Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Smik_4.3588.265ON37135717750.0
YDR113C (PDS1)8.265ON37335613360.0
Skud_4.3748.265ON37335912871e-178
Suva_2.2738.265ON37636212521e-172
TDEL0F039208.265ON3223244112e-46
SAKL0H16962g8.265ON3363433335e-35
NCAS0B038308.265ON3253523212e-33
ZYRO0C01584g8.265ON2823412798e-28
Kpol_543.418.265ON3063082316e-21
KLTH0G13618g8.265ON3023192272e-20
NDAI0J013508.265ON4223011852e-14
TPHA0A017808.265ON3523481824e-14
AGR083W8.265ON2953201795e-14
Ecym_43058.265ON3113221682e-12
Kwal_56.237818.265ON2932981644e-12
KLLA0F19206g8.265ON2632131626e-12
KNAG0H032308.265ON2812981582e-11
KAFR0B055108.265ON2752761502e-10
CAGL0L12298g8.265ON2863431282e-07
NOTE: 1 genes in the same pillar as Smik_4.358 were not hit in these BLAST results
LIST: TBLA0E04460

BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Smik_4.358
         (371 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Smik_4.358 Chr4 complement(641799..642914) [1116 bp, 371 aa] {ON...   688   0.0  
YDR113C Chr4 complement(680496..681617) [1122 bp, 373 aa] {ON}  ...   519   0.0  
Skud_4.374 Chr4 complement(652139..653260) [1122 bp, 373 aa] {ON...   500   e-178
Suva_2.273 Chr2 complement(475164..476294) [1131 bp, 376 aa] {ON...   486   e-172
TDEL0F03920 Chr6 complement(729845..730813) [969 bp, 322 aa] {ON...   162   2e-46
SAKL0H16962g Chr8 (1489800..1490810) [1011 bp, 336 aa] {ON} weak...   132   5e-35
NCAS0B03830 Chr2 (682538..683515) [978 bp, 325 aa] {ON} Anc_8.26...   128   2e-33
ZYRO0C01584g Chr3 (112438..113286) [849 bp, 282 aa] {ON} weakly ...   112   8e-28
Kpol_543.41 s543 complement(90836..91756) [921 bp, 306 aa] {ON} ...    94   6e-21
KLTH0G13618g Chr7 (1166359..1167267) [909 bp, 302 aa] {ON} weakl...    92   2e-20
NDAI0J01350 Chr10 (311490..312758) [1269 bp, 422 aa] {ON} Anc_8....    76   2e-14
TPHA0A01780 Chr1 (361017..362075) [1059 bp, 352 aa] {ON} Anc_8.2...    75   4e-14
AGR083W Chr7 (883948..884835) [888 bp, 295 aa] {ON} Syntenic hom...    74   5e-14
Ecym_4305 Chr4 (649254..650189) [936 bp, 311 aa] {ON} similar to...    69   2e-12
Kwal_56.23781 s56 (702900..703781) [882 bp, 293 aa] {ON} YDR113C...    68   4e-12
KLLA0F19206g Chr6 complement(1780093..1780884) [792 bp, 263 aa] ...    67   6e-12
KNAG0H03230 Chr8 (602896..603741) [846 bp, 281 aa] {ON} Anc_8.26...    65   2e-11
KAFR0B05510 Chr2 (1128895..1129722) [828 bp, 275 aa] {ON} Anc_8....    62   2e-10
CAGL0L12298g Chr12 complement(1331112..1331972) [861 bp, 286 aa]...    54   2e-07

>Smik_4.358 Chr4 complement(641799..642914) [1116 bp, 371 aa] {ON}
           YDR113C (REAL)
          Length = 371

 Score =  688 bits (1775), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 343/357 (96%), Positives = 343/357 (96%)

Query: 1   MPANEDKENNIVYSGNGSSNLNFPQTPAHLLKRSHSNVLKPPTRLDQLKKDVNSNNCNAL 60
           MPANEDKENNIVYSGNGSSNLNFPQTPAHLLKRSHSNVLKPPTRLDQLKKDVNSNNCNAL
Sbjct: 1   MPANEDKENNIVYSGNGSSNLNFPQTPAHLLKRSHSNVLKPPTRLDQLKKDVNSNNCNAL 60

Query: 61  KYIQGGKEVSPTKRLHTHAQQQGRLPLAAKDNNRAKSFIFIPENSNQSKDADIIPQQQNT 120
           KYIQGGKEVSPTKRLHTHAQQQGRLPLAAKDNNRAKSFIFIPENSNQSKDADIIPQQQNT
Sbjct: 61  KYIQGGKEVSPTKRLHTHAQQQGRLPLAAKDNNRAKSFIFIPENSNQSKDADIIPQQQNT 120

Query: 121 LSIRKNDQLRKLSQISRNRNRVNHSDLLNNTRKLQKYGSVLGYNALPKMKSLVLKDLVDP 180
           LSIRKNDQLRKLSQISRNRNRVNHSDLLNNTRKLQKYGSVLGYNALPKMKSLVLKDLVDP
Sbjct: 121 LSIRKNDQLRKLSQISRNRNRVNHSDLLNNTRKLQKYGSVLGYNALPKMKSLVLKDLVDP 180

Query: 181 GKNXXXXXXXXXXXXXXNKLSKKLQNALLQQHSSDDEHEFSGDIGLFNNQGGLQQLIKNS 240
           GKN              NKLSKKLQNALLQQHSSDDEHEFSGDIGLFNNQGGLQQLIKNS
Sbjct: 181 GKNEESSDDDDGSEGSENKLSKKLQNALLQQHSSDDEHEFSGDIGLFNNQGGLQQLIKNS 240

Query: 241 VQNESKSKSDNADGYEIEIAPQRLDPLPYVPDGYSPFRQEDIQKLKSFNSPYELDLEDDG 300
           VQNESKSKSDNADGYEIEIAPQRLDPLPYVPDGYSPFRQEDIQKLKSFNSPYELDLEDDG
Sbjct: 241 VQNESKSKSDNADGYEIEIAPQRLDPLPYVPDGYSPFRQEDIQKLKSFNSPYELDLEDDG 300

Query: 301 GSTDKVDLLPLEAINEESEQDEIVHIAGDREEGTPLPLLSKNLRKITAIPTIESLCN 357
           GSTDKVDLLPLEAINEESEQDEIVHIAGDREEGTPLPLLSKNLRKITAIPTIESLCN
Sbjct: 301 GSTDKVDLLPLEAINEESEQDEIVHIAGDREEGTPLPLLSKNLRKITAIPTIESLCN 357

