Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Smik_4.3578.263ON50750726300.0
YDR111C (ALT2)8.263ON50750723530.0
Skud_4.3728.263ON50750723220.0
Suva_2.2718.263ON50750722880.0
NCAS0B050208.263ON56848917540.0
TDEL0F039008.263ON55948917430.0
YLR089C (ALT1)8.263ON59249317440.0
Skud_12.1578.263ON59249317340.0
Smik_12.1488.263ON59249317210.0
NDAI0B019908.263ON58850517170.0
SAKL0H17006g8.263ON53148817020.0
Suva_10.1738.263ON59249317070.0
KNAG0M012108.263ON52149516980.0
KLLA0F19162g8.263ON52850316970.0
KNAG0G020408.263ON59149017030.0
ZYRO0C01628g8.263ON53448616820.0
CAGL0L12254g8.263ON57449216750.0
KAFR0B05520singletonON51049016500.0
Kpol_392.58.263ON51248916490.0
NCAS0B038408.263ON49749716460.0
KAFR0B055308.263ON51449016220.0
KAFR0B027308.263ON53949116170.0
KLTH0G13662g8.263ON51950515820.0
Ecym_43078.263ON53450015660.0
NDAI0J013608.263ON50149015610.0
Kwal_56.237918.263ON51849615600.0
TPHA0J007508.263ON52250015520.0
TPHA0A018008.263ON49849015490.0
Kpol_543.398.263ON49249215370.0
TBLA0E044408.263ON56248415280.0
AGR085W8.263ON52148814960.0
TBLA0F030608.263ON50050114750.0
TBLA0G01630singletonON50049414450.0
CAGL0J05126g1.321ON4332591187e-06
Suva_6.1361.321ON4442591152e-05
Kwal_14.25741.321ON4432621142e-05
AEL170C1.321ON4582621134e-05
Kpol_1035.231.321ON4442621115e-05
TPHA0O014501.321ON4432641081e-04
SAKL0F02156g3.511ON498911091e-04
Kwal_34.160181.472ON3791071081e-04
Ecym_6319singletonON3542261071e-04
KNAG0G005501.472ON3871591072e-04
SAKL0D06886g1.321ON4472671072e-04
Kpol_480.11.472ON3803031062e-04
KAFR0A017101.321ON4352621063e-04
TDEL0D019001.321ON4432601054e-04
NCAS0A092001.321ON4452641044e-04
KLTH0H10648g1.321ON4432621027e-04
YJL060W (BNA3)1.321ON4442591027e-04
KLLA0F10021g3.511ON4972951010.001
Skud_10.1561.321ON4602621000.001
KLTH0G09614g2.252ON389164990.001
ZYRO0G20636g1.321ON453261990.002
NDAI0G057601.321ON448264990.002
KLLA0F01617g1.321ON444259970.003
Smik_10.1801.321ON444259960.004
NCAS0G040501.472ON384103960.004
KNAG0B006603.511ON49659950.005
KNAG0B053201.321ON43372930.008
TPHA0F012602.252ON392162930.009
Kwal_47.189823.511ON49691920.011
Ecym_62921.321ON43068920.012
KLTH0G02002g3.511ON49691890.025
KNAG0E018502.252ON384155890.027
SAKL0D11528g1.472ON38391890.028
ZYRO0A01672g2.252ON386132870.049
YIL116W (HIS5)2.252ON385212860.054
KLTH0G19624gsingletonON46862860.065
KLTH0E07678gna 1ON492167860.068
KLTH0G19646g1.472ON37991850.087
SAKL0H21824gna 1ON499198840.11
ADL249W2.252ON387234840.11
TDEL0D057903.511ON49759830.13
KLTH0B00176g8.204ON44840830.15
TBLA0B009902.102ON54644830.17
Kwal_23.48882.252ON389149820.18
Kpol_278.23.511ON49859810.25
TDEL0C040902.252ON383142800.28
TPHA0D033703.511ON49759810.28
CAGL0C01243g2.252ON383144800.31
Kpol_1039.222.252ON386156800.33
CAGL0G01254g3.511ON50459800.33
Ecym_55428.204ON44695790.39
Kwal_8.5858.204ON44652780.53
TDEL0A016008.204ON47550780.59
NCAS0B064402.252ON385104760.87
YGL202W (ARO8)3.511ON50059761.1
Smik_5.3198.204ON44370761.1
NCAS0E006703.511ON49780751.2
Skud_9.552.252ON385210751.3
KLLA0F03509g2.252ON387156751.3
KAFR0J015802.252ON383156751.3
ZYRO0C06028g3.511ON49659741.6
Ecym_32902.252ON386148741.6
KLLA0A04906gna 1ON48063732.4
AFR548C3.511ON49791732.7
NDAI0I028303.511ON50059723.3
Kpol_1032.398.204ON45348713.5
KLLA0E00969g8.204ON44571713.8
Kwal_47.17462na 1ON49289713.9
NCAS0B071702.109ON14287684.2
SAKL0E08492g2.252ON384180704.3
NDAI0C059608.204ON478126705.7
TBLA0H018905.367ON111246705.8
KLLA0F03377g2.246ON476134696.5
KAFR0D014203.511ON49244697.1
Smik_7.693.511ON50059697.4
Suva_9.782.252ON386147688.1
Skud_7.693.511ON50059688.2
Suva_7.613.511ON50059689.1
Kpol_397.88.363ON51950689.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Smik_4.357
         (507 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Smik_4.357 Chr4 complement(639561..641084) [1524 bp, 507 aa] {ON...  1017   0.0  
YDR111C Chr4 complement(678241..679764) [1524 bp, 507 aa] {ON}  ...   910   0.0  
Skud_4.372 Chr4 complement(649872..651395) [1524 bp, 507 aa] {ON...   899   0.0  
Suva_2.271 Chr2 complement(472714..474237) [1524 bp, 507 aa] {ON...   885   0.0  
NCAS0B05020 Chr2 complement(931456..933162) [1707 bp, 568 aa] {O...   680   0.0  
TDEL0F03900 Chr6 complement(726159..727838) [1680 bp, 559 aa] {O...   676   0.0  
YLR089C Chr12 complement(318237..320015) [1779 bp, 592 aa] {ON} ...   676   0.0  
Skud_12.157 Chr12 complement(301427..303205) [1779 bp, 592 aa] {...   672   0.0  
Smik_12.148 Chr12 complement(298127..299905) [1779 bp, 592 aa] {...   667   0.0  
NDAI0B01990 Chr2 complement(493160..494926) [1767 bp, 588 aa] {O...   665   0.0  
SAKL0H17006g Chr8 (1493272..1494867) [1596 bp, 531 aa] {ON} high...   660   0.0  
Suva_10.173 Chr10 complement(323066..324844) [1779 bp, 592 aa] {...   662   0.0  
KNAG0M01210 Chr13 (220612..222177) [1566 bp, 521 aa] {ON} Anc_8....   658   0.0  
KLLA0F19162g Chr6 complement(1775240..1776826) [1587 bp, 528 aa]...   658   0.0  
KNAG0G02040 Chr7 complement(463058..464833) [1776 bp, 591 aa] {O...   660   0.0  
ZYRO0C01628g Chr3 (115665..117269) [1605 bp, 534 aa] {ON} simila...   652   0.0  
CAGL0L12254g Chr12 complement(1327111..1328835) [1725 bp, 574 aa...   649   0.0  
KAFR0B05520 Chr2 (1130297..1131829) [1533 bp, 510 aa] {ON} Anc_8...   640   0.0  
Kpol_392.5 s392 (6873..8411) [1539 bp, 512 aa] {ON} (6873..8411)...   639   0.0  
NCAS0B03840 Chr2 (683781..685274) [1494 bp, 497 aa] {ON} Anc_8.2...   638   0.0  
KAFR0B05530 Chr2 (1132895..1134439) [1545 bp, 514 aa] {ON}            629   0.0  
KAFR0B02730 Chr2 complement(558858..560477) [1620 bp, 539 aa] {O...   627   0.0  
KLTH0G13662g Chr7 (1169989..1171548) [1560 bp, 519 aa] {ON} simi...   613   0.0  
Ecym_4307 Chr4 (652209..653813) [1605 bp, 534 aa] {ON} similar t...   607   0.0  
NDAI0J01360 Chr10 (313791..315296) [1506 bp, 501 aa] {ON} Anc_8....   605   0.0  
Kwal_56.23791 s56 (706946..708502) [1557 bp, 518 aa] {ON} YLR089...   605   0.0  
TPHA0J00750 Chr10 complement(176561..178129) [1569 bp, 522 aa] {...   602   0.0  
TPHA0A01800 Chr1 (364262..365758) [1497 bp, 498 aa] {ON} Anc_8.2...   601   0.0  
Kpol_543.39 s543 complement(86358..87836) [1479 bp, 492 aa] {ON}...   596   0.0  
TBLA0E04440 Chr5 complement(1138820..1140508) [1689 bp, 562 aa] ...   593   0.0  
AGR085W Chr7 (887023..888588) [1566 bp, 521 aa] {ON} Syntenic ho...   580   0.0  
TBLA0F03060 Chr6 (743646..745148) [1503 bp, 500 aa] {ON} Anc_8.2...   572   0.0  
TBLA0G01630 Chr7 (428016..429518) [1503 bp, 500 aa] {ON}              561   0.0  
CAGL0J05126g Chr10 complement(487452..488753) [1302 bp, 433 aa] ...    50   7e-06
Suva_6.136 Chr6 complement(227366..228700) [1335 bp, 444 aa] {ON...    49   2e-05
Kwal_14.2574 s14 complement(818144..819475) [1332 bp, 443 aa] {O...    49   2e-05
AEL170C Chr5 complement(318032..319408) [1377 bp, 458 aa] {ON} S...    48   4e-05
Kpol_1035.23 s1035 complement(56123..57457) [1335 bp, 444 aa] {O...    47   5e-05
TPHA0O01450 Chr15 complement(291591..292922) [1332 bp, 443 aa] {...    46   1e-04
SAKL0F02156g Chr6 (185574..187070) [1497 bp, 498 aa] {ON} highly...    47   1e-04
Kwal_34.16018 s34 (159210..160349) [1140 bp, 379 aa] {ON} YJL060...    46   1e-04
Ecym_6319 Chr6 complement(607599..608663) [1065 bp, 354 aa] {ON}...    46   1e-04
KNAG0G00550 Chr7 (96823..97986) [1164 bp, 387 aa] {ON} Anc_1.472       46   2e-04
SAKL0D06886g Chr4 complement(571478..572821) [1344 bp, 447 aa] {...    46   2e-04
Kpol_480.1 s480 (215..1357) [1143 bp, 380 aa] {ON} (215..1357) [...    45   2e-04
KAFR0A01710 Chr1 complement(348198..349505) [1308 bp, 435 aa] {O...    45   3e-04
TDEL0D01900 Chr4 (369434..370765) [1332 bp, 443 aa] {ON} Anc_1.3...    45   4e-04
NCAS0A09200 Chr1 complement(1819134..1820471) [1338 bp, 445 aa] ...    45   4e-04
KLTH0H10648g Chr8 complement(919601..920932) [1332 bp, 443 aa] {...    44   7e-04
YJL060W Chr10 (323386..324720) [1335 bp, 444 aa] {ON}  BNA3Kynur...    44   7e-04
KLLA0F10021g Chr6 (926569..928062) [1494 bp, 497 aa] {ON} simila...    44   0.001
Skud_10.156 Chr10 complement(294149..295531) [1383 bp, 460 aa] {...    43   0.001
KLTH0G09614g Chr7 (804939..806108) [1170 bp, 389 aa] {ON} simila...    43   0.001
ZYRO0G20636g Chr7 complement(1700506..1701867) [1362 bp, 453 aa]...    43   0.002
NDAI0G05760 Chr7 (1427844..1429190) [1347 bp, 448 aa] {ON} Anc_1...    43   0.002
KLLA0F01617g Chr6 complement(154025..155359) [1335 bp, 444 aa] {...    42   0.003
Smik_10.180 Chr10 (315030..316364) [1335 bp, 444 aa] {ON} YJL060...    42   0.004
NCAS0G04050 Chr7 complement(753216..754370) [1155 bp, 384 aa] {O...    42   0.004
KNAG0B00660 Chr2 (115417..116907) [1491 bp, 496 aa] {ON} Anc_3.5...    41   0.005
KNAG0B05320 Chr2 (1028845..1030146) [1302 bp, 433 aa] {ON} Anc_1...    40   0.008
TPHA0F01260 Chr6 complement(290133..291311) [1179 bp, 392 aa] {O...    40   0.009
Kwal_47.18982 s47 complement(1051414..1052904) [1491 bp, 496 aa]...    40   0.011
Ecym_6292 Chr6 (547563..548855) [1293 bp, 430 aa] {ON} similar t...    40   0.012
KLTH0G02002g Chr7 (155219..156709) [1491 bp, 496 aa] {ON} highly...    39   0.025
KNAG0E01850 Chr5 (381827..382981) [1155 bp, 384 aa] {ON} Anc_2.2...    39   0.027
SAKL0D11528g Chr4 complement(960867..962018) [1152 bp, 383 aa] {...    39   0.028
ZYRO0A01672g Chr1 (136284..137444) [1161 bp, 386 aa] {ON} highly...    38   0.049
YIL116W Chr9 (142928..144085) [1158 bp, 385 aa] {ON}  HIS5Histid...    38   0.054
KLTH0G19624g Chr7 complement(1697587..1698993) [1407 bp, 468 aa]...    38   0.065
KLTH0E07678g Chr5 (702610..704088) [1479 bp, 492 aa] {ON} simila...    38   0.068
KLTH0G19646g Chr7 complement(1699421..1700560) [1140 bp, 379 aa]...    37   0.087
SAKL0H21824g Chr8 (1903887..1905386) [1500 bp, 499 aa] {ON} simi...    37   0.11 
ADL249W Chr4 (261227..262390) [1164 bp, 387 aa] {ON} Syntenic ho...    37   0.11 
TDEL0D05790 Chr4 complement(1045218..1046711) [1494 bp, 497 aa] ...    37   0.13 
KLTH0B00176g Chr2 (10791..12137) [1347 bp, 448 aa] {ON} similar ...    37   0.15 
TBLA0B00990 Chr2 complement(221196..222836) [1641 bp, 546 aa] {O...    37   0.17 
Kwal_23.4888 s23 (907745..908914) [1170 bp, 389 aa] {ON} YIL116W...    36   0.18 
Kpol_278.2 s278 (2488..3984) [1497 bp, 498 aa] {ON} (2488..3984)...    36   0.25 
TDEL0C04090 Chr3 complement(722310..723461) [1152 bp, 383 aa] {O...    35   0.28 
TPHA0D03370 Chr4 complement(704980..706473) [1494 bp, 497 aa] {O...    36   0.28 
CAGL0C01243g Chr3 (128629..129780) [1152 bp, 383 aa] {ON} highly...    35   0.31 
Kpol_1039.22 s1039 (68736..69896) [1161 bp, 386 aa] {ON} (68736....    35   0.33 
CAGL0G01254g Chr7 (119281..120795) [1515 bp, 504 aa] {ON} highly...    35   0.33 
Ecym_5542 Chr5 (1099530..1100870) [1341 bp, 446 aa] {ON} similar...    35   0.39 
Kwal_8.585 s8 (15757..17097) [1341 bp, 446 aa] {ON} YER152C - Hy...    35   0.53 
TDEL0A01600 Chr1 (289263..290690) [1428 bp, 475 aa] {ON} Anc_8.2...    35   0.59 
NCAS0B06440 Chr2 complement(1218759..1219916) [1158 bp, 385 aa] ...    34   0.87 
YGL202W Chr7 (116059..117561) [1503 bp, 500 aa] {ON}  ARO8Aromat...    34   1.1  
Smik_5.319 Chr5 complement(477840..479171) [1332 bp, 443 aa] {ON...    34   1.1  
NCAS0E00670 Chr5 (117006..118499) [1494 bp, 497 aa] {ON} Anc_3.511     33   1.2  
Skud_9.55 Chr9 (119747..120904) [1158 bp, 385 aa] {ON} YIL116W (...    33   1.3  
KLLA0F03509g Chr6 (327598..328761) [1164 bp, 387 aa] {ON} simila...    33   1.3  
KAFR0J01580 Chr10 complement(287313..288464) [1152 bp, 383 aa] {...    33   1.3  
ZYRO0C06028g Chr3 (457564..459054) [1491 bp, 496 aa] {ON} highly...    33   1.6  
Ecym_3290 Chr3 (546773..547933) [1161 bp, 386 aa] {ON} similar t...    33   1.6  
KLLA0A04906g Chr1 (437523..438965) [1443 bp, 480 aa] {ON} simila...    33   2.4  
AFR548C Chr6 complement(1422283..1423776) [1494 bp, 497 aa] {ON}...    33   2.7  
NDAI0I02830 Chr9 complement(669885..671387) [1503 bp, 500 aa] {O...    32   3.3  
Kpol_1032.39 s1032 complement(90576..91937) [1362 bp, 453 aa] {O...    32   3.5  
KLLA0E00969g Chr5 (101430..102767) [1338 bp, 445 aa] {ON} simila...    32   3.8  
Kwal_47.17462 s47 (413555..415033) [1479 bp, 492 aa] {ON} YGL202...    32   3.9  
NCAS0B07170 Chr2 (1360700..1361128) [429 bp, 142 aa] {ON} Anc_2....    31   4.2  
SAKL0E08492g Chr5 complement(692049..693203) [1155 bp, 384 aa] {...    32   4.3  
NDAI0C05960 Chr3 complement(1365183..1366619) [1437 bp, 478 aa] ...    32   5.7  
TBLA0H01890 Chr8 complement(447319..450657) [3339 bp, 1112 aa] {...    32   5.8  
KLLA0F03377g Chr6 complement(317185..318615) [1431 bp, 476 aa] {...    31   6.5  
KAFR0D01420 Chr4 (284515..285993) [1479 bp, 492 aa] {ON} Anc_3.5...    31   7.1  
Smik_7.69 Chr7 (111132..112634) [1503 bp, 500 aa] {ON} YGL202W (...    31   7.4  
Suva_9.78 Chr9 (137747..138907) [1161 bp, 386 aa] {ON} YIL116W (...    31   8.1  
Skud_7.69 Chr7 (120729..122231) [1503 bp, 500 aa] {ON} YGL202W (...    31   8.2  
Suva_7.61 Chr7 (112022..113524) [1503 bp, 500 aa] {ON} YGL202W (...    31   9.1  
Kpol_397.8 s397 (25467..27026) [1560 bp, 519 aa] {ON} (25467..27...    31   9.8  

>Smik_4.357 Chr4 complement(639561..641084) [1524 bp, 507 aa] {ON}
           YDR111C (REAL)
          Length = 507

 Score = 1017 bits (2630), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 491/507 (96%), Positives = 491/507 (96%)

Query: 1   MAMTHQQDLKSVFTTKDLNFKPAAKITKKDLNAGVTKAEYAVRGAIPTRADELKEELKRK 60
           MAMTHQQDLKSVFTTKDLNFKPAAKITKKDLNAGVTKAEYAVRGAIPTRADELKEELKRK
Sbjct: 1   MAMTHQQDLKSVFTTKDLNFKPAAKITKKDLNAGVTKAEYAVRGAIPTRADELKEELKRK 60

Query: 61  PGVLPFDDIINANIGNPQQLDQKPLTFTRQVLSILEYPEILRVGPDKLASLNLFRKDALG 120
           PGVLPFDDIINANIGNPQQLDQKPLTFTRQVLSILEYPEILRVGPDKLASLNLFRKDALG
Sbjct: 61  PGVLPFDDIINANIGNPQQLDQKPLTFTRQVLSILEYPEILRVGPDKLASLNLFRKDALG 120

Query: 121 RAEHLLEDIGGSIGAYSHSQGVPGIRQSVAEFITKRDDGEPAAPENIYXXXXXXXXXXXX 180
           RAEHLLEDIGGSIGAYSHSQGVPGIRQSVAEFITKRDDGEPAAPENIY            
Sbjct: 121 RAEHLLEDIGGSIGAYSHSQGVPGIRQSVAEFITKRDDGEPAAPENIYLTTGASSAATSL 180

Query: 181 XXXXCKDVQTGLLIPIPQYPLYTASASLFNAQVLPYYLDEGSNWSTKSDEIEKVVKDALE 240
               CKDVQTGLLIPIPQYPLYTASASLFNAQVLPYYLDEGSNWSTKSDEIEKVVKDALE
Sbjct: 181 LSLLCKDVQTGLLIPIPQYPLYTASASLFNAQVLPYYLDEGSNWSTKSDEIEKVVKDALE 240

Query: 241 KGIKPSVLIVINPGNPTGAVLSEDTIAKICLIAAKYGIAIISDEVYQENVFNGVKFHSMK 300
           KGIKPSVLIVINPGNPTGAVLSEDTIAKICLIAAKYGIAIISDEVYQENVFNGVKFHSMK
Sbjct: 241 KGIKPSVLIVINPGNPTGAVLSEDTIAKICLIAAKYGIAIISDEVYQENVFNGVKFHSMK 300

Query: 301 KVLRKLQRLYPGKFDNVQLASLHSISKGFMGECGQRGGYMEVVGFSKDIRDALFKLMSIS 360
           KVLRKLQRLYPGKFDNVQLASLHSISKGFMGECGQRGGYMEVVGFSKDIRDALFKLMSIS
Sbjct: 301 KVLRKLQRLYPGKFDNVQLASLHSISKGFMGECGQRGGYMEVVGFSKDIRDALFKLMSIS 360

Query: 361 ICSVVTGQAVVDLMVKPPQPGDESYDQDHSERMKIFHEMYTRATLLHETFNELEGIECQK 420
           ICSVVTGQAVVDLMVKPPQPGDESYDQDHSERMKIFHEMYTRATLLHETFNELEGIECQK
Sbjct: 361 ICSVVTGQAVVDLMVKPPQPGDESYDQDHSERMKIFHEMYTRATLLHETFNELEGIECQK 420

Query: 421 PQGAMYLFPRLVLPEKALRESERLGIEPDEFYCTSLLESTGICTVPGSGFGQQPGTYHVR 480
           PQGAMYLFPRLVLPEKALRESERLGIEPDEFYCTSLLESTGICTVPGSGFGQQPGTYHVR
Sbjct: 421 PQGAMYLFPRLVLPEKALRESERLGIEPDEFYCTSLLESTGICTVPGSGFGQQPGTYHVR 480

Query: 481 TTFLAPGTQWIQDWKHFHQDFFNKYRD 507
           TTFLAPGTQWIQDWKHFHQDFFNKYRD
Sbjct: 481 TTFLAPGTQWIQDWKHFHQDFFNKYRD 507

>YDR111C Chr4 complement(678241..679764) [1524 bp, 507 aa] {ON}
           ALT2Putative alanine transaminase (glutamic pyruvic
           transaminase)
          Length = 507

 Score =  910 bits (2353), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 435/507 (85%), Positives = 463/507 (91%)

Query: 1   MAMTHQQDLKSVFTTKDLNFKPAAKITKKDLNAGVTKAEYAVRGAIPTRADELKEELKRK 60
           M MTHQQDLK VFT KDL+FKPA KITKKDLN GVTKAEYAVRGAIPTRADELKEELK+ 
Sbjct: 1   MTMTHQQDLKGVFTAKDLDFKPAGKITKKDLNTGVTKAEYAVRGAIPTRADELKEELKKN 60

Query: 61  PGVLPFDDIINANIGNPQQLDQKPLTFTRQVLSILEYPEILRVGPDKLASLNLFRKDALG 120
           P VLPFDDIINANIGNPQQLDQKPLTFTRQVL+ILEYPEILRVG ++LASLNLF +DAL 
Sbjct: 61  PEVLPFDDIINANIGNPQQLDQKPLTFTRQVLAILEYPEILRVGHNELASLNLFSRDALE 120

Query: 121 RAEHLLEDIGGSIGAYSHSQGVPGIRQSVAEFITKRDDGEPAAPENIYXXXXXXXXXXXX 180
           RAE LL DIGGSIGAYSHSQGVPGIRQ+VA+FIT+RD GEPA PE+IY            
Sbjct: 121 RAERLLNDIGGSIGAYSHSQGVPGIRQTVADFITRRDGGEPATPEDIYLTTGASSAATSL 180

Query: 181 XXXXCKDVQTGLLIPIPQYPLYTASASLFNAQVLPYYLDEGSNWSTKSDEIEKVVKDALE 240
               CKD QTGLLIPIPQYPLYTASASLFNAQVLPYYLDE SNWST SDEIEKVV+DAL+
Sbjct: 181 LSLLCKDSQTGLLIPIPQYPLYTASASLFNAQVLPYYLDEESNWSTNSDEIEKVVQDALK 240

Query: 241 KGIKPSVLIVINPGNPTGAVLSEDTIAKICLIAAKYGIAIISDEVYQENVFNGVKFHSMK 300
           K I+PSVLIVINPGNPTGAVLSE+TIA+ICLIAAKYGI IISDEVYQEN+FN VKFHSMK
Sbjct: 241 KQIRPSVLIVINPGNPTGAVLSEETIARICLIAAKYGITIISDEVYQENIFNDVKFHSMK 300

Query: 301 KVLRKLQRLYPGKFDNVQLASLHSISKGFMGECGQRGGYMEVVGFSKDIRDALFKLMSIS 360
           KVLRKLQ LYPGKFDNVQLASLHSISKGFM ECGQRGGYME++GFS++IRDALFKLMSIS
Sbjct: 301 KVLRKLQHLYPGKFDNVQLASLHSISKGFMDECGQRGGYMEIIGFSQEIRDALFKLMSIS 360

Query: 361 ICSVVTGQAVVDLMVKPPQPGDESYDQDHSERMKIFHEMYTRATLLHETFNELEGIECQK 420
           ICSVVTGQAVVDLMVKPPQPGDESY+QDH ER+KIFHEM TRA LL+ETF ELEGIECQK
Sbjct: 361 ICSVVTGQAVVDLMVKPPQPGDESYEQDHDERLKIFHEMRTRANLLYETFKELEGIECQK 420

Query: 421 PQGAMYLFPRLVLPEKALRESERLGIEPDEFYCTSLLESTGICTVPGSGFGQQPGTYHVR 480
           PQGAMYLFPRLVLP+KAL ESERLGIEPDEFYCTSLLESTGICTVPGSGFGQ+PGTYHVR
Sbjct: 421 PQGAMYLFPRLVLPKKALCESERLGIEPDEFYCTSLLESTGICTVPGSGFGQRPGTYHVR 480

Query: 481 TTFLAPGTQWIQDWKHFHQDFFNKYRD 507
           TTFLAPGT+WIQDWK FHQDFF+KYR+
Sbjct: 481 TTFLAPGTKWIQDWKEFHQDFFSKYRN 507

>Skud_4.372 Chr4 complement(649872..651395) [1524 bp, 507 aa] {ON}
           YDR111C (REAL)
          Length = 507

 Score =  899 bits (2322), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 427/507 (84%), Positives = 459/507 (90%)

Query: 1   MAMTHQQDLKSVFTTKDLNFKPAAKITKKDLNAGVTKAEYAVRGAIPTRADELKEELKRK 60
           M MTHQQDLKSVF  KDL+FKPAAKITKKDLN  VTKAEYAVRG+IPTRADELKEELK+ 
Sbjct: 1   MTMTHQQDLKSVFIAKDLDFKPAAKITKKDLNGSVTKAEYAVRGSIPTRADELKEELKKN 60

Query: 61  PGVLPFDDIINANIGNPQQLDQKPLTFTRQVLSILEYPEILRVGPDKLASLNLFRKDALG 120
           PG+LPFDDIINANIGNPQQLDQKPLTFTRQVLSILEYPEIL+V  +KLASLNLF KDAL 
Sbjct: 61  PGLLPFDDIINANIGNPQQLDQKPLTFTRQVLSILEYPEILQVDHEKLASLNLFSKDALK 120

Query: 121 RAEHLLEDIGGSIGAYSHSQGVPGIRQSVAEFITKRDDGEPAAPENIYXXXXXXXXXXXX 180
           RAE LL+DIGGS+GAYSHSQGVPGIRQ+VA+FIT RD GEPA PE+IY            
Sbjct: 121 RAECLLKDIGGSVGAYSHSQGVPGIRQTVADFITARDGGEPATPEDIYLTTGASSAATSL 180

Query: 181 XXXXCKDVQTGLLIPIPQYPLYTASASLFNAQVLPYYLDEGSNWSTKSDEIEKVVKDALE 240
               CKD +TGLLIPIPQYPLYTASASLFNAQVLPYYLDE  NWST+SDEIEKVV+DALE
Sbjct: 181 LSLLCKDTRTGLLIPIPQYPLYTASASLFNAQVLPYYLDEECNWSTESDEIEKVVQDALE 240

Query: 241 KGIKPSVLIVINPGNPTGAVLSEDTIAKICLIAAKYGIAIISDEVYQENVFNGVKFHSMK 300
           KGI+PSVLIVINPGNPTGAVL+E+TIA+ICLIAAKYGIA+ISDEVYQENVFN  KFHSMK
Sbjct: 241 KGIRPSVLIVINPGNPTGAVLTEETIARICLIAAKYGIAVISDEVYQENVFNDFKFHSMK 300

Query: 301 KVLRKLQRLYPGKFDNVQLASLHSISKGFMGECGQRGGYMEVVGFSKDIRDALFKLMSIS 360
           KVLRKLQ  YPGKFDNVQLASLHSISKGFMGECGQRGGYME+VGFS+DIRDALFKLMSIS
Sbjct: 301 KVLRKLQHCYPGKFDNVQLASLHSISKGFMGECGQRGGYMEIVGFSQDIRDALFKLMSIS 360

Query: 361 ICSVVTGQAVVDLMVKPPQPGDESYDQDHSERMKIFHEMYTRATLLHETFNELEGIECQK 420
           ICSVVTGQA+VDLMV PPQPGDESY+QD  ER KIF+EM TRA LL+ETFN LEGIECQ 
Sbjct: 361 ICSVVTGQAIVDLMVNPPQPGDESYEQDRQERSKIFNEMRTRANLLYETFNGLEGIECQN 420

Query: 421 PQGAMYLFPRLVLPEKALRESERLGIEPDEFYCTSLLESTGICTVPGSGFGQQPGTYHVR 480
           PQGAMYLFPRL+LP+KA RESERLG+EPDEFYC SLLESTGICTVPGSGFGQ+PGTYHVR
Sbjct: 421 PQGAMYLFPRLILPDKAFRESERLGVEPDEFYCASLLESTGICTVPGSGFGQKPGTYHVR 480

Query: 481 TTFLAPGTQWIQDWKHFHQDFFNKYRD 507
           TTFLAPGTQWIQ+WK+FHQ FFN+YRD
Sbjct: 481 TTFLAPGTQWIQNWKNFHQSFFNEYRD 507

