Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Smik_4.3598.267ON1051054583e-60
Suva_2.2748.267ON1051054244e-55
Skud_4.3758.267ON1051053933e-50
YDR115W8.267ON1051053742e-47
KAFR0B054908.267ON85762282e-25
NCAS0B038208.267ON115762284e-25
ZYRO0C01540g8.267ON97712274e-25
KLTH0G13574g8.267ON1121102284e-25
Kpol_543.428.267ON112502275e-25
TPHA0A017708.267ON104502251e-24
NDAI0J013408.267ON141522271e-24
TDEL0F039408.267ON110672223e-24
Kwal_56.237768.267ON130552224e-24
TBLA0E044708.267ON94522171e-23
SAKL0H16918g8.267ON111522172e-23
Ecym_43038.267ON109612145e-23
CAGL0B01793g8.267ON98532067e-22
AGR081C8.267ON130522061e-21
KLLA0F19250g8.267ON116602023e-21
KNAG0H032208.267ON86492004e-21
TDEL0H021407.230ON44846641.7
KAFR0G016703.339ON141978615.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Smik_4.359
         (105 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Smik_4.359 Chr4 (643476..643793) [318 bp, 105 aa] {ON} YDR115W (...   181   3e-60
Suva_2.274 Chr2 (476840..477157) [318 bp, 105 aa] {ON} YDR115W (...   167   4e-55
Skud_4.375 Chr4 (653818..654135) [318 bp, 105 aa] {ON} YDR115W (...   155   3e-50
YDR115W Chr4 (682175..682492) [318 bp, 105 aa] {ON} Putative mit...   148   2e-47
KAFR0B05490 Chr2 complement(1123665..1123922) [258 bp, 85 aa] {O...    92   2e-25
NCAS0B03820 Chr2 complement(681940..682287) [348 bp, 115 aa] {ON...    92   4e-25
ZYRO0C01540g Chr3 complement(110968..111261) [294 bp, 97 aa] {ON...    92   4e-25
KLTH0G13574g Chr7 complement(1164609..1164947) [339 bp, 112 aa] ...    92   4e-25
Kpol_543.42 s543 (92324..92662) [339 bp, 112 aa] {ON} (92324..92...    92   5e-25
TPHA0A01770 Chr1 complement(360221..360535) [315 bp, 104 aa] {ON...    91   1e-24
NDAI0J01340 Chr10 complement(310691..311116) [426 bp, 141 aa] {O...    92   1e-24
TDEL0F03940 Chr6 (732097..732429) [333 bp, 110 aa] {ON} Anc_8.26...    90   3e-24
Kwal_56.23776 s56 complement(701147..701539) [393 bp, 130 aa] {O...    90   4e-24
TBLA0E04470 Chr5 (1143613..1143897) [285 bp, 94 aa] {ON} Anc_8.2...    88   1e-23
SAKL0H16918g Chr8 complement(1487378..1487713) [336 bp, 111 aa] ...    88   2e-23
Ecym_4303 Chr4 complement(647272..647601) [330 bp, 109 aa] {ON} ...    87   5e-23
CAGL0B01793g Chr2 (165053..165349) [297 bp, 98 aa] {ON} some sim...    84   7e-22
AGR081C Chr7 complement(882207..882599) [393 bp, 130 aa] {ON} Sy...    84   1e-21
KLLA0F19250g Chr6 (1782824..1783174) [351 bp, 116 aa] {ON} simil...    82   3e-21
KNAG0H03220 Chr8 complement(602460..602720) [261 bp, 86 aa] {ON}...    82   4e-21
TDEL0H02140 Chr8 (364932..366278) [1347 bp, 448 aa] {ON} Anc_7.2...    29   1.7  
KAFR0G01670 Chr7 (363200..367459) [4260 bp, 1419 aa] {ON} Anc_3....    28   5.0  

>Smik_4.359 Chr4 (643476..643793) [318 bp, 105 aa] {ON} YDR115W
           (REAL)
          Length = 105

 Score =  181 bits (458), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 93/105 (88%), Positives = 93/105 (88%)

Query: 1   MTLFARLYQLQXXXXXXXXXXXXALTVLRPQTSMIMNSSPLKTMSLTTFGFGFIDQRRWK 60
           MTLFARLYQLQ            ALTVLRPQTSMIMNSSPLKTMSLTTFGFGFIDQRRWK
Sbjct: 1   MTLFARLYQLQSRRMISSISSFSALTVLRPQTSMIMNSSPLKTMSLTTFGFGFIDQRRWK 60