>YDR113C Chr4 complement(680496..681617) [1122 bp, 373 aa] {ON}
           PDS1Securin, inhibits anaphase by binding separin Esp1p;
           blocks cyclin destruction and mitotic exit, essential
           for meiotic progression and mitotic cell cycle arrest;
           localization is cell-cycle dependent and regulated by
           Cdc28p phosphorylation
          Length = 373

 Score =  519 bits (1336), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 262/356 (73%), Positives = 300/356 (84%), Gaps = 5/356 (1%)

Query: 1   MPANEDKENNIVYSGNGSSNLNFPQTPAHLLKRSHSNVLKPPTRLDQLKKDVNSNNCNAL 60
           MPANEDKENNIVY+GN SS +NFPQTPAHLLKRSHSN+LKPP RLDQLK+D NSNN N L
Sbjct: 2   MPANEDKENNIVYTGNESSGINFPQTPAHLLKRSHSNILKPPVRLDQLKRDANSNNGNTL 61

Query: 61  KYIQGGKEVSPTKRLHTHAQQQGRLPLAAKDNNRAKSFIFIPENSNQSKDADIIPQQQNT 120
           KYIQGGKEVSPTKRLHTHAQQQGRLPLAAKDNNR+KSFIF PE SNQSKDAD+ PQ QNT
Sbjct: 62  KYIQGGKEVSPTKRLHTHAQQQGRLPLAAKDNNRSKSFIF-PETSNQSKDADL-PQLQNT 119

Query: 121 LSIRKNDQLRKLSQISRNRNRVNHSDLLNNTRKLQKYGSVLGYNALPKMKSLVLKDLVDP 180
           LSIRKNDQLRKLSQISR+R+R NH+DLL+N+RKLQKYGSVLGYNALPKMKSLVLKDL D 
Sbjct: 120 LSIRKNDQLRKLSQISRSRSRANHNDLLSNSRKLQKYGSVLGYNALPKMKSLVLKDLADS 179

Query: 181 GKNXXXXXXXXXXXXXXNKLSKKLQNALLQQHSSDDEHEFSGDIGLFNNQGGLQQLIKNS 240
           GKN              +KL KKLQ+ALL+Q SSD E+E +G +GLFN QGGLQQLIKNS
Sbjct: 180 GKNEESSDDDEGNEDSESKLGKKLQSALLKQDSSDGENELNGGLGLFNEQGGLQQLIKNS 239

Query: 241 VQNESKS---KSDNADGYEIEIAPQRLDPLPYVPDGYSPFRQEDIQKLKSFNSPYELDLE 297
            +NE K+   KSD  D Y+IEIAPQR +PLPYVP+GYSPF+Q+DI+KLK+FNSPY+LDLE
Sbjct: 240 TKNEQKTKNDKSDKTDDYDIEIAPQRQEPLPYVPEGYSPFQQDDIEKLKTFNSPYKLDLE 299

Query: 298 DDGGSTDKVDLLPLEAINEESEQDEIVHIAGDREEGTPLPLLSKNLRKITAIPTIE 353
           D+  + DKVDLLPLE I+EE E+DE   I  ++EEG  LPLLSKN +++ A+PT+E
Sbjct: 300 DEDDTPDKVDLLPLEQIDEEGEKDETECITRNQEEGAALPLLSKNFKEVAAVPTME 355

>Skud_4.374 Chr4 complement(652139..653260) [1122 bp, 373 aa] {ON}
           YDR113C (REAL)
          Length = 373

 Score =  500 bits (1287), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 260/359 (72%), Positives = 293/359 (81%), Gaps = 2/359 (0%)

Query: 1   MPANEDKENNIVYSGNGSSNLNFPQTPAHLLKRSHSNVLKPPTRLDQLKKDVNSNNCNAL 60
           MPANEDKENNIVY+GN SS +NFPQTPAHLLKRSHSNVLKPP RLDQLKKD+NSNN   L
Sbjct: 1   MPANEDKENNIVYTGNESSGINFPQTPAHLLKRSHSNVLKPPVRLDQLKKDLNSNNGKGL 60

Query: 61  KYIQGGKEVSPTKRLHTHAQQQGRLPLAAKDNNRAKSFIFIPENSNQSKDADIIPQQQNT 120
           KYIQGGKEVSPTKRLHTHAQQQGRLPLAAKDNNR+KSF+F+ E +N SKD++ IPQQQNT
Sbjct: 61  KYIQGGKEVSPTKRLHTHAQQQGRLPLAAKDNNRSKSFVFVSETTNLSKDSEAIPQQQNT 120

Query: 121 LSIRKNDQLRKLSQISRNRNRVNHSDLLNNTRKLQKYGSVLGYNALPKMKSLVLKDLVDP 180
           LSIRKNDQLR+LSQISRNR R N+++LLNN+RKLQKYGSVLGYNALPKMKSLVLKDL  P
Sbjct: 121 LSIRKNDQLRQLSQISRNRTRANYNELLNNSRKLQKYGSVLGYNALPKMKSLVLKDLAGP 180

Query: 181 GKNXXXXXXXXXXXXXXNKLSKKLQNALLQQHSSDDEHEFSGDIGLFNNQGGLQQLIKNS 240
            KN              +KL  KLQNA LQQHSSDDEHE +GDIGLFNNQGGLQQLIKN+
Sbjct: 181 AKNQESSDDDDGSEGPESKLGVKLQNAFLQQHSSDDEHESNGDIGLFNNQGGLQQLIKNT 240

Query: 241 VQNE--SKSKSDNADGYEIEIAPQRLDPLPYVPDGYSPFRQEDIQKLKSFNSPYELDLED 298
            + +  SK + D+ D YEIEIAPQR +PLPYVPDGY  F++EDI+KL++FNSPYELDLED
Sbjct: 241 TKGKQGSKEEDDDDDDYEIEIAPQRQEPLPYVPDGYPSFQREDIEKLRTFNSPYELDLED 300

Query: 299 DGGSTDKVDLLPLEAINEESEQDEIVHIAGDREEGTPLPLLSKNLRKITAIPTIESLCN 357
            G S D+V LL LE I+EE+EQD   H  GD E     PLLSK L++ TA PTI  LC+
Sbjct: 301 HGDSVDRVGLLSLEVIDEEAEQDGTAHTTGDPEACAAPPLLSKRLKEGTASPTINLLCS 359

>Suva_2.273 Chr2 complement(475164..476294) [1131 bp, 376 aa] {ON}
           YDR113C (REAL)
          Length = 376

 Score =  486 bits (1252), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 249/362 (68%), Positives = 285/362 (78%), Gaps = 5/362 (1%)