>Suva_2.271 Chr2 complement(472714..474237) [1524 bp, 507 aa] {ON}
           YDR111C (REAL)
          Length = 507

 Score =  885 bits (2288), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 419/507 (82%), Positives = 457/507 (90%)

Query: 1   MAMTHQQDLKSVFTTKDLNFKPAAKITKKDLNAGVTKAEYAVRGAIPTRADELKEELKRK 60
           M MT Q+DLKSVFTTKDL+FKPAAK+TKKDLNA VTKAEYAVRGAIPTRA+ELKEELKR 
Sbjct: 1   MTMTDQKDLKSVFTTKDLDFKPAAKLTKKDLNASVTKAEYAVRGAIPTRAEELKEELKRS 60

Query: 61  PGVLPFDDIINANIGNPQQLDQKPLTFTRQVLSILEYPEILRVGPDKLASLNLFRKDALG 120
              LPF+ IINANIGNPQQLDQKPLTFTRQVLSILEYPEILRV  DKLASLNLF KDAL 
Sbjct: 61  SNSLPFNSIINANIGNPQQLDQKPLTFTRQVLSILEYPEILRVDHDKLASLNLFAKDALK 120

Query: 121 RAEHLLEDIGGSIGAYSHSQGVPGIRQSVAEFITKRDDGEPAAPENIYXXXXXXXXXXXX 180
           RA+ LL+DIGGS+GAYSHSQGVPGIRQ+VA+FIT+RD GEPA PE+IY            
Sbjct: 121 RAQRLLDDIGGSVGAYSHSQGVPGIRQTVADFITERDGGEPAGPEDIYLTTGASSAATSL 180

Query: 181 XXXXCKDVQTGLLIPIPQYPLYTASASLFNAQVLPYYLDEGSNWSTKSDEIEKVVKDALE 240
               CKD QTGLL+PIPQYPLYTASASL+NAQVLPYYLDE ++WST+SDEIE+VV DAL+
Sbjct: 181 LSLLCKDSQTGLLLPIPQYPLYTASASLYNAQVLPYYLDEEADWSTESDEIERVVLDALK 240

Query: 241 KGIKPSVLIVINPGNPTGAVLSEDTIAKICLIAAKYGIAIISDEVYQENVFNGVKFHSMK 300
           KGI+PSVL+VINPGNPTGAVL+E+TIAKICLIAAKYGI IISDEVYQEN+F  VKFHSMK
Sbjct: 241 KGIRPSVLVVINPGNPTGAVLTENTIAKICLIAAKYGITIISDEVYQENIFGDVKFHSMK 300

Query: 301 KVLRKLQRLYPGKFDNVQLASLHSISKGFMGECGQRGGYMEVVGFSKDIRDALFKLMSIS 360
           K+LRKLQ L+PGKFDNVQLASLHSISKGFMGECGQRGGYME+VGFS+DIRDALFKLMSIS
Sbjct: 301 KILRKLQNLHPGKFDNVQLASLHSISKGFMGECGQRGGYMEIVGFSQDIRDALFKLMSIS 360

Query: 361 ICSVVTGQAVVDLMVKPPQPGDESYDQDHSERMKIFHEMYTRATLLHETFNELEGIECQK 420
           ICSV TGQA++DLMVKPPQPGDESYDQD  ER+KI++EM TRA LL+ETFNELEGI+CQK
Sbjct: 361 ICSVATGQAIIDLMVKPPQPGDESYDQDRKERLKIYNEMLTRANLLYETFNELEGIKCQK 420

Query: 421 PQGAMYLFPRLVLPEKALRESERLGIEPDEFYCTSLLESTGICTVPGSGFGQQPGTYHVR 480
           PQGAMYLFP+L LPEKALRESERL IEPD  YCTSLLESTGICTVPGSGFGQ+ GTYHVR
Sbjct: 421 PQGAMYLFPKLFLPEKALRESERLNIEPDVLYCTSLLESTGICTVPGSGFGQKSGTYHVR 480

Query: 481 TTFLAPGTQWIQDWKHFHQDFFNKYRD 507
           TTFL PGTQWIQDW+ FHQDFFNKYRD
Sbjct: 481 TTFLPPGTQWIQDWRQFHQDFFNKYRD 507

>NCAS0B05020 Chr2 complement(931456..933162) [1707 bp, 568 aa] {ON} 
          Length = 568

 Score =  680 bits (1754), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 323/489 (66%), Positives = 388/489 (79%)

Query: 19  NFKPAAKITKKDLNAGVTKAEYAVRGAIPTRADELKEELKRKPGVLPFDDIINANIGNPQ 78
           NF PA ++T  +LN  V KA+YAVRGAIP RA+ELK +L+  P  LPFD I+NANIGNPQ
Sbjct: 80  NFLPADQLTLAELNDNVLKAKYAVRGAIPMRAEELKIQLQEDPSSLPFDHIVNANIGNPQ 139

Query: 79  QLDQKPLTFTRQVLSILEYPEILRVGPDKLASLNLFRKDALGRAEHLLEDIGGSIGAYSH 138
           QL+QKPL+F RQVLS+L+YPEIL+    KL +  LF+KDAL RA+ LL +IGG++GAYS 
Sbjct: 140 QLNQKPLSFYRQVLSLLQYPEILKQDESKLVASGLFKKDALERAKTLLHEIGGTVGAYSA 199

Query: 139 SQGVPGIRQSVAEFITKRDDGEPAAPENIYXXXXXXXXXXXXXXXXCKDVQTGLLIPIPQ 198
           SQGV GIR++VA FITKRD+GEPA PE+I+                CK  +TG+LIPIPQ
Sbjct: 200 SQGVYGIRKTVANFITKRDNGEPAYPEDIFLTAGASAAVMYLLSILCKGPETGVLIPIPQ 259

Query: 199 YPLYTASASLFNAQVLPYYLDEGSNWSTKSDEIEKVVKDALEKGIKPSVLIVINPGNPTG 258
           YPLYTAS +L N+  LPYYLDE S WST   EIE+VV  A +K I+PSVL+VINPGNPTG
Sbjct: 260 YPLYTASLALNNSHALPYYLDEKSGWSTNPKEIEEVVLAAKDKKIRPSVLVVINPGNPTG 319

Query: 259 AVLSEDTIAKICLIAAKYGIAIISDEVYQENVFNGVKFHSMKKVLRKLQRLYPGKFDNVQ 318
           AVLSE +I  I  IAAKYGI +I+DEVYQENVFN VKFHSMKKVLR LQ+ +PG +D VQ
Sbjct: 320 AVLSEKSIEHIFEIAAKYGIVVIADEVYQENVFNEVKFHSMKKVLRNLQKKHPGVYDMVQ 379

Query: 319 LASLHSISKGFMGECGQRGGYMEVVGFSKDIRDALFKLMSISICSVVTGQAVVDLMVKPP 378
           LASLHS SKG  GECGQRGGYME+ GF+ ++R  + KL SIS+C VVTGQA+VDLMV PP
Sbjct: 380 LASLHSTSKGVSGECGQRGGYMELTGFTHEVRSVILKLASISLCPVVTGQALVDLMVSPP 439

Query: 379 QPGDESYDQDHSERMKIFHEMYTRATLLHETFNELEGIECQKPQGAMYLFPRLVLPEKAL 438
           + GDES++QD +ER  I  E++TRA  L++ FN LEGIECQKPQGAMYLFPRL LP KA+
Sbjct: 440 KKGDESFEQDQAERKHIKSELHTRAMQLYKNFNTLEGIECQKPQGAMYLFPRLDLPFKAV 499

Query: 439 RESERLGIEPDEFYCTSLLESTGICTVPGSGFGQQPGTYHVRTTFLAPGTQWIQDWKHFH 498
           ++++ L + PDEFYC SLLE+TGICTVPGSGFGQ+PGTYH+RTTFLAPGT+WI+ WK FH
Sbjct: 500 QKAQHLEMSPDEFYCKSLLEATGICTVPGSGFGQEPGTYHLRTTFLAPGTEWIEKWKIFH 559

Query: 499 QDFFNKYRD 507
           QDF+N YRD
Sbjct: 560 QDFYNTYRD 568

>TDEL0F03900 Chr6 complement(726159..727838) [1680 bp, 559 aa] {ON}
           Anc_8.263 YDR111C
          Length = 559

 Score =  676 bits (1743), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 312/489 (63%), Positives = 391/489 (79%)

Query: 19  NFKPAAKITKKDLNAGVTKAEYAVRGAIPTRADELKEELKRKPGVLPFDDIINANIGNPQ 78
           +F PA  +T +DLN  V KA+YAVRG+IP RA+EL+E+LKR P  LPFD I+NANIGNPQ
Sbjct: 71  DFYPAESLTVRDLNENVLKAKYAVRGSIPMRAEELQEQLKRDPSSLPFDKIVNANIGNPQ 130

Query: 79  QLDQKPLTFTRQVLSILEYPEILRVGPDKLASLNLFRKDALGRAEHLLEDIGGSIGAYSH 138
           QL+QKPL+F RQVLSIL+YPE+L  G ++L S  +F++DA+ RA+ +L D+GGS+GAYS 
Sbjct: 131 QLNQKPLSFYRQVLSILQYPEVLEQGEEELISKGVFKRDAIERAKRILRDVGGSVGAYSS 190

Query: 139 SQGVPGIRQSVAEFITKRDDGEPAAPENIYXXXXXXXXXXXXXXXXCKDVQTGLLIPIPQ 198
           SQGV GIR++VA+FIT+RD GEPA PE+I+                C+  +TG+LIPIPQ
Sbjct: 191 SQGVYGIRKTVADFITERDSGEPAYPEDIFLTAGASAAVSYLLSILCRGQETGVLIPIPQ 250

Query: 199 YPLYTASASLFNAQVLPYYLDEGSNWSTKSDEIEKVVKDALEKGIKPSVLIVINPGNPTG 258
           YPLYTA+ +L N+ VLPYYLDE S WST + EIE VV +++E GI+PSVL+VINPGNPTG
Sbjct: 251 YPLYTATLALNNSHVLPYYLDEESGWSTNTAEIEGVVTESIESGIRPSVLVVINPGNPTG 310

Query: 259 AVLSEDTIAKICLIAAKYGIAIISDEVYQENVFNGVKFHSMKKVLRKLQRLYPGKFDNVQ 318
           +VLS + I KI  +AAKYGI +I+DEVYQEN+F G +FHSMKKVLR+LQ+ +PG +DNVQ
Sbjct: 311 SVLSVEAIEKIFQVAAKYGIVVIADEVYQENIFAGSEFHSMKKVLRQLQKEHPGIYDNVQ 370

Query: 319 LASLHSISKGFMGECGQRGGYMEVVGFSKDIRDALFKLMSISICSVVTGQAVVDLMVKPP 378
           L SLHS SKG  GECGQRGGYME+ GF+ +IR  + KL SIS+C VVTGQA+VDLMV PP
Sbjct: 371 LVSLHSTSKGVSGECGQRGGYMELTGFTHEIRQVVLKLASISLCPVVTGQALVDLMVCPP 430

Query: 379 QPGDESYDQDHSERMKIFHEMYTRATLLHETFNELEGIECQKPQGAMYLFPRLVLPEKAL 438
           +PGDESY+QD  ER  I  E+  RA LLH+TFN LEGIECQKP+GAMYLFP++ LP KA+
Sbjct: 431 KPGDESYEQDRKEREMIHEELDHRAGLLHDTFNSLEGIECQKPRGAMYLFPQIKLPYKAI 490

Query: 439 RESERLGIEPDEFYCTSLLESTGICTVPGSGFGQQPGTYHVRTTFLAPGTQWIQDWKHFH 498
           + ++ L   PDEFYC  LLE+TGICTVPGSGFGQ+PGTYH+RTTFLAPGT+WI+ W+ FH
Sbjct: 491 QAAQHLEKTPDEFYCQKLLEATGICTVPGSGFGQEPGTYHLRTTFLAPGTEWIKKWEDFH 550

Query: 499 QDFFNKYRD 507
           + F+++YRD
Sbjct: 551 KKFYDQYRD 559

>YLR089C Chr12 complement(318237..320015) [1779 bp, 592 aa] {ON}
           ALT1Alanine transaminase (glutamic pyruvic
           transaminase); involved in alanine biosynthetic and
           catabolic processes; the authentic, non-tagged protein
           is detected in highly purified mitochondria in
           high-throughput studies
          Length = 592

 Score =  676 bits (1744), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 315/493 (63%), Positives = 390/493 (79%)

Query: 15  TKDLNFKPAAKITKKDLNAGVTKAEYAVRGAIPTRADELKEELKRKPGVLPFDDIINANI 74
           T +  F PA ++T +D+N  V KA+YAVRGAIP RA+ELK +L++ P  LPFD IINANI
Sbjct: 100 TSNNEFYPAEQLTLEDVNENVLKAKYAVRGAIPMRAEELKAQLEKDPQSLPFDRIINANI 159

Query: 75  GNPQQLDQKPLTFTRQVLSILEYPEILRVGPDKLASLNLFRKDALGRAEHLLEDIGGSIG 134
           GNPQQL QKPLT+ RQVLS+L+YPE+L     +L    LF+ DA+ RA+ L+EDIGGS+G
Sbjct: 160 GNPQQLQQKPLTYYRQVLSLLQYPELLNQNEQQLVDSKLFKLDAIKRAKSLMEDIGGSVG 219

Query: 135 AYSHSQGVPGIRQSVAEFITKRDDGEPAAPENIYXXXXXXXXXXXXXXXXCKDVQTGLLI 194
           AYS SQGV GIR+SVAEFITKRD+GE + PE+I+                C+  +TG+LI
Sbjct: 220 AYSSSQGVEGIRKSVAEFITKRDEGEISYPEDIFLTAGASAAVNYLLSIFCRGPETGVLI 279

Query: 195 PIPQYPLYTASASLFNAQVLPYYLDEGSNWSTKSDEIEKVVKDALEKGIKPSVLIVINPG 254
           PIPQYPLYTA+ +L N+Q LPYYLDE S WST  +EIE VVK+A++  IKP+VL+VINPG
Sbjct: 280 PIPQYPLYTATLALNNSQALPYYLDENSGWSTNPEEIETVVKEAIQNEIKPTVLVVINPG 339

Query: 255 NPTGAVLSEDTIAKICLIAAKYGIAIISDEVYQENVFNGVKFHSMKKVLRKLQRLYPGKF 314
           NPTGAVLS ++IA+I  +AAKYG  +I+DEVYQEN+F G KFHSMKK+LR LQR +PGKF
Sbjct: 340 NPTGAVLSPESIAQIFEVAAKYGTVVIADEVYQENIFPGTKFHSMKKILRHLQREHPGKF 399

Query: 315 DNVQLASLHSISKGFMGECGQRGGYMEVVGFSKDIRDALFKLMSISICSVVTGQAVVDLM 374
           DNVQLASLHS SKG  GECGQRGGYME+ GFS ++R  + KL SIS+C VVTGQA+VDLM
Sbjct: 400 DNVQLASLHSTSKGVSGECGQRGGYMELTGFSHEMRQVILKLASISLCPVVTGQALVDLM 459

Query: 375 VKPPQPGDESYDQDHSERMKIFHEMYTRATLLHETFNELEGIECQKPQGAMYLFPRLVLP 434
           V+PP  G+ES++ D +ER  I  ++ TRA  L+ETFN LEGIECQKPQGAMYLFP++ LP
Sbjct: 460 VRPPVEGEESFESDQAERNSIHEKLITRAMTLYETFNSLEGIECQKPQGAMYLFPKIDLP 519

Query: 435 EKALRESERLGIEPDEFYCTSLLESTGICTVPGSGFGQQPGTYHVRTTFLAPGTQWIQDW 494
            KA++E+  L + PDEFYC  LLESTGICTVPGSGFGQ+PGTYH+RTTFLAPG +WI+ W
Sbjct: 520 FKAVQEARHLELTPDEFYCKKLLESTGICTVPGSGFGQEPGTYHLRTTFLAPGLEWIKKW 579

Query: 495 KHFHQDFFNKYRD 507
           + FH++FF++YRD
Sbjct: 580 ESFHKEFFDQYRD 592

>Skud_12.157 Chr12 complement(301427..303205) [1779 bp, 592 aa] {ON}
           YLR089C (REAL)
          Length = 592

 Score =  672 bits (1734), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 314/493 (63%), Positives = 392/493 (79%)

Query: 15  TKDLNFKPAAKITKKDLNAGVTKAEYAVRGAIPTRADELKEELKRKPGVLPFDDIINANI 74
           T + +F PA ++T +D+N  V KA+YAVRGAIP RA+ELK +L++ P  LPFD IINANI
Sbjct: 100 TGNDDFYPAEQLTLEDVNENVLKAKYAVRGAIPMRAEELKAQLEKDPQSLPFDKIINANI 159

Query: 75  GNPQQLDQKPLTFTRQVLSILEYPEILRVGPDKLASLNLFRKDALGRAEHLLEDIGGSIG 134
           GNPQQL QKPLT+ RQVLS+L+YPE+L     +L    LF+ DA+ RA+ L+EDIGGS+G
Sbjct: 160 GNPQQLQQKPLTYYRQVLSLLQYPELLNQNEQQLVDSKLFKLDAIKRAKSLMEDIGGSVG 219

Query: 135 AYSHSQGVPGIRQSVAEFITKRDDGEPAAPENIYXXXXXXXXXXXXXXXXCKDVQTGLLI 194
           AYS SQGV GIR+SVAEFITKRDDGE + PE+I+                C+  +TG+LI
Sbjct: 220 AYSSSQGVEGIRKSVAEFITKRDDGEISYPEDIFLTAGASAAVNYLLSIFCRGPETGVLI 279

Query: 195 PIPQYPLYTASASLFNAQVLPYYLDEGSNWSTKSDEIEKVVKDALEKGIKPSVLIVINPG 254
           PIPQYPLYTA+ +L N+Q LPYYLDE S WST  +EIE VVK+A++  IKP+VL+VINPG
Sbjct: 280 PIPQYPLYTATLALNNSQALPYYLDEQSGWSTNPEEIETVVKEAIQNEIKPTVLVVINPG 339

Query: 255 NPTGAVLSEDTIAKICLIAAKYGIAIISDEVYQENVFNGVKFHSMKKVLRKLQRLYPGKF 314
           NPTGAVLS +++++I  +AAKYG  +I+DEVYQEN+F G KFHSMKK+LR LQR +PGKF
Sbjct: 340 NPTGAVLSPESVSQIFEVAAKYGTVVIADEVYQENIFPGTKFHSMKKILRTLQREHPGKF 399

Query: 315 DNVQLASLHSISKGFMGECGQRGGYMEVVGFSKDIRDALFKLMSISICSVVTGQAVVDLM 374
           DNVQLASLHS SKG  GECGQRGGYME+ GFS ++R  + KL SIS+C VVTGQA+VDLM
Sbjct: 400 DNVQLASLHSTSKGVSGECGQRGGYMELTGFSHEMRQVILKLASISLCPVVTGQALVDLM 459

Query: 375 VKPPQPGDESYDQDHSERMKIFHEMYTRATLLHETFNELEGIECQKPQGAMYLFPRLVLP 434
           V+PP  G+ES++ D +ER  I  ++ TRA  L++TFN LEGIECQKPQGAMYLFP++ LP
Sbjct: 460 VRPPVEGEESFELDQAERNSIHEKLITRAMTLYDTFNSLEGIECQKPQGAMYLFPKIDLP 519

Query: 435 EKALRESERLGIEPDEFYCTSLLESTGICTVPGSGFGQQPGTYHVRTTFLAPGTQWIQDW 494
            KA++E+  L + PDEFYC SLLESTGICTVPGSGFGQ+PGTYH+RTTFLAPG +WI+ W
Sbjct: 520 FKAVQEARHLELTPDEFYCKSLLESTGICTVPGSGFGQEPGTYHLRTTFLAPGLEWIKKW 579

Query: 495 KHFHQDFFNKYRD 507
           + FH++FF++YRD
Sbjct: 580 ETFHKEFFDQYRD 592

>Smik_12.148 Chr12 complement(298127..299905) [1779 bp, 592 aa] {ON}
           YLR089C (REAL)
          Length = 592

 Score =  667 bits (1721), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 311/493 (63%), Positives = 387/493 (78%)

Query: 15  TKDLNFKPAAKITKKDLNAGVTKAEYAVRGAIPTRADELKEELKRKPGVLPFDDIINANI 74
           T +  F PA ++T  D+N  V KA+YAVRGAIP RA+ELK +L++ P  LPF+ IINANI
Sbjct: 100 TSNNEFYPAEQLTLDDVNENVLKAKYAVRGAIPMRAEELKAQLEKDPQSLPFNKIINANI 159

Query: 75  GNPQQLDQKPLTFTRQVLSILEYPEILRVGPDKLASLNLFRKDALGRAEHLLEDIGGSIG 134
           GNPQQL QKPLT+ RQVLS+L+YPE+L     +L    LF+ DA+ RA+ L+E+IGGS+G
Sbjct: 160 GNPQQLQQKPLTYYRQVLSLLQYPELLNQNEQQLVDSKLFKLDAIKRAKSLMEEIGGSVG 219

Query: 135 AYSHSQGVPGIRQSVAEFITKRDDGEPAAPENIYXXXXXXXXXXXXXXXXCKDVQTGLLI 194
           AYS SQGV GIR+SVAEFITKRD+GE + PE+I+                C+  +TG+LI
Sbjct: 220 AYSSSQGVEGIRRSVAEFITKRDEGEISYPEDIFLTAGASAAVNYLLSIFCRGPETGVLI 279

Query: 195 PIPQYPLYTASASLFNAQVLPYYLDEGSNWSTKSDEIEKVVKDALEKGIKPSVLIVINPG 254
           PIPQYPLYTA+ +L N+Q LPYYLDE S WST  +EIE VVK+A+E  IK +VL+VINPG
Sbjct: 280 PIPQYPLYTATLALNNSQALPYYLDESSGWSTNPEEIETVVKEAIENEIKSTVLVVINPG 339

Query: 255 NPTGAVLSEDTIAKICLIAAKYGIAIISDEVYQENVFNGVKFHSMKKVLRKLQRLYPGKF 314
           NPTGAVLS ++IA+I  +AAKYG  +I+DEVYQEN+F G KFHSMKK+LR LQR +PGKF
Sbjct: 340 NPTGAVLSPESIAQIFEVAAKYGTVVIADEVYQENIFPGTKFHSMKKILRHLQREHPGKF 399

Query: 315 DNVQLASLHSISKGFMGECGQRGGYMEVVGFSKDIRDALFKLMSISICSVVTGQAVVDLM 374
           DNVQLASLHS SKG  GECGQRGGYME+ GFS ++R  + KL SIS+C VVTGQA+VDLM
Sbjct: 400 DNVQLASLHSTSKGVSGECGQRGGYMELTGFSHEMRQVILKLASISLCPVVTGQALVDLM 459

Query: 375 VKPPQPGDESYDQDHSERMKIFHEMYTRATLLHETFNELEGIECQKPQGAMYLFPRLVLP 434
           V+PP  G+ES++ D +ER  I  ++ TRA  L++TFN LEGIECQKPQGAMYLFP++ LP
Sbjct: 460 VRPPLEGEESFESDQAERNSIHEKLITRAMTLYKTFNSLEGIECQKPQGAMYLFPKIDLP 519

Query: 435 EKALRESERLGIEPDEFYCTSLLESTGICTVPGSGFGQQPGTYHVRTTFLAPGTQWIQDW 494
            +A++E+  L + PDEFYC  LLESTGICTVPGSGFGQ+PGTYH+RTTFLAPG +WI+ W
Sbjct: 520 FRAVQEARHLELTPDEFYCKKLLESTGICTVPGSGFGQEPGTYHLRTTFLAPGLEWIKKW 579

Query: 495 KHFHQDFFNKYRD 507
           + FH++FF+ YRD
Sbjct: 580 ETFHKEFFDHYRD 592

>NDAI0B01990 Chr2 complement(493160..494926) [1767 bp, 588 aa] {ON}
           Anc_8.263 YDR111C
          Length = 588

 Score =  665 bits (1717), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 314/505 (62%), Positives = 393/505 (77%)

Query: 3   MTHQQDLKSVFTTKDLNFKPAAKITKKDLNAGVTKAEYAVRGAIPTRADELKEELKRKPG 62
           MT      S+   K  +F PA ++T  DLN  V KA+YAVRG+IP RA+ELK +L+  P 
Sbjct: 84  MTRSISHHSLKVAKGKDFAPAEQLTLADLNENVLKAKYAVRGSIPMRAEELKVQLENNPS 143

Query: 63  VLPFDDIINANIGNPQQLDQKPLTFTRQVLSILEYPEILRVGPDKLASLNLFRKDALGRA 122
            LPF  I+NANIGNPQQL QKPL+F RQVLSIL+YP+IL+     L    ++++DA+ RA
Sbjct: 144 TLPFSQIVNANIGNPQQLKQKPLSFYRQVLSILQYPDILKENEQNLIDAKVYKRDAIDRA 203

Query: 123 EHLLEDIGGSIGAYSHSQGVPGIRQSVAEFITKRDDGEPAAPENIYXXXXXXXXXXXXXX 182
           + LL +IGGS+GAYS SQGV GIR++VA FIT+RD GEPA PE+I+              
Sbjct: 204 KLLLSEIGGSVGAYSASQGVYGIRKTVANFITERDGGEPAYPEDIFLTVWCFRCCCYLLS 263

Query: 183 XXCKDVQTGLLIPIPQYPLYTASASLFNAQVLPYYLDEGSNWSTKSDEIEKVVKDALEKG 242
             C+  +TG+LIPIPQYPLYTA+ +L N+  LPYYLDE S WST   EIE+VV+DA+E+ 
Sbjct: 264 ILCQGPKTGVLIPIPQYPLYTATLALNNSHALPYYLDEKSGWSTNPKEIEEVVQDAMERA 323

Query: 243 IKPSVLIVINPGNPTGAVLSEDTIAKICLIAAKYGIAIISDEVYQENVFNGVKFHSMKKV 302
           I PSVL+VINPGNPTGAVL+E++I  I  IAAKYGI +I+DEVYQEN+ +GVKF+SMKKV
Sbjct: 324 INPSVLVVINPGNPTGAVLTEESIEHIFEIAAKYGIVVIADEVYQENIADGVKFYSMKKV 383

Query: 303 LRKLQRLYPGKFDNVQLASLHSISKGFMGECGQRGGYMEVVGFSKDIRDALFKLMSISIC 362
           LRKLQ+ +PGKFDNVQLASLHS SKG  GECGQRGGYME++GF+ ++R  + KL SIS+C
Sbjct: 384 LRKLQKSHPGKFDNVQLASLHSTSKGVSGECGQRGGYMELIGFTHEVRKVILKLASISLC 443

Query: 363 SVVTGQAVVDLMVKPPQPGDESYDQDHSERMKIFHEMYTRATLLHETFNELEGIECQKPQ 422
            VVTGQA+VDLMV PP+ GD SY+QD +ER  I  E+  RA+ L+ETF  LEGIECQKPQ
Sbjct: 444 PVVTGQALVDLMVSPPKKGDASYEQDQAERRHIKSELSIRASQLYETFVGLEGIECQKPQ 503

Query: 423 GAMYLFPRLVLPEKALRESERLGIEPDEFYCTSLLESTGICTVPGSGFGQQPGTYHVRTT 482
           GAMYLFP+L LP KA++E++ L + PDEFYC SLL++TGICTVPGSGFGQ+PGTYH+RTT
Sbjct: 504 GAMYLFPKLDLPFKAVQEAQHLEMTPDEFYCKSLLDATGICTVPGSGFGQEPGTYHLRTT 563

Query: 483 FLAPGTQWIQDWKHFHQDFFNKYRD 507
           FLAPGT+WI+ W+ FH++F++ YRD
Sbjct: 564 FLAPGTEWIKKWEAFHKEFYDNYRD 588

>SAKL0H17006g Chr8 (1493272..1494867) [1596 bp, 531 aa] {ON} highly
           similar to gnl|GLV|KLLA0F19162g Kluyveromyces lactis
           KLLA0F19162g and similar to YLR089C uniprot|P52893
           Saccharomyces cerevisiae YLR089C ALT1 putative alanine
           transaminase (glutamyc pyruvic transaminase)
          Length = 531

 Score =  660 bits (1702), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 311/488 (63%), Positives = 382/488 (78%), Gaps = 1/488 (0%)

Query: 20  FKPAAKITKKDLNAGVTKAEYAVRGAIPTRADELKEELKRKPGVLPFDDIINANIGNPQQ 79
           F+PA K++ +DLN  V +A+YAVRG IP +A+ELK +L R P  LPFD IINANIGNPQQ
Sbjct: 45  FQPADKLSLEDLNENVLRAKYAVRGKIPQKAEELKNQLARDPKSLPFDRIINANIGNPQQ 104

Query: 80  LDQKPLTFTRQVLSILEYPEILRVGPDKLASLNLFRKDALGRAEHLLEDIGGSIGAYSHS 139
           LDQKPLTF RQVLS+L+ P++L   P +  S  +++ DA+ RA  LL +IGGS+GAYSHS
Sbjct: 105 LDQKPLTFYRQVLSLLQNPDMLEEIPREQLS-QIYKPDAIDRAARLLSNIGGSVGAYSHS 163

Query: 140 QGVPGIRQSVAEFITKRDDGEPAAPENIYXXXXXXXXXXXXXXXXCKDVQTGLLIPIPQY 199
           QGV G R++VA+FITKRD GE A  E+I+                C+  QTG+LIPIPQY
Sbjct: 164 QGVYGFRKTVADFITKRDGGEEAYAEDIFLTAGASAAVSYILSILCRGPQTGVLIPIPQY 223

Query: 200 PLYTASASLFNAQVLPYYLDEGSNWSTKSDEIEKVVKDALEKGIKPSVLIVINPGNPTGA 259
           PLYTAS +L N+  LPYYLDE SNWST  +EIEKVV +++ KG++P  L+VINPGNPTGA
Sbjct: 224 PLYTASLALNNSHALPYYLDEESNWSTNPEEIEKVVTNSIAKGVEPKCLVVINPGNPTGA 283

Query: 260 VLSEDTIAKICLIAAKYGIAIISDEVYQENVFNGVKFHSMKKVLRKLQRLYPGKFDNVQL 319
           +LS ++I KI  +AAKYGI +I+DEVYQENVFNG +FHSM+KVL+ LQR + GKFDN+QL
Sbjct: 284 ILSPESIEKIFEVAAKYGIVVIADEVYQENVFNGAEFHSMRKVLKDLQRKHHGKFDNIQL 343

