAATNPLYMPVTMALRYLRAAEVGRPQSQQTINLTTLVVGERGTAPLSGSVTFP 120
           KAEAKRPA  +PLYMPVT ALRYLRAAEVGRPQSQQTINLTTLVVGERGTAPLSGSVTFP
Sbjct: 61  KAEAKRPATASPLYMPVTKALRYLRAAEVGRPQSQQTINLTTLVVGERGTAPLSGSVTFP 120

Query: 121 KPLRYIKVAAFTNDENKLEELRKKYPNHLIGGADLVARIKSGEIPVDFDKAFATPDIVPT 180
           KPLRYIK+AAFTNDE+KLEELR+KYPNHLIGGADLVA+IKSGEI VDFDKAFATPDIVP 
Sbjct: 121 KPLRYIKIAAFTNDESKLEELREKYPNHLIGGADLVAKIKSGEISVDFDKAFATPDIVPA 180

Query: 181 LQSQVARILGPRGVLPSLKKGTVSDDINSLLEESLGSMPFRQRGNSISLGVGKCYFSDRE 240
           LQSQVARILGPRGVLPS+KKGTVSDDI+SLL+ESLGSMPFRQRGNSIS+GVGKCYF+DRE
Sbjct: 181 LQSQVARILGPRGVLPSVKKGTVSDDISSLLQESLGSMPFRQRGNSISIGVGKCYFTDRE 240

Query: 241 ILQNIISARSAFKAAVNNQKSKKPNLLSKTTLSSTHGPGIVIDFA 285
           ILQNIISAR+AFK AV+NQKSKKPN+LSKTTLSSTHGPGIVIDFA
Sbjct: 241 ILQNIISARAAFKTAVDNQKSKKPNILSKTTLSSTHGPGIVIDFA 285

>Skud_4.376 Chr4 complement(654375..655232) [858 bp, 285 aa] {ON}
           YDR116C (REAL)
          Length = 285

 Score =  521 bits (1341), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 256/285 (89%), Positives = 276/285 (96%)

Query: 1   MLSVVAIPKICIASSTRRCLSHTAKKLYAEEYKPTAMSSNAPSLTKDQAKKRELKRLAQR 60
           MLSV+A PKIC+ SSTRRCLSHTA KLYAEEYK TAMSSNAPSLTK+QAKKRELKRLAQR
Sbjct: 1   MLSVIATPKICVVSSTRRCLSHTASKLYAEEYKSTAMSSNAPSLTKEQAKKRELKRLAQR 60

Query: 61  KAEAKRPAATNPLYMPVTMALRYLRAAEVGRPQSQQTINLTTLVVGERGTAPLSGSVTFP 120
           +AEAKRPAATNPLYMPVT+ALRYLRAAEVGRPQSQQTINLTTLVVGERGTAPLSGSV FP
Sbjct: 61  RAEAKRPAATNPLYMPVTVALRYLRAAEVGRPQSQQTINLTTLVVGERGTAPLSGSVAFP 120

Query: 121 KPLRYIKVAAFTNDENKLEELRKKYPNHLIGGADLVARIKSGEIPVDFDKAFATPDIVPT 180
           KPLRYIKVA FTNDENKL+ELR+KYPNHLIGGADLV+RIK+GEIPVDFDKA+AT DIVP 
Sbjct: 121 KPLRYIKVAVFTNDENKLKELREKYPNHLIGGADLVSRIKNGEIPVDFDKAYATADIVPA 180

Query: 181 LQSQVARILGPRGVLPSLKKGTVSDDINSLLEESLGSMPFRQRGNSISLGVGKCYFSDRE 240
           LQSQVARILGPRGVLPS+KKGTVSDDI SLL+ESLGSMPFRQRGNSISLG+GKCYF+DRE
Sbjct: 181 LQSQVARILGPRGVLPSVKKGTVSDDITSLLQESLGSMPFRQRGNSISLGIGKCYFTDRE 240

Query: 241 ILQNIISARSAFKAAVNNQKSKKPNLLSKTTLSSTHGPGIVIDFA 285
           +LQNII+AR+AFKAAV++QKSKKPN+LSKTTLSSTHGPGIVIDFA
Sbjct: 241 VLQNIIAARAAFKAAVSDQKSKKPNILSKTTLSSTHGPGIVIDFA 285

>Suva_2.275 Chr2 complement(477386..478243) [858 bp, 285 aa] {ON}
           YDR116C (REAL)
          Length = 285

 Score =  508 bits (1309), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 244/285 (85%), Positives = 269/285 (94%)

Query: 1   MLSVVAIPKICIASSTRRCLSHTAKKLYAEEYKPTAMSSNAPSLTKDQAKKRELKRLAQR 60
           ML   AIPKICIAS  RR LSHTA++LYAEEYK  AMSSNAPSLTKDQAKKRELKRLAQR
Sbjct: 1   MLPTTAIPKICIASPIRRYLSHTARQLYAEEYKTAAMSSNAPSLTKDQAKKRELKRLAQR 60

Query: 61  KAEAKRPAATNPLYMPVTMALRYLRAAEVGRPQSQQTINLTTLVVGERGTAPLSGSVTFP 120
           +AEAKRPAAT+PL+MPVTMALRYLRAAEVGRPQSQQTINLTTLVVGERGTAP+SG+VTF 
Sbjct: 61  RAEAKRPAATSPLHMPVTMALRYLRAAEVGRPQSQQTINLTTLVVGERGTAPISGNVTFS 120

Query: 121 KPLRYIKVAAFTNDENKLEELRKKYPNHLIGGADLVARIKSGEIPVDFDKAFATPDIVPT 180
           KPLRY+KVA FTNDE KL+ELR+KYPN ++GG DLVA+IK+ E PVDFDKAFATPDIVPT
Sbjct: 121 KPLRYVKVAVFTNDEVKLKELREKYPNLIVGGTDLVAKIKNNESPVDFDKAFATPDIVPT 180

Query: 181 LQSQVARILGPRGVLPSLKKGTVSDDINSLLEESLGSMPFRQRGNSISLGVGKCYFSDRE 240
           LQSQVARILGPRGVLPS+KKGTVSDDI SLL+ESLGSMPFRQRGN+ISLG+GKCYF+DRE
Sbjct: 181 LQSQVARILGPRGVLPSVKKGTVSDDITSLLQESLGSMPFRQRGNAISLGIGKCYFTDRE 240

Query: 241 ILQNIISARSAFKAAVNNQKSKKPNLLSKTTLSSTHGPGIVIDFA 285
           +LQNIISAR+AF+AAV+NQK+KKP+LLSKTTLSSTHGPGIVIDFA
Sbjct: 241 LLQNIISARTAFRAAVDNQKAKKPSLLSKTTLSSTHGPGIVIDFA 285