Query: 1   MPANEDKENNIVYSGNGSSNLNFPQTPAHLLKRSHSNVLKPPTRLDQLKKDVNSNNCNAL 60
           MPANEDKENNIVY+GN SS+ +FPQTPAHLLKRSHSNVLKPP RLDQLKKDVNSN+   L
Sbjct: 1   MPANEDKENNIVYTGNESSSTSFPQTPAHLLKRSHSNVLKPPVRLDQLKKDVNSNSGKNL 60

Query: 61  KYIQGGKEVSPTKRLHTHAQQQGRLPLAAKDNNRAKSFIFIPENSNQSKDADIIPQQQNT 120
           KYIQGGKEVSPTKRLHTH Q QGRLPLAAKDNNR+KSF+F  E +NQ+KDA+I+PQQQNT
Sbjct: 61  KYIQGGKEVSPTKRLHTHTQPQGRLPLAAKDNNRSKSFVFALETANQNKDAEIVPQQQNT 120

Query: 121 LSIRKNDQLRKLSQISRNRNRVNHSDLLNNTRKLQKYGSVLGYNALPKMKSLVLKDLVDP 180
           LS RKNDQLRKLSQ+SRNRNR N++ +LNN+RKLQKYGSVLGYNALPKMKSLVLKDL DP
Sbjct: 121 LSTRKNDQLRKLSQVSRNRNRGNYNGMLNNSRKLQKYGSVLGYNALPKMKSLVLKDLADP 180

Query: 181 GKNXXXXXXXXXXXXXXNKLSKKLQNALLQQHSSDDEHEFSGDIGLFNNQGGLQQLIKNS 240
            KN              NKLS+KLQ+A  QQHSS+DEHEFSG IGLFNNQGGLQQLIKN+
Sbjct: 181 AKNQESSDDDDGSEGTDNKLSQKLQSAFFQQHSSEDEHEFSGGIGLFNNQGGLQQLIKNT 240

Query: 241 VQNESKSKSDNADGYEIEIAPQRLDPLPYVPDGYSPFRQEDIQKLKSFNSPYELDLEDDG 300
            + +     ++ D ++IEIAPQR +PLPYVPDGY PF+QEDI KLK+FNSPY LDLE + 
Sbjct: 241 AKGKEGPGKEDGDDHDIEIAPQRQEPLPYVPDGYPPFQQEDILKLKTFNSPYGLDLEGNS 300

Query: 301 GST---DKVDLLPLEAINEESEQDEIVHIAGDREEGTPLPLLSKNLRKI--TAIPTIESL 355
            +T   DKV LL L  +NEE E+D   H  GD++E   L L  +N       A+P IESL
Sbjct: 301 NNTNSADKVGLLSLVEVNEEDEKDNTTHTIGDQQEPAELSLALQNSEDDDNAAMPLIESL 360

Query: 356 CN 357
            N
Sbjct: 361 YN 362

>TDEL0F03920 Chr6 complement(729845..730813) [969 bp, 322 aa] {ON}
           Anc_8.265 YDR113C
          Length = 322

 Score =  162 bits (411), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 125/324 (38%), Positives = 173/324 (53%), Gaps = 44/324 (13%)

Query: 1   MPANEDKENNIVYSGNGSSNLNFPQTPAHLLKRSHSNVLKPPTRLDQLKKDVNSNNCNAL 60
           MP NE+KEN++V +   S  ++FPQTPAHLLKRS S ++KP    ++   ++   +C+A 
Sbjct: 1   MPINENKENDLVLNLPESGGVSFPQTPAHLLKRSQSAMMKPSG--EENPSNLTYRDCDAP 58

Query: 61  KYIQGGKEVSPTKRLHTHAQQQGRLPLAAKDNNRAKSFIFIPENSNQSKDADIIPQQQNT 120
                 K  SP++R+     QQGR PLA+KDNNR+  F                   Q  
Sbjct: 59  V-----KRASPSRRV-----QQGRPPLASKDNNRSTGF-----------------LPQLQ 91

Query: 121 LSIRKNDQLRKLSQISRNRNRVNHSDLLNNTRKLQKYGSVLGYNALPKMKSLVLKDLVDP 180
              ++    R LSQ  +    V    LL N R+L+KYGSVLGYNALPKMKSLVLKD+   
Sbjct: 92  KLQQQPSLKRNLSQSKKRNANVVDGQLLTNPRRLKKYGSVLGYNALPKMKSLVLKDVDQV 151

Query: 181 GKNXXXXXXXXXXXXXXNKLSKKLQNALLQQHSSDDEHEFSGDIGLFNNQGGLQQLIKNS 240
           G+               + L  KL NA+     SD+E E  G  GLF ++ GL  L+++S
Sbjct: 152 GEQ---GEDENDDEDEDHILRLKLHNAI---DRSDEEGEEVG--GLF-DKSGLLHLVRDS 202

Query: 241 VQNESKSKSDNADGYEIEIAPQRLDPLPYVPDGYSPFRQEDIQKLKSFNSPYELDLEDDG 300
            ++E     D+ +  EIE  PQR +PLPY+P+G+    QED  KLK+F SPY ++ +   
Sbjct: 203 KKDE-----DDWEDREIEYGPQRHEPLPYIPEGHLSLAQEDYDKLKTFRSPYLIEDDYSD 257

Query: 301 GSTDKVD-LLPLEAINEESEQDEI 323
              DK D  L LE I    + + I
Sbjct: 258 SDDDKQDGFLQLEEIGSAGDDENI 281

>SAKL0H16962g Chr8 (1489800..1490810) [1011 bp, 336 aa] {ON} weakly
           similar to uniprot|P40316 Saccharomyces cerevisiae
           YDR113C PDS1 Securin that inhibits anaphase by binding
           separin Esp1p also blocks cyclin destruction and mitotic
           exit essential for cell cycle arrest in mitosis in the
           presence of DNA damage or aberrant mitotic spindles also
           present in meiotic nuclei
          Length = 336

 Score =  132 bits (333), Expect = 5e-35,   Method: Compositional matrix adjust.
 Identities = 122/343 (35%), Positives = 171/343 (49%), Gaps = 80/343 (23%)

Query: 1   MPANEDKENNIVYSGNGSSNLNFPQTPAHLLKRSHSNVLKPPTRLDQLKKDVNSNNCNAL 60
           M  +E+KEN +++S       N P TP+HLLKRS S  +KP          + SN     
Sbjct: 1   MRTHENKEN-VIFSSE-----NLPTTPSHLLKRSQS-FMKP----------LASN----- 38

Query: 61  KYIQGGKEVSPTKRLHTHAQQQGRLPLAAKDNNRAKSFIFIPENSNQSKDADIIPQQQNT 120
                    SPTK+         RLPLA+KDNN++ + I    N  +S   ++ P     
Sbjct: 39  ---------SPTKK------SGKRLPLASKDNNKSNTLI---NNGQKSALVNLAP----- 75