Query: 320 ASLHSISKGFMGECGQRGGYMEVVGFSKDIRDALFKLMSISICSVVTGQAVVDLMVKPPQ 379
           ASLHS SKG  GECGQRGGYME++GFS D+R    KL SIS+C VVTGQA+VDLMV PP+
Sbjct: 344 ASLHSTSKGVSGECGQRGGYMELLGFSHDVRQVFLKLASISLCPVVTGQALVDLMVCPPK 403

Query: 380 PGDESYDQDHSERMKIFHEMYTRATLLHETFNELEGIECQKPQGAMYLFPRLVLPEKALR 439
           PGD SY+QD  ER +I   +  RA++L+ETFN LEGIECQKPQGAMYLFPRL L  KA++
Sbjct: 404 PGDASYEQDQKERSEIHDALDARASMLYETFNRLEGIECQKPQGAMYLFPRLDLSYKAVQ 463

Query: 440 ESERLGIEPDEFYCTSLLESTGICTVPGSGFGQQPGTYHVRTTFLAPGTQWIQDWKHFHQ 499
           ++E L + PDEFYC  LLE+TGICTVPGSGFGQ PGTYH+RTTFLAPGT WI+ W+ FH+
Sbjct: 464 KAEHLSLSPDEFYCQELLEATGICTVPGSGFGQVPGTYHLRTTFLAPGTDWIKAWEEFHK 523

Query: 500 DFFNKYRD 507
            F+N+YRD
Sbjct: 524 KFYNEYRD 531

>Suva_10.173 Chr10 complement(323066..324844) [1779 bp, 592 aa] {ON}
           YDR111C (REAL)
          Length = 592

 Score =  662 bits (1707), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 311/493 (63%), Positives = 387/493 (78%)

Query: 15  TKDLNFKPAAKITKKDLNAGVTKAEYAVRGAIPTRADELKEELKRKPGVLPFDDIINANI 74
           T +  F PA ++T  D+N  V KA YAVRGAIP RA+ELK +L++ P  LPF+ IINANI
Sbjct: 100 TANNEFYPAEQLTLDDVNENVLKARYAVRGAIPMRAEELKAQLEKDPQSLPFNKIINANI 159

Query: 75  GNPQQLDQKPLTFTRQVLSILEYPEILRVGPDKLASLNLFRKDALGRAEHLLEDIGGSIG 134
           GNPQQL QKPLT+ RQVLS+L+YPE+L     +L    LF+ DA+ RA+ L++DIGGS+G
Sbjct: 160 GNPQQLQQKPLTYYRQVLSLLQYPELLNHNEQELVGSKLFKIDAIKRAKSLIKDIGGSVG 219

Query: 135 AYSHSQGVPGIRQSVAEFITKRDDGEPAAPENIYXXXXXXXXXXXXXXXXCKDVQTGLLI 194
           AYS SQGV GIR+SVA+FITKRD GE A PE+I+                C+  +TG+LI
Sbjct: 220 AYSSSQGVEGIRKSVADFITKRDGGETAYPEDIFLTAGASAAVTYLLSIFCRGPETGVLI 279

Query: 195 PIPQYPLYTASASLFNAQVLPYYLDEGSNWSTKSDEIEKVVKDALEKGIKPSVLIVINPG 254
           PIPQYPLYTA+ +L N+Q LPYYLDE S WST  +EIE VVK+A++  IKP+VL+VINPG
Sbjct: 280 PIPQYPLYTATLALNNSQPLPYYLDENSGWSTNPEEIETVVKEAIQNEIKPTVLVVINPG 339

Query: 255 NPTGAVLSEDTIAKICLIAAKYGIAIISDEVYQENVFNGVKFHSMKKVLRKLQRLYPGKF 314
           NPTGAVLS ++IA+I  +AAKYG  +I+DEVYQEN+F G +F+SMKKVLR LQR +PGKF
Sbjct: 340 NPTGAVLSPESIAQIFEVAAKYGTVVIADEVYQENIFPGTEFNSMKKVLRHLQRDHPGKF 399

Query: 315 DNVQLASLHSISKGFMGECGQRGGYMEVVGFSKDIRDALFKLMSISICSVVTGQAVVDLM 374
           DNVQLASLHS SKG  GECGQRGGYME+ GFS ++R  + KL SIS+C VVTGQA+VDLM
Sbjct: 400 DNVQLASLHSTSKGVSGECGQRGGYMELTGFSHEMRQVILKLASISLCPVVTGQALVDLM 459

Query: 375 VKPPQPGDESYDQDHSERMKIFHEMYTRATLLHETFNELEGIECQKPQGAMYLFPRLVLP 434
           V+PP  G+ES++ D SER  I  ++ TRA  L+ETFN LEGIECQKPQGAMYLFP++ +P
Sbjct: 460 VRPPVEGEESFESDQSERNSIHEKLNTRAMTLYETFNSLEGIECQKPQGAMYLFPKIDVP 519

Query: 435 EKALRESERLGIEPDEFYCTSLLESTGICTVPGSGFGQQPGTYHVRTTFLAPGTQWIQDW 494
            KA++E+  L + PDEFYC  LLESTGICTVPGSGFGQ+PGTYH+RTTFLAPG +W++ W
Sbjct: 520 FKAIQEAHHLELTPDEFYCKKLLESTGICTVPGSGFGQEPGTYHLRTTFLAPGVEWMKKW 579

Query: 495 KHFHQDFFNKYRD 507
           + FH++FF++YRD
Sbjct: 580 EIFHKEFFDQYRD 592

>KNAG0M01210 Chr13 (220612..222177) [1566 bp, 521 aa] {ON} Anc_8.263
           YDR111C
          Length = 521

 Score =  658 bits (1698), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 306/495 (61%), Positives = 396/495 (80%), Gaps = 2/495 (0%)

Query: 14  TTKDLNFKPAAKITKKDLNAGVTKAEYAVRGAIPTRADELKEELKRKPGVLPFDDIINAN 73
           T   L F+PA K+   DLN  +  AEYAVRGAIP +A+EL+ +L ++P +LPF+ I  AN
Sbjct: 28  TVSGLAFEPARKLGADDLNKNIIDAEYAVRGAIPMKAEELEIQLSQQPDLLPFNAITVAN 87

Query: 74  IGNPQQLDQKPLTFTRQVLSILEYPEILRVGPDKLASLNLFRKDALGRAEHLLEDIGGSI 133
           IGNPQQLDQKPLTF+RQV+SIL+YP +L    ++L +   +++DA  RA  LLE IGGS+
Sbjct: 88  IGNPQQLDQKPLTFSRQVVSILQYPPLLDY-EEQLVTSGAYKRDAFKRAAVLLEQIGGSV 146

Query: 134 GAYSHSQGVPGIRQSVAEFITKRDDGEPAAPENIYXXXXXXXXXXXXXXXXCKDVQTGLL 193
           GAYS +QGV GIR+SVA+FIT+RD+GE A+P++I+                C+D  TG++
Sbjct: 147 GAYSLAQGVYGIRESVADFITRRDEGETASPDDIFLTDGASKAATYLLSILCRDSSTGIM 206

Query: 194 IPIPQYPLYTASASLFNAQVLPYYLDEGSNWSTKSDEIEKVVKDALEKGIKPSVLIVINP 253
           IPIPQYPLYTAS +++N+ +LPYYLDE S WSTK++EIE+ V D++++G+ P V++VINP
Sbjct: 207 IPIPQYPLYTASITMYNSVMLPYYLDEESGWSTKAEEIEQQVIDSIKRGVTPRVIVVINP 266

Query: 254 GNPTGAVLSEDTIAKICLIAAKYGIAIISDEVYQENVFNGVKFHSMKKVLRKLQRLYP-G 312
           GNPTGAVLS DTIA+I  IAAKYGI +++DEVYQ N++ GVKFHSMKKVLR LQR +P G
Sbjct: 267 GNPTGAVLSFDTIAQILTIAAKYGIVVLADEVYQNNIYKGVKFHSMKKVLRSLQRDHPNG 326

Query: 313 KFDNVQLASLHSISKGFMGECGQRGGYMEVVGFSKDIRDALFKLMSISICSVVTGQAVVD 372
           ++DNVQLAS+HS SKG  GECGQRGGYME+VGFS ++R  + KL SISICSVVTGQA+VD
Sbjct: 327 EYDNVQLASMHSTSKGVSGECGQRGGYMELVGFSNEVRQVILKLASISICSVVTGQALVD 386

Query: 373 LMVKPPQPGDESYDQDHSERMKIFHEMYTRATLLHETFNELEGIECQKPQGAMYLFPRLV 432
           LM+ PP+ GD+SY+ D  ER +I + M TR  LL++TF +LEGIECQ+PQGAMYLFP+L+
Sbjct: 387 LMLNPPREGDDSYELDVRERKEIHNNMKTRGYLLYDTFQKLEGIECQEPQGAMYLFPKLL 446

Query: 433 LPEKALRESERLGIEPDEFYCTSLLESTGICTVPGSGFGQQPGTYHVRTTFLAPGTQWIQ 492
           L +KA+ E++ LG++PDEFYC  LL++TGICTVPGSGFGQ+ GTYHVRTTFLAPGTQWI+
Sbjct: 447 LSKKAIEEAKSLGLQPDEFYCHRLLDTTGICTVPGSGFGQKEGTYHVRTTFLAPGTQWIK 506

Query: 493 DWKHFHQDFFNKYRD 507
           DW+ FH+ F++KYRD
Sbjct: 507 DWETFHKAFYDKYRD 521

>KLLA0F19162g Chr6 complement(1775240..1776826) [1587 bp, 528 aa]
           {ON} similar to uniprot|P52893 Saccharomyces cerevisiae
           YLR089C ALT1 putative alanine transaminase (glutamyc
           pyruvic transaminase)
          Length = 528

 Score =  658 bits (1697), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 313/503 (62%), Positives = 390/503 (77%), Gaps = 6/503 (1%)

Query: 9   LKSVFTTKDLNF----KPAAKITKKDLNAGVTKAEYAVRGAIPTRADELKEELKRKPGVL 64
           + SV +   L F    KPA K++  D+N  V KA+YAVRG IP RA+EL+++LK+ P  L
Sbjct: 28  MPSVTSLTQLRFSTTVKPAPKLSLDDVNENVLKAKYAVRGRIPMRAEELRDQLKKDPSSL 87

Query: 65  PFDDIINANIGNPQQLDQKPLTFTRQVLSILEYPEILRVGPDKLASLNLFRKDALGRAEH 124
           PF  II+ANIGNPQQLDQKPLTF R+VLS+L++PE+L    + L +L  ++ D++ RA+ 
Sbjct: 88  PFSKIISANIGNPQQLDQKPLTFYREVLSLLQHPELLEEADEALQTL--YKTDSIKRAKR 145

Query: 125 LLEDIGGSIGAYSHSQGVPGIRQSVAEFITKRDDGEPAAPENIYXXXXXXXXXXXXXXXX 184
           LL ++GGS+GAYS SQGV GIR++VA+FITKRDDGE + PE+IY                
Sbjct: 146 LLSEVGGSVGAYSQSQGVQGIRETVADFITKRDDGEISYPEDIYLTAGASAAVSYILSIL 205

Query: 185 CKDVQTGLLIPIPQYPLYTASASLFNAQVLPYYLDEGSNWSTKSDEIEKVVKDALEKGIK 244
           CK   TG+LIPIPQYPLYTAS +L N++ LPYYL E  NWST  +EIE+VV DA++KGIK
Sbjct: 206 CKGPNTGVLIPIPQYPLYTASLALNNSRPLPYYLREEQNWSTDPEEIEQVVLDAIQKGIK 265

Query: 245 PSVLIVINPGNPTGAVLSEDTIAKICLIAAKYGIAIISDEVYQENVFNGVKFHSMKKVLR 304
           P+ L+VINPGNPTGA+LSE +I KI  +AAKYGI +I+DEVYQENVF G KF+SMKKVLR
Sbjct: 266 PTCLVVINPGNPTGAILSEQSIQKIFEVAAKYGIVVIADEVYQENVFKGSKFYSMKKVLR 325

Query: 305 KLQRLYPGKFDNVQLASLHSISKGFMGECGQRGGYMEVVGFSKDIRDALFKLMSISICSV 364
            LQ+ Y G++DN+QLASLHS SKG  GECGQRGGYME+VGF+ DIR    KL SIS+C V
Sbjct: 326 NLQKTYHGQYDNIQLASLHSTSKGVSGECGQRGGYMELVGFNHDIRQVFLKLASISLCPV 385

Query: 365 VTGQAVVDLMVKPPQPGDESYDQDHSERMKIFHEMYTRATLLHETFNELEGIECQKPQGA 424
           VTGQA+VDLMV PPQPGDESY+QD  ER  I   +  RA+ L ETF+ LEGIEC+KPQGA
Sbjct: 386 VTGQALVDLMVSPPQPGDESYEQDQQEREDIHDALDERASKLFETFSRLEGIECRKPQGA 445

Query: 425 MYLFPRLVLPEKALRESERLGIEPDEFYCTSLLESTGICTVPGSGFGQQPGTYHVRTTFL 484
           MYL+P+L LP K ++E++ L +EPDEFYC +LLE+TGICTVPGSGFGQ PGTYH+RTTFL
Sbjct: 446 MYLYPKLDLPYKVIQEAQHLEMEPDEFYCKALLENTGICTVPGSGFGQVPGTYHLRTTFL 505

Query: 485 APGTQWIQDWKHFHQDFFNKYRD 507
            PGT+W++ W+ FH+ FF+KYRD
Sbjct: 506 PPGTEWVETWEKFHKAFFDKYRD 528

>KNAG0G02040 Chr7 complement(463058..464833) [1776 bp, 591 aa] {ON}
           Anc_8.263 YDR111C
          Length = 591

 Score =  660 bits (1703), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 314/490 (64%), Positives = 388/490 (79%), Gaps = 2/490 (0%)

Query: 20  FKPAAKITKKDLNAGVTKAEYAVRGAIPTRADELKEELKRKPGVLPFDDIINANIGNPQQ 79
           F PAA++   DLN  V KA+YAVRG+IP RA++L+ +L+  P  LPFD IINANIGNPQQ
Sbjct: 102 FTPAAQVKIADLNENVLKAKYAVRGSIPMRAEQLQHQLQEDPRSLPFDKIINANIGNPQQ 161

Query: 80  LDQKPLTFTRQVLSILEYPEILR-VGPDKLASLNLFRKDALGRAEHLLEDIGGSIGAYSH 138
           L+QKPL+F RQVLS+L++PE+L  +  +  A+ +L++ DA+ RAE LLEDIGGS+GAYS 
Sbjct: 162 LNQKPLSFYRQVLSLLQFPELLNSLKENPAAATSLYKADAVRRAEKLLEDIGGSVGAYST 221

Query: 139 SQGVPGIRQSVAEFITKRDDGEPAAPENIYXXXXXXXXXXXXXXXXCKDVQTGLLIPIPQ 198
           SQGV GIR++VA+FIT+RD+ EPA PE+I+                CK  +TG+LIPIPQ
Sbjct: 222 SQGVMGIRKTVADFITRRDNNEPAYPEDIFLTAGASAAVSYLLSIFCKGEKTGVLIPIPQ 281

Query: 199 YPLYTASASLFNAQVLPYYLDEGSNWSTKSDEIEKVVKDALEKGIKPSVLIVINPGNPTG 258
           YPLYTA+ +L N+  LPYYLDE S WST + EI+ VV DA+++ IKPSVL+VINPGNPTG
Sbjct: 282 YPLYTATLALNNSHTLPYYLDEKSGWSTNTKEIDSVVLDAIDRNIKPSVLVVINPGNPTG 341

Query: 259 AVLSEDTIAKICLIAAKYGIAIISDEVYQENVFN-GVKFHSMKKVLRKLQRLYPGKFDNV 317
           AVLSE  IA+I  IAAKYGI +I+DEVYQEN+F+  VKFHSMKKVLRKLQ+ +PGKFD V
Sbjct: 342 AVLSEKAIAEIFEIAAKYGIVVIADEVYQENIFDEDVKFHSMKKVLRKLQQEHPGKFDEV 401

Query: 318 QLASLHSISKGFMGECGQRGGYMEVVGFSKDIRDALFKLMSISICSVVTGQAVVDLMVKP 377
           QLASLHS SKG  GECGQRGG+ME+ GFS +IR  + KL SIS+C VVTGQA+VDLMV P
Sbjct: 402 QLASLHSTSKGVSGECGQRGGFMELTGFSHEIRQVILKLASISLCPVVTGQALVDLMVHP 461

Query: 378 PQPGDESYDQDHSERMKIFHEMYTRATLLHETFNELEGIECQKPQGAMYLFPRLVLPEKA 437
           PQ G+ESY+ D +ER  I  E++ RA  L ETFN LEGI+CQKPQGAMYLFPRL LP KA
Sbjct: 462 PQEGEESYELDQAERSHIHSELHKRANKLWETFNRLEGIQCQKPQGAMYLFPRLNLPFKA 521

Query: 438 LRESERLGIEPDEFYCTSLLESTGICTVPGSGFGQQPGTYHVRTTFLAPGTQWIQDWKHF 497
           +++++ + +  DEFYC  LLE+TGICTVPGSGFGQ PGTYH+RTTFLAPGT+WI  W+ F
Sbjct: 522 VQKAQHMEMTADEFYCKELLENTGICTVPGSGFGQVPGTYHLRTTFLAPGTEWIDLWEKF 581

Query: 498 HQDFFNKYRD 507
           H++F+NKYRD
Sbjct: 582 HKEFYNKYRD 591

>ZYRO0C01628g Chr3 (115665..117269) [1605 bp, 534 aa] {ON} similar
           to uniprot|P52893 Saccharomyces cerevisiae YLR089C ALT1
           putative alanine transaminase (glutamyc pyruvic
           transaminase)
          Length = 534

 Score =  652 bits (1682), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 308/486 (63%), Positives = 372/486 (76%)

Query: 22  PAAKITKKDLNAGVTKAEYAVRGAIPTRADELKEELKRKPGVLPFDDIINANIGNPQQLD 81
           PA K+   ++N  V KA+YAVRGAIP  A EL  +LK+ P  LPFD+I++ANIGNPQ L 
Sbjct: 49  PAEKLGLSEVNENVLKAKYAVRGAIPMLAAELNAKLKKDPHSLPFDNIVSANIGNPQHLK 108

Query: 82  QKPLTFTRQVLSILEYPEILRVGPDKLASLNLFRKDALGRAEHLLEDIGGSIGAYSHSQG 141
           QKPLTF RQVLS+L+YP +L      L    L++KDA+ RA  LL DIG S+GAYS SQG
Sbjct: 109 QKPLTFYRQVLSLLQYPGLLEENEQVLIDSKLYQKDAIARARRLLNDIGSSVGAYSTSQG 168

Query: 142 VPGIRQSVAEFITKRDDGEPAAPENIYXXXXXXXXXXXXXXXXCKDVQTGLLIPIPQYPL 201
           + GIR++VA+FIT+RD GE A  E+I+                CK  +TG+LIPIPQYPL
Sbjct: 169 IQGIRETVAQFITERDGGEKAYAEDIFLTAGASSAVSYLLSILCKGQETGVLIPIPQYPL 228

Query: 202 YTASASLFNAQVLPYYLDEGSNWSTKSDEIEKVVKDALEKGIKPSVLIVINPGNPTGAVL 261
           YTAS +L N+  LPYYLDE S WST   EIE VV +A+E+ IKPSVL+VINPGNPTGAVL
Sbjct: 229 YTASLALNNSHPLPYYLDEKSGWSTNPTEIEDVVNNAIEQNIKPSVLVVINPGNPTGAVL 288

Query: 262 SEDTIAKICLIAAKYGIAIISDEVYQENVFNGVKFHSMKKVLRKLQRLYPGKFDNVQLAS 321
           SE+ I++I  IAAKYGI +I+DEVYQENVF+G +FHSMKK+LRKLQ+  PG FDNVQLAS
Sbjct: 289 SEEDISQIFAIAAKYGIVVIADEVYQENVFDGAEFHSMKKILRKLQKSNPGVFDNVQLAS 348

Query: 322 LHSISKGFMGECGQRGGYMEVVGFSKDIRDALFKLMSISICSVVTGQAVVDLMVKPPQPG 381
           LHS SKG  GECGQRGGYME+ GF+ DIR  + KL SIS+C VVTGQA+VDLMV PP+PG
Sbjct: 349 LHSTSKGVSGECGQRGGYMEITGFNNDIRQVILKLASISLCPVVTGQALVDLMVSPPKPG 408

Query: 382 DESYDQDHSERMKIFHEMYTRATLLHETFNELEGIECQKPQGAMYLFPRLVLPEKALRES 441
           DESY+ D  ER  I   +  RA  LH TFN LEGIECQKP+GAMYLFPRL+LP KA++ +
Sbjct: 409 DESYELDQQERKSIHEALAERAGKLHATFNSLEGIECQKPEGAMYLFPRLLLPFKAIQSA 468

Query: 442 ERLGIEPDEFYCTSLLESTGICTVPGSGFGQQPGTYHVRTTFLAPGTQWIQDWKHFHQDF 501
           E  G+ PD FYC  LLE+TGICTVPGSGFGQ+PGTYH+RTTFLAPGT+WI+ W++FH+ F
Sbjct: 469 EHEGMTPDAFYCKKLLEATGICTVPGSGFGQEPGTYHLRTTFLAPGTEWIERWENFHKAF 528

Query: 502 FNKYRD 507
           + +YRD
Sbjct: 529 YEEYRD 534

>CAGL0L12254g Chr12 complement(1327111..1328835) [1725 bp, 574 aa]
           {ON} similar to uniprot|P52893 Saccharomyces cerevisiae
           YLR089c
          Length = 574

 Score =  649 bits (1675), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 308/492 (62%), Positives = 382/492 (77%), Gaps = 2/492 (0%)

Query: 16  KDLNFKPAAKITKKDLNAGVTKAEYAVRGAIPTRADELKEELKRKPGVLPFDDIINANIG 75
            +L F PA + T KD+N  V  A+YAVRGAIP RA+ELK +L   P  LPF+DIINANIG
Sbjct: 85  NNLPFLPAEQATLKDVNECVLNAKYAVRGAIPMRAEELKTQLMENPHSLPFNDIINANIG 144

Query: 76  NPQQLDQKPLTFTRQVLSILEYPEILRVGPDKLASLNLFRKDALGRAEHLLEDIGGSIGA 135
           NPQQL QKPL+F RQVLS+L+YPE++    +   ++   ++DA+ RA+ LL+DIGGS+GA
Sbjct: 145 NPQQLKQKPLSFYRQVLSLLQYPELIPTLENNPQTM--IKQDAIDRAKRLLDDIGGSVGA 202

Query: 136 YSHSQGVPGIRQSVAEFITKRDDGEPAAPENIYXXXXXXXXXXXXXXXXCKDVQTGLLIP 195
           YS SQGV GIR++VA+FIT RDDG  A PE+I+                C+  +TG+LIP
Sbjct: 203 YSSSQGVLGIRKTVADFITNRDDGIIAYPEDIFLTAGASSAVDYLLSIFCRGEETGVLIP 262

Query: 196 IPQYPLYTASASLFNAQVLPYYLDEGSNWSTKSDEIEKVVKDALEKGIKPSVLIVINPGN 255
           IPQYPLYTA+ +L N+  LPYYL+E + WST  +E+E ++ D++E  IKPSVL+VINPGN
Sbjct: 263 IPQYPLYTATLALQNSHALPYYLNEETGWSTDPEELESIILDSIENNIKPSVLVVINPGN 322

Query: 256 PTGAVLSEDTIAKICLIAAKYGIAIISDEVYQENVFNGVKFHSMKKVLRKLQRLYPGKFD 315
           PTGAVLSE+ I +I  +AAKYGI +I+DEVYQENVF  VKFHSMKKVLR+LQ   PG +D
Sbjct: 323 PTGAVLSEEAIEQIFTLAAKYGIIVIADEVYQENVFEDVKFHSMKKVLRQLQMKQPGLYD 382

Query: 316 NVQLASLHSISKGFMGECGQRGGYMEVVGFSKDIRDALFKLMSISICSVVTGQAVVDLMV 375
           NVQLASLHS SKG  GECGQRGGYME+VGF+ DIR  + KL SIS+C VVTGQA+VDLMV
Sbjct: 383 NVQLASLHSTSKGVSGECGQRGGYMELVGFTHDIRQVVLKLASISLCPVVTGQALVDLMV 442

Query: 376 KPPQPGDESYDQDHSERMKIFHEMYTRATLLHETFNELEGIECQKPQGAMYLFPRLVLPE 435
            PPQ G+ESY+QD  ER  I  E++ RATLLH+ F +L+GI CQKPQGAMYLFP+L LP 
Sbjct: 443 CPPQKGEESYEQDQEERRNIHKELHKRATLLHDAFVKLDGISCQKPQGAMYLFPKLELPY 502

Query: 436 KALRESERLGIEPDEFYCTSLLESTGICTVPGSGFGQQPGTYHVRTTFLAPGTQWIQDWK 495
           KA++E+    + PDEFYC SLLE TGICTVPGSGFGQ+PGTYH+RTTFLAPGT+WI+DW 
Sbjct: 503 KAIQEALHQDMSPDEFYCKSLLEKTGICTVPGSGFGQEPGTYHLRTTFLAPGTKWIEDWV 562

Query: 496 HFHQDFFNKYRD 507
            FHQ+F+NK+++
Sbjct: 563 DFHQEFYNKFKN 574

>KAFR0B05520 Chr2 (1130297..1131829) [1533 bp, 510 aa] {ON}
           Anc_8.263 YDR111C
          Length = 510

 Score =  640 bits (1650), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 306/490 (62%), Positives = 381/490 (77%), Gaps = 4/490 (0%)

Query: 19  NFKPAAKITKKDLNAGVTKAEYAVRGAIPTRADELKEEL--KRKPGVLPFDDIINANIGN 76
           +F+PA KI+  DLN  +  AEYAVRG+I  RA+EL+ EL  K +P   PF+ II ANIGN
Sbjct: 23  DFEPAPKISVADLNQKIINAEYAVRGSIAMRAEELEFELYHKTQPHSFPFERIIYANIGN 82

Query: 77  PQQLDQKPLTFTRQVLSILEYPEILRVGPDKLASLNLFRKDALGRAEHLLEDIGGSIGAY 136
           PQQLDQKPLTF+RQV+SILEYP +L+   D L S  +++KDAL RAE L   IG S+GAY
Sbjct: 83  PQQLDQKPLTFSRQVMSILEYPGLLKF-KDVLLSQGIYKKDALERAELLQSQIGASVGAY 141

Query: 137 SHSQGVPGIRQSVAEFITKRDDGEPAAPENIYXXXXXXXXXXXXXXXXCKDVQTGLLIPI 196
           S +QGV GIR++ A FI+KRD+ E A+ ++I+                C++  TG+LIPI
Sbjct: 142 SLAQGVYGIRETTARFISKRDNCEAASADDIFLTDGASKAVTYLMMALCQNEHTGILIPI 201

Query: 197 PQYPLYTASASLFNAQVLPYYLDEGSNWSTKSDEIEKVVKDALEKGIKPSVLIVINPGNP 256
           PQYPLYTAS  + NA++LPYYLDE S WSTK +EIE  V +A+E GIKPS ++VINPGNP
Sbjct: 202 PQYPLYTASICIHNAKMLPYYLDEESGWSTKVEEIENSVINAIENGIKPSAMVVINPGNP 261

Query: 257 TGAVLSEDTIAKICLIAAKYGIAIISDEVYQENVFNGVKFHSMKKVLRKLQRLYPGKFDN 316
           TGAVLS D I +I  +AAKYGI +I+DEVYQ+N+FNG +FHSMKK+LR+LQ+ YPGK+DN
Sbjct: 262 TGAVLSVDVIQRIITVAAKYGIVLIADEVYQDNIFNG-EFHSMKKILRQLQKKYPGKYDN 320

Query: 317 VQLASLHSISKGFMGECGQRGGYMEVVGFSKDIRDALFKLMSISICSVVTGQAVVDLMVK 376
           VQLASLHS SKG  GECGQRGGYME+VGFS ++R  L KL SI+ICSVVTGQA+VDLMV 
Sbjct: 321 VQLASLHSTSKGVSGECGQRGGYMEIVGFSDEVRHLLLKLASINICSVVTGQALVDLMVD 380

Query: 377 PPQPGDESYDQDHSERMKIFHEMYTRATLLHETFNELEGIECQKPQGAMYLFPRLVLPEK 436
           PP  GDESY++D  ER +I   +  RA  L++TF+ LEGIECQKPQGAMYLFPRL+LP++
Sbjct: 381 PPHVGDESYEKDQEERNEIHSTLKKRADKLYDTFSNLEGIECQKPQGAMYLFPRLILPDR 440

Query: 437 ALRESERLGIEPDEFYCTSLLESTGICTVPGSGFGQQPGTYHVRTTFLAPGTQWIQDWKH 496
           A+ E+++L +E DEFYC  LLE+TGICTVPGSGFGQ+ GTYHVRTTFL+PGT+WI DWK 
Sbjct: 441 AIEEAKKLQMEADEFYCHKLLENTGICTVPGSGFGQREGTYHVRTTFLSPGTEWIDDWKK 500

Query: 497 FHQDFFNKYR 506
           FH+ F  +Y+
Sbjct: 501 FHEKFMKEYQ 510

>Kpol_392.5 s392 (6873..8411) [1539 bp, 512 aa] {ON} (6873..8411)
           [1539 nt, 513 aa]
          Length = 512

 Score =  639 bits (1649), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 302/489 (61%), Positives = 375/489 (76%), Gaps = 8/489 (1%)

Query: 19  NFKPAAKITKKDLNAGVTKAEYAVRGAIPTRADELKEELKRKPGVLPFDDIINANIGNPQ 78
           N  PA K+   DLN  V KA+YAVRG+IP RA+ELK  L+     LPFD +INANIGNPQ
Sbjct: 32  NVYPAQKLRMDDLNKNVLKAKYAVRGSIPLRAEELKLYLEAGQK-LPFDTVINANIGNPQ 90

Query: 79  QLDQKPLTFTRQVLSILEYPEILRVGPDKLASLNLFRKDALGRAEHLLEDIGGSIGAYSH 138
           QL QKPLTF RQVLSIL+YPE+L  G       N+F+KDA+ RA  LL++IG S+G+YS 
Sbjct: 91  QLKQKPLTFYRQVLSILQYPELLESGS------NIFKKDAIERARKLLKEIG-SVGSYSS 143