Query: 61  SRGNTYQPSTLKRKRTFGFLARAKSKQGSKILKRRKLKGRWFLSH 105
           SRGNTYQPSTLKRKRTFGFLARAKSKQGSKILKRRKLKGRWFLSH
Sbjct: 61  SRGNTYQPSTLKRKRTFGFLARAKSKQGSKILKRRKLKGRWFLSH 105

>Suva_2.274 Chr2 (476840..477157) [318 bp, 105 aa] {ON} YDR115W
           (REAL)
          Length = 105

 Score =  167 bits (424), Expect = 4e-55,   Method: Compositional matrix adjust.
 Identities = 85/105 (80%), Positives = 89/105 (84%)

Query: 1   MTLFARLYQLQXXXXXXXXXXXXALTVLRPQTSMIMNSSPLKTMSLTTFGFGFIDQRRWK 60
           M+LF RLYQ Q            AL+VLRPQTSM++NSSPLKTMSLT FGFGFI QRRWK
Sbjct: 1   MSLFGRLYQFQSRRMFSSISPISALSVLRPQTSMLLNSSPLKTMSLTPFGFGFIGQRRWK 60

Query: 61  SRGNTYQPSTLKRKRTFGFLARAKSKQGSKILKRRKLKGRWFLSH 105
           SRGNTYQPSTLKRKRTFGFLARAKSKQGSKILKRRKLKGRWFLSH
Sbjct: 61  SRGNTYQPSTLKRKRTFGFLARAKSKQGSKILKRRKLKGRWFLSH 105

>Skud_4.375 Chr4 (653818..654135) [318 bp, 105 aa] {ON} YDR115W
           (REAL)
          Length = 105

 Score =  155 bits (393), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 81/105 (77%), Positives = 86/105 (81%)

Query: 1   MTLFARLYQLQXXXXXXXXXXXXALTVLRPQTSMIMNSSPLKTMSLTTFGFGFIDQRRWK 60
           MTL   LYQLQ            AL+VLRPQ+SM++NS P+KTMSLT  GFGFI QRRWK
Sbjct: 1   MTLLTSLYQLQSKRMLSSISSFSALSVLRPQSSMLLNSPPMKTMSLTALGFGFIGQRRWK 60

Query: 61  SRGNTYQPSTLKRKRTFGFLARAKSKQGSKILKRRKLKGRWFLSH 105
           SRGNTYQPSTLKRKRTFGFLARAKSKQGSKILKRRKLKGRWFLSH
Sbjct: 61  SRGNTYQPSTLKRKRTFGFLARAKSKQGSKILKRRKLKGRWFLSH 105

>YDR115W Chr4 (682175..682492) [318 bp, 105 aa] {ON} Putative
           mitochondrial ribosomal protein of the large subunit,
           has similarity to E. coli L34 ribosomal protein;
           required for respiratory growth, as are most
           mitochondrial ribosomal proteins
          Length = 105

 Score =  148 bits (374), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 80/105 (76%), Positives = 83/105 (79%)

Query: 1   MTLFARLYQLQXXXXXXXXXXXXALTVLRPQTSMIMNSSPLKTMSLTTFGFGFIDQRRWK 60
           M LFARL Q Q            AL+VLRPQT M++NSSPLKT S T  GFG I QRRWK
Sbjct: 1   MPLFARLCQPQSRRMFSSISSFSALSVLRPQTGMLLNSSPLKTPSFTPLGFGLIGQRRWK 60

Query: 61  SRGNTYQPSTLKRKRTFGFLARAKSKQGSKILKRRKLKGRWFLSH 105
           SRGNTYQPSTLKRKRTFGFLARAKSKQGSKILKRRKLKGRWFLSH
Sbjct: 61  SRGNTYQPSTLKRKRTFGFLARAKSKQGSKILKRRKLKGRWFLSH 105

>KAFR0B05490 Chr2 complement(1123665..1123922) [258 bp, 85 aa] {ON}
           Anc_8.267 YDR115W
          Length = 85

 Score = 92.4 bits (228), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 50/76 (65%), Positives = 56/76 (73%), Gaps = 7/76 (9%)

Query: 37  NSSPLKTMSLTT-------FGFGFIDQRRWKSRGNTYQPSTLKRKRTFGFLARAKSKQGS 89
           N+S  K++ L T       F   F  Q+RWKSRGNTYQPSTLKRKR FGFL+RAKSKQ S
Sbjct: 10  NTSIFKSVILNTVQSTNVFFILPFFGQKRWKSRGNTYQPSTLKRKRKFGFLSRAKSKQKS 69