>KLLA0F19272g Chr6 complement(1783497..1784297) [801 bp, 266 aa]
           {ON} similar to uniprot|Q04599 Saccharomyces cerevisiae
           YDR116C MRPL1 Mitochondrial ribosomal protein of the
           large subunit
          Length = 266

 Score =  340 bits (872), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 154/263 (58%), Positives = 214/263 (81%), Gaps = 3/263 (1%)

Query: 26  KLYAEEYKPTAM---SSNAPSLTKDQAKKRELKRLAQRKAEAKRPAATNPLYMPVTMALR 82
           +++  +++ T+          LTK+Q +KREL+++ QR+ +AK PA+ +PLYMPV+ ALR
Sbjct: 4   RIFTRQFQITSFRLAEETGTKLTKEQLRKRELRKMVQRRLQAKTPASDHPLYMPVSRALR 63

Query: 83  YLRAAEVGRPQSQQTINLTTLVVGERGTAPLSGSVTFPKPLRYIKVAAFTNDENKLEELR 142
           YLRA EVG+P SQQTI LTTLVV ERG  PL+G+V+F KPL+ +KVA FTNDE +   ++
Sbjct: 64  YLRAIEVGQPASQQTITLTTLVVAERGVPPLTGNVSFGKPLKDVKVAVFTNDEAQAALMK 123

Query: 143 KKYPNHLIGGADLVARIKSGEIPVDFDKAFATPDIVPTLQSQVARILGPRGVLPSLKKGT 202
            KY  HL+GG+DLV++IK+GE+ +DFDKAFATPDIVP L SQV RILGPRG+LP+ KKGT
Sbjct: 124 DKYSVHLVGGSDLVSQIKAGEVSIDFDKAFATPDIVPQLASQVGRILGPRGLLPTAKKGT 183

Query: 203 VSDDINSLLEESLGSMPFRQRGNSISLGVGKCYFSDREILQNIISARSAFKAAVNNQKSK 262
           V++D+  L+++S+ S+PFRQRGNSISLGV K +F+D+E+L+N+++ + AFK ++ NQ++K
Sbjct: 184 VAEDLEPLIKDSMSSVPFRQRGNSISLGVAKTHFTDKEVLENLLATQKAFKQSITNQQTK 243

Query: 263 KPNLLSKTTLSSTHGPGIVIDFA 285
           KP++LS+TTL+STHGPGIVIDFA
Sbjct: 244 KPSILSQTTLTSTHGPGIVIDFA 266

>NCAS0B03810 Chr2 (680870..681814) [945 bp, 314 aa] {ON} Anc_8.268
           YDR116C
          Length = 314

 Score =  340 bits (871), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 161/277 (58%), Positives = 213/277 (76%), Gaps = 4/277 (1%)

Query: 11  CIASSTRRCLSHTAKKLYAEEYKPTAMSSN---APSLTKDQAKKRELKRLAQRKAEAKRP 67
           C +SS  R + H+   + AEE   T  S+     P+L+K+Q KKREL+RL+QRK EAKRP
Sbjct: 38  CTSSSQSRGI-HSTSNVGAEEAASTTTSATIPVVPTLSKEQLKKRELRRLSQRKTEAKRP 96

Query: 68  AATNPLYMPVTMALRYLRAAEVGRPQSQQTINLTTLVVGERGTAPLSGSVTFPKPLRYIK 127
           A+ +PLYMPV  ALRY+RAAEVGRP  QQTI LT+LVV E+G APL+G ++ P+PL+ +K
Sbjct: 97  ASIHPLYMPVVEALRYIRAAEVGRPSGQQTITLTSLVVNEKGVAPLNGHISLPRPLKALK 156

Query: 128 VAAFTNDENKLEELRKKYPNHLIGGADLVARIKSGEIPVDFDKAFATPDIVPTLQSQVAR 187
           VA F+ +E  L  +++KY  HL+GG +L+ +IK+GE+  DFDKAFA+ D+   L +Q+ +
Sbjct: 157 VAVFSQNEELLTRMKEKYHCHLVGGVELINKIKNGEVKTDFDKAFASSDMANILSAQLGK 216

Query: 188 ILGPRGVLPSLKKGTVSDDINSLLEESLGSMPFRQRGNSISLGVGKCYFSDREILQNIIS 247
            LG RG+LP+ KKGTVSDD+ SLL + +GS+PFRQ GN IS+G+GKC+FSD EIL+NII+
Sbjct: 217 TLGRRGLLPNAKKGTVSDDLESLLADKIGSLPFRQTGNCISIGIGKCHFSDEEILRNIIA 276

Query: 248 ARSAFKAAVNNQKSKKPNLLSKTTLSSTHGPGIVIDF 284
           ARSA   A++ QKSKKP++L KTTLSSTHGPGIVIDF
Sbjct: 277 ARSAVMKALSEQKSKKPSILGKTTLSSTHGPGIVIDF 313

>ZYRO0C01518g Chr3 (110061..110894) [834 bp, 277 aa] {ON} similar to
           uniprot|Q04599 Saccharomyces cerevisiae YDR116C MRPL1
           Mitochondrial ribosomal protein of the large subunit
          Length = 277

 Score =  335 bits (858), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 158/270 (58%), Positives = 207/270 (76%), Gaps = 8/270 (2%)

Query: 15  STRRCLSHTAKKLYAEEYKPTAMSSNAPSLTKDQAKKRELKRLAQRKAEAKRPAATNPLY 74
           ST RCL HTA  L AEE            LTK+Q +KRE++R A+RK EAK+PA T+PLY
Sbjct: 15  STSRCLFHTAALLRAEEA--------GSKLTKEQLRKREVRRAARRKVEAKKPAHTHPLY 66

Query: 75  MPVTMALRYLRAAEVGRPQSQQTINLTTLVVGERGTAPLSGSVTFPKPLRYIKVAAFTND 134
           MP  +ALRYLRA EVG P SQQ I +TT VV +RG  P++G+V+ P PL+ + VA F+ND
Sbjct: 67  MPTPLALRYLRAVEVGYPASQQVITVTTSVVADRGNPPIAGNVSLPSPLKDVLVAVFSND 126

Query: 135 ENKLEELRKKYPNHLIGGADLVARIKSGEIPVDFDKAFATPDIVPTLQSQVARILGPRGV 194
           E +L   R K+  HL+GG+D++A+IK GEIPVDFDKAFATPDI   L SQVARILGP+ V
Sbjct: 127 EQQLSMARDKFRCHLVGGSDIIAKIKQGEIPVDFDKAFATPDIAQELTSQVARILGPKQV 186