Query: 139 SQGVPGIRQSVAEFITKRDDGEPAAPENIYXXXXXXXXXXXXXXXXCKDVQTGLLIPIPQ 198
           SQG+P IR++VA FITKRDDGE + P +I+                CK+ ++G+LIPIPQ
Sbjct: 144 SQGIPAIRKTVANFITKRDDGEISTPNDIFLTAGASSAVDYLLSILCKNEKSGVLIPIPQ 203

Query: 199 YPLYTASASLFNAQVLPYYLDEGSNWSTKSDEIEKVVKDALEKGIKPSVLIVINPGNPTG 258
           YPLYTA+ +L NA  LPYYLDE   WST  +EIE+V+ D+L+KGIKP+ L++INPGNPTG
Sbjct: 204 YPLYTATLALNNAHALPYYLDESKGWSTDINEIEEVINDSLDKGIKPTALVIINPGNPTG 263

Query: 259 AVLSEDTIAKICLIAAKYGIAIISDEVYQENVFNGVKFHSMKKVLRKLQRLYPGKFDNVQ 318
           ++LS +++ KI  +AA +GI II+DEVYQENVFN  KFHSMKKVLR LQ+ +PG++D VQ
Sbjct: 264 SILSVESMEKIIEVAATHGIVIIADEVYQENVFNNAKFHSMKKVLRNLQKAFPGEYDTVQ 323

Query: 319 LASLHSISKGFMGECGQRGGYMEVVGFSKDIRDALFKLMSISICSVVTGQAVVDLMVKPP 378
           LASLHS SKG  GECGQRGGYME+ GF+ +I+  + KL SIS+C VVTGQA+VDLMV PP
Sbjct: 324 LASLHSTSKGVSGECGQRGGYMELTGFNPEIKQVILKLCSISLCPVVTGQALVDLMVSPP 383

Query: 379 QPGDESYDQDHSERMKIFHEMYTRATLLHETFNELEGIECQKPQGAMYLFPRLVLPEKAL 438
           Q GDESY+QD  ER  I +++  RA LL E FN +EG+ CQKP+GAMYLFP++ LP K L
Sbjct: 384 QKGDESYEQDQLERSTILNDLSNRAILLWEAFNSMEGVSCQKPEGAMYLFPKIDLPFKVL 443

Query: 439 RESERLGIEPDEFYCTSLLESTGICTVPGSGFGQQPGTYHVRTTFLAPGTQWIQDWKHFH 498
           ++S+ L I PDEFYC +LLE+TGICTVPGSGFGQQPGTYH+RTTFLAPGT+WI  W  FH
Sbjct: 444 QKSQELDITPDEFYCKALLEATGICTVPGSGFGQQPGTYHLRTTFLAPGTEWIDRWNKFH 503

Query: 499 QDFFNKYRD 507
            +F++KYRD
Sbjct: 504 AEFYDKYRD 512

>NCAS0B03840 Chr2 (683781..685274) [1494 bp, 497 aa] {ON} Anc_8.263
           YDR111C
          Length = 497

 Score =  638 bits (1646), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 296/497 (59%), Positives = 384/497 (77%), Gaps = 1/497 (0%)

Query: 11  SVFTTKDLNFKPAAKITKKDLNAGVTKAEYAVRGAIPTRADELKEELKRKPGVLPFDDII 70
           S  + ++ +F+PA K++ KD+N  V  A++A+RG+I  +A++L+ +L + P  LPFD+I 
Sbjct: 2   SPLSLENNDFQPAPKLSLKDINENVVDAKFAIRGSISIKAEDLQVQLNKNPHCLPFDEIT 61

Query: 71  NANIGNPQQLDQKPLTFTRQVLSILEYPEILRVGPDKLASLNLFRKDALGRAEHLLEDIG 130
            ANIGNPQ+L+QKPLTF RQV+SIL+YPE+L    D L    +F  D+  RAE LL DIG
Sbjct: 62  VANIGNPQELNQKPLTFARQVVSILQYPELLN-NRDVLTKEKIFNSDSFDRAERLLRDIG 120

Query: 131 GSIGAYSHSQGVPGIRQSVAEFITKRDDGEPAAPENIYXXXXXXXXXXXXXXXXCKDVQT 190
           GS+GAYS SQGV GIR++ AE+ITKRD GEP+ PE+I+                C+  QT
Sbjct: 121 GSVGAYSASQGVYGIRKTAAEYITKRDGGEPSYPEDIFLTTGATSAASYLLSVLCRGPQT 180

Query: 191 GLLIPIPQYPLYTASASLFNAQVLPYYLDEGSNWSTKSDEIEKVVKDALEKGIKPSVLIV 250
           G+LIPIPQYPLYTA+ +L  + ++PYYLDE S WST + EIEK+V D+++KGIKPSV++V
Sbjct: 181 GVLIPIPQYPLYTATLALNKSTMIPYYLDEESAWSTNTTEIEKLVLDSIKKGIKPSVIVV 240

Query: 251 INPGNPTGAVLSEDTIAKICLIAAKYGIAIISDEVYQENVFNGVKFHSMKKVLRKLQRLY 310
           INPGNPTGAVLSE  IAKI  IAAKYGI +++DEVYQEN+F+GV+FHS KKVLR LQ+ Y
Sbjct: 241 INPGNPTGAVLSELAIAKIFQIAAKYGIVVLADEVYQENIFDGVQFHSTKKVLRGLQKQY 300

Query: 311 PGKFDNVQLASLHSISKGFMGECGQRGGYMEVVGFSKDIRDALFKLMSISICSVVTGQAV 370
           PGKFDN+QLAS+HS SKG  GECGQRGGYME+VGF+ ++R  L KL  +++CSVVTGQA+
Sbjct: 301 PGKFDNIQLASMHSTSKGVFGECGQRGGYMELVGFTDEVRQLLLKLACLAVCSVVTGQAM 360

Query: 371 VDLMVKPPQPGDESYDQDHSERMKIFHEMYTRATLLHETFNELEGIECQKPQGAMYLFPR 430
           VDLM+ PP+ GD SY+ D  ER +IF  MY RA  L+  F++L+GIECQKPQGAMYL+P 
Sbjct: 361 VDLMLLPPKKGDASYELDKKERQEIFDAMYERARKLYAMFDKLDGIECQKPQGAMYLYPS 420

Query: 431 LVLPEKALRESERLGIEPDEFYCTSLLESTGICTVPGSGFGQQPGTYHVRTTFLAPGTQW 490
           L+L +KA+ ++E L + PDEFYC  LL++TGICTVPGSGFGQ+ GTYH+RTTFLAPG +W
Sbjct: 421 LILSKKAIAKAESLNLTPDEFYCHELLDATGICTVPGSGFGQKKGTYHLRTTFLAPGIEW 480

Query: 491 IQDWKHFHQDFFNKYRD 507
           I  W+ FH+ F+ KY+D
Sbjct: 481 INKWEKFHKHFYEKYQD 497

>KAFR0B05530 Chr2 (1132895..1134439) [1545 bp, 514 aa] {ON} 
          Length = 514

 Score =  629 bits (1622), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 302/490 (61%), Positives = 377/490 (76%), Gaps = 4/490 (0%)

Query: 19  NFKPAAKITKKDLNAGVTKAEYAVRGAIPTRADELKEEL--KRKPGVLPFDDIINANIGN 76
           NFKPA KIT  DLN  V K+EYAVRG+IP RA+EL+ EL        L F++I++ANIGN
Sbjct: 27  NFKPAKKITLDDLNQNVLKSEYAVRGSIPRRAEELEFELLNNDSSDSLAFENIVHANIGN 86

Query: 77  PQQLDQKPLTFTRQVLSILEYPEILRVGPDKLASLNLFRKDALGRAEHLLEDIGGSIGAY 136
           PQQLDQKPLTF+RQV+SIL+YPE+L    + L S  +F+ DA+ RAE LL  IGGS+GAY
Sbjct: 87  PQQLDQKPLTFSRQVISILQYPELLN-QRNILVSTGIFKSDAMERAETLLCHIGGSVGAY 145

Query: 137 SHSQGVPGIRQSVAEFITKRDDGEPAAPENIYXXXXXXXXXXXXXXXXCKDVQTGLLIPI 196
           S SQGV GIR++VA +IT RD+GE A+P++I+                CKD  TG+LIPI
Sbjct: 146 SSSQGVYGIRETVANYITARDNGETASPDDIFLTEGASKAASYLLSLLCKDKNTGVLIPI 205

Query: 197 PQYPLYTASASLFNAQVLPYYLDEGSNWSTKSDEIEKVVKDALEKGIKPSVLIVINPGNP 256
           PQYPLYTA+ +L +A++LPYYL+E S WST ++EIEKVV DA+   +KPSV++VINPGNP
Sbjct: 206 PQYPLYTATITLCDAKMLPYYLNEESGWSTNTNEIEKVVLDAIADNVKPSVMVVINPGNP 265

Query: 257 TGAVLSEDTIAKICLIAAKYGIAIISDEVYQENVFNGVKFHSMKKVLRKLQRLYPGKFDN 316
           TG+VLS+D I  I  I AKYGI +I+DEVYQEN+F+G +FHSMKKVLR LQ+ YPGK+D 
Sbjct: 266 TGSVLSKDDIIHIINIGAKYGIVLIADEVYQENIFDG-EFHSMKKVLRSLQKQYPGKYDA 324

Query: 317 VQLASLHSISKGFMGECGQRGGYMEVVGFSKDIRDALFKLMSISICSVVTGQAVVDLMVK 376
           VQLASLHS SKG  GECGQRGGYME+VGF  +IR A+ KL SIS+CSV+TGQA+VDLMV 
Sbjct: 325 VQLASLHSTSKGVSGECGQRGGYMELVGFKDEIRQAILKLASISLCSVITGQALVDLMVN 384

Query: 377 PPQPGDESYDQDHSERMKIFHEMYTRATLLHETFNELEGIECQKPQGAMYLFPRLVLPEK 436
           PP+ GDESY+ D+ ER  I   +  RA  L+  F +L+G+ECQKPQGAMYLFP+L  P+ 
Sbjct: 385 PPKKGDESYELDNFERKNIHETLKERAEKLYNLFCQLKGVECQKPQGAMYLFPKLHFPQT 444

Query: 437 ALRESERLGIEPDEFYCTSLLESTGICTVPGSGFGQQPGTYHVRTTFLAPGTQWIQDWKH 496
            + E+    + PDEFYC +LLE+TGICTVPGSGFGQ+ GTYH+RTTFLAPG QW + WK 
Sbjct: 445 LITEAINQNMSPDEFYCHALLEATGICTVPGSGFGQKEGTYHLRTTFLAPGNQWTEKWKL 504

Query: 497 FHQDFFNKYR 506
           FH++FF+KY+
Sbjct: 505 FHEEFFSKYQ 514

>KAFR0B02730 Chr2 complement(558858..560477) [1620 bp, 539 aa] {ON}
           Anc_8.263 YDR111C
          Length = 539

 Score =  627 bits (1617), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 304/491 (61%), Positives = 375/491 (76%)

Query: 17  DLNFKPAAKITKKDLNAGVTKAEYAVRGAIPTRADELKEELKRKPGVLPFDDIINANIGN 76
           +LNFKPA ++T  DLN  V KA+YAVRG IPTRA+ELK +L  KP  LPFD IINANIGN
Sbjct: 49  NLNFKPAGQLTIGDLNENVLKAKYAVRGKIPTRAEELKRQLAEKPNSLPFDKIINANIGN 108

Query: 77  PQQLDQKPLTFTRQVLSILEYPEILRVGPDKLASLNLFRKDALGRAEHLLEDIGGSIGAY 136
           PQQL Q+PL+F RQVLS+L+YP +L     K  S  +++KDA+ RA+ +L+DIGGS+GAY
Sbjct: 109 PQQLQQQPLSFYRQVLSLLQYPTLLHAIETKPGSSAVYKKDAILRAKKILKDIGGSVGAY 168

Query: 137 SHSQGVPGIRQSVAEFITKRDDGEPAAPENIYXXXXXXXXXXXXXXXXCKDVQTGLLIPI 196
           S SQGV GIR++VA FIT+RD GEPA PE+I+                CK  +TG+LIPI
Sbjct: 169 SESQGVYGIRRTVANFITERDGGEPAYPEDIFLTAGASAAVNYLLSILCKGEKTGVLIPI 228

Query: 197 PQYPLYTASASLFNAQVLPYYLDEGSNWSTKSDEIEKVVKDALEKGIKPSVLIVINPGNP 256
           PQYPLYTA+ +L N+  LPY+LDE + WS    EIE V+K A++  IKP VL+VINPGNP
Sbjct: 229 PQYPLYTATLALNNSHALPYFLDEMNGWSINPIEIENVIKKAVQDNIKPDVLVVINPGNP 288

Query: 257 TGAVLSEDTIAKICLIAAKYGIAIISDEVYQENVFNGVKFHSMKKVLRKLQRLYPGKFDN 316
           TGAVLS++ I  I  IAAKYGI +I+DEVYQEN+F+G+KFHS+K VLR+LQR  PGKFDN
Sbjct: 289 TGAVLSKEAIVSILEIAAKYGIVVIADEVYQENIFDGMKFHSVKGVLRRLQREIPGKFDN 348

Query: 317 VQLASLHSISKGFMGECGQRGGYMEVVGFSKDIRDALFKLMSISICSVVTGQAVVDLMVK 376
           VQLASLHS SKG  GECGQRGGYME++GF+ ++R  + KL SIS+C VVTGQA+VDLMV 
Sbjct: 349 VQLASLHSTSKGVSGECGQRGGYMEIIGFTHEVRQVILKLASISLCPVVTGQALVDLMVS 408

Query: 377 PPQPGDESYDQDHSERMKIFHEMYTRATLLHETFNELEGIECQKPQGAMYLFPRLVLPEK 436
           PP+ G+ES+  D ++R  I  ++  RA LL +TFN L+GIECQKP GAMYLFP+L LP +
Sbjct: 409 PPKRGEESFALDQAQRKTIHSQLSQRAELLWKTFNSLDGIECQKPNGAMYLFPKLNLPYR 468

Query: 437 ALRESERLGIEPDEFYCTSLLESTGICTVPGSGFGQQPGTYHVRTTFLAPGTQWIQDWKH 496
           A++E++RL + PDEFYC  LLE TGICTVPGSGFGQ  GTYH+RTTFLAPG +WI  WK 
Sbjct: 469 AIQEAQRLELSPDEFYCKELLEHTGICTVPGSGFGQVAGTYHLRTTFLAPGIEWIDSWKQ 528

Query: 497 FHQDFFNKYRD 507
           FH +F  KY  
Sbjct: 529 FHIEFMEKYNS 539

>KLTH0G13662g Chr7 (1169989..1171548) [1560 bp, 519 aa] {ON} similar
           to uniprot|P52893 Saccharomyces cerevisiae YLR089C ALT1
           putative alanine transaminase (glutamyc pyruvic
           transaminase)
          Length = 519

 Score =  613 bits (1582), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 292/505 (57%), Positives = 374/505 (74%), Gaps = 6/505 (1%)

Query: 3   MTHQQDLKSVFTTKDLNFKPAAKITKKDLNAGVTKAEYAVRGAIPTRADELKEELKRKPG 62
           ++ +  +KS  + K L     +K T +D+N  V  A+YAVRG IP RA+EL+ +L  +PG
Sbjct: 21  LSAKAAVKSDLSQKAL----GSKKTLRDVNQCVLNAKYAVRGPIPLRAEELRHKLVEEPG 76

Query: 63  VLPFDDIINANIGNPQQLDQKPLTFTRQVLSILEYPEILRVGPDKLASLNLFRKDALGRA 122
            LPF+ IINANIGNPQQLDQKPLTF RQVLS+L+ P ++   P       LF+ DA+ RA
Sbjct: 77  SLPFNKIINANIGNPQQLDQKPLTFYRQVLSLLQNPALIESLPTGELH-KLFKPDAVERA 135

Query: 123 EHLLEDIGGSIGAYSHSQGVPGIRQSVAEFITKRDDGEPAAPENIYXXXXXXXXXXXXXX 182
           + +L+ +GGS+GAYS SQGV G RQSVAEFI +RD GEPA+  +I+              
Sbjct: 136 KKMLKQVGGSVGAYSASQGVAGFRQSVAEFIEERD-GEPASANDIFLTAGASSAVSAILS 194

Query: 183 XXCKDVQTGLLIPIPQYPLYTASASLFNAQVLPYYLDEGSNWSTKSDEIEKVVKDALEKG 242
             C   + G LIPIPQYPLYTA+ +L +A  LPYYLDE S WS  ++++E+VVKDA+ KG
Sbjct: 195 MFCTGSENGALIPIPQYPLYTATLALNDAHALPYYLDEASGWSMDTEQVEQVVKDAIRKG 254

Query: 243 IKPSVLIVINPGNPTGAVLSEDTIAKICLIAAKYGIAIISDEVYQENVFNGVKFHSMKKV 302
           ++P+ L+VINPGNPTGA+LS + I KI  +AAKY + +I+DEVYQEN F+   F SMKKV
Sbjct: 255 VRPTCLVVINPGNPTGAILSPEAIEKILTVAAKYSLVVIADEVYQENGFDDADFVSMKKV 314

Query: 303 LRKLQRLYPGKFDNVQLASLHSISKGFMGECGQRGGYMEVVGFSKDIRDALFKLMSISIC 362
           LR LQ+  PGK+DNVQLASLHS SKG  GECGQRGGYME+VGFS++++    KL SIS+C
Sbjct: 315 LRVLQKTEPGKYDNVQLASLHSTSKGVSGECGQRGGYMELVGFSEEVKQVFLKLASISLC 374

Query: 363 SVVTGQAVVDLMVKPPQPGDESYDQDHSERMKIFHEMYTRATLLHETFNELEGIECQKPQ 422
            VVTGQA+VDLMV+PP+ GD SY+ D  ER  I + ++ ++TLL+ETF  LEG+ CQKPQ
Sbjct: 375 PVVTGQALVDLMVRPPKKGDASYELDRQERNAIHNSLHQKSTLLYETFQSLEGVSCQKPQ 434

Query: 423 GAMYLFPRLVLPEKALRESERLGIEPDEFYCTSLLESTGICTVPGSGFGQQPGTYHVRTT 482
           GAMYLFP+L L  KA+R++E LG+ PDE+YC  LLE+TGICTVPGSGF Q PGTYH+RTT
Sbjct: 435 GAMYLFPKLDLSRKAIRKAESLGMAPDEYYCKELLEATGICTVPGSGFRQVPGTYHLRTT 494

Query: 483 FLAPGTQWIQDWKHFHQDFFNKYRD 507
           FLAPGT+W+  WK FHQ F +++RD
Sbjct: 495 FLAPGTEWVDSWKKFHQKFVDEHRD 519

>Ecym_4307 Chr4 (652209..653813) [1605 bp, 534 aa] {ON} similar to
           Ashbya gossypii AGR085W
          Length = 534

 Score =  607 bits (1566), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 287/500 (57%), Positives = 380/500 (76%), Gaps = 4/500 (0%)

Query: 9   LKSVFT-TKDLNFKPAAKITKKDLNAGVTKAEYAVRGAIPTRADELKEELKRKPGVLPFD 67
           L+S+ + T  + F+P   +  +DLN+ V +A+YAVRG IP RA EL+ +L R P  LPF 
Sbjct: 38  LRSISSGTSRIRFEPGDPLKLEDLNSNVLEAKYAVRGKIPARAMELERQLSRDPDSLPFK 97

Query: 68  DIINANIGNPQQLDQKPLTFTRQVLSILEYPEILRVGPDKLASLNLFRKDALGRAEHLLE 127
            II ANIGNPQQL QKPL+F+R+VLS+LE P +L++ P ++ +L +++ DA+ RA+ ++ 
Sbjct: 98  KIIYANIGNPQQLGQKPLSFSREVLSLLESPNLLQM-PMEVLNL-IYKPDAVRRAKRMMR 155

Query: 128 DIGGSIGAYSHSQGVPGIRQSVAEFITKRDDGEPAAPENIYXXXXXXXXXXXXXXXXCKD 187
           D+  SIGAYSHSQGV G R++VAE+++ RD GEPA+ E+I+                CK 
Sbjct: 156 DLQTSIGAYSHSQGVLGFRKTVAEYLSSRD-GEPASAEDIFLTTGASNGASLMIELLCKG 214

Query: 188 VQTGLLIPIPQYPLYTASASLFNAQVLPYYLDEGSNWSTKSDEIEKVVKDALEKGIKPSV 247
            ++G+LIPIPQYPLYTA+ +L N   LPYYLDE S WS   D++E+++ +++EKG+KP+ 
Sbjct: 215 QESGVLIPIPQYPLYTATITLNNTVALPYYLDEESGWSLNIDDLERIIIESIEKGVKPAC 274

Query: 248 LIVINPGNPTGAVLSEDTIAKICLIAAKYGIAIISDEVYQENVFNGVKFHSMKKVLRKLQ 307
           L+VINPGNPTGA+L  +++ +I +IAAKY I +I+DEVYQENVF G+KF+SMKKVLR LQ
Sbjct: 275 LVVINPGNPTGAILPVESMERIFVIAAKYSIVVIADEVYQENVFEGLKFYSMKKVLRSLQ 334

Query: 308 RLYPGKFDNVQLASLHSISKGFMGECGQRGGYMEVVGFSKDIRDALFKLMSISICSVVTG 367
           R Y   F NVQL SLHS SKG  GECGQRGGYME+VGFS DIR+ + K+ SI +CS V G
Sbjct: 335 RRYKELFSNVQLVSLHSTSKGLSGECGQRGGYMELVGFSDDIREVILKMASIQLCSPVGG 394

Query: 368 QAVVDLMVKPPQPGDESYDQDHSERMKIFHEMYTRATLLHETFNELEGIECQKPQGAMYL 427
           QA+VDLM+  P+PGDESY++D SER  I + +  R+  L ETFN LEG+EC+KPQG+MYL
Sbjct: 395 QALVDLMLSRPKPGDESYERDLSERSSIRNALQERSKSLWETFNNLEGVECRKPQGSMYL 454

Query: 428 FPRLVLPEKALRESERLGIEPDEFYCTSLLESTGICTVPGSGFGQQPGTYHVRTTFLAPG 487
           FPRLVLP+KA++ +E L ++PDEFYCT LL STGICTVPGSGFGQ P T H+RTTFL PG
Sbjct: 455 FPRLVLPQKAIKAAESLDMQPDEFYCTELLNSTGICTVPGSGFGQAPDTCHLRTTFLCPG 514

Query: 488 TQWIQDWKHFHQDFFNKYRD 507
           T+WI+ W+ FH+ F++KYRD
Sbjct: 515 TEWIESWELFHKSFYDKYRD 534

>NDAI0J01360 Chr10 (313791..315296) [1506 bp, 501 aa] {ON} Anc_8.263
          Length = 501

 Score =  605 bits (1561), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 283/490 (57%), Positives = 369/490 (75%), Gaps = 4/490 (0%)

Query: 19  NFKPAAKITKKDLNAGVTKAEYAVRGAIPTRADELKEELKRKPGVLPFDDIINANIGNPQ 78
           +F+PA K++ KDLN  V KAE+AVRG IP +A EL+ +L + P  LPF++I  ANIGNPQ
Sbjct: 12  DFEPAPKLSIKDLNPNVIKAEFAVRGTIPMKAQELQTQLNKNPHSLPFNEITVANIGNPQ 71

Query: 79  QLDQKPLTFTRQVLSILEYPEILRVGPDKLASLN--LFRKDALGRAEHLLEDIGGSIGAY 136
           +L QKPLTF RQV+SIL+YPE+L    ++L S    ++  D+  RAE LL +IGGS+GAY
Sbjct: 72  ELHQKPLTFARQVVSILQYPELLNRR-NELTSTTPPIYNNDSFDRAEKLLNEIGGSVGAY 130

Query: 137 SHSQGVPGIRQSVAEFITKRDDGEPAAPENIYXXXXXXXXXXXXXXXXCKDVQTGLLIPI 196
           S SQGV GIR+++A +IT+RD GE A+P +I+                    QTG+L+PI
Sbjct: 131 SASQGVYGIRKTIANYITQRDLGESASPNDIFMTTGATAASSYLLSILSNGPQTGVLLPI 190

Query: 197 PQYPLYTASASLFNAQVLPYYLDEGSNWSTKSDEIEKVVK-DALEKGIKPSVLIVINPGN 255
           PQYPLYTA  +L NA +LPYYL+E S WS  ++EIEK +K +A+ KGI+P V+++INPGN
Sbjct: 191 PQYPLYTALLALHNATMLPYYLEEESGWSIDTNEIEKTIKKNAMTKGIQPKVMVIINPGN 250

Query: 256 PTGAVLSEDTIAKICLIAAKYGIAIISDEVYQENVFNGVKFHSMKKVLRKLQRLYPGKFD 315
           PTG++LSED++ KI  IAAKYGI II+DEVYQEN+FNG KFHS KKVLR LQ+ +P +++
Sbjct: 251 PTGSILSEDSLIKIFNIAAKYGIVIIADEVYQENLFNGNKFHSCKKVLRSLQKQFPTQYN 310

Query: 316 NVQLASLHSISKGFMGECGQRGGYMEVVGFSKDIRDALFKLMSISICSVVTGQAVVDLMV 375
           NVQLASLHS SKG  GECGQRGGYME++GF+ D+R+ + KL  I +C VVTGQA++DLM+
Sbjct: 311 NVQLASLHSTSKGLFGECGQRGGYMEIIGFNNDVRNLILKLACIDVCPVVTGQAMMDLMI 370

Query: 376 KPPQPGDESYDQDHSERMKIFHEMYTRATLLHETFNELEGIECQKPQGAMYLFPRLVLPE 435
            PP+ GD+SY  D  ER +I ++M  RA  L++ F+ +EGI+CQKPQGAMYLFPRL+L  
Sbjct: 371 LPPKQGDQSYQLDCIERQQIHNDMLNRAKKLYDMFSHMEGIQCQKPQGAMYLFPRLLLST 430

Query: 436 KALRESERLGIEPDEFYCTSLLESTGICTVPGSGFGQQPGTYHVRTTFLAPGTQWIQDWK 495
           K + E+++  +EPDEFYC  LL  TGICTVPGSGFGQ+P TYH+RTTFLAPG QWI  W+
Sbjct: 431 KVIDEAKKFEMEPDEFYCHELLNETGICTVPGSGFGQKPNTYHLRTTFLAPGDQWINKWE 490

Query: 496 HFHQDFFNKY 505
            FH+ F  +Y
Sbjct: 491 KFHKAFLKRY 500

>Kwal_56.23791 s56 (706946..708502) [1557 bp, 518 aa] {ON} YLR089C -
           Hypothetical ORF [contig 173] FULL
          Length = 518

 Score =  605 bits (1560), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 290/496 (58%), Positives = 373/496 (75%), Gaps = 9/496 (1%)

Query: 16  KDLNFKP-AAKITKKDLNAGVTKAEYAVRGAIPTRADELKEELKRKPGVLPFDDIINANI 74
           KD + KP  +K T +D+N  V  A+YAVRG IP RA+ELK++L  +PG LPFD IINANI
Sbjct: 28  KDYSQKPLGSKKTLQDINECVLNAKYAVRGLIPLRAEELKQKLLEEPGSLPFDKIINANI 87

Query: 75  GNPQQLDQKPLTFTRQVLSILEYPEILRVGPDKLASLNL---FRKDALGRAEHLLEDIGG 131
           GNPQQLDQKPLTF RQVL++L+ P+++      L+S  L   F+ DA+ RA+ +L+ +GG
Sbjct: 88  GNPQQLDQKPLTFYRQVLALLQNPDLI----SDLSSGELHKFFKPDAVERAKKMLKQVGG 143

Query: 132 SIGAYSHSQGVPGIRQSVAEFITKRDDGEPAAPENIYXXXXXXXXXXXXXXXXCKDVQTG 191
           S+GAYS+SQGV G R+SVAEFI +RD GEPA+ ++I+                C   + G
Sbjct: 144 SVGAYSNSQGVAGFRESVAEFIEERD-GEPASAQDIFLTTGASGAVSYILSLFCNGPENG 202

Query: 192 LLIPIPQYPLYTASASLFNAQVLPYYLDEGSNWSTKSDEIEKVVKDALEKGIKPSVLIVI 251
            LIPIPQYPLYTAS +L N+  LPYYLDE S WS  +++IEKVV+D+++KGI+P+ L+VI
Sbjct: 203 ALIPIPQYPLYTASLALNNSHALPYYLDEESGWSMDTEQIEKVVQDSIKKGIRPTCLVVI 262

Query: 252 NPGNPTGAVLSEDTIAKICLIAAKYGIAIISDEVYQENVFNGVKFHSMKKVLRKLQRLYP 311
           NPGNPTGA+L+ DTI  +  +AAKY + II+DEVYQEN FN  +F SMKKVLR LQ+  P
Sbjct: 263 NPGNPTGALLNTDTIENVIKVAAKYSMVIIADEVYQENGFNDAEFVSMKKVLRVLQKTEP 322

Query: 312 GKFDNVQLASLHSISKGFMGECGQRGGYMEVVGFSKDIRDALFKLMSISICSVVTGQAVV 371
           GK+DNVQLASLHS SKG  GECGQRGGYME+VGFS++++    KL SIS+C VVTGQA++
Sbjct: 323 GKYDNVQLASLHSTSKGVSGECGQRGGYMELVGFSEEVKQVFLKLASISLCPVVTGQALI 382

Query: 372 DLMVKPPQPGDESYDQDHSERMKIFHEMYTRATLLHETFNELEGIECQKPQGAMYLFPRL 431
           DLMV+PP+ GD SY+QD  ER  I   ++ R+ LL++ F  +EG+ CQ+PQGAMYLFP+L
Sbjct: 383 DLMVRPPKKGDASYEQDRQERCDIHDALHKRSGLLYQAFQSMEGVSCQEPQGAMYLFPKL 442

Query: 432 VLPEKALRESERLGIEPDEFYCTSLLESTGICTVPGSGFGQQPGTYHVRTTFLAPGTQWI 491
            L  KA+ ++E  G+ PDE+YC  LLE+TGICTVPGSGFGQ PGT+H+RTTFLAPGT+WI
Sbjct: 443 ELSNKAIHKAESAGLAPDEYYCKELLEATGICTVPGSGFGQVPGTFHLRTTFLAPGTEWI 502

Query: 492 QDWKHFHQDFFNKYRD 507
             WK FH+ F   +RD
Sbjct: 503 DSWKKFHEKFTEDHRD 518

>TPHA0J00750 Chr10 complement(176561..178129) [1569 bp, 522 aa] {ON}
           Anc_8.263 YDR111C
          Length = 522

 Score =  602 bits (1552), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 297/500 (59%), Positives = 373/500 (74%), Gaps = 7/500 (1%)