Query: 90  KILKRRKLKGRWFLSH 105
           KILK RK KGRW+LSH
Sbjct: 70  KILKDRKEKGRWYLSH 85

>NCAS0B03820 Chr2 complement(681940..682287) [348 bp, 115 aa] {ON}
           Anc_8.267 YDR115W
          Length = 115

 Score = 92.4 bits (228), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 49/76 (64%), Positives = 58/76 (76%), Gaps = 4/76 (5%)

Query: 30  PQTSMIMNSSPLKTMSLTTFGFGFIDQRRWKSRGNTYQPSTLKRKRTFGFLARAKSKQGS 89
           P  S +++ SP+   SL  FG   I QRRWKSRGNTYQPSTLKRKR FGFLA+A+  Q  
Sbjct: 44  PMGSNVLSQSPMMG-SLLPFG---ILQRRWKSRGNTYQPSTLKRKRKFGFLAKARDSQKC 99

Query: 90  KILKRRKLKGRWFLSH 105
           KILKRR+LKGRW+L+H
Sbjct: 100 KILKRRRLKGRWYLTH 115

>ZYRO0C01540g Chr3 complement(110968..111261) [294 bp, 97 aa] {ON}
           similar to uniprot|Q04598 Saccharomyces cerevisiae
           YDR115W
          Length = 97

 Score = 92.0 bits (227), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 49/71 (69%), Positives = 57/71 (80%), Gaps = 7/71 (9%)

Query: 35  IMNSSPLKTMSLTTFGFGFIDQRRWKSRGNTYQPSTLKRKRTFGFLARAKSKQGSKILKR 94
           ++  SPL +      GFG + QRRWKSRGNT+QPSTLKRKR  GFLARA+SKQGSKIL+R
Sbjct: 34  LLGPSPLSS------GFG-MGQRRWKSRGNTFQPSTLKRKRRVGFLARARSKQGSKILQR 86

Query: 95  RKLKGRWFLSH 105
           RK KGRWFL+H
Sbjct: 87  RKHKGRWFLTH 97

>KLTH0G13574g Chr7 complement(1164609..1164947) [339 bp, 112 aa]
           {ON} some similarities with uniprot|Q04598 Saccharomyces
           cerevisiae YDR115W
          Length = 112

 Score = 92.4 bits (228), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 52/110 (47%), Positives = 67/110 (60%), Gaps = 8/110 (7%)

Query: 3   LFARLYQLQXXXXXXXXXXXXALTVLRPQTSMIMNSSPLK-------TMSLTTFGFGFID 55
           ++ RL+Q               L  +  + S+   ++P+        +  L +  FGF  
Sbjct: 4   IYNRLFQFSARRSLSSLSSFSPLNAVSCRPSVFQAAAPMAAERSSQGSSPLFSALFGFT- 62

Query: 56  QRRWKSRGNTYQPSTLKRKRTFGFLARAKSKQGSKILKRRKLKGRWFLSH 105
           QRRWKSRGNTYQPSTLKRKR  GFLARAKSKQG K+LKRR+ KGRW+L+H
Sbjct: 63  QRRWKSRGNTYQPSTLKRKRRVGFLARAKSKQGYKVLKRRREKGRWYLTH 112

>Kpol_543.42 s543 (92324..92662) [339 bp, 112 aa] {ON}
           (92324..92662) [339 nt, 113 aa]
          Length = 112

 Score = 92.0 bits (227), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 43/50 (86%), Positives = 47/50 (94%)

Query: 56  QRRWKSRGNTYQPSTLKRKRTFGFLARAKSKQGSKILKRRKLKGRWFLSH 105
           QRRWKSRGNTYQPSTLKRKR FGFLARA+S+ GSKIL+RRK KGRW+LSH
Sbjct: 63  QRRWKSRGNTYQPSTLKRKRKFGFLARARSRSGSKILERRKAKGRWYLSH 112

>TPHA0A01770 Chr1 complement(360221..360535) [315 bp, 104 aa] {ON}
           Anc_8.267 YDR115W
          Length = 104

 Score = 91.3 bits (225), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 42/50 (84%), Positives = 47/50 (94%)

Query: 56  QRRWKSRGNTYQPSTLKRKRTFGFLARAKSKQGSKILKRRKLKGRWFLSH 105
           QRRWKSRGNTYQPSTLKRKR  GFLARA+SKQG+KIL+RRK KGRW+L+H
Sbjct: 55  QRRWKSRGNTYQPSTLKRKRRIGFLARARSKQGNKILERRKAKGRWYLTH 104

>NDAI0J01340 Chr10 complement(310691..311116) [426 bp, 141 aa] {ON}
           Anc_8.267 YDR115W
          Length = 141

 Score = 92.0 bits (227), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 42/52 (80%), Positives = 48/52 (92%)