Query: 195 LPSLKKGTVSDDINSLLEESLGSMPFRQRGNSISLGVGKCYFSDREILQNIISARSAFKA 254
           LP  K+GTV+ D+  L+++S GS+PFRQ+GNSISL V KC FSDR++L+N+++ ++AFK 
Sbjct: 187 LPMAKRGTVASDLEPLIKDSFGSIPFRQKGNSISLAVAKCEFSDRQVLENLLAVQTAFKE 246

Query: 255 AVNNQKSKKPNLLSKTTLSSTHGPGIVIDF 284
           AV+NQK+K+P++L +TTL++THGPGIVID 
Sbjct: 247 AVSNQKAKRPSILGRTTLTTTHGPGIVIDL 276

>SAKL0H16896g Chr8 (1486354..1487211) [858 bp, 285 aa] {ON} similar
           to uniprot|Q04599 Saccharomyces cerevisiae YDR116C MRPL1
           Mitochondrial ribosomal protein of the large subunit
          Length = 285

 Score =  335 bits (858), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 164/282 (58%), Positives = 227/282 (80%), Gaps = 9/282 (3%)

Query: 4   VVAIPKICIASSTRRCLSHTAKKLYAEEYKPTAMSSNAPSLTKDQAKKRELKRLAQRKAE 63
           ++ +P  C    TR  L HT   L +EE      S+ A  L+KDQ K+REL+RL QRKA 
Sbjct: 13  IITLPISC----TRTSLFHTFTALKSEEP-----STIATKLSKDQLKRRELRRLVQRKAA 63

Query: 64  AKRPAATNPLYMPVTMALRYLRAAEVGRPQSQQTINLTTLVVGERGTAPLSGSVTFPKPL 123
           A++PAA +PLYMPVT ALR+LRAAEVG+PQSQQTI+LTTLV+ ERG   L+G+++FPKPL
Sbjct: 64  ARKPAADHPLYMPVTQALRFLRAAEVGQPQSQQTISLTTLVISERGAPQLNGNISFPKPL 123

Query: 124 RYIKVAAFTNDENKLEELRKKYPNHLIGGADLVARIKSGEIPVDFDKAFATPDIVPTLQS 183
           + +K+A FTNDE+KL+  R ++  HL+GG++L+ +IK GE+P+DFDKAFATPDI  +L S
Sbjct: 124 KDVKIAVFTNDEDKLKIARDQFNCHLVGGSELIEKIKKGEVPLDFDKAFATPDIAISLTS 183

Query: 184 QVARILGPRGVLPSLKKGTVSDDINSLLEESLGSMPFRQRGNSISLGVGKCYFSDREILQ 243
           Q+ RILGPRG+LP+ KKGTV++DI+SL+++S+G++PFRQRGN IS+ V KC F+D ++L+
Sbjct: 184 QLGRILGPRGLLPNAKKGTVTEDISSLIKDSMGTLPFRQRGNCISIAVAKCSFTDTQVLE 243

Query: 244 NIISARSAFKAAVNNQKSKKPNLLSKTTLSSTHGPGIVIDFA 285
           NI++A+ +FK A+ NQK+KKP++L +TTL++THGPG+VIDFA
Sbjct: 244 NILAAQKSFKLALANQKAKKPSILGQTTLTTTHGPGLVIDFA 285

>Kpol_392.3 s392 (3674..4519) [846 bp, 281 aa] {ON} (3674..4519)
           [846 nt, 282 aa]
          Length = 281

 Score =  334 bits (856), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 156/272 (57%), Positives = 216/272 (79%), Gaps = 2/272 (0%)

Query: 16  TRRCLSHTAKKLYAEEYKPTAMSSNAP--SLTKDQAKKRELKRLAQRKAEAKRPAATNPL 73
           +RRC  H+ + L AE    +  +S  P     KD+ K+REL+R ++RKA+A++PA++ PL
Sbjct: 10  SRRCEYHSGRVLLAEAVAASETASAKPVSKSVKDKLKRRELRRHSKRKADARKPASSYPL 69

Query: 74  YMPVTMALRYLRAAEVGRPQSQQTINLTTLVVGERGTAPLSGSVTFPKPLRYIKVAAFTN 133
           YMP++ ALRYLRAAEVG+P SQQ I +TT VV ERG   L+G++++  P++ +K+A F+N
Sbjct: 70  YMPISQALRYLRAAEVGQPISQQIITITTDVVSERGNLNLNGNISYNTPIKDVKIAVFSN 129

Query: 134 DENKLEELRKKYPNHLIGGADLVARIKSGEIPVDFDKAFATPDIVPTLQSQVARILGPRG 193
           D  KL ++++++  HLIGG DLV +IKSG+ PVDFDKAFATPDI P L SQ+AR+LGPRG
Sbjct: 130 DPEKLAKIKEEHNCHLIGGTDLVEKIKSGKQPVDFDKAFATPDISPMLTSQLARVLGPRG 189

Query: 194 VLPSLKKGTVSDDINSLLEESLGSMPFRQRGNSISLGVGKCYFSDREILQNIISARSAFK 253
           VLP++KKGTVS+D++SL++ S+G MPFRQ GNSIS+ VG+C FSD++IL+NII+ RSA+ 
Sbjct: 190 VLPTIKKGTVSEDVSSLIKGSIGLMPFRQTGNSISVSVGRCNFSDKQILENIIAVRSAYN 249

Query: 254 AAVNNQKSKKPNLLSKTTLSSTHGPGIVIDFA 285
             +++QKSKKP+LL KTT++STHGPGI IDFA
Sbjct: 250 TTLSSQKSKKPSLLGKTTITSTHGPGITIDFA 281

>TDEL0F03950 Chr6 complement(732544..733374) [831 bp, 276 aa] {ON}
           Anc_8.268 YDR116C
          Length = 276

 Score =  330 bits (845), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 171/276 (61%), Positives = 216/276 (78%), Gaps = 6/276 (2%)

Query: 11  CIASST-RRCLSHTAKKLYAEEYKPTAMSSNAPSLTKDQAKKRELKRLAQRKAEAKRPAA 69
           CI  S  RR   HT   L AEE      ++N   L+KDQ KKRE++RLAQRKA AK+  +
Sbjct: 6   CIGRSVLRRSFLHTGNVLRAEE-----AAANVSKLSKDQLKKREIRRLAQRKAAAKKSPS 60

Query: 70  TNPLYMPVTMALRYLRAAEVGRPQSQQTINLTTLVVGERGTAPLSGSVTFPKPLRYIKVA 129
            +PLYM + MALR+LRAAEVG+PQ+QQTI LTT VV ERG   L+GSV+FPKPL+ +K+A
Sbjct: 61  DHPLYMSIPMALRFLRAAEVGQPQTQQTITLTTAVVAERGVPALAGSVSFPKPLKEVKIA 120