Query: 121 LSIRKNDQLRKLSQISRNRNRVNHSDLLNNT------------RKLQKYGSVLGYNALPK 168
                N+ L    ++ RNR  V+++    NT             +L+KYGSVLGYN LP+
Sbjct: 76  -----NNSLLHGGKLKRNRPVVSNTGSFINTNTSKSSFPLLPDSRLKKYGSVLGYNGLPR 130

Query: 169 MKSLVLKDLVDPGK------NXXXXXXXXXXXXXXNKLSKKLQNALLQQHSSDDEHEFSG 222
           +KSLVLKD VD  K                     N L+ KL  AL   H+ DD+ E  G
Sbjct: 131 VKSLVLKD-VDERKVGKSEEGEEEEEDDDEEEEEDNPLAAKLLKAL-NNHNEDDKEE--G 186

Query: 223 DIGLFNNQGGLQQLIKNSVQNESKSKSDNADGYEIEIAPQRLDPLPYVPDGYSPFRQEDI 282
            IGL  +  GLQQL+K+    E     +N+D +EIEI P   + LP+VP+GYSPF++ D+
Sbjct: 187 SIGLLGSNTGLQQLLKHRNVEEG----ENSD-FEIEIVPPHSEELPHVPNGYSPFKESDV 241

Query: 283 QKLKSFNSPYELDLED-DGGSTDKVD-LLPLEAI-NEESEQDE 322
            KL +F SP+ +  ED D    D  D LL +  + +E+ EQD+
Sbjct: 242 IKLNTFTSPFSMHKEDSDCEECDDYDGLLTISMVKSEDEEQDD 284

>NCAS0B03830 Chr2 (682538..683515) [978 bp, 325 aa] {ON} Anc_8.265
           YDR113C
          Length = 325

 Score =  128 bits (321), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 127/352 (36%), Positives = 159/352 (45%), Gaps = 106/352 (30%)

Query: 1   MPANEDKENNIVYSGNGSSNLN---FPQTPAHLL-KRSHSNVLKPPTRLDQLKKDVNSNN 56
           +  NEDKEN   Y  +  S       P+TPAHLL KRS S VLKP             N+
Sbjct: 3   LDTNEDKENKTTYESHVHSTKQSHLMPETPAHLLLKRSLSTVLKP-------------NS 49

Query: 57  CNALKYIQGGKEVSPTKRLHTHAQQQGRLPLAAKDNNRAKSFIFIPENSNQSKDADIIPQ 116
            NA   +     +SP +R     Q Q RLPLA KDNN +                     
Sbjct: 50  VNATDELGN---ISPRRR--QLLQLQNRLPLAKKDNNNS--------------------- 83

Query: 117 QQNTLSIRKNDQLRKLSQISRNRNRVNHSDLLNNTRKLQKYGSVLGYNALPKMKSLVLKD 176
              + S RKN                     LNN +KL+KYGSVLG +ALP+ KSL+LK 
Sbjct: 84  ---SFSSRKNG--------------------LNNIKKLKKYGSVLGMDALPRTKSLILK- 119

Query: 177 LVDPGKNXXXXXXXXXXXXXXNKLSKKLQNALLQQHSSDDEHEFSG----DIGLFNNQ-- 230
                 +              N    KL+NA+ Q  ++ +E E  G     IGLF++   
Sbjct: 120 ------DVDDKPDDDEEDEDDNAFGLKLRNAMKQHENNSNEEENEGMSGLGIGLFHDNED 173

Query: 231 ------GGLQQLIKNSVQNESKSK---------SDNADGYEIEIAPQRLDPLPYVPDGYS 275
                 GGLQQLI+ + +  S SK          D     EIE AP R +PLP+VP GY+
Sbjct: 174 NSKSKLGGLQQLIRENTKERSTSKIRSPLKTIGQDTDSDREIEYAPIREEPLPFVPFGYT 233

Query: 276 PFRQEDIQKLKSFNSPYELD-----LEDDGGSTDKVDLLPLEAINEESEQDE 322
           PF  EDI KLK+F+S Y+LD     +ED     DK  LL LE I E S  DE
Sbjct: 234 PFTPEDINKLKTFHSSYKLDSPVSTVED----ADK--LLALETI-ETSVDDE 278

>ZYRO0C01584g Chr3 (112438..113286) [849 bp, 282 aa] {ON} weakly
           similar to uniprot|P40316 Saccharomyces cerevisiae
           YDR113C PDS1 Securin that inhibits anaphase by binding
           separin Esp1p also blocks cyclin destruction and mitotic
           exit essential for cell cycle arrest in mitosis in the
           presence of DNA damage or aberrant mitotic spindles also
           present in meiotic nuclei
          Length = 282

 Score =  112 bits (279), Expect = 8e-28,   Method: Compositional matrix adjust.
 Identities = 110/341 (32%), Positives = 154/341 (45%), Gaps = 98/341 (28%)

Query: 5   EDKENNIVYSGNGSSNLNFPQTPAHLLKRSHSNVLKPPTRLDQLKKDVNSNNCNALKYIQ 64
           ++KENN+V     + +L  PQTP HLLKRS  NVLKP                     ++
Sbjct: 7   DNKENNVVLDPGENGSLALPQTPIHLLKRSQPNVLKPEEN----------------TPVK 50

Query: 65  GGKEVSPTKRLHTHAQQQGRLPLAAKDNNRAKSFIFIPENSNQSKDADIIPQQQNTLSIR 124
             + VSP +        Q RLPLA+KD+N++ +             A  + ++Q TL   
Sbjct: 51  KSRSVSPVR-------GQRRLPLASKDHNKSSA-------------AGPVKKRQPTL--- 87

Query: 125 KNDQLRKLSQISRNRNRVNHSDLLNNTRKLQKYGSVLGYNALPKMKSLVLKDLVDPGKNX 184
                                +LL+N RKLQKYGSVLGY  LP+ KSLVLKD        
Sbjct: 88  -------------------QGELLSNPRKLQKYGSVLGYTDLPRTKSLVLKD-------- 120

Query: 185 XXXXXXXXXXXXXNKLSKKLQNALLQQHSSDDEHEFSGDIGLFNNQGGLQQLIKNSVQNE 244
                        ++L KKLQ+A+ ++  S++        GL    GGL +L+++     
Sbjct: 121 -GDDEDDDEEEENSELQKKLQDAMNRREDSNE--------GL----GGLAKLVRD----- 162

Query: 245 SKSKSDNADGYEIEIAPQRLDPLPYVPDGYSPFRQEDIQKLKSFNSPY---ELDLEDDGG 301
             +K D      IE AP RL PL Y PDG++ +  EDI KLK  +      + D ED+  
Sbjct: 163 --TKDD------IEYAPHRLPPLEYAPDGHTRWEDEDIVKLKKVDLRIRDDQDDHEDNEP 214