Query: 54  IDQRRWKSRGNTYQPSTLKRKRTFGFLARAKSKQGSKILKRRKLKGRWFLSH 105
           I+Q+RWKSRGNTYQPSTLKRKR +GFL+R + +Q SKILKRRKLKGRWFLSH
Sbjct: 90  INQKRWKSRGNTYQPSTLKRKRKYGFLSRMRDRQASKILKRRKLKGRWFLSH 141

>TDEL0F03940 Chr6 (732097..732429) [333 bp, 110 aa] {ON} Anc_8.267
           YDR115W
          Length = 110

 Score = 90.1 bits (222), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 47/67 (70%), Positives = 57/67 (85%), Gaps = 2/67 (2%)

Query: 39  SPLKTMSLTTFGFGFIDQRRWKSRGNTYQPSTLKRKRTFGFLARAKSKQGSKILKRRKLK 98
           SPL ++SL  F FG I QRRWKSRGNT+QPSTLKRKR  GFLARA+SK GS++L+RRK K
Sbjct: 46  SPLSSISLL-FPFG-IMQRRWKSRGNTFQPSTLKRKRRIGFLARARSKTGSRVLQRRKAK 103

Query: 99  GRWFLSH 105
           GRW+L++
Sbjct: 104 GRWYLTY 110

>Kwal_56.23776 s56 complement(701147..701539) [393 bp, 130 aa] {ON}
           YDR115W - Hypothetical ORF [contig 173] FULL
          Length = 130

 Score = 90.1 bits (222), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 44/55 (80%), Positives = 49/55 (89%), Gaps = 1/55 (1%)

Query: 51  FGFIDQRRWKSRGNTYQPSTLKRKRTFGFLARAKSKQGSKILKRRKLKGRWFLSH 105
           FG + Q+RWKSRGNTYQPSTLKRKR  GFLAR KSKQGSKILKRR+ KGRW+L+H
Sbjct: 77  FG-LTQKRWKSRGNTYQPSTLKRKRRVGFLARVKSKQGSKILKRRREKGRWYLTH 130

>TBLA0E04470 Chr5 (1143613..1143897) [285 bp, 94 aa] {ON} Anc_8.267
           YDR115W
          Length = 94

 Score = 88.2 bits (217), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 43/52 (82%), Positives = 45/52 (86%)

Query: 54  IDQRRWKSRGNTYQPSTLKRKRTFGFLARAKSKQGSKILKRRKLKGRWFLSH 105
           ID RRWKSRGNTYQPSTLKRKR  GFL+RAKS   +KILKRRK KGRWFLSH
Sbjct: 43  IDSRRWKSRGNTYQPSTLKRKRKHGFLSRAKSYTMNKILKRRKAKGRWFLSH 94

>SAKL0H16918g Chr8 complement(1487378..1487713) [336 bp, 111 aa]
           {ON} similar to uniprot|Q04598 Saccharomyces cerevisiae
           YDR115W
          Length = 111

 Score = 88.2 bits (217), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 42/52 (80%), Positives = 46/52 (88%)

Query: 54  IDQRRWKSRGNTYQPSTLKRKRTFGFLARAKSKQGSKILKRRKLKGRWFLSH 105
           + QRRWKSRGNTYQPSTLKRKR  GFLARAK+KQ SKILK RK KGRW+L+H
Sbjct: 60  LTQRRWKSRGNTYQPSTLKRKRRVGFLARAKNKQASKILKSRKEKGRWYLTH 111

>Ecym_4303 Chr4 complement(647272..647601) [330 bp, 109 aa] {ON}
           similar to Ashbya gossypii AGR081C
          Length = 109

 Score = 87.0 bits (214), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 43/61 (70%), Positives = 52/61 (85%), Gaps = 1/61 (1%)

Query: 45  SLTTFGFGFIDQRRWKSRGNTYQPSTLKRKRTFGFLARAKSKQGSKILKRRKLKGRWFLS 104
           S+ +  FG ++QRRWKSRGNT+QPSTLKRKR  GFLARA+SK G KILKRRK KGRW+L+
Sbjct: 50  SVISLVFG-LNQRRWKSRGNTFQPSTLKRKRRVGFLARARSKTGQKILKRRKEKGRWYLT 108

Query: 105 H 105
           +
Sbjct: 109 Y 109

>CAGL0B01793g Chr2 (165053..165349) [297 bp, 98 aa] {ON} some
           similarities with uniprot|Q04598 Saccharomyces
           cerevisiae YDR115w
          Length = 98

 Score = 84.0 bits (206), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 40/53 (75%), Positives = 46/53 (86%)