Query: 130 AFTNDENKLEELRKKYPNHLIGGADLVARIKSGEIPVDFDKAFATPDIVPTLQSQVARIL 189
            F+ DE++L+  R+K+  HL+GG +++ +IKSGEIPVDFDKAFATPDI P L SQ+ARIL
Sbjct: 121 VFSGDEDQLKVAREKFNCHLVGGTEIIEKIKSGEIPVDFDKAFATPDIAPALTSQLARIL 180

Query: 190 GPRGVLPSLKKGTVSDDINSLLEESLGSMPFRQRGNSISLGVGKCYFSDREILQNIISAR 249
           GPRGVLP++KKGTV+ D++ L+++S+GSMPFRQRGN+IS+ VGK  FSDR+IL+N I+  
Sbjct: 181 GPRGVLPTVKKGTVATDVSRLVQDSMGSMPFRQRGNAISIAVGKSSFSDRQILENAIATH 240

Query: 250 SAFKAAVNNQKSKKPNLLSKTTLSSTHGPGIVIDFA 285
            A K A+ NQ SKK +LL KTTLSSTHGPGIVIDFA
Sbjct: 241 DAVKEALANQVSKKTSLLGKTTLSSTHGPGIVIDFA 276

>KLTH0G13552g Chr7 (1163624..1164469) [846 bp, 281 aa] {ON} similar
           to uniprot|Q04599 Saccharomyces cerevisiae YDR116C MRPL1
           Mitochondrial ribosomal protein of the large subunit
          Length = 281

 Score =  327 bits (838), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 154/273 (56%), Positives = 217/273 (79%), Gaps = 6/273 (2%)

Query: 13  ASSTRRCLSHTAKKLYAEEYKPTAMSSNAPSLTKDQAKKRELKRLAQRKAEAKRPAATNP 72
           AS  RR   H +  L AEE    A S     L+KDQ KKRE++R AQ+KA A+RPA+ +P
Sbjct: 15  ASPVRRL--HVSASLRAEEPVGNATSK----LSKDQLKKREVRRFAQKKAAARRPASEHP 68

Query: 73  LYMPVTMALRYLRAAEVGRPQSQQTINLTTLVVGERGTAPLSGSVTFPKPLRYIKVAAFT 132
           LYMPV  ALR+LRAAEVG+PQSQQT+++TT+V+ ERG   LSG+V+FP  L+ +K+A FT
Sbjct: 69  LYMPVDKALRFLRAAEVGQPQSQQTLSVTTIVISERGAPLLSGNVSFPNALKELKIAVFT 128

Query: 133 NDENKLEELRKKYPNHLIGGADLVARIKSGEIPVDFDKAFATPDIVPTLQSQVARILGPR 192
           NDE + +  R+K+  H++GG++LV +IK G++P+DFDK+FATP+I   L SQ+ RILGPR
Sbjct: 129 NDEQQAQIAREKFNCHVVGGSELVEKIKQGQVPLDFDKSFATPEIATLLASQLGRILGPR 188

Query: 193 GVLPSLKKGTVSDDINSLLEESLGSMPFRQRGNSISLGVGKCYFSDREILQNIISARSAF 252
           G+LP+ KKGTVS+++ SL+++S+G++PFRQRGN+IS+ VG+C F+D+++L+NI++A+ + 
Sbjct: 189 GLLPAAKKGTVSENLESLIKDSMGTLPFRQRGNNISIAVGRCSFTDKQLLENIVAAQKSV 248

Query: 253 KAAVNNQKSKKPNLLSKTTLSSTHGPGIVIDFA 285
           K A+ NQK+KKP+LL +TTL+ST GPGIVIDFA
Sbjct: 249 KEALANQKAKKPSLLGQTTLTSTRGPGIVIDFA 281

>Kwal_56.23775 s56 (700146..700991) [846 bp, 281 aa] {ON} YDR116C -
           Hypothetical ORF [contig 173] FULL
          Length = 281

 Score =  322 bits (824), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 149/264 (56%), Positives = 209/264 (79%), Gaps = 4/264 (1%)

Query: 22  HTAKKLYAEEYKPTAMSSNAPSLTKDQAKKRELKRLAQRKAEAKRPAATNPLYMPVTMAL 81
           H    L AEE  P+ + S    L+KDQ +KRE+++LAQ+KA A+RPA  +PLYMPV  AL
Sbjct: 22  HAFSALRAEET-PSPVVSK---LSKDQLRKREIRKLAQKKAAARRPATDHPLYMPVDKAL 77

Query: 82  RYLRAAEVGRPQSQQTINLTTLVVGERGTAPLSGSVTFPKPLRYIKVAAFTNDENKLEEL 141
           R+LRAAE G+P SQQT+++TT+V+ ERG  PLSG+++FPKPL+ +K+A FTNDE + +  
Sbjct: 78  RFLRAAEAGQPHSQQTLSVTTIVISERGAPPLSGNLSFPKPLKDLKIAVFTNDEQQAQIA 137

Query: 142 RKKYPNHLIGGADLVARIKSGEIPVDFDKAFATPDIVPTLQSQVARILGPRGVLPSLKKG 201
           R+K+  HL+GG+DLV +IK G + +DFDK+FATP+I   L SQ+ RILGPRG+LP+ KKG
Sbjct: 138 REKFGCHLVGGSDLVEKIKEGAVSLDFDKSFATPEITTLLASQLGRILGPRGLLPAAKKG 197

Query: 202 TVSDDINSLLEESLGSMPFRQRGNSISLGVGKCYFSDREILQNIISARSAFKAAVNNQKS 261
           TV++++  LL+ S+G++PFRQRGN +S+ VGKC F+D+++L+NI++A+   K A+  QK+
Sbjct: 198 TVAENLEPLLKNSMGTLPFRQRGNVVSVAVGKCSFTDKQLLENILAAQKGLKEALATQKT 257

Query: 262 KKPNLLSKTTLSSTHGPGIVIDFA 285
           KKP+LL +TTL+STHGPGIVIDFA
Sbjct: 258 KKPSLLGQTTLTSTHGPGIVIDFA 281

>TPHA0J00770 Chr10 complement(179754..180590) [837 bp, 278 aa] {ON}
           Anc_8.268 YDR116C
          Length = 278

 Score =  319 bits (818), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 154/270 (57%), Positives = 207/270 (76%), Gaps = 1/270 (0%)

Query: 16  TRRCLSHTAKKLYAEEYKPTAMSSNAPSLTKDQAKKRELKRLAQRKAEAKRPAATNPLYM 75
           TR+   H ++ +  E        +    L+KDQ KKREL+R   RK EAK PA ++PLYM
Sbjct: 10  TRKNAFHVSRIIREEITGAEGPIAQVSKLSKDQLKKRELRRFTIRKREAKMPATSHPLYM 69