Query: 302 STDKVDLLPLEAI---NEESEQDEIVHIAGDREEGTPLPLL 339
             +   LLPL +I   NE+S ++E   I        P P L
Sbjct: 215 QENDDGLLPLMSIESNNEDSNENEADEILPKNHRIHPFPKL 255

>Kpol_543.41 s543 complement(90836..91756) [921 bp, 306 aa] {ON}
           complement(90836..91756) [921 nt, 307 aa]
          Length = 306

 Score = 93.6 bits (231), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 98/308 (31%), Positives = 141/308 (45%), Gaps = 61/308 (19%)

Query: 4   NEDKENNIVYSGNGSSNLNFPQTPAHLLKRSHSNVLKPPTRLDQLKKDVNSNNCNALKYI 63
           +++KENNI          + PQTP +LLKR+HS          +LK  +        K I
Sbjct: 2   DQNKENNIFRHAMLK---DMPQTPNNLLKRTHS----------KLKTGI-------AKDI 41

Query: 64  QGGKEVSPTKRLHTHAQQQGRLPLAAKDNNRAKSFIFIPENSNQSKDADIIPQQQNTLSI 123
           QGG  ++ +         Q RLPLA+KDNNR+ SF+     +      +      N ++ 
Sbjct: 42  QGGNVINTS--------PQKRLPLASKDNNRSNSFLNNSNVNLNFNINNNNNNNNNNINN 93

Query: 124 RKNDQLRKLSQISRNRNRVNHSDLLNNTRKLQKYGSVLGYNALPKMKSLVLKDLVDPGKN 183
               +     Q        N S +L + RKL+KYGSVLGYNALPK+KSLVLK       +
Sbjct: 94  NNIKKQHIFQQ--------NKSGILADDRKLKKYGSVLGYNALPKVKSLVLK----DISD 141

Query: 184 XXXXXXXXXXXXXXNKLSKKLQNALLQQHSSDDEHEFSGDIGLFNNQGGLQQLIKNSVQN 243
                         + ++KK  N           ++ +  IGL +  G LQQLI+++   
Sbjct: 142 NEDDDDDLLSLKLRDSMNKKSINT----------NKSNSGIGLLSG-GNLQQLIRDA--- 187

Query: 244 ESKSKSDNADGYEIEIAPQRLDPLPYVPDGYSPFRQEDIQKLKSFNSPYELDLEDDGGST 303
                  N D  EIE          Y+PD + PF + DI KLK+FNSP++L+  +     
Sbjct: 188 -------NEDVREIEHKSNAFPDKEYIPDDHLPFDENDIAKLKTFNSPFKLEQSNSDDEE 240

Query: 304 DKVDLLPL 311
           D  +LL L
Sbjct: 241 DSSELLLL 248

>KLTH0G13618g Chr7 (1166359..1167267) [909 bp, 302 aa] {ON} weakly
           similar to uniprot|P40316 Saccharomyces cerevisiae
           YDR113C PDS1
          Length = 302

 Score = 92.0 bits (227), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 97/319 (30%), Positives = 134/319 (42%), Gaps = 87/319 (27%)

Query: 1   MPANEDKENNIVYSGNGSSNLNFPQTPAHLLKRSHSNVLKPPTRLDQLKKDVNSNNCNAL 60
           M  +EDKEN+I       S  N P TP HLL RS S +                      
Sbjct: 1   MGRHEDKENSIW------SESNVPVTPRHLLSRSQSFM---------------------- 32

Query: 61  KYIQGGKEVSPTKRLHTHAQQQGRLPLAAKDNNRAKSFIFIPENSNQSKDADIIPQQQNT 120
                 K  SP +        + R PLA+KDNNR+ S++   E                 
Sbjct: 33  ------KNKSPKR-------AEARRPLASKDNNRSVSYLGTKE----------------- 62

Query: 121 LSIRKNDQLRKLSQISRNRNRVNHSDLLNNTRKLQKYGSVLGYNALPKMKSLVLKDLVDP 180
                   LRK     R R  VNH+       +L      L  +  PK+KSLVLKD ++ 
Sbjct: 63  -------PLRK-----RTRPGVNHAGSFVGNARLGP-APTLNASGAPKIKSLVLKDGIEE 109

Query: 181 -GKNXXXXXXXXXXXXXXNKLSKKLQNALLQQHSSDDEHEFSGDIGLFNNQGGLQQLIKN 239
            G                N+L+ KL+  LL +   D E E     GL    GGLQ L+  
Sbjct: 110 EGSQSEGAEVDEDDDDDSNRLAAKLRTKLLSR-DRDAEGE---QTGLLGATGGLQSLLGP 165

Query: 240 SV-QNESKSKSDNADGYEIEIAPQRLDPLPYVPDGYSPFRQEDIQKLKSFN-SPYEL--- 294
            + Q   +S SD     E+E+ P R +PLP+VP+GY+PF +++I KL+  + SP++L   
Sbjct: 166 KLSQRAEESDSDQ----EVEVIPPRPEPLPHVPEGYTPFGEQEIAKLQGVDVSPFQLNFS 221

Query: 295 --DLEDDGGSTDKVDLLPL 311
             D ++D  S D   L  L
Sbjct: 222 GVDEDEDINSQDSTQLFTL 240

>NDAI0J01350 Chr10 (311490..312758) [1269 bp, 422 aa] {ON} Anc_8.265
           YDR113C
          Length = 422

 Score = 75.9 bits (185), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 89/301 (29%), Positives = 134/301 (44%), Gaps = 53/301 (17%)

Query: 23  FPQTPAHLLKRSHSNV------LKPPTRLDQLKKDVNSNNCNALKYIQGGKEVSPTKRLH 76
           FPQTPAHLLKRS S +      +KP     QL+ D  +              +SP ++L 
Sbjct: 37  FPQTPAHLLKRSSSILSKQKPDIKPGNLELQLQSDAGAGAVPP--------NISPRRQL- 87

Query: 77  THAQQQGRLPLAAKDNNRAKSFIFIPENSNQSKDADIIPQQQNTLSI-----RKNDQLR- 130
              Q Q R PL+ KDNN +    FI +   Q  D   + +  + L +       N+  R 
Sbjct: 88  --LQLQNRFPLSKKDNNNS----FILKQQQQQFDHKRLKKYGSVLGLGTDGNNHNNLTRI 141

Query: 131 ---KLSQISRNRNRVNHSDLLNNTRKLQKYGSVLGYNALPKMKSLVLKDLVDPGKNXXXX 187
               L  I  + N  +H+D   N+      GS L Y+A+P +   +  D +   +     
Sbjct: 142 KSLVLKDIDDDDNAGSHTD---NSTNGNIRGS-LNYSAIPNLDFNI--DTIQERRKGSDD 195