Query: 53  FIDQRRWKSRGNTYQPSTLKRKRTFGFLARAKSKQGSKILKRRKLKGRWFLSH 105
           F  QRRWKSRGNTYQPSTLKRKR FGFLAR  +K+ +KI+KRRK KGRW+L+H
Sbjct: 46  FPLQRRWKSRGNTYQPSTLKRKRKFGFLARMTNKRTAKIIKRRKEKGRWYLTH 98

>AGR081C Chr7 complement(882207..882599) [393 bp, 130 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR115W
          Length = 130

 Score = 84.0 bits (206), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 38/52 (73%), Positives = 45/52 (86%)

Query: 54  IDQRRWKSRGNTYQPSTLKRKRTFGFLARAKSKQGSKILKRRKLKGRWFLSH 105
           + Q+RWKSRGNTYQPSTLKRKR  GFLARA+S+ G  ILKRR+ KGRW+L+H
Sbjct: 79  LTQKRWKSRGNTYQPSTLKRKRRVGFLARARSRTGRNILKRRREKGRWYLTH 130

>KLLA0F19250g Chr6 (1782824..1783174) [351 bp, 116 aa] {ON} similar
           to uniprot|Q04598 Saccharomyces cerevisiae YDR115W
          Length = 116

 Score = 82.4 bits (202), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 41/60 (68%), Positives = 50/60 (83%), Gaps = 1/60 (1%)

Query: 47  TTFGFGF-IDQRRWKSRGNTYQPSTLKRKRTFGFLARAKSKQGSKILKRRKLKGRWFLSH 105
           + FG  F + QRRWKSRGNT+QPSTLKRKR  GFLARA+S+ G +ILKRRK KGRW+L++
Sbjct: 57  SIFGMLFDLTQRRWKSRGNTFQPSTLKRKRRVGFLARARSRSGQQILKRRKNKGRWYLTY 116

>KNAG0H03220 Chr8 complement(602460..602720) [261 bp, 86 aa] {ON}
           Anc_8.267 YDR115W
          Length = 86

 Score = 81.6 bits (200), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 39/49 (79%), Positives = 43/49 (87%)

Query: 57  RRWKSRGNTYQPSTLKRKRTFGFLARAKSKQGSKILKRRKLKGRWFLSH 105
           RRWKSRGNTYQPSTLKRKR FGFLAR ++   SK+LKRRK KGRW+LSH
Sbjct: 38  RRWKSRGNTYQPSTLKRKRKFGFLARVRASFRSKVLKRRKEKGRWYLSH 86

>TDEL0H02140 Chr8 (364932..366278) [1347 bp, 448 aa] {ON} Anc_7.230
           YER054C
          Length = 448

 Score = 29.3 bits (64), Expect = 1.7,   Method: Composition-based stats.
 Identities = 16/46 (34%), Positives = 23/46 (50%)

Query: 26  TVLRPQTSMIMNSSPLKTMSLTTFGFGFIDQRRWKSRGNTYQPSTL 71
           T L P   ++ N++  K +S  T+G G+   RR  S GN Y    L
Sbjct: 61  TNLFPDEEILKNTNLNKKLSTETYGGGYSPTRRQGSNGNLYSDEQL 106

>KAFR0G01670 Chr7 (363200..367459) [4260 bp, 1419 aa] {ON} Anc_3.339
           YBR097W
          Length = 1419

 Score = 28.1 bits (61), Expect = 5.0,   Method: Composition-based stats.
 Identities = 20/78 (25%), Positives = 34/78 (43%), Gaps = 10/78 (12%)

Query: 29  RPQTSMIMNSSPLKTMSLTTFG---------FGFIDQRRWKSRGNTYQPSTLKRKRTFGF 79
           RP TS  ++ +    +SL+TF            F+++R  +S  N+        K+ FG 
Sbjct: 869 RPDTSFSIDGNDKNQLSLSTFNILPRTVFFEIDFVEERTQQSIDNSNMDKAKANKKMFG- 927

Query: 80  LARAKSKQGSKILKRRKL 97
           L    +  GS I K + +
Sbjct: 928 LPPVTALHGSLIFKAKSM 945

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.326    0.134    0.400 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 8,742,449
Number of extensions: 294457
Number of successful extensions: 826
Number of sequences better than 10.0: 24
Number of HSP's gapped: 826
Number of HSP's successfully gapped: 24
Length of query: 105
Length of database: 53,481,399
Length adjustment: 75
Effective length of query: 30
Effective length of database: 44,881,449
Effective search space: 1346443470
Effective search space used: 1346443470
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 59 (27.3 bits)