Query: 76  PVTMALRYLRAAEVGRPQSQQTINLTTLVVGERGTAPLSGSVTFPKPLRYIKVAAFTNDE 135
            V  ALR+LRAAEVG+P SQQTINLTTLVV E+G+  L+G + F  PL+ +K+A FTNDE
Sbjct: 70  QVPQALRFLRAAEVGQPLSQQTINLTTLVVSEKGSPNLAGDIAFVTPLKEVKIAIFTNDE 129

Query: 136 NKLEELRKKYPNHLIGGADLVARIKSGEIPVDFDKAFATPDIVPTLQSQVARILGPRGVL 195
            +++  ++K+  +++GG++L+++IK+GEI VDFDKAFATPDIV  L S VARILGPRGV 
Sbjct: 130 TQMKIAKEKFNCYVVGGSELISKIKNGEIEVDFDKAFATPDIVQELGS-VARILGPRGVF 188

Query: 196 PSLKKGTVSDDINSLLEESLGSMPFRQRGNSISLGVGKCYFSDREILQNIISARSAFKAA 255
           PS+KKGTVS+++  L++ +LGS+PFRQ GN IS+ +GKC FSDR+IL+N+IS R AFK +
Sbjct: 189 PSIKKGTVSENVEDLIKGNLGSIPFRQLGNCISVAIGKCNFSDRQILENLISVRKAFKDS 248

Query: 256 VNNQKSKKPNLLSKTTLSSTHGPGIVIDFA 285
           V+ QK+KKP++L KT LS+THGPGIVIDF+
Sbjct: 249 VSTQKTKKPSILGKTILSTTHGPGIVIDFS 278

>CAGL0B01815g Chr2 complement(165648..166520) [873 bp, 290 aa] {ON}
           similar to uniprot|Q04599 Saccharomyces cerevisiae
           YDR116c
          Length = 290

 Score =  305 bits (781), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 144/248 (58%), Positives = 202/248 (81%), Gaps = 6/248 (2%)

Query: 43  SLTKDQAKKRELKRLAQRKAEAKRPAATNPLYMPVTMALRYLRAAEVGRPQSQQTINLTT 102
           +LTK+QAKKRE+KRLA +KAEAK+PA  +PLYMP+ +ALRYLR+AEVGRP   QTI +TT
Sbjct: 42  TLTKEQAKKREMKRLALKKAEAKKPANIHPLYMPIPLALRYLRSAEVGRPTQHQTITVTT 101

Query: 103 LVVGERGTAPLSGSVTFPKPLRYIKVAAFTNDENKLEELRKKYPNH--LIGGADLVARIK 160
           LVV ++G A L+G++ FP PL+ +K+A F++++ KL+EL+ KY     + GG D++A IK
Sbjct: 102 LVVADKGNAALAGNILFPHPLKQMKIAIFSSNKEKLDELKSKYSKQVKIAGGEDMIADIK 161

Query: 161 SGEIPVD-FDKAFATPDIVPTLQSQVARILGPRGVLPSLKK---GTVSDDINSLLEESLG 216
           SG+I VD  +K FATP+I PT+ SQ+ R+LGP+G++P+LKK    TV +D++SL+EE+LG
Sbjct: 162 SGKIKVDGVNKVFATPEIFPTIASQLGRVLGPKGLMPNLKKQHQNTVGEDLDSLIEENLG 221

Query: 217 SMPFRQRGNSISLGVGKCYFSDREILQNIISARSAFKAAVNNQKSKKPNLLSKTTLSSTH 276
            + FRQRGNS+S+ VG+C FSDR+IL+NII+ R+AFK +V++Q +KKP++L KTT+S+T 
Sbjct: 222 QVSFRQRGNSLSVSVGRCNFSDRDILENIIAVRNAFKQSVSSQVAKKPSILGKTTISTTA 281

Query: 277 GPGIVIDF 284
           GPGIVIDF
Sbjct: 282 GPGIVIDF 289

>NDAI0J01330 Chr10 (309586..310530) [945 bp, 314 aa] {ON} Anc_8.268
           YDR116C
          Length = 314

 Score =  304 bits (779), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 144/261 (55%), Positives = 201/261 (77%), Gaps = 5/261 (1%)

Query: 29  AEEYKPTAMSSNAP-----SLTKDQAKKRELKRLAQRKAEAKRPAATNPLYMPVTMALRY 83
           A E K T   +N P      L+K+Q KKRE++RL+QRK +A++PA ++PLYM V  ALR+
Sbjct: 53  ASESKSTTSGTNMPPANATKLSKEQLKKREIRRLSQRKQQARQPANSHPLYMEVVDALRF 112

Query: 84  LRAAEVGRPQSQQTINLTTLVVGERGTAPLSGSVTFPKPLRYIKVAAFTNDENKLEELRK 143
           +RAAEVGRP+ QQTI LTTL+V E+GT+ L+G++   +PL+ +K+A F+ D+  LEE++ 
Sbjct: 113 IRAAEVGRPEGQQTITLTTLIVSEKGTSLLNGNMKLFRPLKELKIAVFSTDKELLEEVKS 172

Query: 144 KYPNHLIGGADLVARIKSGEIPVDFDKAFATPDIVPTLQSQVARILGPRGVLPSLKKGTV 203
           ++   L+GG + V  IK G I  +FD AFATP+IVP + SQ+ + LG RG+LP+ KKGTV
Sbjct: 173 QFNCQLVGGNETVEGIKDGTIRANFDVAFATPEIVPFINSQLGKQLGRRGILPNTKKGTV 232

Query: 204 SDDINSLLEESLGSMPFRQRGNSISLGVGKCYFSDREILQNIISARSAFKAAVNNQKSKK 263
           SDD+ +L+   +G++PF+Q GN+IS+ +GKCYFSD++IL NII+AR AFK A+ NQK+K+
Sbjct: 233 SDDLVTLMNAKMGNIPFKQTGNNISIPIGKCYFSDKDILLNIIAARDAFKEALANQKAKR 292

Query: 264 PNLLSKTTLSSTHGPGIVIDF 284
           P++LSKTTLSSTHGPGIVIDF
Sbjct: 293 PSILSKTTLSSTHGPGIVIDF 313

>AGR080W Chr7 (881213..882040) [828 bp, 275 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR116C (MRPL1)
          Length = 275

 Score =  300 bits (767), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 153/270 (56%), Positives = 210/270 (77%), Gaps = 6/270 (2%)

Query: 15  STRRCLSHTAKKLYAEEYKPTAMSSNAPSLTKDQAKKRELKRLAQRKAEAKRPAATNPLY 74
           S RR L  TA +L  E       ++ +  L+KDQ KKREL+RLAQRKA A+RPA+ +PLY
Sbjct: 10  SFRRGLHLTAVQLSQEA------AATSSKLSKDQLKKRELRRLAQRKAAARRPASASPLY 63