Query: 188 XXXXXXXXXXNKLSKKLQNALLQQHSSDDEHEFSGDIGLFNNQG-GLQQLI--------- 237
                     +    KL++A+   +++++     G   LF++   GL QLI         
Sbjct: 196 DSEDDDTGADDLFGLKLKHAMNNNNNNNNS---DGSGLLFHDSNHGLHQLINFNKKNMPE 252

Query: 238 KNSVQNESKSKSDNADGYE----IEIAPQRLDPLPYVPDGYSPFRQEDIQKLKSFNSPYE 293
           KNS+    K  +   D Y+    IE AP R D LPY+P GY+PF  EDI KLK ++SP+ 
Sbjct: 253 KNSISQSVKLDNKKEDTYDEEDDIEYAPIREDSLPYIPQGYTPFTNEDINKLKVYHSPFA 312

Query: 294 L 294
           +
Sbjct: 313 I 313

>TPHA0A01780 Chr1 (361017..362075) [1059 bp, 352 aa] {ON} Anc_8.265
           YDR113C
          Length = 352

 Score = 74.7 bits (182), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 106/348 (30%), Positives = 147/348 (42%), Gaps = 92/348 (26%)

Query: 1   MPANEDKENNIVYSGN-------GSSNLNFPQTPA-HLLKRSHSNVLKPPTRLDQLKKDV 52
           +  N DKEN+I Y  N         SN   PQTP   LLKR+HS  L             
Sbjct: 7   LNVNSDKENDIAYKNNDPLFVKDAISNRTVPQTPMDKLLKRTHSKTLSTAV--------- 57

Query: 53  NSNNCNALKYIQGGKEVSPTKRLHTHAQQQGRLPLAAKDNN---RAKSFIFIPENSNQSK 109
                         K+   +K  + +  +  RLPLA+KDNN   R+ SFI          
Sbjct: 58  -------------FKDAQQSKENNNNNIKLNRLPLASKDNNNSRRSNSFIL--------- 95

Query: 110 DADIIPQQQNTLSIRKNDQLRKLSQISRNRNRVNHSDLLNN---TRKLQKYGSVLGYNAL 166
                  Q N L + K        Q+S          LLNN   + KL+KYGS+LG N  
Sbjct: 96  -------QNNKLVLNK--------QLS----------LLNNNQTSNKLRKYGSILGVNNN 130

Query: 167 PK--------MKSLVLKDLVDPGKNXXXXXXXXXXXXXXNKLSKKLQNA---LLQQHSSD 215
                     +KSL+LKD+ D G                  L   LQ+    LL Q  + 
Sbjct: 131 GNNTNKTLNPVKSLILKDIPDNGNENDDDDDDDDDNIITLNLKNALQSKKEPLLNQLKNA 190

Query: 216 DEHEFSG----DIGLFNNQGGLQQLIKNSVQNESKSKSDNADGYEIEIAPQRLDPLPYVP 271
            ++ +S     +IGLF    GLQ+LI  S+ +++K +++     E + A      L Y P
Sbjct: 191 KKNSYSDSEEEEIGLFGKGNGLQKLISQSMNHKTKIEAEIIPEIETKSAA--YPDLSYSP 248

Query: 272 DGYSPFRQEDIQKLKSFNSPYE-LDLED----DGGSTDKVDLLPLEAI 314
           +GY PF  EDI+KL +F SPY  L++ D    D  + +   LL LE +
Sbjct: 249 EGYIPFNNEDIKKLNTFKSPYSNLNVNDSLLADHNNNNNSGLLELENV 296

>AGR083W Chr7 (883948..884835) [888 bp, 295 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR113C (PDS1)
          Length = 295

 Score = 73.6 bits (179), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 85/320 (26%), Positives = 125/320 (39%), Gaps = 89/320 (27%)

Query: 1   MPANEDKENNIVYSGNGSSNLNFPQTPAHLLKRSHSNVLKPPTRLDQLKKDVNSNNCNAL 60
           M  +EDKEN +  +G G+     P+TP H LKRS SN+                      
Sbjct: 1   MKKHEDKENLVTSAGRGA---MMPRTPIHQLKRSSSNL---------------------- 35

Query: 61  KYIQGGKEVSPTKRLHTHAQQQGRLPLAAKDNNRAKSFIFIPENSNQSKDADIIPQQQNT 120
                              +   R+PLA+KD N                      Q Q  
Sbjct: 36  -----------------AGRNSTRMPLASKDRN----------------------QSQGV 56

Query: 121 LSIRKNDQLRKLSQISRNRNRVNHSDLLNNT--RKLQKYGSVLG--YNALPKMKSLVLKD 176
             ++ +         ++++ R   S +  N    KL+KYGSVLG  Y +L K KSLVLKD
Sbjct: 57  FGLKTSGAGGAGGAQAQSK-RPASSSIAKNMPDSKLKKYGSVLGVGYGSLAKAKSLVLKD 115

Query: 177 LVDPGKNXXXXXXXXXXXXXXNKLSKKLQNALLQQHSSDDEHEFSGDIGLFNNQGGLQQL 236
             D                  N L+ KL++ L       +E +  G  GL   +  L QL
Sbjct: 116 TSD-----CESANEESEEEEGNPLAAKLKSRLCSAEEGGNEDD--GSSGLLLGEA-LSQL 167

Query: 237 IKNSVQNESKSKSDNADGYEIEIAPQRLDPLPYVPDGYSPFRQEDIQKLKSFNSPY---- 292
                  E        D   +E AP++L  LP+VP+GY   +  D+ KL  ++SP+    
Sbjct: 168 AAAGETQE--------DVPPVEYAPEKLPELPHVPNGYESLKSADLAKLAKYHSPFLRFG 219

Query: 293 ELDLEDDGGSTDKVDLLPLE 312
           + + E++    D   L+PLE
Sbjct: 220 DKEDEENTEPGDSQQLIPLE 239

>Ecym_4305 Chr4 (649254..650189) [936 bp, 311 aa] {ON} similar to
           Ashbya gossypii AGR083W
          Length = 311

 Score = 69.3 bits (168), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 98/322 (30%), Positives = 134/322 (41%), Gaps = 79/322 (24%)

Query: 1   MPANEDKENNIVYSGNGSSNLNFPQTPAHLLKRSHSNVLKPPTRLDQLKKDVNSNNCNAL 60
           M  +EDKEN  + +G+  S    P+TP H LKRS SNV                      
Sbjct: 1   MKKHEDKEN--IPTGSEPSGSIVPRTPMHQLKRSTSNV---------------------- 36