Query: 11  SVFTTKDLNFKPAAKITKKDLNAGVTKAEYAVRGAIPTRADELKEELKRKPGVLPFDDII 70
           +  + K  NFKPA K+T  DLN  V KA+YAVRG IP RA+ LK++L   P  LPF  +I
Sbjct: 27  TTISLKHKNFKPADKLTINDLNENVLKAKYAVRGKIPARAEVLKQQLIDNPSSLPFKKVI 86

Query: 71  NANIGNPQQLDQKPLTFTRQVLSILEYPEILRVGPDKLASLN---LFRKDALGRAEHLLE 127
           NANIGNPQQL+QKPLTF RQVLS+L+YP +L    D+  S N   L+++DA+ RA+ +L 
Sbjct: 87  NANIGNPQQLNQKPLTFYRQVLSLLQYPMVL----DETFSGNTKTLYKQDAIERAKRILN 142

Query: 128 DIGGSIGAYSHSQGVPGIRQSVAEFITKRDDGEPAAPENIYXXXXXXXXXXXXXXXXCKD 187
           DIG S+G+YS SQGV G+R++VAE+I++RD GE A  E+I+                CK 
Sbjct: 143 DIGSSVGSYSSSQGVFGLRKTVAEYISRRDGGEKAYAEDIFLTAGASSAVSYLLNILCKG 202

Query: 188 VQTGLLIPIPQYPLYTASASLFNAQVLPYYLDEGSNWSTKSDEIEKVVKDALEKGIKPSV 247
            ++G+LIPIPQYPLYTA+ +L N   LPYYL+E S WST  +EIE VV +A+ + I P V
Sbjct: 203 KESGVLIPIPQYPLYTATLALNNTNALPYYLEENSGWSTNMEEIENVVHNAIREKIIPRV 262

Query: 248 LIVINPGNPTGAVLSEDTIAKICLIAAKYGIAIISDEVYQENVFNGVKFHSMKKVLRKLQ 307
           L+VINPGNPTGA+LS ++I KI  +AA +GI +I+DEVYQEN+F G +FHSMKKVLR LQ
Sbjct: 263 LVVINPGNPTGAILSVESIEKIFDVAAHHGIVVIADEVYQENIFPGNEFHSMKKVLRDLQ 322

Query: 308 RLYPGKFDNVQLASLHSISKGFMGECGQRGGYMEVVGFSKDIRDALFKLMSISICSVVTG 367
           R  PGK++NVQLASLHS SKG  GECGQRGGYME+ GFS +I+  + KL SIS+C VVTG
Sbjct: 323 RRVPGKYENVQLASLHSTSKGVSGECGQRGGYMELTGFSTEIKHEILKLCSISLCPVVTG 382

Query: 368 QAVVDLMVKPPQPGDESYDQDHSERMKIFHEMYTRATLLHETFNELEGIECQKPQGAMYL 427
           QA+VDLM  PP+ G+ SY+QD  ER  I  E+Y RAT L + FNE+EG+ CQKPQG+MYL
Sbjct: 383 QALVDLMTCPPKKGEASYEQDQMERSTIHSELYERATYLWKAFNEMEGVSCQKPQGSMYL 442

Query: 428 FPRLVLPEKALRESERLGIEPDEFYCTSLLESTGICTVPGSGFGQQPGTYHVRTTFLAPG 487
           FP++ +P KAL +++ L I PDE YC  LLE+TGICTVPGSGFGQ+PGT+H+RTTFLAPG
Sbjct: 443 FPKIDIPHKALEKAQELDITPDELYCAELLEATGICTVPGSGFGQKPGTFHLRTTFLAPG 502

Query: 488 TQWIQDWKHFHQDFFNKYRD 507
           T WI  W+ FHQ F NKYRD
Sbjct: 503 TSWIDQWREFHQIFCNKYRD 522

>TPHA0A01800 Chr1 (364262..365758) [1497 bp, 498 aa] {ON} Anc_8.263
           YDR111C
          Length = 498

 Score =  601 bits (1549), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 279/490 (56%), Positives = 365/490 (74%), Gaps = 2/490 (0%)

Query: 19  NFKPAAKITKKDLNAGVTKAEYAVRGAIPTRADELKEELKRKPGVLPFDDIINANIGNPQ 78
           +F P AK+T KDLN+ + K +YAVRG IP RA+ELK +L++ P  LPF+ IINANIGNPQ
Sbjct: 8   DFTPVAKVTLKDLNSKIIKTQYAVRGPIPARAEELKLQLEKDPKSLPFNKIINANIGNPQ 67

Query: 79  QLDQKPLTFTRQVLSILEYPEILR--VGPDKLASLNLFRKDALGRAEHLLEDIGGSIGAY 136
           QL QKPL+F R+VLSIL+YP+IL        L  L +++KD + RA  LL +IGGS+GAY
Sbjct: 68  QLGQKPLSFIRKVLSILQYPDILEDESKLQTLIELRVYQKDVVRRARKLLGEIGGSVGAY 127

Query: 137 SHSQGVPGIRQSVAEFITKRDDGEPAAPENIYXXXXXXXXXXXXXXXXCKDVQTGLLIPI 196
           S SQGVPGI+Q+VA++ITKRD GE A PE+I+                C    TG+LIPI
Sbjct: 128 SLSQGVPGIQQTVADYITKRDSGEVAYPEDIFLTTGASSAVSFILPMFCNGPTTGVLIPI 187

Query: 197 PQYPLYTASASLFNAQVLPYYLDEGSNWSTKSDEIEKVVKDALEKGIKPSVLIVINPGNP 256
           PQYPLYTA+ +L  A  + YYL+E  NWS  + E+E  ++++++ GIKP+ +++INPGNP
Sbjct: 188 PQYPLYTATITLVGATAISYYLNEEDNWSVNTVEMENTIQESIKSGIKPTTIVIINPGNP 247

Query: 257 TGAVLSEDTIAKICLIAAKYGIAIISDEVYQENVFNGVKFHSMKKVLRKLQRLYPGKFDN 316
           TG++L+E  IA I  I+AKYG+ II+DEVYQENVF+G +FHS+KKVLRKLQR Y G ++ 
Sbjct: 248 TGSILTEKDIANIIRISAKYGLLIIADEVYQENVFSGNEFHSVKKVLRKLQRKYLGFYET 307

Query: 317 VQLASLHSISKGFMGECGQRGGYMEVVGFSKDIRDALFKLMSISICSVVTGQAVVDLMVK 376
           VQLASLHS SKG +GECGQRGGYME++G + D+R  + KLMSISICSVVTGQA++D++V 
Sbjct: 308 VQLASLHSTSKGLIGECGQRGGYMELIGLTDDVRLEVVKLMSISICSVVTGQALIDMVVS 367

Query: 377 PPQPGDESYDQDHSERMKIFHEMYTRATLLHETFNELEGIECQKPQGAMYLFPRLVLPEK 436
           PP+PGDESY+ D  ER  I +++ +R+  LH+ F  LEG+EC +PQGAMYLFP+ + P+K
Sbjct: 368 PPRPGDESYEMDQLERNNIKNDLISRSQKLHQLFISLEGVECLRPQGAMYLFPKFIFPQK 427

Query: 437 ALRESERLGIEPDEFYCTSLLESTGICTVPGSGFGQQPGTYHVRTTFLAPGTQWIQDWKH 496
            +  +++L  E D  YC  LLE TGICTVPGSGFGQ+P TYH+RTTFL PG  WI  W+ 
Sbjct: 428 FIDIAQKLHTEADTLYCKELLEHTGICTVPGSGFGQKPNTYHLRTTFLVPGDSWIDLWRK 487

Query: 497 FHQDFFNKYR 506
           FH +F  +YR
Sbjct: 488 FHTEFCERYR 497

>Kpol_543.39 s543 complement(86358..87836) [1479 bp, 492 aa] {ON}
           complement(86358..87836) [1479 nt, 493 aa]
          Length = 492

 Score =  596 bits (1537), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 281/492 (57%), Positives = 364/492 (73%), Gaps = 5/492 (1%)

Query: 18  LNFKPAAKITKKDLNAGVTKAEYAVRGAIPTRADELKEELKRKPGVLPFDDIINANIGNP 77
           ++F PA K++  DLN     A+YAVRG+IP RA++L  ++   PG LPFD II ANIGNP
Sbjct: 1   MSFVPAEKLSVNDLNQHAVHADYAVRGSIPMRAEQLHAQIINDPGSLPFDKIITANIGNP 60

Query: 78  QQLDQKPLTFTRQVLSILEYPEILRVGPD---KLASLNLFRKDALGRAEHLLEDIGGSIG 134
           QQ+ QKPLTF RQVLSILEYP IL   P+   KL  L ++++D + RA  +L+ IGGS+G
Sbjct: 61  QQVGQKPLTFIRQVLSILEYPNILN-DPELLEKLVQLGVYQRDVIERARKMLDSIGGSVG 119

Query: 135 AYSHSQGVPGIRQSVAEFITKRDD-GEPAAPENIYXXXXXXXXXXXXXXXXCKDVQTGLL 193
           AYS SQGV G RQ+VA+FI KRD   + A+P +I+                C   + G+L
Sbjct: 120 AYSASQGVLGFRQTVADFINKRDGCKQLASPNDIFLTGGASSAVHYLLSILCSGPEFGVL 179

Query: 194 IPIPQYPLYTASASLFNAQVLPYYLDEGSNWSTKSDEIEKVVKDALEKGIKPSVLIVINP 253
           IPIPQYPLYTA+ +L N+  +PYYL E ++WST + EIE  +K+++  G+KP  +++INP
Sbjct: 180 IPIPQYPLYTATLTLSNSTAIPYYLKEHTSWSTNTKEIEINIKESMANGVKPVAIVIINP 239

Query: 254 GNPTGAVLSEDTIAKICLIAAKYGIAIISDEVYQENVFNGVKFHSMKKVLRKLQRLYPGK 313
           GNPTGA+LSE  +A I  I+AKYGIAII+DEVYQEN+F G +FHSM+KVL  LQ  +PG 
Sbjct: 240 GNPTGAILSESDLADIIRISAKYGIAIIADEVYQENIFPGFEFHSMRKVLLNLQSEFPGT 299

Query: 314 FDNVQLASLHSISKGFMGECGQRGGYMEVVGFSKDIRDALFKLMSISICSVVTGQAVVDL 373
           +DNVQLASLHS SKGF+GECGQRGGYME++GF  ++   + KL SISICSVVTGQA++DL
Sbjct: 300 YDNVQLASLHSTSKGFIGECGQRGGYMELIGFKDEVIAIVLKLASISICSVVTGQALMDL 359

Query: 374 MVKPPQPGDESYDQDHSERMKIFHEMYTRATLLHETFNELEGIECQKPQGAMYLFPRLVL 433
           +  PPQPGD SY  D  ER KI  ++  RA  L+  F  LEG+ECQ+PQGAMYLFP+L+L
Sbjct: 360 VTCPPQPGDASYKLDQEERNKIKQDLMFRADRLYGLFTSLEGVECQRPQGAMYLFPKLIL 419

Query: 434 PEKALRESERLGIEPDEFYCTSLLESTGICTVPGSGFGQQPGTYHVRTTFLAPGTQWIQD 493
           P+KA+ ++ +L I PDE+YC  LL++TGICTVPGSGFGQ PGTYH+RTTFL PGT+WI+ 
Sbjct: 420 PDKAIEKALQLEIPPDEYYCRELLDATGICTVPGSGFGQDPGTYHLRTTFLVPGTEWIER 479

Query: 494 WKHFHQDFFNKY 505
           W+ FHQ F+ ++
Sbjct: 480 WREFHQQFYERF 491

>TBLA0E04440 Chr5 complement(1138820..1140508) [1689 bp, 562 aa]
           {ON} Anc_8.263 YDR111C
          Length = 562

 Score =  593 bits (1528), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 282/484 (58%), Positives = 360/484 (74%), Gaps = 2/484 (0%)

Query: 23  AAKITKKDLNAGVTKAEYAVRGAIPTRADELKEELKRKPGVLPFDDIINANIGNPQQLDQ 82
           A ++  +DLN  V KA+YAVRGAIP+ AD+LK +L + PG LPF+ +IN+NIGNPQQL Q
Sbjct: 81  AERLEPEDLNPNVVKAKYAVRGAIPSYADKLKIQLLKHPGTLPFESVINSNIGNPQQLGQ 140

Query: 83  KPLTFTRQVLSILEYPEILRVGPDKLASLNLFRKDALGRAEHLLEDIGGSIGAYSHSQGV 142
           KPL+F RQVLSILEYP +L      + S+  +  D++ RA+ LL DIG SIGAYS+SQGV
Sbjct: 141 KPLSFGRQVLSILEYPALLDHERTLVDSMG-YAPDSIERAKTLLTDIG-SIGAYSNSQGV 198

Query: 143 PGIRQSVAEFITKRDDGEPAAPENIYXXXXXXXXXXXXXXXXCKDVQTGLLIPIPQYPLY 202
            GIRQ+VA+FIT RDDGE A P++I+                CK  QTG+LIPIPQYPLY
Sbjct: 199 HGIRQTVADFITNRDDGEVAYPDDIFLTAGASSAVSTILSILCKGQQTGVLIPIPQYPLY 258

Query: 203 TASASLFNAQVLPYYLDEGSNWSTKSDEIEKVVKDALEKGIKPSVLIVINPGNPTGAVLS 262
           TA+ +L +A  LPYYLDE + WST  +EI KV +D+LE GIKP+ L+VINPGNPTG+VL+
Sbjct: 259 TATLTLNDATALPYYLDESNGWSTDINEISKVAQDSLEAGIKPTCLVVINPGNPTGSVLT 318

Query: 263 EDTIAKICLIAAKYGIAIISDEVYQENVFNGVKFHSMKKVLRKLQRLYPGKFDNVQLASL 322
            + I  +  +AAKYG+ +I+DEVYQ+N+F G +FHSMKK+LR LQ+  P K+DN+QLASL
Sbjct: 319 VEAIKNVFDVAAKYGLVVIADEVYQDNIFPGSEFHSMKKILRILQKEVPNKYDNIQLASL 378

Query: 323 HSISKGFMGECGQRGGYMEVVGFSKDIRDALFKLMSISICSVVTGQAVVDLMVKPPQPGD 382
           HS SKG +GECG RGGY E +GF+ +++  + KL SIS+CS V GQA+VDLM  PP+ G+
Sbjct: 379 HSCSKGLLGECGHRGGYCEFIGFTPEVKQVITKLSSISLCSSVIGQALVDLMCCPPKKGE 438

Query: 383 ESYDQDHSERMKIFHEMYTRATLLHETFNELEGIECQKPQGAMYLFPRLVLPEKALRESE 442
            SY+ D  ER  I      R+  L+E FN LEG+ CQKPQGAMY+FP + LP  A++ ++
Sbjct: 439 PSYELDQHERQTIRTNHKKRSNKLYEMFNSLEGVTCQKPQGAMYMFPNIQLPFNAIKMAQ 498

Query: 443 RLGIEPDEFYCTSLLESTGICTVPGSGFGQQPGTYHVRTTFLAPGTQWIQDWKHFHQDFF 502
            L I PDEFYC  LL++TGICTVPGSGFGQQPGTYHVRTTFLAPG +W++ W+ FH +FF
Sbjct: 499 NLDITPDEFYCRELLKATGICTVPGSGFGQQPGTYHVRTTFLAPGVEWMKRWEKFHIEFF 558

Query: 503 NKYR 506
            KYR
Sbjct: 559 EKYR 562

>AGR085W Chr7 (887023..888588) [1566 bp, 521 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YLR089C (ALT1) and
           YDR111C (ALT2)
          Length = 521

 Score =  580 bits (1496), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 281/488 (57%), Positives = 354/488 (72%), Gaps = 3/488 (0%)

Query: 20  FKPAAKITKKDLNAGVTKAEYAVRGAIPTRADELKEELKRKPGVLPFDDIINANIGNPQQ 79
           F PA  +T  D+N  V KA+YAVRG IPTRA+EL+  L+  PG LPF  II ANIGNPQQ
Sbjct: 37  FVPAEPMTLADVNENVVKAKYAVRGKIPTRAEELERRLEEHPGSLPFSKIIQANIGNPQQ 96

Query: 80  LDQKPLTFTRQVLSILEYPEILRVGPDKLASLNLFRKDALGRAEHLLEDIGGSIGAYSHS 139
           L QKPLTF RQV+S+++ P++L +  + L     F+ D + RA  +L+D GGS+GAYS S
Sbjct: 97  LGQKPLTFYRQVISLMQNPQLLEMPAEWLQ--QAFKADVVVRARRMLQDAGGSVGAYSAS 154

Query: 140 QGVPGIRQSVAEFITKRDDGEPAAPENIYXXXXXXXXXXXXXXXXCKDVQTGLLIPIPQY 199
           QGV G R++VA+FI +RD G PA P+N+Y                CK  +TG+LIPIPQY
Sbjct: 155 QGVKGYRRTVAQFIERRD-GIPANPDNVYLTAGASSAVSCLLSTFCKGPETGVLIPIPQY 213

Query: 200 PLYTASASLFNAQVLPYYLDEGSNWSTKSDEIEKVVKDALEKGIKPSVLIVINPGNPTGA 259
           PLYTA+ +  NA  LPYYL+E   WST  DE+E+V+ D+ ++ I P  L+VINPGNPTG+
Sbjct: 214 PLYTATITQNNAVALPYYLNEADGWSTNPDEMERVILDSKKRNIAPKCLVVINPGNPTGS 273

Query: 260 VLSEDTIAKICLIAAKYGIAIISDEVYQENVFNGVKFHSMKKVLRKLQRLYPGKFDNVQL 319
           VLS   +  I  +AAKYGI +I+DEVYQ+NVF   KFHSM+KVL+ LQ   P  + NVQL
Sbjct: 274 VLSVKDMEAILTLAAKYGIVVIADEVYQDNVFGDAKFHSMRKVLKNLQLREPTLYKNVQL 333

Query: 320 ASLHSISKGFMGECGQRGGYMEVVGFSKDIRDALFKLMSISICSVVTGQAVVDLMVKPPQ 379
           ASLHSISKG  GECGQRGGYME++GF +++R    KL SIS+C VVTGQA+VDLMV PP 
Sbjct: 334 ASLHSISKGLSGECGQRGGYMELIGFREELRKVFVKLASISLCPVVTGQALVDLMVGPPS 393

Query: 380 PGDESYDQDHSERMKIFHEMYTRATLLHETFNELEGIECQKPQGAMYLFPRLVLPEKALR 439
            GD SY+Q   E   I+HE+  R+ LL +TF  LEGIEC  PQGA+YLFP+L LP+KA+ 
Sbjct: 394 QGDPSYEQYTQETRSIYHELEERSQLLWKTFCSLEGIECNMPQGALYLFPKLHLPQKAIE 453

Query: 440 ESERLGIEPDEFYCTSLLESTGICTVPGSGFGQQPGTYHVRTTFLAPGTQWIQDWKHFHQ 499
            +++LGI  DE YC+ LL+ TGICTVPG+GFGQ PGTYHVRTTFL PGT+WI+ WK FH+
Sbjct: 454 AAQKLGIPADELYCSELLDETGICTVPGTGFGQIPGTYHVRTTFLPPGTKWIESWKDFHK 513

Query: 500 DFFNKYRD 507
            F++KYRD
Sbjct: 514 KFYDKYRD 521

>TBLA0F03060 Chr6 (743646..745148) [1503 bp, 500 aa] {ON} Anc_8.263
           YDR111C
          Length = 500

 Score =  572 bits (1475), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 277/501 (55%), Positives = 353/501 (70%), Gaps = 8/501 (1%)

Query: 13  FTTKDLNFKPAAKITKKDLNAGVTKAEYAVRGAIPTRADELKEELKRKPGVLPFDDIINA 72
            T     F PA K +  D+N  + KAEYA+RG IP RA+EL  +L      LPF  I+ A
Sbjct: 1   MTMNQKTFLPAPKFSLNDINESILKAEYAIRGTIPNRAEELDIQLLENSKSLPFAKIVYA 60

Query: 73  NIGNPQQLDQKPLTFTRQVLSILEYPEILRVGPDKLASLNLFRKDALGRAEHLLEDIGGS 132
           NIGNPQQLDQ+PLTF RQV+S++++P++L+   D L +  ++ KD++ RA  LL  IGGS
Sbjct: 61  NIGNPQQLDQQPLTFQRQVMSLVQFPDLLK-SKDILLAQKIYSKDSIERATKLLNSIGGS 119

Query: 133 IGAYSHSQGVPGIRQSVAEFITKRD-------DGEPAAPENIYXXXXXXXXXXXXXXXXC 185
           +GAYS SQGV  IR++VA FI KRD       D       N++                 
Sbjct: 120 VGAYSSSQGVLDIRKNVARFILKRDLHHDPTQDLIDETASNVFLTAGASTAVDHILPLFA 179

Query: 186 KDVQTGLLIPIPQYPLYTASASLFNAQVLPYYLDEGSNWSTKSDEIEKVVKDALEKGIKP 245
           KD   G+L+PIPQYPLYTA+ +L  +++LPYYL+E +NWST   +IE++V DA+++ IKP
Sbjct: 180 KDESCGVLLPIPQYPLYTAAVTLQKSKLLPYYLNESNNWSTDPKQIEQIVIDAIKQNIKP 239

Query: 246 SVLIVINPGNPTGAVLSEDTIAKICLIAAKYGIAIISDEVYQENVFNGVKFHSMKKVLRK 305
           + L+VINPGNPTGA+L++D+I  I  IAA+YGI II+DEVYQENV+   +FHS KKVL +
Sbjct: 240 TTLVVINPGNPTGAILTKDSIIDIIDIAAEYGIVIIADEVYQENVYEAFEFHSFKKVLSE 299

Query: 306 LQRLYPGKFDNVQLASLHSISKGFMGECGQRGGYMEVVGFSKDIRDALFKLMSISICSVV 365
           L++ YP K+DNVQLASLHSISKG  GECGQRGGYME+ GFS D++  L K+ SISICSVV
Sbjct: 300 LRKNYPSKYDNVQLASLHSISKGVNGECGQRGGYMEITGFSNDVKKVLLKVASISICSVV 359

Query: 366 TGQAVVDLMVKPPQPGDESYDQDHSERMKIFHEMYTRATLLHETFNELEGIECQKPQGAM 425
           TGQ +VDLMV PPQPGDESY+ D  ER  I   +  ++  L++ F  L GI CQKPQGAM
Sbjct: 360 TGQILVDLMVNPPQPGDESYELDQLERSVIHSNLILKSNTLYDVFTRLPGISCQKPQGAM 419

Query: 426 YLFPRLVLPEKALRESERLGIEPDEFYCTSLLESTGICTVPGSGFGQQPGTYHVRTTFLA 485
           YLFPRL L E A+  +  L ++PDEFYC  LLE+TGICTVPGSGFGQ PGTYH+RTTFL 
Sbjct: 420 YLFPRLHLSENAINAATELNLKPDEFYCLKLLENTGICTVPGSGFGQYPGTYHLRTTFLP 479

Query: 486 PGTQWIQDWKHFHQDFFNKYR 506
           PG +WI  W+ FH +F  KY+
Sbjct: 480 PGIEWINSWEKFHLEFMEKYK 500

>TBLA0G01630 Chr7 (428016..429518) [1503 bp, 500 aa] {ON} 
          Length = 500

 Score =  561 bits (1445), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 268/494 (54%), Positives = 346/494 (70%), Gaps = 10/494 (2%)

Query: 22  PAAKITKKDLNAGVTKAEYAVRGAIPTRADELKEELKRKPGVLPFDDIINANIGNPQQLD 81
           PA K +  D++  +   EYA+RG IPTRADEL+E+L   P  LPF  II ANIGNPQQL+
Sbjct: 8   PAPKFSLNDISQSILDTEYAIRGTIPTRADELQEQLNISPNQLPFKKIIYANIGNPQQLE 67

Query: 82  QKPLTFTRQVLSILEYPEILRVGPDKLASLNLFRKDALGRAEHLLEDIGGSIGAYSHSQG 141
           Q+PLTF RQVLS++EYP ++    + L    ++  DA+ RAE +L  IGGS+GAYS SQG
Sbjct: 68  QEPLTFQRQVLSLVEYPNLVN-SKNILVENKIYAPDAIKRAETILNSIGGSVGAYSSSQG 126

Query: 142 VPGIRQSVAEFITKRDDGEPAAPE---------NIYXXXXXXXXXXXXXXXXCKDVQTGL 192
           +  IR++VA+ I +RD+ E    +         NI+                 KD   G+
Sbjct: 127 ILSIRKNVAKCILQRDNDELCCNDEELINETASNIFLTDGATTAVSYILPLFAKDENCGV 186

Query: 193 LIPIPQYPLYTASASLFNAQVLPYYLDEGSNWSTKSDEIEKVVKDALEKGIKPSVLIVIN 252
           L+PIPQYPLYTA+ +L N+++LPYYL+E  NWST  +EIE ++KDA+ + IKP+ L++IN
Sbjct: 187 LLPIPQYPLYTAAVTLQNSKLLPYYLNEDENWSTDPEEIETIIKDAISRNIKPTTLVIIN 246

Query: 253 PGNPTGAVLSEDTIAKICLIAAKYGIAIISDEVYQENVFNGVKFHSMKKVLRKLQRLYPG 312
           PGNPTGA+LS ++I +I  IAAKYGI II+DEVYQ N++   KFHS KK+L  L+  YP 
Sbjct: 247 PGNPTGAILSVESITQIINIAAKYGIVIIADEVYQNNIYQDFKFHSFKKILNSLKLQYPK 306

Query: 313 KFDNVQLASLHSISKGFMGECGQRGGYMEVVGFSKDIRDALFKLMSISICSVVTGQAVVD 372
           K+DNVQLASLHSISKG  GECGQRGGY E++GFS +I+  + KL SI ICSVVTGQ +VD
Sbjct: 307 KYDNVQLASLHSISKGVNGECGQRGGYFELLGFSDEIKKIILKLASIDICSVVTGQILVD 366

Query: 373 LMVKPPQPGDESYDQDHSERMKIFHEMYTRATLLHETFNELEGIECQKPQGAMYLFPRLV 432
           LM KPP+ GD SY  D  ER  I   +  ++  L++ F+ L GI CQKPQGAMYLFPRL 
Sbjct: 367 LMSKPPEKGDYSYKLDQRERNNIQSNLILKSNTLYDLFSRLPGISCQKPQGAMYLFPRLH 426

Query: 433 LPEKALRESERLGIEPDEFYCTSLLESTGICTVPGSGFGQQPGTYHVRTTFLAPGTQWIQ 492
           L    + E++   +EPDEFYC  LLE+TGICTVPGSGFGQ+ GTYHVRTTFL  G +WI+
Sbjct: 427 LTSNMINEAKLNNLEPDEFYCLKLLENTGICTVPGSGFGQKEGTYHVRTTFLPSGIEWIK 486

Query: 493 DWKHFHQDFFNKYR 506
            W+ FH +F N+Y+
Sbjct: 487 LWEKFHLEFMNQYK 500

>CAGL0J05126g Chr10 complement(487452..488753) [1302 bp, 433 aa]
           {ON} highly similar to uniprot|P47039 Saccharomyces
           cerevisiae YJL060w
          Length = 433

 Score = 50.1 bits (118), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 56/259 (21%), Positives = 105/259 (40%), Gaps = 42/259 (16%)

Query: 221 GSNWSTKSDEIEKVVKDALEKGIKPSVLIVINPGNPTGAVLSEDTIAKICLIAAKYGIAI 280
           G  W    D +EK   +      K   +I+  P NP G V +E  + K+  +  ++   +
Sbjct: 170 GDEWQIDWDALEKTFNN------KTKAVIINTPHNPIGKVFTEQELTKLAQLCVEHNTVV 223

Query: 281 ISDEVYQENVFNGVKFHSMKKVLRKLQRLYPGKFDNVQLASLHSISKGFMGECGQRGGYM 340
           ISDEVY E+++    F  +  +             N  +A+L +++ G  G+     G+ 
Sbjct: 224 ISDEVY-EHLYFTESFPRIANI-------------NEDIANL-TLTVGSAGKSFAATGWR 268

Query: 341 EVVGFSKDIRDALFKLMSISICSVVTGQAVVDLMVKPPQPGDESY--DQDHSERMKIF-- 396
             +G+     D L   +S         +A   +    P P  E+     +H+ ++  F  
Sbjct: 269 --IGWIISKNDQLLNYVS---------KAHTRICFASPSPLQEACAGSIEHALKIDYFPK 317

Query: 397 --HEMYTRATLLHETFNELEGIECQKPQGAMYL---FPRLVLPEKALRESERLGIEPDEF 451
              E   +  +L   F++L G+   +P+G  ++   F ++ +PE  +   E L    D  
Sbjct: 318 MREEYRKKFEILTTAFDKL-GLNYTQPEGTYFILVDFSKVKIPEDYVYPEELLEKAKDFR 376

Query: 452 YCTSLLESTGICTVPGSGF 470
               L+   GI  +P + F
Sbjct: 377 ISYWLINEIGIVAIPPTEF 395

>Suva_6.136 Chr6 complement(227366..228700) [1335 bp, 444 aa] {ON}
           YJL060W (REAL)
          Length = 444

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 57/259 (22%), Positives = 105/259 (40%), Gaps = 42/259 (16%)

Query: 221 GSNWSTKSDEIEKVVKDALEKGIKPSVLIVINPGNPTGAVLSEDTIAKICLIAAKYGIAI 280
           G  W+   ++ EK +        K   +I+  P NP G V + D +  +  I  K+ + I
Sbjct: 181 GEEWTIDFEQFEKAITS------KTKAVIINTPNNPIGKVFTHDELTTLGNICVKHNVVI 234

Query: 281 ISDEVYQENVFNGVKFHSMKKVLRKLQRLYPGKFDNVQLASLHSISKGFMGECGQRGGYM 340
           ISDEVY+   F    F  +  +  ++ +L           ++ S  K F    G R G+ 
Sbjct: 235 ISDEVYEHLYFTD-SFTRVATLSPEIGQL---------TLTVGSAGKSFAA-TGWRIGW- 282

Query: 341 EVVGFSKDIRDALFKLMSISICSVVTGQAVVDLMVKPPQPGDESYDQDHSERMKIFH--- 397
            V+  + +       L+S +       +A   +    P P  E+     ++ +KI +   
Sbjct: 283 -VLSLNAE-------LLSYA------AKAHTRICFASPSPLQEACANSINDALKIGYFEN 328

Query: 398 ---EMYTRATLLHETFNELEGIECQKPQGAMYL---FPRLVLPEKALRESERLGIEPDEF 451
              E  T+  +L   F+EL G+    P+G+ ++   F ++ +PE      E +    D  
Sbjct: 329 MRQEYITKFKILTSVFDEL-GLPYTAPEGSYFVLVNFSKVKIPEDYPYPQEIMDKGKDFR 387