Query: 75  MPVTMALRYLRAAEVGRPQSQQTINLTTLVVGERGTAPLSGSVTFPKPLRYIKVAAFTND 134
           MPV  ALR+LRAAEVG+P +QQTI++ T+V+G++G A LSG+VT P P+R  KVA FTND
Sbjct: 64  MPVQQALRFLRAAEVGQPATQQTISVNTMVIGDKGAALLSGTVTLPSPMRETKVAVFTND 123

Query: 135 ENKLEELRKKYPNHLIGGADLVARIKSGEIPVDFDKAFATPDIVPTLQSQVARILGPRGV 194
             + E  R KY  +L+GGA+LV ++KSGE+ VDFDKAFATPDI P + +++ R+LGP+G+
Sbjct: 124 PEQAETARTKYGCYLVGGAELVEQLKSGEVKVDFDKAFATPDIAPLMAAKLGRVLGPKGL 183

Query: 195 LPSLKKGTVSDDINSLLEESLGSMPFRQRGNSISLGVGKCYFSDREILQNIISARSAFKA 254
           LPS+KKGTV+ D++ LL + + S PF+QR N ISL +GKC+FSDR+I++N+++ ++AF+A
Sbjct: 184 LPSVKKGTVAGDLSELLGDDINSTPFKQRNNCISLAIGKCHFSDRQIMENLLAVQAAFRA 243

Query: 255 AVNNQKSKKPNLLSKTTLSSTHGPGIVIDF 284
           A+ +QK+KK +L   TTL+STHGPGIVIDF
Sbjct: 244 AMTSQKTKKTSLFGTTTLTSTHGPGIVIDF 273

>Ecym_4302 Chr4 (646221..647048) [828 bp, 275 aa] {ON} similar to
           Ashbya gossypii AGR080W
          Length = 275

 Score =  291 bits (745), Expect = 2e-98,   Method: Compositional matrix adjust.
 Identities = 142/282 (50%), Positives = 207/282 (73%), Gaps = 13/282 (4%)

Query: 7   IPKICIASSTRRCLSHTAKKLYAEEYKPTAMSSNAPS----LTKDQAKKRELKRLAQRKA 62
            P+     + RR L+ T+ +  A         +N+PS    L+K+Q KK+EL+ L Q++A
Sbjct: 2   FPRCLKLVTVRRGLNFTSVRCAA---------NNSPSSTTKLSKEQMKKKELRALLQKRA 52

Query: 63  EAKRPAATNPLYMPVTMALRYLRAAEVGRPQSQQTINLTTLVVGERGTAPLSGSVTFPKP 122
            AK+    +PLYMPV  A R+LRAAEVG+P SQQTI+LTT+VV ++G   LSG++ FP P
Sbjct: 53  AAKKSPFEHPLYMPVQQAFRFLRAAEVGQPPSQQTISLTTVVVSDKGAPLLSGNILFPNP 112

Query: 123 LRYIKVAAFTNDENKLEELRKKYPNHLIGGADLVARIKSGEIPVDFDKAFATPDIVPTLQ 182
           LR +KVA FTN++ + E  R+++  HL+GG +L+  IK+G+ P+DFDKA ATPD+V  L 
Sbjct: 113 LRDVKVAVFTNNKEQEEVAREQFKCHLVGGTELIEAIKNGDTPIDFDKALATPDVVAQLT 172

Query: 183 SQVARILGPRGVLPSLKKGTVSDDINSLLEESLGSMPFRQRGNSISLGVGKCYFSDREIL 242
           SQ+A +LGPR +LP++KKGTVS++I +L+ E++ ++PFRQRG  +S+ VGKC FSD+++L
Sbjct: 173 SQLASVLGPRRLLPAVKKGTVSENIANLIRENMFTVPFRQRGPFLSVAVGKCDFSDKQLL 232

Query: 243 QNIISARSAFKAAVNNQKSKKPNLLSKTTLSSTHGPGIVIDF 284
           QNI++ + AFK A+ +Q+ KK ++L KTT++STHGPGIVIDF
Sbjct: 233 QNIVAVQKAFKQALADQQGKKSSILGKTTVTSTHGPGIVIDF 274

>KNAG0H03210 Chr8 (601470..602327) [858 bp, 285 aa] {ON} Anc_8.268
           YDR116C
          Length = 285

 Score =  281 bits (720), Expect = 1e-94,   Method: Compositional matrix adjust.
 Identities = 128/244 (52%), Positives = 186/244 (76%)

Query: 42  PSLTKDQAKKRELKRLAQRKAEAKRPAATNPLYMPVTMALRYLRAAEVGRPQSQQTINLT 101
           P LTK+Q ++REL+++ + K  AKRPA+ + +Y+ V  A+R LRA EVG+P SQQTI LT
Sbjct: 42  PKLTKEQLRRRELRKMIRSKMLAKRPASQDKVYLSVPEAMRILRAVEVGQPTSQQTITLT 101

Query: 102 TLVVGERGTAPLSGSVTFPKPLRYIKVAAFTNDENKLEELRKKYPNHLIGGADLVARIKS 161
           T+VV E+G  PL G V  P PL+ +++AAF+ D   L+ L+++    ++GGA+L+ ++KS
Sbjct: 102 TMVVSEKGVPPLHGDVVLPTPLKPVRIAAFSADPELLKRLQEEVELEIVGGAELIDQLKS 161

Query: 162 GEIPVDFDKAFATPDIVPTLQSQVARILGPRGVLPSLKKGTVSDDINSLLEESLGSMPFR 221
           GE+PV FDKAFATPDI P L S++  +LG RG+LP++KKGTV  D+ +++   +G+MPFR
Sbjct: 162 GEVPVQFDKAFATPDIAPQLNSKLGALLGRRGLLPNIKKGTVGPDLLAMIRSKVGAMPFR 221

Query: 222 QRGNSISLGVGKCYFSDREILQNIISARSAFKAAVNNQKSKKPNLLSKTTLSSTHGPGIV 281
           QR  +++ G+ KC+FSDR++L N+I+AR AF+ A+ NQKSKK ++L ++TLSSTHGPGIV
Sbjct: 222 QRAANLAFGIAKCHFSDRQVLGNLIAAREAFQLAIQNQKSKKRSILGRSTLSSTHGPGIV 281

Query: 282 IDFA 285
           ID A
Sbjct: 282 IDLA 285

>KAFR0B05480 Chr2 (1122727..1123569) [843 bp, 280 aa] {ON} Anc_8.268
           YDR116C
          Length = 280

 Score =  269 bits (688), Expect = 9e-90,   Method: Compositional matrix adjust.
 Identities = 134/261 (51%), Positives = 187/261 (71%), Gaps = 8/261 (3%)