Query: 61  KYIQGGKEVSPTKRLHTHAQQQGRLPLAAKDNNRAKSFIFIPENSNQSKDADIIPQQQNT 120
                            H +   RLPLA+KD NR++S   + +   Q      +   QN 
Sbjct: 37  -----------------HLKNNSRLPLASKDRNRSQSGFNLKQQLVQGHVGGGVMVGQN- 78

Query: 121 LSIRKNDQLRKLSQISRNRNRVNHSDLLNNTRKLQKYGSVLG--YNALPKMKSLVLKDLV 178
                     K  + + N    N  D      KL+KYGSVLG  Y  L K KSLVLKD  
Sbjct: 79  ----------KSKRPASNSFVKNMPD-----SKLKKYGSVLGVNYPHLTKTKSLVLKDAS 123

Query: 179 DPGKNXXXXXXXXXXXXXXNKLSKKLQNALLQQHSSDDEHEFSGDIGLFNNQGGLQQLIK 238
           D G                N L+ KL++ L      ++E + S  + L      L +L  
Sbjct: 124 D-GSQDNGEESDDYDDEEGNPLAAKLRSRLTSGVEDENEDDGSSGLLLGGGLKKLIKL-- 180

Query: 239 NSVQNESKSKSDNADGYE---IEIAPQRLDPLPYVPDGYSPFRQEDIQKLKSFNSPYELD 295
                    +SDN D  E   IE AP+++  L ++P+GY  F  E+I KL ++ SP+ L 
Sbjct: 181 --------HESDNQDTEEVPQIETAPEKVPELEHIPNGYEQFEDEEIVKLATYTSPF-LR 231

Query: 296 L----EDDGGSTDKVDLL-PLE 312
                EDD  ST+   LL PL+
Sbjct: 232 FADREEDDSDSTEGERLLIPLD 253

>Kwal_56.23781 s56 (702900..703781) [882 bp, 293 aa] {ON} YDR113C
           (PDS1) - 42-kDa nuclear protein [contig 173] FULL
          Length = 293

 Score = 67.8 bits (164), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 88/298 (29%), Positives = 126/298 (42%), Gaps = 83/298 (27%)

Query: 1   MPANEDKENNIVYSGNGSSNLNFPQTPAHLLKRSHSNVLKPPTRLDQLKKDVNSNNCNAL 60
           M A E+KEN I       S  + P TP HLL RS S +                      
Sbjct: 1   MGARENKENAIW------SERSVPVTPTHLLSRSQSFM---------------------- 32

Query: 61  KYIQGGKEVSPTKRLHTHAQQQGRLPLAAKDNNRAKSFIFIPENSNQSKDADIIPQQQNT 120
                 K +SP +     A+Q  R PLA+KDNN++  F+   E                 
Sbjct: 33  ------KNISPKR-----AEQ--RKPLASKDNNKSTGFLGAKE----------------- 62

Query: 121 LSIRKNDQLRKLSQISRNRNRVNHS-DLLNNTRKLQKYGSVLGYNALPKMKSLVLKDLVD 179
                   LRK     R R  VNH+   + NTR       +L  N  P++KSLVLKD ++
Sbjct: 63  -------PLRK-----RTRPTVNHAGSFIGNTRP--GVVPILNTNGAPRIKSLVLKDDIE 108

Query: 180 PGKNXXXXXXXXXXXXXXNKLSKKLQNALLQQHSSDDEHEFSGDIGLFNNQGGLQQLIKN 239
             +               N L+ KL+  L    ++ D  + +   GL    GGLQ L   
Sbjct: 109 --EEQSQSDGGEAEDDESNSLAAKLRGKL----NARDRDDSTEQGGLLGATGGLQGLANT 162

Query: 240 SVQNESKSKSDNADGYEIEIAPQRLDPLPYVPDGYSPFRQEDIQKLKSFN-SPYELDL 296
            + +E+    D+    E+E+ P R +PLP++P GY+PF  EDI KL+    SP++L+ 
Sbjct: 163 KLHSETL---DSDSDLEVEVIPPRPEPLPHIPHGYTPFTDEDIGKLQDTEASPFQLNF 217

>KLLA0F19206g Chr6 complement(1780093..1780884) [792 bp, 263 aa]
           {ON} weakly similar to uniprot|P40316 Saccharomyces
           cerevisiae YDR113C PDS1 Securin that inhibits anaphase
           by binding separin Esp1p also blocks cyclin destruction
           and mitotic exit essential for cell cycle arrest in
           mitosis in the presence of DNA damage or aberrant
           mitotic spindles also present in meiotic nuclei
          Length = 263

 Score = 67.0 bits (162), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 64/213 (30%), Positives = 92/213 (43%), Gaps = 57/213 (26%)

Query: 84  RLPLAAKDNNRAKSFIFIPENSNQSKDADIIPQQQNTLSIRKNDQLRKLSQISRNRNRVN 143
           R PLA+KDNNR +S + +                +N  ++ K+D   K    S  +N   
Sbjct: 39  RRPLASKDNNRTQSILSV----------------KNNAALGKSDHPLKRPASSFMKNMPE 82

Query: 144 HSDLLNNTRKLQKYGSVLGYNA-LPKMKSLVLKDLVDPGKNXXXXXXXXXXXXXXNKLSK 202
           +        KL+KYGSVLG N  +P+ KSLVLKD     KN                  K
Sbjct: 83  N--------KLKKYGSVLGMNTFMPRTKSLVLKDTELNEKNDDEDEEDEEDDLPIFPSGK 134

Query: 203 KLQNALLQQHSSDDEHEFSGDIGLFNNQGGLQQLIKNSVQNESKSKSDNADGYEIEIAPQ 262
            L                  ++G  N   GL+ LI+           +  D   IE AP+
Sbjct: 135 SL------------------NLGFGN---GLKALIR-----------EKEDELNIEYAPK 162

Query: 263 RLDPLPYVPDGYSPFRQEDIQKLKSFNSPYELD 295
           R   LPY+P+GY PF +E I+KL+   SP++++
Sbjct: 163 RQKELPYIPNGYDPFDKESIEKLQHHRSPFQVE 195

>KNAG0H03230 Chr8 (602896..603741) [846 bp, 281 aa] {ON} Anc_8.265
           YDR113C
          Length = 281

 Score = 65.5 bits (158), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 86/298 (28%), Positives = 119/298 (39%), Gaps = 106/298 (35%)

Query: 1   MPANEDKENNIVYSGNGSSNLNFPQTPAHLLKRSHSNVLKPPTRLDQLKKDVNSNNCNAL 60
           M  NEDKEN +            PQTPA  +      VLKP          V S    + 
Sbjct: 1   MQDNEDKENAVA----------VPQTPASNILDGSGVVLKP----------VGSRGKQSF 40