Query: 452 YCTSLLESTGICTVPGSGF 470
               L+   G+  +P + F
Sbjct: 388 ISHWLINELGVVAIPPTEF 406

>Kwal_14.2574 s14 complement(818144..819475) [1332 bp, 443 aa] {ON}
           YJL060W (BNA3) - 1:1 [contig 224] FULL
          Length = 443

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 54/262 (20%), Positives = 106/262 (40%), Gaps = 46/262 (17%)

Query: 220 EGSNWSTKSDEIEKVVKDALEKGIKPSVLIVINPGNPTGAVLSEDTIAKICLIAAKYGIA 279
           +G+ W+   DE+E  +        K   LI+  P NP G V + + + +I  I  K+ + 
Sbjct: 179 KGTEWTVNYDELEAAITP------KTKALILNTPHNPVGKVFTREELLRIGEICVKHNVV 232

Query: 280 IISDEVYQENVFNGVKFHSMKKVLRKLQRLYPGKFDNVQLASLHSISKGFMGECGQRGGY 339
           IISDEVY E+++   +F  +  +  ++ ++              +++ G  G+     G+
Sbjct: 233 IISDEVY-EHLYFTPEFTRIATLSPEIGQI--------------TLTVGSAGKSFAATGW 277

Query: 340 MEVVGFSKDIRDALFKLMSISICSVVTGQAVVDLMVKPPQPGDE--------SYDQDHSE 391
              +G+   +   L K  S+         A   +    P P  E        + D  + E
Sbjct: 278 R--IGWVVSLNPELLKYASM---------AHTRICFSSPSPLQEACANSLNTALDNGYFE 326

Query: 392 RMKIFHEMYTRATLLHETFNELEGIECQKPQGAMYL---FPRLVLPEKALRESERLGIEP 448
           +M+   E   +  +    F+EL G+   +P+G  ++   F ++ +P+      E      
Sbjct: 327 KMR--QEYINKFKIFTRVFDEL-GLPYTEPEGTYFVLVDFSKVKIPDNYPFPEELRSKGK 383

Query: 449 DEFYCTSLLESTGICTVPGSGF 470
           D      L+   G+  +P + F
Sbjct: 384 DFRISYWLVNELGVVAIPPTEF 405

>AEL170C Chr5 complement(318032..319408) [1377 bp, 458 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YJL060W
           (BNA3)
          Length = 458

 Score = 48.1 bits (113), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 59/262 (22%), Positives = 102/262 (38%), Gaps = 42/262 (16%)

Query: 218 LDEGSNWSTKSDEIEKVVKDALEKGIKPSVLIVINPGNPTGAVLSEDTIAKICLIAAKYG 277
           + EG+ W    D + + + +      K   +I+ +P NP G V + + + K+  I  + G
Sbjct: 192 VTEGTEWVIDYDMLRQTINE------KTKAVIINSPHNPIGKVFTREELLKLGNICVEKG 245

Query: 278 IAIISDEVYQENVFNGVKFHSMKKVLRKLQRLYPGKFDNVQLASLHSISKGFMGECGQRG 337
           I IISDEVY+   F   +F  +  +  ++              S H+++ G  G+     
Sbjct: 246 IYIISDEVYEHLYFTD-EFTRIATLSEEI--------------SQHTLTVGSAGKSFAAT 290

Query: 338 GYMEVVGFSKDIRDALFKLMSISICSVVTGQAVVDLMVKPPQPGDESYDQDHSERMKIFH 397
           G+   +G+       L  L S         +A V +    P P  E+        +K  +
Sbjct: 291 GWR--IGWVISRNKELLALAS---------KAHVRICFSSPAPLQEACAVAIEHALKTTY 339

Query: 398 EMYTRATL------LHETFNELEGIECQKPQGAMYL---FPRLVLPEKALRESERLGIEP 448
              TRA          + F++L G+   + +G+ +L   F RL LP       E      
Sbjct: 340 YADTRAAYQKKYERFQKPFDDL-GLPYTRAEGSYFLLVDFSRLPLPADYHFPEELADKGR 398

Query: 449 DEFYCTSLLESTGICTVPGSGF 470
           D      L+   G+  +P S F
Sbjct: 399 DFRVAYWLINELGLVAIPCSSF 420

>Kpol_1035.23 s1035 complement(56123..57457) [1335 bp, 444 aa] {ON}
           complement(56123..57457) [1335 nt, 445 aa]
          Length = 444

 Score = 47.4 bits (111), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 56/262 (21%), Positives = 106/262 (40%), Gaps = 42/262 (16%)

Query: 218 LDEGSNWSTKSDEIEKVVKDALEKGIKPSVLIVINPGNPTGAVLSEDTIAKICLIAAKYG 277
           + +G+ W+   DE  + +        K   +I+  P NP G V + + + K+  I  +  
Sbjct: 178 VTKGTEWTVDFDEFTRAITP------KTKAVIINTPHNPIGKVFTREELTKLGNICVENN 231

Query: 278 IAIISDEVYQENVFNGVKFHSMKKVLRKLQRLYPGKFDNVQLASLHSISKGFMGECGQRG 337
           + II+DEVY E+++   +F  +  +  ++ +L           S+ S  K F    G R 
Sbjct: 232 VIIIADEVY-EHLYFVDEFPRIATLSEEIGQL---------TLSVGSAGKSFAA-TGWRI 280

Query: 338 GYMEVVGFSKDIRDALFKLMSISICSVVTGQAVVDLMVKPPQPGDE--SYDQDHSERMKI 395
           G+  VV  + D+                  +A   +    P P  E  SY  DH+ ++  
Sbjct: 281 GW--VVSQNPDLLQ-------------YASKAHTRICFASPSPIQEACSYSIDHALKIDY 325

Query: 396 FHEM----YTRATLLHETFNELEGIECQKPQGAMYL---FPRLVLPEKALRESERLGIEP 448
           F  M      +  +    F+EL G+    P+G+ ++   F ++ +P+      E +    
Sbjct: 326 FENMRQEYVKKFKIFTSVFDEL-GLPYTIPEGSYFVLADFSKVKIPDSYQFPEEIMSKGK 384

Query: 449 DEFYCTSLLESTGICTVPGSGF 470
           D      L+   G+  +P + F
Sbjct: 385 DFRISNWLINELGVVAIPPTEF 406

>TPHA0O01450 Chr15 complement(291591..292922) [1332 bp, 443 aa] {ON}
           Anc_1.321 YJL060W
          Length = 443

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 54/264 (20%), Positives = 107/264 (40%), Gaps = 46/264 (17%)

Query: 218 LDEGSNWSTKSDEIEKVVKDALEKGIKPSVLIVINPGNPTGAVLSEDTIAKICLIAAKYG 277
           + +G+ W+   ++ E V+ +      K   +I+  P NP G V + + + +I  I  K+ 
Sbjct: 177 VTKGTEWTLDFEQFENVITN------KTKAIIINTPHNPIGKVFTREELKRIGDICVKHN 230

Query: 278 IAIISDEVYQENVFNGVKFHSMKKVLRKLQRLYPGKFDNVQLASLHSISKGFMGECGQRG 337
           + IISDEVY +N++   +F  +  +  ++ +L              ++S G  G+     
Sbjct: 231 VIIISDEVY-DNLYFVDEFTRIATLSPEIGQL--------------TLSVGSAGKTFAAT 275

Query: 338 GYMEVVGFSKDIRDALFKLMSISICSVVTGQAVVDLMVKPPQPGDESYDQD--------H 389
           G+   +G+   +   L    S         +A   +    P P  E+  +         +
Sbjct: 276 GWR--IGWVVSLNPELLNFAS---------KAHTRICFASPSPIQEACAESINIALRNGY 324

Query: 390 SERMKIFHEMYTRATLLHETFNELEGIECQKPQGAMYL---FPRLVLPEKALRESERLGI 446
            E M+  +E   +  +    F+EL G+   + +G  +L   F R+ +PE      E +  
Sbjct: 325 FENMR--NEYVKKYKIFTSVFDEL-GLPYTEAEGTYFLLVDFSRVKIPEDYKFPEEIINK 381

Query: 447 EPDEFYCTSLLESTGICTVPGSGF 470
             D      L+   G+  +P + F
Sbjct: 382 GKDFRISNWLINELGVVAIPPTEF 405

>SAKL0F02156g Chr6 (185574..187070) [1497 bp, 498 aa] {ON} highly
           similar to uniprot|P53090 Saccharomyces cerevisiae
           YGL202W ARO8 Aromatic aminotransferase expression is
           regulated by general control of amino acid biosynthesis
          Length = 498

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 34/91 (37%), Positives = 50/91 (54%), Gaps = 9/91 (9%)

Query: 202 YTASASLFNAQ-----VLPYYLDEGSNWSTKSDEIEKVVKDALEKGIKPSVLIVINPG-N 255
           Y+ S+SL+ A+     V P  LDE   +    +++E ++ +   +  KP +L  I  G N
Sbjct: 165 YSFSSSLYAAEAQGVNVFPVPLDE---FGIIPEKLESIMDNWNPETPKPKLLYTIPTGQN 221

Query: 256 PTGAVLSEDTIAKICLIAAKYGIAIISDEVY 286
           PTG+ LS+D  AKI  IA K+   II DE Y
Sbjct: 222 PTGSSLSDDRKAKIYRIAQKHNFIIIEDEPY 252

>Kwal_34.16018 s34 (159210..160349) [1140 bp, 379 aa] {ON} YJL060W
           (BNA3) - YJL060W [contig 272] FULL
          Length = 379

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 33/107 (30%), Positives = 55/107 (51%), Gaps = 16/107 (14%)

Query: 197 PQYPLYTASASLFNAQVLPYYLDEGSNWSTKSDEIEKVVKDALEKGIKPSV-LIVIN-PG 254
           P Y   ++   +F A+V   +L + +N+     E+E++        IKP+   IV+N P 
Sbjct: 113 PTYQQLSSIPQMFGAEVELLHLRKETNYQPNIVELERM--------IKPNTKCIVLNTPN 164

Query: 255 NPTGAVLSEDTIAKICLIAAKYGIAIISDEVYQENVFNGVKFHSMKK 301
           NP  +V+  +T+ +I  +A K+GI +  DEVY         FHS +K
Sbjct: 165 NPLSSVIPTETLREIAELADKHGIVVFCDEVYSP------LFHSCEK 205

>Ecym_6319 Chr6 complement(607599..608663) [1065 bp, 354 aa] {ON}
           similar to Ashbya gossypii AEL170C
          Length = 354

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 59/226 (26%), Positives = 99/226 (43%), Gaps = 46/226 (20%)

Query: 220 EGSNWSTKSDEIEKVVKDALEKGIKPSVLIVINPGNPTGAVLSEDTIAKICLIAAKYGIA 279
           +GS W+   D+    + +      K   +I+ +P NPTG V + + +  +  I  +  + 
Sbjct: 164 KGSEWTLDFDQFRSAISE------KTKAVIINSPHNPTGKVFTREELLTLGNICVEKNVY 217

Query: 280 IISDEVYQENVFNGVKFHSMKKVLRKLQRLYPGKFDNVQLASLHSISKGFMGECGQRGGY 339
           IISDEVY EN++             KL  L P +  N+ L ++ S  K F    G R G+
Sbjct: 218 IISDEVY-ENLY-------FTPECVKLASLSP-EISNITL-TIGSAGKIF-AVTGWRIGW 266

Query: 340 MEVVGFSKDIRDALFKLMS---ISICSVVTGQAVVDLMVKPPQPG-----DESYDQDHSE 391
           +     S+++   L KL S   I IC              PPQ       D + + D+ +
Sbjct: 267 I----ISENVE--LLKLASSAHIKICFSSPS---------PPQLACAHAIDIALNSDYFD 311

Query: 392 RMKIFHEMYTRATLLHETFNELEGIECQKPQGAMYL---FPRLVLP 434
           RM+   +   +  +L   F EL G+    P+G+ ++   F +L +P
Sbjct: 312 RMR--KDYIEKVEILTSVFEEL-GMPYTVPEGSYFIVVDFSKLKIP 354

>KNAG0G00550 Chr7 (96823..97986) [1164 bp, 387 aa] {ON} Anc_1.472
          Length = 387

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 43/159 (27%), Positives = 74/159 (46%), Gaps = 23/159 (14%)

Query: 197 PQYPLYTASASLFNAQVLPYYLDEGSNWSTKSDEIEKVVKDALEKGIKPSVLIVINPGNP 256
           P Y    +   +F A+V    L E  ++    D ++K +K          ++I+ NP NP
Sbjct: 111 PTYSQLYSVPKMFGAEVTLLELSEKDSFLPNLDTLKKAIKS------NTKLIIINNPNNP 164

Query: 257 TGAVLSEDTIAKICLIAAKYGIAIISDEVYQENVFNGVKFHSMKKVL---RKLQRLYPGK 313
            G V+S++ +  IC +  +  + +  DEVY+        FHS+   +   R   ++Y   
Sbjct: 165 LGCVISDELLTSICELCKEKNVYLHCDEVYRP------IFHSLPSGVTTPRSAAQIY--- 215

Query: 314 FDNVQLASLHSISKGFMGECGQRGGYMEVVGFSKDIRDA 352
            DN  ++   S+SK F    G R G++ V   +K +RDA
Sbjct: 216 -DNAVVSG--SMSKAF-SLAGIRLGWI-VSKNAKLLRDA 249

>SAKL0D06886g Chr4 complement(571478..572821) [1344 bp, 447 aa] {ON}
           highly similar to uniprot|P47039 Saccharomyces
           cerevisiae YJL060W BNA3 Arylformamidase involved in
           biosynthesis of nicotinic acid from tryptophan via
           kynurenine pathway potential Cdc28p substrate
          Length = 447

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 61/267 (22%), Positives = 105/267 (39%), Gaps = 46/267 (17%)

Query: 218 LDEGSNWSTKSDEIEKVVKDALEKGIKPSVLIVINPGNPTGAVLSEDTIAKICLIAAKYG 277
           +  G+ W+   DE+   +        K   LI+  P NP G V + + + +I  I  +  
Sbjct: 181 VTHGTEWTVDYDELRAAITP------KTKALILNTPHNPIGKVFTREELLEIGNICVENN 234

Query: 278 IAIISDEVYQENVFNGVKFHSMKKVLRKLQRLYPGKFDNVQLASLHSISKGFMGECGQRG 337
           + IISDEVY+   F             ++  L P +  N+ L S+ S  K F    G R 
Sbjct: 235 VVIISDEVYEHLYFTS--------EFTRIATLSP-EIGNLTL-SVGSAGKTFAA-TGWRI 283

Query: 338 GYMEVVGFSKDIRDALFKLMSISICSVVTGQAVVDLMVKPPQPGDE--------SYDQDH 389
           G++     S++    L K  S+         A   +    P P  E        +   ++
Sbjct: 284 GWI----VSQNAE--LLKYASM---------AHTRICFASPSPFQEACAKSIEIALQNNY 328

Query: 390 SERMKIFHEMYTRATLLHETFNELEGIECQKPQGAMYL---FPRLVLPEKALRESERLGI 446
            E+M+   E   +  +    F+EL G+   +P+G  ++   F ++ +PE      E L  
Sbjct: 329 FEKMR--QEYINKFDIFTRVFDEL-GLPYTQPEGTYFVLVDFSKVKIPEDYPFPEELLSK 385

Query: 447 EPDEFYCTSLLESTGICTVPGSGFGQQ 473
             D      L+   G+  +P + F  Q
Sbjct: 386 AKDFRISYWLINELGVVAIPPTEFYIQ 412

>Kpol_480.1 s480 (215..1357) [1143 bp, 380 aa] {ON} (215..1357)
           [1143 nt, 381 aa]
          Length = 380

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 65/303 (21%), Positives = 123/303 (40%), Gaps = 79/303 (26%)

Query: 197 PQYPLYTASASLFNAQVLPYYLDEGSNWSTKSDEIEKVVKDALEKGIKPSVLIVINPGNP 256
           P Y    +   +F A+V    L +  ++      ++ ++K+         ++I+ NP NP
Sbjct: 110 PTYSQLYSVPEMFGAEVDLLTLKKEDDFLPNLQTLKSMIKN------NTKLIIINNPNNP 163

Query: 257 TGAVLSEDTIAKICLIAAKYGIAIISDEVYQENVFNGVKFHSMKK--VLRKLQRLYPGKF 314
            G+V+ +D + +IC +  +  I + SDEVY+        FHS++   V      LY    
Sbjct: 164 LGSVIKKDLLKQICKLCEENDIYLHSDEVYRP------IFHSLEDEMVPPSACELYSKAI 217

Query: 315 DNVQLASLHSISKGFMGECGQRGGYMEVVGFSKD---IRDAL----FKLMSISICSVVTG 367
            +  ++  +S++       G R G++     SKD   +RDA     + ++S+S+      
Sbjct: 218 VSGSMSKAYSVA-------GIRLGWL----VSKDKQFLRDAASRRDYNMISVSMIDDQIA 266

Query: 368 QAVVD-----------LMVKPPQPGDESYDQDHSERMKIFHEMYTRATLLHETFNELEGI 416
           Q V+D           L +   +  ++  D+ HS++ + +H                   
Sbjct: 267 QYVLDNREYVIKRNYELCLNNFRLLNDFMDE-HSDKFEFYH------------------- 306

Query: 417 ECQKPQGAMYLFPRLVLPEKALRESERLGIEPDEFYCTSLLESTGICTVPGSGFGQQPGT 476
              KP  A     ++    K + ++ +        + T L E  G+  VPG  FG  PGT
Sbjct: 307 ---KPTAATVCLAKV----KGVNDTMK--------FATFLAEKYGVLAVPGEAFG-VPGT 350

Query: 477 YHV 479
             +
Sbjct: 351 IRI 353

>KAFR0A01710 Chr1 complement(348198..349505) [1308 bp, 435 aa] {ON}
           Anc_1.321 YJL060W
          Length = 435

 Score = 45.4 bits (106), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 54/262 (20%), Positives = 102/262 (38%), Gaps = 42/262 (16%)

Query: 218 LDEGSNWSTKSDEIEKVVKDALEKGIKPSVLIVINPGNPTGAVLSEDTIAKICLIAAKYG 277
           + +G  W    D ++  +        K   +I+  P NP G V +E  + ++  I  K  
Sbjct: 169 VTKGEEWQIDWDSLQAAMNS------KTKAIIINTPHNPIGKVFTEPELRRLGDICVKNN 222

Query: 278 IAIISDEVYQENVFNGVKFHSMKKVLRKLQRLYPGKFDNVQLASLHSISKGFMGECGQRG 337
           + IISDEVY+   F        K    ++  L P      ++  L +++ G  G+     
Sbjct: 223 VVIISDEVYEHLYF--------KDSFTRIATLSP------EIGQL-TLTVGSAGKSFAAT 267

Query: 338 GYMEVVGFSKDIRDALFKLMSISICSVVTGQAVVDLMVKPPQPGDESYDQ--DHSERMKI 395
           G+   +G++  +   L              +A   +    P P  E+     + +E+++ 
Sbjct: 268 GWR--IGWALSLNQELLSY---------AAKAHTRICFASPSPLQEAVANAFNDAEKVEY 316

Query: 396 FHEMYTRATLLHETF----NELEGIECQKPQGAMYL---FPRLVLPEKALRESERLGIEP 448
           F E   +    +E F    NEL G+   +P+G  ++   F ++ +P       E L    
Sbjct: 317 FKETRLQYIRKYEIFTNVLNEL-GLPYTEPEGTYFILVNFSKVKIPPDYKYPEELLNKAK 375

Query: 449 DEFYCTSLLESTGICTVPGSGF 470
           D      L+   G+  +P + F
Sbjct: 376 DFRISYWLMNELGVVAIPPTEF 397

>TDEL0D01900 Chr4 (369434..370765) [1332 bp, 443 aa] {ON} Anc_1.321
           YJL060W
          Length = 443

 Score = 45.1 bits (105), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 54/260 (20%), Positives = 100/260 (38%), Gaps = 42/260 (16%)

Query: 220 EGSNWSTKSDEIEKVVKDALEKGIKPSVLIVINPGNPTGAVLSEDTIAKICLIAAKYGIA 279
           +G+ W+   ++    + D      K   +I+  P NP G V + + + +I  I  K  + 
Sbjct: 179 KGTEWTVDYEQFANAITD------KTKAVIINTPHNPIGKVFTREELTRIGEICVKKNVV 232

Query: 280 IISDEVYQENVFNGVKFHSMKKVLRKLQRLYPGKFDNVQLASLHSISKGFMGECGQRGGY 339
           IISDEVY+   F             ++  L P      ++  L ++S G  G+     G+
Sbjct: 233 IISDEVYEHLYFT--------DSFTRIATLSP------EIGQL-TLSVGSAGKSFAATGW 277

Query: 340 MEVVGFSKDIRDALFKLMSISICSVVTGQAVVDLMVKPPQPGDESYDQDHSERMKIFHEM 399
              VG+   +   L   +S         +A   +    P P  E+     ++ ++I +  
Sbjct: 278 R--VGWVVSLNPELLSYVS---------KAHTRICFASPSPLQEAVANSINDALEINYFE 326

Query: 400 YTRATLLHE------TFNELEGIECQKPQGAMYL---FPRLVLPEKALRESERLGIEPDE 450
             R    H+       F EL G+   +P+G  ++   F ++ +PE      E      D 
Sbjct: 327 NMRQEYKHKYDIFTSVFKEL-GLPYTEPEGTYFILVDFSKVKIPEGYSYPEEIANKAKDF 385

Query: 451 FYCTSLLESTGICTVPGSGF 470
                L+   G+  +P + F
Sbjct: 386 RIAYWLINELGVVAIPPTEF 405

>NCAS0A09200 Chr1 complement(1819134..1820471) [1338 bp, 445 aa]
           {ON} Anc_1.321 YJL060W
          Length = 445

 Score = 44.7 bits (104), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 52/264 (19%), Positives = 105/264 (39%), Gaps = 46/264 (17%)

Query: 218 LDEGSNWSTKSDEIEKVVKDALEKGIKPSVLIVINPGNPTGAVLSEDTIAKICLIAAKYG 277
           + EG+ W+   ++ +  +        K   +I+  P NP G V + + + +I  I  +  
Sbjct: 179 VTEGTEWTVDMEQFKNAITS------KTKAVIINTPHNPIGKVFTREELLQIGNICVEKN 232

Query: 278 IAIISDEVYQENVFNGVKFHSMKKVLRKLQRLYPGKFDNVQLASLHSISKGFMGECGQRG 337
           + IISDEVY+   F   +F  +  +  ++ +L              +++ G  G+     
Sbjct: 233 VIIISDEVYEHLYFTD-EFTRIATLSPEIGQL--------------TLTVGSAGKTFAAT 277

Query: 338 GYMEVVGFSKDIRDALFKLMSISICSVVTGQAVVDLMVKPPQPGDE--------SYDQDH 389
           G+   +G+   +   L + +S         +A   +    P P  E        + + ++
Sbjct: 278 GWR--IGWVISLNSELLQYVS---------KAHTRICFASPSPLQEACANSINDALESNY 326

Query: 390 SERMKIFHEMYTRATLLHETFNELEGIECQKPQGAMYL---FPRLVLPEKALRESERLGI 446
            E+M+   E   +  +    F EL G+   KP+G  ++   F ++ +PE      E L  
Sbjct: 327 FEKMR--QEYIQKFKIFTSVFEEL-GLPYTKPEGTYFVLADFSKVKIPEDYPYPKEILNK 383

Query: 447 EPDEFYCTSLLESTGICTVPGSGF 470
             D      L+   G+  +P + F
Sbjct: 384 GKDFRISHWLINELGVVAIPPTEF 407

>KLTH0H10648g Chr8 complement(919601..920932) [1332 bp, 443 aa] {ON}
           highly similar to uniprot|P47039 Saccharomyces
           cerevisiae YJL060W BNA3 Arylformamidase involved in
           biosynthesis of nicotinic acid from tryptophan via
           kynurenine pathway potential Cdc28p substrate
          Length = 443

 Score = 43.9 bits (102), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 52/262 (19%), Positives = 104/262 (39%), Gaps = 46/262 (17%)

Query: 220 EGSNWSTKSDEIEKVVKDALEKGIKPSVLIVINPGNPTGAVLSEDTIAKICLIAAKYGIA 279
           EG+ W+   DE+   +        K   LI+  P NP G V + + + +I  I  +  + 
Sbjct: 179 EGTEWTVDYDELRAAITP------KTKALILNTPHNPVGKVFTREELLQIGQICVENNVV 232

Query: 280 IISDEVYQENVFNGVKFHSMKKVLRKLQRLYPGKFDNVQLASLHSISKGFMGECGQRGGY 339
           IISDEVY E+++   +F  +  +  ++ ++              +++ G  G+     G+
Sbjct: 233 IISDEVY-EHLYFTPEFTRVATLSPEIGQI--------------TLTIGSAGKSFAATGW 277

Query: 340 MEVVGFSKDIRDALFKLMSISICSVVTGQAVVDLMVKPPQPGDE--------SYDQDHSE 391
              +G+   +   L +  S++   +             P P  E        + D  + +
Sbjct: 278 R--IGWIVSLNPELLEYASMAHTRICFAS---------PSPLQEACANALPIALDNGYFK 326

Query: 392 RMKIFHEMYTRATLLHETFNELEGIECQKPQGAMYL---FPRLVLPEKALRESERLGIEP 448
           +M+   E   +  +    F+EL G+   KP+G  ++   F ++ +PE      E      
Sbjct: 327 KMR--EEYIHKFNIFTRVFDEL-GLPYTKPEGTYFVLVDFSKVKIPEDYPFPEELRSKAK 383

Query: 449 DEFYCTSLLESTGICTVPGSGF 470
           D      L+   G+  +P + F
Sbjct: 384 DFRISYWLINELGVVAIPPTEF 405

>YJL060W Chr10 (323386..324720) [1335 bp, 444 aa] {ON}
           BNA3Kynurenine aminotransferase, catalyzes formation of
           kynurenic acid from kynurenine; potential Cdc28p
           substrate
          Length = 444

 Score = 43.9 bits (102), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 55/259 (21%), Positives = 102/259 (39%), Gaps = 42/259 (16%)

Query: 221 GSNWSTKSDEIEKVVKDALEKGIKPSVLIVINPGNPTGAVLSEDTIAKICLIAAKYGIAI 280
           G  W+   ++ EK +        K   +I+  P NP G V + + +  +  I  K+ + I
Sbjct: 181 GEEWTIDFEQFEKAITS------KTKAVIINTPHNPIGKVFTREELTTLGNICVKHNVVI 234

Query: 281 ISDEVYQENVFNGVKFHSMKKVLRKLQRLYPGKFDNVQLASLHSISKGFMGECGQRGGYM 340
           ISDEVY+   F    F  +  +  ++ +L           ++ S  K F    G R G+ 
Sbjct: 235 ISDEVYEHLYFTD-SFTRIATLSPEIGQL---------TLTVGSAGKSFAA-TGWRIGW- 282

Query: 341 EVVGFSKDIRDALFKLMSISICSVVTGQAVVDLMVKPPQPGDESYDQDHSERMKIFH--- 397
            V+  + +       L+S +       +A   +    P P  E+     ++ +KI +   
Sbjct: 283 -VLSLNAE-------LLSYA------AKAHTRICFASPSPLQEACANSINDALKIGYFEK 328

Query: 398 ---EMYTRATLLHETFNELEGIECQKPQGAMYL---FPRLVLPEKALRESERLGIEPDEF 451
              E   +  +    F+EL G+    P+G  ++   F ++ +PE      E L    D  
Sbjct: 329 MRQEYINKFKIFTSIFDEL-GLPYTAPEGTYFVLVDFSKVKIPEDYPYPEEILNKGKDFR 387

Query: 452 YCTSLLESTGICTVPGSGF 470
               L+   G+  +P + F
Sbjct: 388 ISHWLINELGVVAIPPTEF 406

>KLLA0F10021g Chr6 (926569..928062) [1494 bp, 497 aa] {ON} similar
           to uniprot|P53090 Saccharomyces cerevisiae YGL202W ARO8
           Aromatic aminotransferase expression is regulated by
           general control of amino acid biosynthesis
          Length = 497

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 74/295 (25%), Positives = 128/295 (43%), Gaps = 39/295 (13%)

Query: 202 YTASASLFNAQ---VLPYYLDEGSNWSTKSDEIEKVVKDALEKGIKPSVLIVINPG-NPT 257
           +++S S   AQ   V P  LDE     +K   +E ++ +  E   KP +L  +  G NPT
Sbjct: 166 FSSSISAAEAQGVNVFPIPLDEHGIIPSK---LETILDNWTEGAAKPKLLYTVPTGQNPT 222

Query: 258 GAVLSEDTIAKICLIAAKYGIAIISD--------EVYQENVFNGV--KFHSMKKVLRKLQ 307
           G+ LS D   +I  IA K+   II D        E Y+++  N V   +   K+ ++ L+
Sbjct: 223 GSSLSFDRKEEIYRIAQKHDFIIIEDEPYYFLQMEKYEKDPANRVVKSYADHKEFIQNLE 282

Query: 308 RLYPGKFDNVQLASLHSISKGFMGECGQRGGYMEVVGFSKDIRDALFKL--MSISICSVV 365
           + +       ++  L S+SK      G R G+  +VG +KDI   +  L  M+I   +  
Sbjct: 283 KSFVSIDTEGRVLRLDSLSKVLA--PGTRFGW--IVG-AKDILARILSLQEMTIQAPAGF 337

Query: 366 TGQAVVDLMVKPPQPGDESYDQDHSERMKIFHEMYTRA-----TLLHETFNELEGIECQK 420
           T   +   M +  Q G   +       + + HE YT+        L++   +++ I+   
Sbjct: 338 TQSIIAGTMNRWGQEGYLDW------LIGLRHE-YTKKRDCCIDALYKYLPQVDYIKINP 390

Query: 421 PQGAMYLFPRLVLPEKALRESERLGIEPDEFYCTSLLES--TGICTVPGSGFGQQ 473
           P   M+ F   +   K    + + G +P++        S  +G+  VPG+ F  Q
Sbjct: 391 PIAGMF-FTVNIDASKHPEFATKYGSDPEKVEKAIFDRSIASGVLVVPGNWFKSQ 444

>Skud_10.156 Chr10 complement(294149..295531) [1383 bp, 460 aa] {ON}
           YJL060W (REAL)
          Length = 460

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 56/262 (21%), Positives = 105/262 (40%), Gaps = 46/262 (17%)