Query: 26  KLYAEEYKPTAMSSNAPSLT-KDQAKKRELKRLAQRKAEAKRPAATNPLYMPVTMALRYL 84
           +L+ EE      +S APS T K QAKK+ L+   + + +A+ PA+ +PLYM V  ALR+L
Sbjct: 25  RLWLEE------ASVAPSKTNKQQAKKKMLRDFLRSRKQAREPASNHPLYMKVPDALRFL 78

Query: 85  RAAEVGRPQSQQTINLTTLVVGERGTAPLSGSVTFPKPLRYIKVAAFTNDENKLEELRKK 144
           RA EVG+P+SQQTI LTTLV+ E+G  P+ G+V  P PLR  KV   ++D  KLEE++  
Sbjct: 79  RAVEVGQPRSQQTITLTTLVISEKGVPPVYGNVQLPTPLRNSKVVVLSDDPKKLEEVQDN 138

Query: 145 YPN-HLIGGADLVARIKSGEIPVDFDKAFATPDIVPTLQSQVARILGPRGVLPSLKKGTV 203
           + N HL+GG +LV + K+ +I +DFDK  ATPDI+      + ++ GP+G+LP++KKGTV
Sbjct: 139 FKNVHLVGGRELVDKFKNEDIEIDFDKVVATPDILNYTNQNLGKMFGPKGLLPNVKKGTV 198

Query: 204 SDDINSLLEESLGSMPFRQRGNSISLGVGKCYFSDREILQNIISARSAFKAAVNNQKSKK 263
           S+++  L+ E++ SMPFRQR   ISLG+GK  FSD++IL+NII+ R AF   ++NQK+KK
Sbjct: 199 SENLIELMNENVSSMPFRQRAGCISLGIGKVEFSDKQILENIIATREAFLNTLSNQKTKK 258

Query: 264 PNLLSKTTLSSTHGPGIVIDF 284
            + L KTTL+STHGPGIVIDF
Sbjct: 259 QSTLGKTTLTSTHGPGIVIDF 279

>TBLA0I03190 Chr9 complement(768942..769667) [726 bp, 241 aa] {ON}
           Anc_8.268 YDR116C
          Length = 241

 Score =  187 bits (476), Expect = 3e-58,   Method: Compositional matrix adjust.
 Identities = 99/214 (46%), Positives = 138/214 (64%), Gaps = 2/214 (0%)

Query: 71  NPLYMPVTMALRYLRAAEVGRPQSQQTINLTTLVVGERGTAPLSGSVTFPKPLRYIKVAA 130
           +PL M V +ALRYLRA E GR  S+QT+ L T+V   RG  PL G + F   +R   +A 
Sbjct: 29  HPLKMEVPLALRYLRAIESGRKSSEQTVTLQTVVAAARGNTPLRGEINFHMLIRKPVIAV 88

Query: 131 FTNDENKLEELRKKYPNHLIGGADLVARIKSGEIPVDFDKAFATPDIVPTLQSQVARILG 190
           FT D  +  ++ K+    +IGG++L+ +I SGE  + F  AFAT D+V  L ++VA+ LG
Sbjct: 89  FTEDPEQ-HKIAKEMGIDIIGGSELIDKIASGEQKITFQTAFATTDMVQDL-ARVAQKLG 146

Query: 191 PRGVLPSLKKGTVSDDINSLLEESLGSMPFRQRGNSISLGVGKCYFSDREILQNIISARS 250
            + VLP LKK TV D+I  LL++ L  +PF ++ + IS  VGKC F+D EIL+N+I AR 
Sbjct: 147 KQKVLPQLKKKTVGDNIRELLQDKLYVVPFAEKASFISFPVGKCSFTDEEILRNLIKARE 206

Query: 251 AFKAAVNNQKSKKPNLLSKTTLSSTHGPGIVIDF 284
             + A+  Q +KKP+ + K TL+STHGPGI ID 
Sbjct: 207 GLQKALREQNNKKPSTIIKATLTSTHGPGIDIDL 240

>KAFR0E03440 Chr5 complement(684043..688692) [4650 bp, 1549 aa] {ON}
           Anc_5.500 YDR406W
          Length = 1549

 Score = 33.5 bits (75), Expect = 0.80,   Method: Compositional matrix adjust.
 Identities = 23/88 (26%), Positives = 42/88 (47%), Gaps = 2/88 (2%)

Query: 44  LTKDQAKKRELKRLAQRKAEAKRPAATNPLYMPVTMALRYLRAAEVGRPQSQQTINLTTL 103
           L KD  K +E  + +    ++ +  +T+P  +   M ++YL    + R ++  +I L   
Sbjct: 470 LNKDNVKNKEAMKESHIAKQSNKLRSTSPYVVNYGMQIKYLLTRNIWRMKNNPSITLFQ- 528

Query: 104 VVGERGTAPLSGSVTFPKPLRYIKVAAF 131
           V G  G A + GS+ F K + +   A F
Sbjct: 529 VFGNSGIAFILGSM-FYKVMLHTTTATF 555

>Skud_15.495 Chr15 (871539..876233) [4695 bp, 1564 aa] {ON} YOR328W
           (REAL)
          Length = 1564

 Score = 32.7 bits (73), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 25/93 (26%), Positives = 46/93 (49%), Gaps = 2/93 (2%)

Query: 27  LYAEEYKPTAMSSNAPSLTKDQAKKRELKRLAQRKAEAKRPAATNPLYMPVTMALRYLRA 86
           L +EEYK    +  +  L  D +++RE  R A    ++KR   ++P  +   M ++YL  
Sbjct: 472 LQSEEYKQL-QTQVSHHLGTDNSQQRERIRNAHVAKQSKRARPSSPYTVSFFMQVKYLLF 530

Query: 87  AEVGRPQSQQTINLTTLVVGERGTAPLSGSVTF 119
            +  R ++  +I L T V+     A + GS+ +
Sbjct: 531 RDFWRIKNDPSIQLFT-VLSHAAMALILGSMFY 562

>NDAI0C03060 Chr3 (696404..697654) [1251 bp, 416 aa] {ON} Anc_5.162
           YGR188C
          Length = 416

 Score = 32.3 bits (72), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 27/124 (21%), Positives = 50/124 (40%), Gaps = 8/124 (6%)

Query: 12  IASSTRRCLSHTAKKLYAEEYKPTAMSSNAPSLTK----DQAKKRELKRLAQRKAEAKRP 67
           I +  R  +  T  +L  E   P     +A  LTK    D+ +K+ +K+  +R+   +  
Sbjct: 5   IKNKKREIIDFTKIELEKENILPLRQGRSAEQLTKALEADEKEKKRIKKYYERRLIDELD 64