Query: 61  KYIQGGKEVSPTKRLHTHAQQQGRLPLAAKDNNRAKSFIFIPENSNQSKDADIIPQQQNT 120
              +     SPT+         GRLPLA+KDNN +   +                     
Sbjct: 41  SVRK-----SPTR--------GGRLPLASKDNNASGLVV------------------SGK 69

Query: 121 LSIRKNDQLRKLSQISRNRNRVNHSDLLNNTRKLQKYGSVLGYN--ALPKMKSLVLKDLV 178
           L  +  DQ+R+                 N++RKL++YGS+LGY+   L + KSL+LKD  
Sbjct: 70  LGRQPADQVRE----------------ANSSRKLKRYGSLLGYDNRQLTRSKSLILKDPE 113

Query: 179 DPGKNXXXXXXXXXXXXXXNKLSKKLQNALL------QQHSSDDEHEFSGDIGLFNNQ-- 230
            P                 N+ SK +   LL      +  S  D+     DI    +Q  
Sbjct: 114 AP-----------------NESSKSVTKRLLLDEEIAKNSSDGDDDGDDTDILKIRSQLG 156

Query: 231 GGLQQLIKNSVQNESKSKSDNADGYEIEIAPQRLDPLPYVPDGYSPFRQEDIQKLKSF 288
           GGL +L++ S QN            E+EI PQ  D LPY+PDG+    + DI KL+ +
Sbjct: 157 GGLDRLVRQS-QNR-----------ELEIRPQAQDELPYIPDGHIILHEADIAKLRDY 202

>KAFR0B05510 Chr2 (1128895..1129722) [828 bp, 275 aa] {ON} Anc_8.265
           YDR113C
          Length = 275

 Score = 62.4 bits (150), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 71/276 (25%), Positives = 112/276 (40%), Gaps = 80/276 (28%)

Query: 56  NCNALKYIQGGKEVSPTKRLHTHAQQQGRLPLAAKDNNRAKSFIFIPENSNQSKDADIIP 115
           N N +K       +SP KRL    QQQG+LPL +K+ N++ S +                
Sbjct: 23  NTNFVKKNTTSTRISPLKRL----QQQGKLPLQSKNGNKSNSIL---------------- 62

Query: 116 QQQNTLSIRKNDQLRKLSQISRNRNRVNHSDLLNNTRKLQKYGSVLGYN-----ALPKMK 170
                                     ++H    NNTR ++KYGS+LG        LPK K
Sbjct: 63  --------------------------ISHKG--NNTR-IKKYGSILGLENPGNFKLPKTK 93

Query: 171 SLVLKDLVDPGKNXXXXXXXXXXXXXXNKLSKKLQNALLQQHSSDDEHEFSGDIGLFNNQ 230
           SL+LKD                       L++KL+ AL  +  +D++ E  G +GLF   
Sbjct: 94  SLILKD-----------NESSESEEEDGLLNRKLKEAL-SRSQNDEDREGDGSVGLF--- 138

Query: 231 GGLQQLIKNSVQNESKSKSDNADGYEIEIAPQRLDPLPYVPDGYSPFRQEDIQKLKSFNS 290
              ++  +N + N+  S+ D  +G E ++       L Y+PD Y     ++I+KLK  N 
Sbjct: 139 --AKEAFQNHISNDDDSEIDIINGKEKDV------ELSYIPDHYEVIAADEIEKLKQVNL 190

Query: 291 PYELDLEDDGGSTD---KVDLLPLEAINEESEQDEI 323
                     G  D    +  L LE +++   ++ I
Sbjct: 191 GTRFKSSASSGLNDNDSTIQFLELEHVSDSDTEENI 226

>CAGL0L12298g Chr12 complement(1331112..1331972) [861 bp, 286 aa]
           {ON} weakly similar to uniprot|P40316 Saccharomyces
           cerevisiae YDR113c cell cycle regulator
          Length = 286

 Score = 53.9 bits (128), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 82/343 (23%), Positives = 126/343 (36%), Gaps = 124/343 (36%)

Query: 6   DKENNIVYSGNGSSNLNFPQTPAHLLKRSHSNVLKPPTRLDQLKKDVNSNNCNALKYIQG 65
           DKENN+V    G+     P TP  LLKR+ S +L                          
Sbjct: 7   DKENNVV----GTLREKGPATPTQLLKRTRSTLL-------------------------- 36

Query: 66  GKEVSPTKRLHTHAQQQGRLPLAAKDN--NRAKSFIFIPENSNQSKDADIIPQQQNTLSI 123
                P K    + Q+Q   PLA+KD   NR+ S++ +  NSNQ K    + +  +T   
Sbjct: 37  -----PKK----NGQRQ---PLASKDKNYNRSSSYLSLKRNSNQKKLKPAVTRAGST--- 81

Query: 124 RKNDQLRKLSQISRNRNRVNHSDLLNNTRKLQKYGSVLGYNALPKMKSLVLKDLVDPGKN 183
                       + N NR                          ++ SL+LKD+    + 
Sbjct: 82  ------------ANNANR--------------------------RVTSLILKDIASGDEK 103

Query: 184 XXXXXXXXXXXXXXNKLSKKLQNALLQQHSSDDEHEFSGDIGLFNNQGGLQQLIKNSVQN 243
                         N L+ K++ AL    +S +     G  GL N + GL+++       
Sbjct: 104 ESASESDSEDDEESNPLALKIKQALTHSIASAE-----GKTGLLNGKSGLRKIF------ 152

Query: 244 ESKSKSDNADGYEIEIAPQRLDPLPYVPDGYSPFRQEDIQKLK----------SFNSPYE 293
                +D     EIE+A  R    PY P+GY P    D++KLK            +SP  
Sbjct: 153 -----NDRDLDREIEVASVREPEKPYEPEGYEPLDDSDLEKLKLKNAINRPTFIMDSPRA 207

Query: 294 LDLEDDGGSTDKVDLLPLE---------AINEESEQDEIVHIA 327
           + +  D    D   LLPL+          +N+++  DE++  A
Sbjct: 208 ISIVGD----DSPQLLPLDLEESKLEEGVLNDKNTTDEVITRA 246

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.309    0.130    0.361 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 42,406,587
Number of extensions: 2102540
Number of successful extensions: 6865
Number of sequences better than 10.0: 99
Number of HSP's gapped: 7034
Number of HSP's successfully gapped: 106
Length of query: 371
Length of database: 53,481,399
Length adjustment: 111
Effective length of query: 260
Effective length of database: 40,753,473
Effective search space: 10595902980
Effective search space used: 10595902980
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.7 bits)
S2: 66 (30.0 bits)