Query: 220 EGSNWSTKSDEIEKVVKDALEKGIKPSVLIVINPGNPTGAVLSEDTIAKICLIAAKYGIA 279
           +G  W+   ++ E  +        K   +I+  P NP G V + + +  +  I  K+ + 
Sbjct: 196 KGEEWTIDFEQFENAITS------KTKAVIINTPHNPIGKVFTREELTTLGNICVKHNVV 249

Query: 280 IISDEVYQENVFNGVKFHSMKKVLRKLQRLYPGKFDNVQLASLHSISKGFMGECGQRGGY 339
           IISDEVY E++F    F  +  +  ++ +L           ++ S  K F    G R G+
Sbjct: 250 IISDEVY-EHLFFTDSFTRIATLSPEIGQL---------TLTVGSAGKSFAA-TGWRIGW 298

Query: 340 MEVVGFSKDIRDALFKLMSISICSVVTGQAVVDLMVKPPQPGDESYDQ--------DHSE 391
             V+  + +       L+S +       +A   +    P P  E+           D+ E
Sbjct: 299 --VLSLNAE-------LLSYA------AKAHTRICFASPSPLQEACANSINDALKIDYFE 343

Query: 392 RMKIFHEMYTRATLLHETFNELEGIECQKPQGAMYL---FPRLVLPEKALRESERLGIEP 448
           +M+   E  T+  +    F++L G+    P+G  ++   F ++ +PE      E L    
Sbjct: 344 KMR--QEYITKFKIFTSIFDKL-GLPYTAPEGTYFVLVDFSKVKIPEDYPYPKEILDKGK 400

Query: 449 DEFYCTSLLESTGICTVPGSGF 470
           D      L+   G+  +P + F
Sbjct: 401 DFRISHWLINELGVVAIPPTEF 422

>KLTH0G09614g Chr7 (804939..806108) [1170 bp, 389 aa] {ON} similar
           to uniprot|P07172 Saccharomyces cerevisiae YIL116W HIS5
           Histidinol-phosphate aminotransferase catalyzes the
           seventh step in histidine biosynthesis responsive to
           general control of amino acid biosynthesis mutations
           cause histidine auxotrophy and sensitivity to Cu Co and
           Ni salts
          Length = 389

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 51/164 (31%), Positives = 74/164 (45%), Gaps = 26/164 (15%)

Query: 192 LLIPIPQYPLYTASASLFNAQVL--PYYLDEGSNWSTKSDEIEKVVKDALEKGIKPSVLI 249
           +LI  P Y +Y+  A + + +++  P  +++ S        IE +  D+    IK  +  
Sbjct: 115 ILIMTPTYGMYSICADINDVEIIKVPLIVEDNSFQMNTDKVIETLQGDS---NIK--IAF 169

Query: 250 VINPGNPTGAVLSEDTIAKICLIAAKYGIAIISDEVYQENVFNGVKFHSMKKVLRKLQRL 309
           V +PGNPTGA++   +I KI L   + GI  I DE Y       + F S       L   
Sbjct: 170 VTSPGNPTGALIDIASIEKI-LSQWQSGIVAI-DEAY-------IDFCSTGGSAAPLVNK 220

Query: 310 YPGKFDNVQLASLHSISKGFMGECGQRGGYMEVVGFSKDIRDAL 353
           YP       LA L ++SK F G  G R G   V   SKD+   L
Sbjct: 221 YP------NLAVLQTLSKSF-GLAGVRLG---VTFTSKDLSRVL 254

>ZYRO0G20636g Chr7 complement(1700506..1701867) [1362 bp, 453 aa]
           {ON} highly similar to uniprot|P47039 Saccharomyces
           cerevisiae YJL060W BNA3 Arylformamidase involved in
           biosynthesis of nicotinic acid from tryptophan via
           kynurenine pathway potential Cdc28p substrate
          Length = 453

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 57/261 (21%), Positives = 102/261 (39%), Gaps = 44/261 (16%)

Query: 220 EGSNWSTKSDEIEKVVKDALEKGIKPSVLIVINPGNPTGAVLSEDTIAKICLIAAKYGIA 279
           EG +W+   +E+ K          K   LI+  P NP G V +++ + KI  +  +  + 
Sbjct: 187 EGKDWTIDYEELAKAFTS------KTKALILNTPHNPIGKVFTKEELTKIGNLCVENNVV 240

Query: 280 IISDEVYQENVFNGVKFHSMKKVLRKLQRLYPGKFDNVQLASLHSISKGFMGECGQRGGY 339
           IISDEVY+        F        ++  L P      ++  L +++ G  G+     G+
Sbjct: 241 IISDEVYE--------FLYFTDSYTRIATLSP------EIGQL-TLTVGSAGKTFAATGW 285

Query: 340 MEVVGFSKDIRDALFKLMS-----ISICSVVTGQAVVDLMVKPPQPGD--ESYDQDHSER 392
              +G+   +   L   +S     I   S    Q  V   ++    GD  E+   D+  +
Sbjct: 286 R--IGWVISLNPELLSYVSKGHTRICFSSPSPIQEAVANSIEDALKGDYFEAMRTDYIRK 343

Query: 393 MKIFHEMYTRATLLHETFNELEGIECQKPQGAMYL---FPRLVLPEKALRESERLGIEPD 449
            +IF  +          F E+ G+    P+G  ++   F ++ +PE      E L    D
Sbjct: 344 FEIFTSV----------FKEM-GLPYTIPEGTYFILVDFSKVNVPEDYPYPEELLDKGKD 392

Query: 450 EFYCTSLLESTGICTVPGSGF 470
                 L+   G+  +P + F
Sbjct: 393 FRISYWLINELGVVAIPPTEF 413

>NDAI0G05760 Chr7 (1427844..1429190) [1347 bp, 448 aa] {ON}
           Anc_1.321
          Length = 448

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 55/264 (20%), Positives = 105/264 (39%), Gaps = 46/264 (17%)

Query: 218 LDEGSNWSTKSDEIEKVVKDALEKGIKPSVLIVINPGNPTGAVLSEDTIAKICLIAAKYG 277
           + EG+ W+   ++    +        K   +IV +P NP G V +++ + K+  I  +  
Sbjct: 182 ITEGTEWTIDFEQFRNAITP------KTKAVIVNSPHNPIGKVFTKEELTKLGEICVENN 235

Query: 278 IAIISDEVYQENVFNGVKFHSMKKVLRKLQRLYPGKFDNVQLASLHSISKGFMGECGQRG 337
           + IISDEVY+   FN            ++  L P      ++  L +++ G  G+     
Sbjct: 236 VIIISDEVYEFLYFN--------DSFTRIATLSP------EIGQL-TLTVGSAGKTFAAT 280

Query: 338 GYMEVVGFSKDIRDALFKLMSISICSVVTGQAVVDLMVKPPQPGDE--------SYDQDH 389
           G+   +G+       L + +S         +A   +    P P  E        + +  +
Sbjct: 281 GWR--IGWVISQNPELLQYVS---------KAHTRICFASPSPLQEACANSINDALESGY 329

Query: 390 SERMKIFHEMYTRATLLHETFNELEGIECQKPQGAMYL---FPRLVLPEKALRESERLGI 446
            E+M+   E   +  + +  F EL G+   KP+G  ++   F ++ +PE      E L  
Sbjct: 330 FEKMR--KEYVQKFKIFNAVFEEL-GLPYTKPEGTYFVLADFSKVKIPEDYPWPEEILDK 386

Query: 447 EPDEFYCTSLLESTGICTVPGSGF 470
             D      L+   G+  +P + F
Sbjct: 387 GKDFRISHWLINELGVVAIPPTEF 410

>KLLA0F01617g Chr6 complement(154025..155359) [1335 bp, 444 aa] {ON}
           highly similar to uniprot|P47039 Saccharomyces
           cerevisiae YJL060W BNA3 Arylformamidase
          Length = 444

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 60/259 (23%), Positives = 106/259 (40%), Gaps = 42/259 (16%)

Query: 221 GSNWSTKSDEIEKVVKDALEKGIKPSVLIVINPGNPTGAVLSEDTIAKICLIAAKYGIAI 280
           G+ W    D + K + +      +   +I+  P NP G V + + + ++  I  K  I I
Sbjct: 181 GAEWKIDFDILNKTINE------RTKCIILNTPHNPIGKVFTREELTQLGDICVKNNIYI 234

Query: 281 ISDEVYQENVFNGVKFHSMKKVLRKLQRLYPGKFDNVQLASLHSISKGFMGECGQRGGYM 340
           ISDEVY E+++ G +F  +  + +++  L           S+ S  K F    G R G+ 
Sbjct: 235 ISDEVY-EHLYFGDEFTRIATISKEIGDL---------TLSVGSAGKSFAA-TGWRIGW- 282

Query: 341 EVVGFSKDIRDALFKLMSISICSVVTGQAVVDLMVKPPQPGDESYDQD-----HSERMKI 395
            VV      R+A  +L+S         +A   +    P P  E+         H+   + 
Sbjct: 283 -VVS-----RNA--ELLS------YVSKAHTRICFSSPSPFQEACAHSIDIGLHNGYFEN 328

Query: 396 FHEMYT-RATLLHETFNELEGIECQKPQGAMYL---FPRLVLPEKALRESERLGIEPDEF 451
             E Y  +  +L   F+EL G+   KP G  ++   F ++ +P++     E      D  
Sbjct: 329 MREEYKEKFAILTRVFDEL-GLPYTKPDGTYFVCVDFSKVQIPDEYPFPRELNERAKDFK 387

Query: 452 YCTSLLESTGICTVPGSGF 470
               L+   G+  +P + F
Sbjct: 388 LSYWLVNELGVVAIPPTEF 406

>Smik_10.180 Chr10 (315030..316364) [1335 bp, 444 aa] {ON} YJL060W
           (REAL)
          Length = 444

 Score = 41.6 bits (96), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 56/259 (21%), Positives = 100/259 (38%), Gaps = 42/259 (16%)

Query: 221 GSNWSTKSDEIEKVVKDALEKGIKPSVLIVINPGNPTGAVLSEDTIAKICLIAAKYGIAI 280
           G  W+   ++ EK +        K   +I+  P NP G V + + +  +  I  K+ + I
Sbjct: 181 GEEWTIDFEQFEKAITP------KTKAVIINTPHNPIGKVFTREELTTLGNICVKHNVII 234

Query: 281 ISDEVYQENVFNGVKFHSMKKVLRKLQRLYPGKFDNVQLASLHSISKGFMGECGQRGGYM 340
           ISDEVY+   F    F  +  +  ++ +L           ++ S  K F    G R G+ 
Sbjct: 235 ISDEVYEHLYFTD-SFTRIATISPEIGQL---------TLTVGSAGKLFAA-TGWRIGW- 282

Query: 341 EVVGFSKDIRDALFKLMSISICSVVTGQAVVDLMVKPPQPGDESYDQDHSERMKIFH--- 397
            VV  + D+   + K  +  IC               P P  E+      + +KI +   
Sbjct: 283 -VVSLNADLLSYVSKAHT-RIC------------FSSPSPLQEACANSIDDGLKIGYFEK 328

Query: 398 ---EMYTRATLLHETFNELEGIECQKPQGAMYL---FPRLVLPEKALRESERLGIEPDEF 451
              E  T+  +    F+EL G+    P+G  ++   F ++ +P+      E      D  
Sbjct: 329 MRQEYITKFKIFTSIFDEL-GLPYTAPEGTYFVLVNFSKVKIPKDYSYPEEIRDKGKDFR 387

Query: 452 YCTSLLESTGICTVPGSGF 470
               L+   G+  +P + F
Sbjct: 388 ISHWLINELGVVAIPPTEF 406

>NCAS0G04050 Chr7 complement(753216..754370) [1155 bp, 384 aa] {ON}
           Anc_1.472
          Length = 384

 Score = 41.6 bits (96), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 27/103 (26%), Positives = 48/103 (46%), Gaps = 12/103 (11%)

Query: 197 PQYPLYTASASLFNAQVLPYYLDEGSNWSTKSDEIEKVVKDALEKGIKPSVLIVINPGNP 256
           P Y    +   +F A+V    L +   +    + ++K++K          ++I+ NP NP
Sbjct: 110 PTYAQLYSVPKMFGAEVSLLKLQKEDGFIPNIETLKKMIKS------NTKLIIINNPNNP 163

Query: 257 TGAVLSEDTIAKICLIAAKYGIAIISDEVYQENVFNGVKFHSM 299
            G+ +S +T+  IC +  +  I +  DEVY+        FHSM
Sbjct: 164 LGSAISTETLNDICQLCEENNIYLHCDEVYKP------IFHSM 200

>KNAG0B00660 Chr2 (115417..116907) [1491 bp, 496 aa] {ON} Anc_3.511
           YGL202W
          Length = 496

 Score = 41.2 bits (95), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 23/59 (38%), Positives = 35/59 (59%), Gaps = 1/59 (1%)

Query: 229 DEIEKVVKDALEKGIKPSVLIVINPG-NPTGAVLSEDTIAKICLIAAKYGIAIISDEVY 286
           +++E+++ +  E   KP +L  I  G NPTG+ LS+D   KI  +A K+   II DE Y
Sbjct: 191 EKLEQILDNWTEGAPKPKLLYTIPTGQNPTGSSLSDDRKEKIYKVAQKHDFIIIEDEPY 249

>KNAG0B05320 Chr2 (1028845..1030146) [1302 bp, 433 aa] {ON}
           Anc_1.321 YJL060W
          Length = 433

 Score = 40.4 bits (93), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 21/72 (29%), Positives = 34/72 (47%), Gaps = 6/72 (8%)

Query: 221 GSNWSTKSDEIEKVVKDALEKGIKPSVLIVINPGNPTGAVLSEDTIAKICLIAAKYGIAI 280
           G+ W    D +EK +        +   +I+  P NP G V + + + ++  I     I I
Sbjct: 170 GTEWEIDWDILEKTINS------RTKCVIINTPHNPIGKVFTREELLRLGKICVDNNIVI 223

Query: 281 ISDEVYQENVFN 292
           ISDEVY+   F+
Sbjct: 224 ISDEVYEHLYFS 235

>TPHA0F01260 Chr6 complement(290133..291311) [1179 bp, 392 aa] {ON}
           Anc_2.252 YIL116W
          Length = 392

 Score = 40.4 bits (93), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 43/162 (26%), Positives = 76/162 (46%), Gaps = 26/162 (16%)

Query: 185 CKDVQTGLLIPIPQYPLYTASASLFNAQVL--PYYLDEGSNWSTKSDEIEKVVKDALEKG 242
           CK     +++  P Y +Y+  A++ +  V+  P  +++ S        +E + KD L + 
Sbjct: 105 CKPAVQKIMVLPPTYSMYSVCANINDVDVVNCPLIVEDNSFQMDVKRTLETLKKDDLIR- 163

Query: 243 IKPSVLIVINPGNPTGAVLSEDTIAKICLIAAKYGIAIISDEVYQE--NVFN----GVKF 296
               +L + +PGNPTG +++   I  + L   K G+ ++ DE Y +    FN      ++
Sbjct: 164 ----LLFITSPGNPTGKIIAIKDIIYV-LEHWKNGLVVV-DEAYVDFSTYFNEETKKTEY 217

Query: 297 HSMKKVLRKLQRLYPGKFDNVQLASLHSISKGFMGECGQRGG 338
            S+ K++ K    YP       L  L ++SK F G  G R G
Sbjct: 218 FSVAKLVTK----YPN------LTVLQTLSKSF-GLAGIRLG 248

>Kwal_47.18982 s47 complement(1051414..1052904) [1491 bp, 496 aa]
           {ON} YGL202W (ARO8) - 1:1 [contig 188] FULL
          Length = 496

 Score = 40.0 bits (92), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 31/91 (34%), Positives = 46/91 (50%), Gaps = 9/91 (9%)

Query: 202 YTASASLFNAQ-----VLPYYLDEGSNWSTKSDEIEKVVKDALEKGIKPSVLIVINPG-N 255
           YT S+S++ A+     V P  LD         + +E ++ +      KP +L  I  G N
Sbjct: 165 YTFSSSVYAAEAQGINVFPVPLDADG---LIPERLEAILDNWNPDTAKPKLLYTIPTGQN 221

Query: 256 PTGAVLSEDTIAKICLIAAKYGIAIISDEVY 286
           PTG+ LS+D   +I  IA K+ + II DE Y
Sbjct: 222 PTGSSLSDDRKVEIYRIAKKHDLLIIEDEPY 252

>Ecym_6292 Chr6 (547563..548855) [1293 bp, 430 aa] {ON} similar to
           Ashbya gossypii AEL170C
          Length = 430

 Score = 40.0 bits (92), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 19/68 (27%), Positives = 33/68 (48%), Gaps = 6/68 (8%)

Query: 220 EGSNWSTKSDEIEKVVKDALEKGIKPSVLIVINPGNPTGAVLSEDTIAKICLIAAKYGIA 279
           E ++W    + +     D      K  ++I+ NP NP G V + D + ++  +    G  
Sbjct: 163 EANDWILDRETLRAAFTD------KTKLMIINNPNNPLGKVFNRDELLEMATLCVNNGAY 216

Query: 280 IISDEVYQ 287
           II+DEVY+
Sbjct: 217 IIADEVYE 224

>KLTH0G02002g Chr7 (155219..156709) [1491 bp, 496 aa] {ON} highly
           similar to uniprot|P53090 Saccharomyces cerevisiae
           YGL202W ARO8 Aromatic aminotransferase expression is
           regulated by general control of amino acid biosynthesis
          Length = 496

 Score = 38.9 bits (89), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 31/91 (34%), Positives = 46/91 (50%), Gaps = 9/91 (9%)

Query: 202 YTASASLFNAQ-----VLPYYLDEGSNWSTKSDEIEKVVKDALEKGIKPSVLIVINPG-N 255
           YT S+S++ A+     V P  LD         + +E ++ +   +  KP +L  I  G N
Sbjct: 165 YTFSSSVYAAEAQGVNVFPVPLDADG---LIPERLEAILDNWNPETPKPKLLYTIPTGQN 221

Query: 256 PTGAVLSEDTIAKICLIAAKYGIAIISDEVY 286
           PTG+ LS+D   +I  IA K+   II DE Y
Sbjct: 222 PTGSSLSDDRKKEIYRIAQKHDFIIIEDEPY 252

>KNAG0E01850 Chr5 (381827..382981) [1155 bp, 384 aa] {ON} Anc_2.252
           YIL116W
          Length = 384

 Score = 38.9 bits (89), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 42/155 (27%), Positives = 71/155 (45%), Gaps = 23/155 (14%)

Query: 185 CKDVQTGLLIPIPQYPLYTASASLFNAQVLPY-YLDEGSNWSTKSDEIEKVVKDALEKGI 243
           C   +  +L+  P Y +Y+  A + + +V+    + E +++   SD+    V D L    
Sbjct: 108 CVPAREKILVLPPTYSMYSVCAKINDVEVVTCPLITEDNSFQMDSDK----VLDILNNDQ 163

Query: 244 KPSVLIVINPGNPTGAVLSEDTIAKICLIAAKYGIAIISDEVYQENVFNGVKFHSMKKVL 303
           +  +L + +PGNPTGA +    I K+ L     G+ ++ DE Y +  F G    S   ++
Sbjct: 164 EIKLLFITSPGNPTGAQIETARIEKV-LQNWDRGLVVV-DEAYVD--FCG---GSTAPLV 216

Query: 304 RKLQRLYPGKFDNVQLASLHSISKGFMGECGQRGG 338
            K Q           L +L ++SK F G  G R G
Sbjct: 217 TKYQ----------NLVTLQTLSKSF-GLAGIRLG 240

>SAKL0D11528g Chr4 complement(960867..962018) [1152 bp, 383 aa] {ON}
           weakly similar to uniprot|P47039 Saccharomyces
           cerevisiae YJL060W BNA3 Arylformamidase, involved in
           biosynthesis of nicotinic acid from tryptophan via
           kynurenine pathway; potential Cdc28p substrate
          Length = 383

 Score = 38.9 bits (89), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 23/91 (25%), Positives = 46/91 (50%), Gaps = 6/91 (6%)

Query: 197 PQYPLYTASASLFNAQVLPYYLDEGSNWSTKSDEIEKVVKDALEKGIKPSVLIVINPGNP 256
           P Y   ++   +F A+V    L+  +++     +++ ++K           +++ NP NP
Sbjct: 113 PTYQQLSSVPKMFGAEVELLELNRENDFIPDIGKLKSMIKG------NTKCIVLNNPNNP 166

Query: 257 TGAVLSEDTIAKICLIAAKYGIAIISDEVYQ 287
            G+V+   T+ +I  +A K  I +I DEVY+
Sbjct: 167 LGSVIPTATLEEIAALARKNEIRVICDEVYR 197

>ZYRO0A01672g Chr1 (136284..137444) [1161 bp, 386 aa] {ON} highly
           similar to uniprot|P07172 Saccharomyces cerevisiae
           YIL116W HIS5 Histidinol-phosphate aminotransferase
           catalyzes the seventh step in histidine biosynthesis
           responsive to general control of amino acid biosynthesis
           mutations cause histidine auxotrophy and sensitivity to
           Cu Co and Ni salts
          Length = 386

 Score = 38.1 bits (87), Expect = 0.049,   Method: Compositional matrix adjust.
 Identities = 32/132 (24%), Positives = 59/132 (44%), Gaps = 7/132 (5%)

Query: 156 RDDGEPAAPENIYXXXXXXXXXXXXXXXXCKDVQTGLLIPIPQYPLYTASASLFNAQVLP 215
           +D  +P   EN+                 C   +  +L+  P Y +Y+  A + + +++ 
Sbjct: 78  KDLPQPLTAENLCLGVGSDESIDAIIRACCVPAKEKILVLPPTYSMYSVCAHINDVEIVK 137

Query: 216 YYLDEGSN-WSTKSDEIEKVVKDALEKGIKPSVLIVINPGNPTGAVLSEDTIAKICLIAA 274
             L    N +   +DE+ K  ++  +  IK  ++ + +PGNPTGA +    I KI L   
Sbjct: 138 CPLITSDNSFQANTDEVIKTAQN--DPSIK--LIFITSPGNPTGAKVETSRIEKI-LQNW 192

Query: 275 KYGIAIISDEVY 286
             G+ ++ DE Y
Sbjct: 193 DRGMVVV-DEAY 203

>YIL116W Chr9 (142928..144085) [1158 bp, 385 aa] {ON}
           HIS5Histidinol-phosphate aminotransferase, catalyzes the
           seventh step in histidine biosynthesis; responsive to
           general control of amino acid biosynthesis; mutations
           cause histidine auxotrophy and sensitivity to Cu, Co,
           and Ni salts
          Length = 385

 Score = 37.7 bits (86), Expect = 0.054,   Method: Compositional matrix adjust.
 Identities = 55/212 (25%), Positives = 101/212 (47%), Gaps = 31/212 (14%)

Query: 192 LLIPIPQYPLYTASASLFNAQVL--PYYLDEGSNWSTKSDEIEKVVK-DALEKGIKPSVL 248
           +L+  P Y +Y+  A++ + +V+  P  + +GS +   ++ +  ++K D+L K     ++
Sbjct: 115 ILVLPPTYSMYSVCANINDIEVVQCPLTVSDGS-FQMDTEAVLTILKNDSLIK-----LM 168

Query: 249 IVINPGNPTGAVLSEDTIAKICLIAAKYGIAIISDEVYQENVFNGVKFHSMKKVLRKLQR 308
            V +PGNPTGA +    I K+ L     G+ ++ DE Y +  F G    S   ++ K   
Sbjct: 169 FVTSPGNPTGAKIKTSLIEKV-LQNWDNGLVVV-DEAYVD--FCG---GSTAPLVTK--- 218

Query: 309 LYPGKFDNVQLASLHSISKGFMGECGQRGGYMEVVGFSKDIRDALFKLMSI-SICSVVTG 367
            YP       L +L ++SK F G  G R G          I +A+    +I S+ S    
Sbjct: 219 -YP------NLVTLQTLSKSF-GLAGIRLGMTYATAELARILNAMKAPYNISSLASEYAL 270

Query: 368 QAVVDLMVKPPQPGDESYDQDHSERMKIFHEM 399
           +AV D  +K  +   +  ++   E+M++  E+
Sbjct: 271 KAVQDSNLKKMEATSKIINE---EKMRLLKEL 299

>KLTH0G19624g Chr7 complement(1697587..1698993) [1407 bp, 468 aa]
           {ON} similar to uniprot|P10356 Saccharomyces cerevisiae
           YER152C Hypothetical ORF
          Length = 468

 Score = 37.7 bits (86), Expect = 0.065,   Method: Compositional matrix adjust.
 Identities = 22/62 (35%), Positives = 37/62 (59%), Gaps = 2/62 (3%)

Query: 227 KSDEIEKVV--KDALEKGIKPSVLIVINPGNPTGAVLSEDTIAKICLIAAKYGIAIISDE 284
           K++E  +++  +D  +K  +  + +V    NPTGA+ S  +  K+  +A KY I IISD+
Sbjct: 168 KAEESLRIINAQDGKKKIYRYVIYLVPTYSNPTGAIYSRSSRLKLLELARKYDILIISDD 227

Query: 285 VY 286
           VY
Sbjct: 228 VY 229

>KLTH0E07678g Chr5 (702610..704088) [1479 bp, 492 aa] {ON} similar
           to uniprot|P53090 Saccharomyces cerevisiae YGL202W ARO8
           Aromatic aminotransferase expression is regulated by
           general control of amino acid biosynthesis
          Length = 492

 Score = 37.7 bits (86), Expect = 0.068,   Method: Compositional matrix adjust.
 Identities = 45/167 (26%), Positives = 73/167 (43%), Gaps = 30/167 (17%)

Query: 213 VLPYYLDEG-SNWSTKSDEIEKVVKDALEKGIKPSVLIVINPG-NPTGAVLSEDTIAKIC 270
           ++P  L+E  +NWS+   E+             P +L  I  G NPTG  LS++    I 
Sbjct: 188 IVPSKLEEMLANWSSLYGEMPM-----------PKLLYTIPTGQNPTGCTLSDNRKPHIY 236

Query: 271 LIAAKYGIAIISDEVY----------QENVFNGVKFHSMKKV--LRKLQRLYPGKFDNVQ 318
            +A +Y I II D+ Y          ++      +  +M +   +  L R +     + +
Sbjct: 237 RLAQQYDIIIIEDDPYYFLQMDPYVSEDARLETAEASTMSQATFMNSLNRSFLELDTDGR 296

Query: 319 LASLHSISKGFMGECGQRGGYMEVVGFSKDIRDALFKLMSISICSVV 365
           +  L S+SK F   C  R G++  VG SK + D  + L  +SI S  
Sbjct: 297 VVRLESVSKTFAPGC--RMGWL--VG-SKHLLDNYWNLHEVSIQSTC 338

>KLTH0G19646g Chr7 complement(1699421..1700560) [1140 bp, 379 aa]
           {ON} conserved hypothetical protein
          Length = 379

 Score = 37.4 bits (85), Expect = 0.087,   Method: Compositional matrix adjust.
 Identities = 23/91 (25%), Positives = 44/91 (48%), Gaps = 6/91 (6%)

Query: 197 PQYPLYTASASLFNAQVLPYYLDEGSNWSTKSDEIEKVVKDALEKGIKPSVLIVINPGNP 256
           P Y   ++  S+F A V   +L+    ++    +++  V+           +++ NP NP
Sbjct: 113 PTYQQLSSVPSMFGADVELLHLEAEDGYTPNIQKLKSKVR------ANTKYIVLNNPNNP 166

Query: 257 TGAVLSEDTIAKICLIAAKYGIAIISDEVYQ 287
            G+V+S + + +I   A +  I I+ DEVY 
Sbjct: 167 LGSVISTEKMTEIIDYAERNEIFIVCDEVYS 197

>SAKL0H21824g Chr8 (1903887..1905386) [1500 bp, 499 aa] {ON} similar
           to uniprot|P53090 Saccharomyces cerevisiae YGL202W ARO8
           Aromatic aminotransferase expression is regulated by
           general control of amino acid biosynthesis
          Length = 499

 Score = 37.0 bits (84), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 51/198 (25%), Positives = 80/198 (40%), Gaps = 45/198 (22%)

Query: 187 DVQTGLLIPIPQYPLYTASASLFNAQVLPYYLDEG-SNWSTKSDEIEKVVKDALEKGIKP 245
           D Q    IP+P          + N  ++P  L+E  SNW+ +   I             P
Sbjct: 173 DAQGLNCIPVP----------MDNQGIIPEKLEEMLSNWTDRYPGIPM-----------P 211

Query: 246 SVLIVINPG-NPTGAVLSEDTIAKICLIAAKYGIAIISDEVY-----------------Q 287
            +L  I  G NPTG  LSE     I  +A KY I I+ D+ Y                 +
Sbjct: 212 KLLYTIPTGQNPTGCTLSECRKPCIYRLAQKYDILIVEDDPYYFLQMGTYVSPDKRETDE 271

Query: 288 ENVFNGVKFHSMKKVLRKLQRLYPGKFDNVQLASLHSISKGFMGECGQRGGYMEVVGFSK 347
           +++       +  + ++ L R +     + ++  L S+SK F   C  R G+  +VG SK
Sbjct: 272 QDIVTQELKQNHGEFVKSLSRSFLDLDRDGRVVRLDSMSKTFAPGC--RLGW--IVG-SK 326

Query: 348 DIRDALFKLMSISICSVV 365
            + D  + L  +SI S  
Sbjct: 327 HLLDNYWNLHEVSIQSTC 344

>ADL249W Chr4 (261227..262390) [1164 bp, 387 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YIL116W (HIS5)
          Length = 387

 Score = 37.0 bits (84), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 61/234 (26%), Positives = 102/234 (43%), Gaps = 31/234 (13%)

Query: 189 QTGLLIPIPQYPLYTASASLFNAQVLPYYLDEGSNWSTKSDEIEKVVKDALEKGIKPSVL 248
           Q  +L+P P Y +Y   A + +   +   L    N S + DE   + +  L+K IK  V+
Sbjct: 113 QKVMLLP-PTYGMYKVCADINDVGYVEVPLISSDN-SFQIDEDRILEQLNLDKSIK--VV 168

Query: 249 IVINPGNPTGAVLSEDTIAKICLIAAKYGIAIISDEVYQENVFNGVKFHSMKKVLRKLQR 308
            + +PGNPTGA +    + K+ L     GI ++ DE Y       + F + K  L  L  
Sbjct: 169 FITSPGNPTGACIEVGRVEKL-LRNWTAGIVVV-DEAY-------IDFSADKPSLSPLVN 219

Query: 309 LYPGKFDNVQLASLHSISKGFMGECGQRGGYMEVVGFSKDIRDALFKLMSISICSVVTGQ 368
            +P       L  L ++SK   G  G R G+      S  I  AL  + +    S +T  
Sbjct: 220 KHP------NLVVLQTLSKA-SGLAGIRLGFTFA---STQIATALNAMKAPYNISQIT-- 267