Query: 68  AATNPLYMPVTMALRYLRAAEVGRPQSQQTINLTTLVVGERGTAPLSGSVTFPKPLRYIK 127
              +PL     + L Y+ A     PQ   +     L + ER       S  +   +RY++
Sbjct: 65  TFDDPL----ALHLEYINAINNLYPQGASSKQSGMLEIIERCLMQFQNSEKYRNDIRYLE 120

Query: 128 VAAF 131
           +  +
Sbjct: 121 MWLW 124

>Smik_12.59 Chr12 (128051..129904) [1854 bp, 617 aa] {ON} YLL004W
           (REAL)
          Length = 617

 Score = 32.0 bits (71), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 31/121 (25%), Positives = 52/121 (42%), Gaps = 23/121 (19%)

Query: 145 YPNHLIGGADLVA-----------RIKSGEIPVDFDKAFA--------TPDIVPTLQSQV 185
           Y N LIG  D+             R+    I   F + F         T  I P+ +S +
Sbjct: 429 YHNLLIGKLDIYLDRWPACKEHKDRLHFEPIDTIFQELFTLDNKSGLLTQSIFPSYKSNL 488

Query: 186 A-RILGPRGVLPSLKK---GTVSDDINSLLEESLGSMPFRQRGNSISLGVGKCYFSDREI 241
              +L    VLPSL K   GT S+D+++++   +G +    R  ++++ +   Y + RE 
Sbjct: 489 EDNLLSWEQVLPSLNKEVNGTASEDLDNIMAPVVGQLFKLYREANMTINIYDFYTAFRET 548

Query: 242 L 242
           L
Sbjct: 549 L 549

>Kwal_27.11638 s27 (886806..888977) [2172 bp, 723 aa] {ON} YDL199C -
           Hypothetical ORF [contig 27] FULL
          Length = 723

 Score = 32.0 bits (71), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 28/103 (27%), Positives = 43/103 (41%), Gaps = 25/103 (24%)

Query: 23  TAKKLYAEEYKPTAMSSNAPSLTKDQAKKRELKRLAQRKAEAKRPAATNPLYMPVTMALR 82
           +A  L A+  +P  ++       KDQ+ KR+L+RL +R +E              T+ L 
Sbjct: 644 SANMLSADALEPPTLA-QVLEFKKDQSDKRDLRRLVRRGSE--------------TVGLF 688

Query: 83  YLRAAEVGRPQSQQTINLTTLVVGERGTAPLS-GSVTFPKPLR 124
           Y +    G+  +           GE GT P + G  T P P R
Sbjct: 689 YDKVVHFGKSSNNN---------GEYGTLPNNEGPTTGPAPSR 722

>YOR328W Chr15 (931803..936497) [4695 bp, 1564 aa] {ON}
           PDR10ATP-binding cassette (ABC) transporter, multidrug
           transporter involved in the pleiotropic drug resistance
           network; regulated by Pdr1p and Pdr3p
          Length = 1564

 Score = 31.6 bits (70), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 22/91 (24%), Positives = 46/91 (50%), Gaps = 2/91 (2%)

Query: 29  AEEYKPTAMSSNAPSLTKDQAKKRELKRLAQRKAEAKRPAATNPLYMPVTMALRYLRAAE 88
           +EEYK   +  N   L  D +++RE  + A    ++KR   ++P  +   + ++Y+   +
Sbjct: 474 SEEYKQLQVQVN-KHLDTDSSQQREQIKNAHIAKQSKRARPSSPYTVSFFLQVKYILIRD 532

Query: 89  VGRPQSQQTINLTTLVVGERGTAPLSGSVTF 119
           + R ++  +I L T V+     A + GS+ +
Sbjct: 533 IWRIKNDPSIQLFT-VLSHAAMALILGSMFY 562

>TBLA0D01780 Chr4 complement(438830..443617) [4788 bp, 1595 aa] {ON}
           Anc_5.500 YDR406W
          Length = 1595

 Score = 31.6 bits (70), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 23/88 (26%), Positives = 44/88 (50%), Gaps = 2/88 (2%)

Query: 44  LTKDQAKKRELKRLAQRKAEAKRPAATNPLYMPVTMALRYLRAAEVGRPQSQQTINLTTL 103
           L++D   KRE  + A    ++KR   ++P  +   + ++Y+    V R +    + L   
Sbjct: 546 LSEDTEVKREAIQNAHHAKQSKRARPSSPYTVSYGLQVKYILIRNVWRLKQSMEVPLFQ- 604

Query: 104 VVGERGTAPLSGSVTFPKPLRYIKVAAF 131
           V+G    A + GS+ F K L+++  A+F
Sbjct: 605 VIGNSIMAFILGSM-FYKILKHVTTASF 631

>NDAI0A04200 Chr1 complement(948224..952879) [4656 bp, 1551 aa] {ON}
           Anc_5.500
          Length = 1551

 Score = 30.8 bits (68), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 24/93 (25%), Positives = 45/93 (48%), Gaps = 2/93 (2%)

Query: 27  LYAEEYKPTAMSSNAPSLTKDQAKKRELKRLAQRKAEAKRPAATNPLYMPVTMALRYLRA 86
           L +E YK   M     SL ++  ++RE+ + A    ++KR   T+P  +   M ++Y+  
Sbjct: 449 LKSENYK-RLMEEIDESLKQNTDEQREVMKEAHIAKQSKRSRPTSPYVVSYMMQVKYILI 507

Query: 87  AEVGRPQSQQTINLTTLVVGERGTAPLSGSVTF 119
             + R ++  +I L   V G    A + GS+ +
Sbjct: 508 RNIWRIKNSSSITLFQ-VFGNSVMAFILGSMFY 539

>Ecym_7173 Chr7 complement(356629..357249) [621 bp, 206 aa] {ON}
           similar to Ashbya gossypii AGL327W
          Length = 206

 Score = 29.6 bits (65), Expect = 7.3,   Method: Compositional matrix adjust.
 Identities = 17/49 (34%), Positives = 25/49 (51%), Gaps = 2/49 (4%)

Query: 122 PLRYIKVAAFTNDENKLEELRKKYPNHLIGGADLVARIKSGEIPVDFDK 170
           P  YI  +   ND  KL +L    P H++  A+ + R+ S EI  D D+
Sbjct: 145 PYHYIYQS--YNDTLKLSQLNLSEPQHVLEDANSITRVSSTEIDEDDDR 191

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.315    0.131    0.362 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 28,687,110
Number of extensions: 1195436
Number of successful extensions: 4327
Number of sequences better than 10.0: 42
Number of HSP's gapped: 4446
Number of HSP's successfully gapped: 42
Length of query: 285
Length of database: 53,481,399
Length adjustment: 108
Effective length of query: 177
Effective length of database: 41,097,471
Effective search space: 7274252367
Effective search space used: 7274252367
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 65 (29.6 bits)