Query: 369 AVVDLMVKPPQP---GDESYDQDHSERMKIFHEMYTRATLLHETFNELEGIECQ 419
           A++ +    P+      +  DQ ++E+ +I   +   ATL H   + + G++  
Sbjct: 268 AIIGIEALQPEALKLMQKHIDQINTEKRRIIKAL---ATLNHIENDPVGGLDAN 318

>TDEL0D05790 Chr4 complement(1045218..1046711) [1494 bp, 497 aa]
           {ON} Anc_3.511 YGL202W
          Length = 497

 Score = 36.6 bits (83), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 21/59 (35%), Positives = 33/59 (55%), Gaps = 1/59 (1%)

Query: 229 DEIEKVVKDALEKGIKPSVLIVINPG-NPTGAVLSEDTIAKICLIAAKYGIAIISDEVY 286
           +++EK++ +      +P +L  I  G NPTG  L++D   +I  IA K+   II DE Y
Sbjct: 190 EKLEKILDEWTPGAPRPKLLYTIPTGQNPTGTSLADDRKKEIYRIAQKHDFLIIEDEPY 248

>KLTH0B00176g Chr2 (10791..12137) [1347 bp, 448 aa] {ON} similar to
           uniprot|P10356 Saccharomyces cerevisiae YER152C
           Hypothetical ORF
          Length = 448

 Score = 36.6 bits (83), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 18/40 (45%), Positives = 25/40 (62%)

Query: 247 VLIVINPGNPTGAVLSEDTIAKICLIAAKYGIAIISDEVY 286
           + +V    NPTGA+ S  +  K+  +A KY I IISD+VY
Sbjct: 191 IYLVPTYSNPTGAIYSRSSRLKLLELARKYDILIISDDVY 230

>TBLA0B00990 Chr2 complement(221196..222836) [1641 bp, 546 aa] {ON}
           Anc_2.102 YHR137W
          Length = 546

 Score = 36.6 bits (83), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 18/44 (40%), Positives = 27/44 (61%), Gaps = 1/44 (2%)

Query: 244 KPSVLIVINPG-NPTGAVLSEDTIAKICLIAAKYGIAIISDEVY 286
           +PS+L  I+ G NPTG  +S +  A+I  +A KY   I+ D+ Y
Sbjct: 225 RPSILYTISTGQNPTGLTISMENRARIYKLAQKYNFLIVEDDPY 268

>Kwal_23.4888 s23 (907745..908914) [1170 bp, 389 aa] {ON} YIL116W
           (HIS5) - histidinol-phosphate aminotransferase [contig
           5] FULL
          Length = 389

 Score = 36.2 bits (82), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 39/149 (26%), Positives = 69/149 (46%), Gaps = 23/149 (15%)

Query: 192 LLIPIPQYPLYTASASLFNAQVL--PYYLDEGSNWSTKSDEIEKVVKDALEKGIKPSVLI 249
           +LI  P Y +Y+    + + + +  P  +++ S       + EKV+ + L+      ++ 
Sbjct: 115 ILIMPPTYGMYSICTDINDVEYVKVPLVVEDNSFQM----DTEKVI-ETLQNDPSIKLVF 169

Query: 250 VINPGNPTGAVLSEDTIAKICLIAAKYGIAIISDEVYQENVFNGVKFHSMKKVLRKLQRL 309
           + +PGNPTGA++  + I K+ L   + G  ++ DE Y       + F +    +  L   
Sbjct: 170 ITSPGNPTGALIKPENIEKL-LSQWQSGFVVV-DEAY-------IDFCTTGGSVAPLVNK 220

Query: 310 YPGKFDNVQLASLHSISKGFMGECGQRGG 338
           YP       LA L ++SK F G  G R G
Sbjct: 221 YP------NLAVLQTLSKSF-GLAGIRLG 242

>Kpol_278.2 s278 (2488..3984) [1497 bp, 498 aa] {ON} (2488..3984)
           [1497 nt, 499 aa]
          Length = 498

 Score = 35.8 bits (81), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 20/59 (33%), Positives = 33/59 (55%), Gaps = 1/59 (1%)

Query: 229 DEIEKVVKDALEKGIKPSVLIVINPG-NPTGAVLSEDTIAKICLIAAKYGIAIISDEVY 286
           +++E+++ +      KP +L  I  G NPTG  L+++   +I  IA K+   II DE Y
Sbjct: 191 EKLEEILDNWTPGAPKPKLLYTIPTGQNPTGTSLADERKVEIYRIACKHDFLIIEDEPY 249

>TDEL0C04090 Chr3 complement(722310..723461) [1152 bp, 383 aa] {ON}
           Anc_2.252 YIL116W
          Length = 383

 Score = 35.4 bits (80), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 42/142 (29%), Positives = 64/142 (45%), Gaps = 21/142 (14%)

Query: 197 PQYPLYTASASLFNAQVLPYYLDEGSNWSTKSDEIEKVVKDALEKGIKPSVLIVINPGNP 256
           P Y +Y+  AS+ + +++   L    N      E    V D L+K     ++ + +PGNP
Sbjct: 117 PTYGMYSVCASVNDVEIVKCPLVTSDNSFQVDTE---AVLDTLKKDPLIKLVFITSPGNP 173

Query: 257 TGAVLSEDTIAKICLIAAKYGIAIISDEVYQENVFNGVKFHSMKKVLRKLQRLYPGKFDN 316
           TGA +    I KI L     GI ++ DE Y +  F G    S   ++ K    YP     
Sbjct: 174 TGAKIETSRIEKI-LQNWDQGILVV-DEAYID--FCG---GSTAPLVNK----YP----- 217

Query: 317 VQLASLHSISKGFMGECGQRGG 338
             + +L ++SK F G  G R G
Sbjct: 218 -NICTLQTLSKSF-GLAGIRVG 237

>TPHA0D03370 Chr4 complement(704980..706473) [1494 bp, 497 aa] {ON}
           Anc_3.511 YGL202W
          Length = 497

 Score = 35.8 bits (81), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 21/59 (35%), Positives = 32/59 (54%), Gaps = 1/59 (1%)

Query: 229 DEIEKVVKDALEKGIKPSVLIVINPG-NPTGAVLSEDTIAKICLIAAKYGIAIISDEVY 286
           +++E ++ +      KP +L  I  G NPTG+ LS++    I  IA K+   II DE Y
Sbjct: 191 EKLESILDNWTPGSPKPKLLYTIPTGQNPTGSSLSDERKEAIYKIACKHDFIIIEDEPY 249

>CAGL0C01243g Chr3 (128629..129780) [1152 bp, 383 aa] {ON} highly
           similar to uniprot|P07172 Saccharomyces cerevisiae
           YIL116w HIS5
          Length = 383

 Score = 35.4 bits (80), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 41/144 (28%), Positives = 66/144 (45%), Gaps = 25/144 (17%)

Query: 197 PQYPLYTASASLFNAQVL--PYYLDEGSNWSTKSDEIEKVVKDALEKGIKPSVLIVINPG 254
           P Y +Y+  A++ + +VL  P   ++ S        I  +  D L K     ++ + +PG
Sbjct: 119 PTYSMYSVCANINDVEVLECPLIYEDNSFQPDSQKVISILSSDPLIK-----LVFLTSPG 173

Query: 255 NPTGAVLSEDTIAKICLIAAKYGIAIISDEVYQENVFNGVKFHSMKKVLRKLQRLYPGKF 314
           NPTGA +  + I KI  + +  G  ++ DE Y +  F G    S   ++ K    YP   
Sbjct: 174 NPTGAKIDSNIIIKI--LESWDGGFVVVDEAYID--FCG---GSTAPLVTK----YP--- 219

Query: 315 DNVQLASLHSISKGFMGECGQRGG 338
               L +L ++SK F G  G R G
Sbjct: 220 ---NLITLQTLSKSF-GLAGIRLG 239

>Kpol_1039.22 s1039 (68736..69896) [1161 bp, 386 aa] {ON}
           (68736..69896) [1161 nt, 387 aa]
          Length = 386

 Score = 35.4 bits (80), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 41/156 (26%), Positives = 75/156 (48%), Gaps = 20/156 (12%)

Query: 185 CK-DVQTGLLIPIPQYPLYTASASLFNAQVLPY-YLDEGSNWSTKSDEIEKVVKDALEKG 242
           C+ +V   L +P P Y +Y+  A++ + +++    + E +++     E+   +K+     
Sbjct: 105 CRPEVDKILTLP-PTYSMYSVCANINDVEIVECPLITEDNSFQMNVPEVLSTLKN----D 159

Query: 243 IKPSVLIVINPGNPTGAVLSEDTIAKICLIAAKYGIAIISDEVYQENVFNGVKFHSMKKV 302
            K  +L + +PGNPTG ++++  I  I L     G+ ++ DE Y +        +SM K+
Sbjct: 160 PKIKLLFITSPGNPTGKLVNKKDIEFI-LENWTNGLVVV-DEAYIDFADAEGTTYSMAKL 217

Query: 303 LRKLQRLYPGKFDNVQLASLHSISKGFMGECGQRGG 338
           + K    YP       L  L ++SK F G  G R G
Sbjct: 218 VTK----YP------NLTVLQTLSKSF-GLAGIRLG 242

>CAGL0G01254g Chr7 (119281..120795) [1515 bp, 504 aa] {ON} highly
           similar to uniprot|P53090 Saccharomyces cerevisiae
           YGL202w ARO8
          Length = 504

 Score = 35.4 bits (80), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 21/59 (35%), Positives = 33/59 (55%), Gaps = 1/59 (1%)

Query: 229 DEIEKVVKDALEKGIKPSVLIVINPG-NPTGAVLSEDTIAKICLIAAKYGIAIISDEVY 286
           +++E ++ +  E   KP +L  I  G NPTG+ L+ +   +I  IA K+   II DE Y
Sbjct: 191 EKLEALLDNWTEGAPKPKLLYTIPTGQNPTGSSLNAERKKEIYRIAQKHDFLIIEDEPY 249

>Ecym_5542 Chr5 (1099530..1100870) [1341 bp, 446 aa] {ON} similar to
           Ashbya gossypii AGR141C
          Length = 446

 Score = 35.0 bits (79), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 28/95 (29%), Positives = 45/95 (47%), Gaps = 4/95 (4%)

Query: 255 NPTGAVLSEDTIAKICLIAAKYGIAIISDEVYQENVFNGVKFHSMKKVLRKLQRLYPGKF 314
           NP+G   S  T  K+  +A KY I +ISD+VY   V++     ++ K L +L  L    +
Sbjct: 199 NPSGKTYSVSTRLKLVELARKYDILLISDDVYDLLVYDQ-PCDALPKCLPRLTHLDRASY 257

Query: 315 DNVQLASLHSISKGFMGEC---GQRGGYMEVVGFS 346
           +  +    ++IS     +    G R GY E V  +
Sbjct: 258 EYGENGYGNTISNATFSKVIAPGLRCGYQESVNMN 292

>Kwal_8.585 s8 (15757..17097) [1341 bp, 446 aa] {ON} YER152C -
           Hypothetical ORF [contig 311] FULL
          Length = 446

 Score = 34.7 bits (78), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 30/52 (57%)

Query: 247 VLIVINPGNPTGAVLSEDTIAKICLIAAKYGIAIISDEVYQENVFNGVKFHS 298
           + +V    NP+GA  S++   K+  +A +Y I IISD+VY    F+G +  S
Sbjct: 192 IYLVPTFSNPSGATYSQECRLKLLDLARRYDILIISDDVYDLLGFHGQRTDS 243

>TDEL0A01600 Chr1 (289263..290690) [1428 bp, 475 aa] {ON} Anc_8.204
           YER152C
          Length = 475

 Score = 34.7 bits (78), Expect = 0.59,   Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 28/50 (56%), Gaps = 1/50 (2%)

Query: 238 ALEKGIKPSVLIVI-NPGNPTGAVLSEDTIAKICLIAAKYGIAIISDEVY 286
           A+ K I   V+  I    NPTG   S +T  K+  IA KY + II+D+VY
Sbjct: 184 AVPKKIYKYVIYCIPTYSNPTGTTYSTETKLKLIEIARKYDMLIIADDVY 233

>NCAS0B06440 Chr2 complement(1218759..1219916) [1158 bp, 385 aa]
           {ON} Anc_2.252 YIL116W
          Length = 385

 Score = 33.9 bits (76), Expect = 0.87,   Method: Compositional matrix adjust.
 Identities = 27/104 (25%), Positives = 54/104 (51%), Gaps = 9/104 (8%)

Query: 185 CKDVQTGLLIPIPQYPLYTASASLFNAQVLPY-YLDEGSNWSTKSDEIEKVVK-DALEKG 242
           C   +  +L+  P Y +Y+  A++ + +V+    + E +++   SD++  ++K D L K 
Sbjct: 108 CVPAKEKILVLPPTYSMYSVCANINDIEVVECPLIYEDNSFQLNSDKVLDILKNDPLIK- 166

Query: 243 IKPSVLIVINPGNPTGAVLSEDTIAKICLIAAKYGIAIISDEVY 286
               ++ + +PGNPTG  +    I K+ L     G+ ++ DE Y
Sbjct: 167 ----LVFITSPGNPTGVKIETKRIEKV-LQNWDNGLVVV-DEAY 204

>YGL202W Chr7 (116059..117561) [1503 bp, 500 aa] {ON}  ARO8Aromatic
           aminotransferase I, expression is regulated by general
           control of amino acid biosynthesis
          Length = 500

 Score = 33.9 bits (76), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 20/59 (33%), Positives = 31/59 (52%), Gaps = 1/59 (1%)

Query: 229 DEIEKVVKDALEKGIKPSVLIVINPG-NPTGAVLSEDTIAKICLIAAKYGIAIISDEVY 286
           +++ KV+++      KP +L  I  G NPTG  +++     I  IA KY   I+ DE Y
Sbjct: 193 EKLAKVMENWTPGAPKPKLLYTIPTGQNPTGTSIADHRKEAIYKIAQKYDFLIVEDEPY 251

>Smik_5.319 Chr5 complement(477840..479171) [1332 bp, 443 aa] {ON}
           YER152C (REAL)
          Length = 443

 Score = 33.9 bits (76), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 25/70 (35%), Positives = 33/70 (47%), Gaps = 1/70 (1%)

Query: 218 LDEGSNWSTKSDEIEKVVKDALEKGIKPSVLIVI-NPGNPTGAVLSEDTIAKICLIAAKY 276
           LD     S      E +   AL K I   VL  I    NP+G   S +T  ++  IA KY
Sbjct: 158 LDHHEGESQPDSTTEIIQGPALTKKIYKYVLYCIPTFANPSGNTYSLETRRRLIDIARKY 217

Query: 277 GIAIISDEVY 286
            + +ISD+VY
Sbjct: 218 DMLVISDDVY 227

>NCAS0E00670 Chr5 (117006..118499) [1494 bp, 497 aa] {ON} Anc_3.511
          Length = 497

 Score = 33.5 bits (75), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 25/80 (31%), Positives = 37/80 (46%), Gaps = 9/80 (11%)

Query: 230 EIEKVVKDALEKGIKPSVLIVINPG-NPTGAVLSEDTIAKICLIAAKYGIAIISDEVYQE 288
           ++E ++ +      KP +L  I  G NPTG  L+++   +I  IA K+   II D  Y  
Sbjct: 193 KLEAILDNWTPGAPKPKLLYTIPTGQNPTGTSLADERKPEIFRIAQKHDFLIIEDAPYY- 251

Query: 289 NVFNGVKFHSMKKVLRKLQR 308
                  F  M K  R LQ+
Sbjct: 252 -------FLQMDKYERDLQK 264

>Skud_9.55 Chr9 (119747..120904) [1158 bp, 385 aa] {ON} YIL116W
           (REAL)
          Length = 385

 Score = 33.5 bits (75), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 51/210 (24%), Positives = 94/210 (44%), Gaps = 27/210 (12%)

Query: 192 LLIPIPQYPLYTASASLFNAQVL--PYYLDEGSNWSTKSDEIEKVVKDALEKGIKPSVLI 249
           +L+  P Y +Y+  A++ + +V+  P  + + S        +  +  D L K     ++ 
Sbjct: 115 ILVLPPTYSMYSVCANINDVEVVQCPLTVSDNSFQMDTEAALTILKNDPLIK-----LIF 169

Query: 250 VINPGNPTGAVLSEDTIAKICLIAAKYGIAIISDEVYQENVFNGVKFHSMKKVLRKLQRL 309
           V +PGNPTGA +    I KI L   + G+ ++ DE Y +  F G    S   ++ K    
Sbjct: 170 VTSPGNPTGAKIKTCLIEKI-LQNWENGLVVV-DEAYID--FCG---GSTAPLVTK---- 218

Query: 310 YPGKFDNVQLASLHSISKGFMGECGQRGGYMEVVGFSKDIRDALFKLMSISICSVVTGQA 369
           YP       L +L ++SK F G  G R G         +I +A+    +IS  S+ +  A
Sbjct: 219 YP------NLVTLQTLSKSF-GLAGIRLGMTYATSDLANILNAMKAPYNIS--SLASEYA 269

Query: 370 VVDLMVKPPQPGDESYDQDHSERMKIFHEM 399
           +  +     Q  + +    + E+M++  ++
Sbjct: 270 LKAVQDSSLQKMEATSKLINEEKMRLLKDL 299

>KLLA0F03509g Chr6 (327598..328761) [1164 bp, 387 aa] {ON} similar
           to uniprot|P07172 Saccharomyces cerevisiae YIL116W HIS5
           Histidinol-phosphate aminotransferase catalyzes the
           seventh step in histidine biosynthesis responsive to
           general control of amino acid biosynthesis mutations
           cause histidine auxotrophy and sensitivity to Cu Co and
           Ni salts
          Length = 387

 Score = 33.5 bits (75), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 40/156 (25%), Positives = 74/156 (47%), Gaps = 20/156 (12%)

Query: 185 CKDVQTGLLIPIPQYPLYTASASLFNAQ--VLPYYLDEGSNWSTKSDEIEKVVKDALEKG 242
           C   +  +LI    Y +YT  + + + +   +P  L E   +    ++I + +++  +  
Sbjct: 108 CVPAKEKILIAPATYGMYTICSQVNDVEYVTVPLLLSEEDKFQIDEEKILETLQN--DPS 165

Query: 243 IKPSVLIVINPGNPTGAVLSEDTIAKICLIAAKYGIAIISDEVYQENVFNGVKFHSMKKV 302
           IK  ++ + +PGNPTG  +  + I KI L   + G+ ++ DE Y + V  G    S+  +
Sbjct: 166 IK--LVFITSPGNPTGTFIDVNRIEKI-LSQWQTGLVVV-DEAYIDFV-EGSDKGSLAPL 220

Query: 303 LRKLQRLYPGKFDNVQLASLHSISKGFMGECGQRGG 338
                     K++N+  A L ++SK F G  G R G
Sbjct: 221 --------ATKYENI--AVLQTLSKSF-GLAGIRLG 245

>KAFR0J01580 Chr10 complement(287313..288464) [1152 bp, 383 aa] {ON}
           Anc_2.252 YIL116W
          Length = 383

 Score = 33.5 bits (75), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 43/156 (27%), Positives = 74/156 (47%), Gaps = 25/156 (16%)

Query: 185 CKDVQTGLLIPIPQYPLYTASASLFNAQVLPY-YLDEGSNWSTKSDEIEKVV-KDALEKG 242
           C   +  +L+  P Y +Y+  A++ +  V+    + E +++   + EI  ++  D L K 
Sbjct: 107 CVPSKEKILVLPPTYSMYSVCANINDVDVVTCPLITEDNSFQIDATEILNILANDPLIK- 165

Query: 243 IKPSVLIVINPGNPTGAVLSEDTIAKICLIAAKYGIAIISDEVYQENVFNGVKFHSMKKV 302
               ++ + +PGNPTGA +  D I  + L     G+ I+ DE Y +  F+G    S   +
Sbjct: 166 ----LVFITSPGNPTGAKIEIDRIEYL-LKNWDQGLVIV-DEAYID--FSG---GSTAPL 214

Query: 303 LRKLQRLYPGKFDNVQLASLHSISKGFMGECGQRGG 338
           + K    YP       L +L ++SK F G  G R G
Sbjct: 215 VTK----YP------NLVTLQTLSKSF-GLAGIRLG 239

>ZYRO0C06028g Chr3 (457564..459054) [1491 bp, 496 aa] {ON} highly
           similar to uniprot|P53090 Saccharomyces cerevisiae
           YGL202W ARO8 Aromatic aminotransferase expression is
           regulated by general control of amino acid biosynthesis
          Length = 496

 Score = 33.1 bits (74), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 20/59 (33%), Positives = 29/59 (49%), Gaps = 1/59 (1%)

Query: 229 DEIEKVVKDALEKGIKPSVLIVINPG-NPTGAVLSEDTIAKICLIAAKYGIAIISDEVY 286
           +++E ++ +      KP +L  I  G NPTG  L  D    I  IA K+   I+ DE Y
Sbjct: 190 EKLEDLLDNWTPNAPKPKLLYTIPTGQNPTGTSLPNDRREAIYRIAQKHDFLIVEDEPY 248

>Ecym_3290 Chr3 (546773..547933) [1161 bp, 386 aa] {ON} similar to
           Ashbya gossypii ADL249W
          Length = 386

 Score = 33.1 bits (74), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 39/148 (26%), Positives = 69/148 (46%), Gaps = 23/148 (15%)

Query: 192 LLIPIPQYPLYTASASLFNAQVLPY-YLDEGSNWSTKSDEIEKVVKDALEKGIKPSVLIV 250
           L++P P Y +Y+  A + + +V+    + E +++    D + + + +  +  IK  +L +
Sbjct: 116 LVLP-PTYSMYSVFAMINDTEVVECPLITEDNSFDMDLDNVLETLSN--DDSIK--LLFI 170

Query: 251 INPGNPTGAVLSEDTIAKICLIAAKYGIAIISDEVYQENVFNGVKFHSMKKVLRKLQRLY 310
             PGNPTGA +S   I ++ L     GI ++ DE Y       + F S       + + Y
Sbjct: 171 TTPGNPTGASISTQKI-EMLLNNWSAGIVVV-DEAY-------IDFSSSDSAAPLVNK-Y 220

Query: 311 PGKFDNVQLASLHSISKGFMGECGQRGG 338
           P       L  + ++SK F G  G R G
Sbjct: 221 P------NLVVIQTLSKSF-GLAGVRLG 241

>KLLA0A04906g Chr1 (437523..438965) [1443 bp, 480 aa] {ON} similar
           to uniprot|P53090 Saccharomyces cerevisiae YGL202W ARO8
           Aromatic aminotransferase expression is regulated by
           general control of amino acid biosynthesis
          Length = 480

 Score = 32.7 bits (73), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 20/63 (31%), Positives = 35/63 (55%), Gaps = 3/63 (4%)

Query: 227 KSDEIEKVVKD--ALEKGIKPSVLIVI-NPGNPTGAVLSEDTIAKICLIAAKYGIAIISD 283
           K D++ ++++D     +G  P +L  I N  NPTG  L E+   ++  +A++Y   II D
Sbjct: 185 KVDKLSEMLRDWDVAVQGPFPKLLYTIPNGHNPTGCTLHEERKPELVRLASQYDFIIIED 244

Query: 284 EVY 286
           + Y
Sbjct: 245 DPY 247

>AFR548C Chr6 complement(1422283..1423776) [1494 bp, 497 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGL202W
           (ARO8)
          Length = 497

 Score = 32.7 bits (73), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 26/91 (28%), Positives = 41/91 (45%), Gaps = 6/91 (6%)

Query: 202 YTASASLFNAQV-----LPYYLDEGSNWSTKSDEIEKVVKDALEKGIKPSVLIVINPG-N 255
           YT S+SL  A+       P  LDE      +  E+    +   +   +P +L  +  G N
Sbjct: 162 YTFSSSLVAAEAQGVRAYPVPLDENGMVPERLGELLDNWERWHDGVPRPKLLYTVPTGQN 221

Query: 256 PTGAVLSEDTIAKICLIAAKYGIAIISDEVY 286
           PTG  LS D    +  +A ++ + I+ DE Y
Sbjct: 222 PTGTCLSNDRRQAVYRLAQQHDLLIVEDEPY 252

>NDAI0I02830 Chr9 complement(669885..671387) [1503 bp, 500 aa] {ON}
           Anc_3.511
          Length = 500

 Score = 32.3 bits (72), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 19/59 (32%), Positives = 30/59 (50%), Gaps = 1/59 (1%)

Query: 229 DEIEKVVKDALEKGIKPSVLIVINPG-NPTGAVLSEDTIAKICLIAAKYGIAIISDEVY 286
           +++EK++ +      KP +L  I  G NPTG  L    + +I  IA K+   I+ D  Y
Sbjct: 192 EKLEKILDNWTPGAPKPKLLYTIPTGQNPTGTSLPAHRMEEIYRIAQKHDFLIVEDAPY 250

>Kpol_1032.39 s1032 complement(90576..91937) [1362 bp, 453 aa] {ON}
           complement(90576..91937) [1362 nt, 454 aa]
          Length = 453

 Score = 32.0 bits (71), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 28/48 (58%)

Query: 239 LEKGIKPSVLIVINPGNPTGAVLSEDTIAKICLIAAKYGIAIISDEVY 286
           L+K  K  + ++    NP+G   + +T  K+  +A KY + II+D+VY
Sbjct: 189 LKKVYKYVIYVIPTYSNPSGKTYNLETRCKLIELARKYDMLIITDDVY 236

>KLLA0E00969g Chr5 (101430..102767) [1338 bp, 445 aa] {ON} similar
           to uniprot|P10356 Saccharomyces cerevisiae YER152C
           Hypothetical ORF
          Length = 445

 Score = 32.0 bits (71), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 22/71 (30%), Positives = 37/71 (52%), Gaps = 3/71 (4%)

Query: 217 YLDEGSNWSTKSDEIEKVVK-DALEKGIKPSVLIVINPGNPTGAVLSEDTIAKICLIAAK 275
           Y D  SN    S E++ +   +A +K  +  + +V    NP G   S +T  K+  +A K
Sbjct: 160 YFDSISN--DNSSELQLITAPNANKKVYRYVIYLVPTYSNPGGQTYSLETRVKLIELARK 217

Query: 276 YGIAIISDEVY 286
           + + I+SD+VY
Sbjct: 218 HDMLIVSDDVY 228

>Kwal_47.17462 s47 (413555..415033) [1479 bp, 492 aa] {ON} YGL202W
           (ARO8) - aromatic amino acid aminotransferase [contig
           207] FULL
          Length = 492

 Score = 32.0 bits (71), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 29/89 (32%), Positives = 39/89 (43%), Gaps = 4/89 (4%)

Query: 202 YTASASLFNAQ---VLPYYLDEGSNWSTKSDEIEKVVKDALEKGIKPSVLIVINPG-NPT 257
           Y++S    +AQ    +P  LD       K +E+     D       P +L  I  G NPT
Sbjct: 164 YSSSVEAADAQGLNCIPMPLDGEGIIPEKLEEMLINWSDLYPDIPMPKLLYTIPTGQNPT 223

Query: 258 GAVLSEDTIAKICLIAAKYGIAIISDEVY 286
           G  LS+     I  +A KY + II DE Y
Sbjct: 224 GCTLSDSRKPYIYHLAQKYDMIIIEDEPY 252

>NCAS0B07170 Chr2 (1360700..1361128) [429 bp, 142 aa] {ON}
          Anc_2.109 YHR132W-A
          Length = 142

 Score = 30.8 bits (68), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 24/87 (27%), Positives = 44/87 (50%), Gaps = 20/87 (22%)

Query: 4  THQQDLKSVFTTKDL--NFKPAAKITKKDLNAGVTKAEYAVRGAIPTRADELKEELK--- 58
          T + DLK++  TKD   N    +K+T ++L        + + G +P++ D LK +++   
Sbjct: 10 TSRVDLKNLAHTKDKDGNMVDLSKLTPQELKL------FKMYGKLPSKRDLLKHKMQERK 63

Query: 59 ---------RKPGVLPFDDIINANIGN 76
                   RK GV+  DD++++N  N
Sbjct: 64 YFDSGDYALRKAGVIKKDDVMSSNSSN 90

>SAKL0E08492g Chr5 complement(692049..693203) [1155 bp, 384 aa] {ON}
           similar to uniprot|P07172 Saccharomyces cerevisiae
           YIL116W HIS5 Histidinol-phosphate aminotransferase
           catalyzes the seventh step in histidine biosynthesis
           responsive to general control of amino acid biosynthesis
           mutations cause histidine auxotrophy and sensitivity to
           Cu Co and Ni salts
          Length = 384

 Score = 31.6 bits (70), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 43/180 (23%), Positives = 72/180 (40%), Gaps = 25/180 (13%)

Query: 161 PAAPENIYXXXXXXXXXXXXXXXXCKDVQTGLLIPIPQYPLYTASASLFNAQVL--PYYL 218
           P   ENI                 C   +  ++I  P Y +Y+  A + +   +  P   
Sbjct: 84  PLTAENICLGVGSDESIDALIRVCCVPSKDKIMIMPPTYGMYSICADINDVGCVKVPLVA 143

Query: 219 DEGSNWSTKSDEIEKVVKDALEKGIKPSVLIVINPGNPTGAVLSEDTIAKICLIAAKYGI 278
           ++ S     S  +E + +D   K     ++ + +PGNPT A++    I K+  +    G 
Sbjct: 144 EDNSFQMDTSKVLETLAQDPTIK-----LIFITSPGNPTAALIDTAEIEKV--LNNWTGG 196

Query: 279 AIISDEVYQENVFNGVKFHSMKKVLRKLQRLYPGKFDNVQLASLHSISKGFMGECGQRGG 338
            ++ DE Y +  F G    S   ++ K    YP       LA + ++SK F G  G R G
Sbjct: 197 LVVVDEAYID--FCG---GSTTPLVNK----YP------NLAVIQTMSKSF-GLAGVRLG 240

>NDAI0C05960 Chr3 complement(1365183..1366619) [1437 bp, 478 aa]
           {ON} Anc_8.204 YER152C
          Length = 478

 Score = 31.6 bits (70), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 34/126 (26%), Positives = 54/126 (42%), Gaps = 17/126 (13%)

Query: 231 IEKVVKDALEKGIKPSVLIVINPGNPTGAVLSEDTIAKICLIAAKYGIAIISDEVYQENV 290
           I +   ++++K  K  +  V +  NP+G   S  T  K+  +A  Y I II+D+VY+   
Sbjct: 202 IRRPNANSMKKIYKYVLYCVPSFANPSGKSYSLKTKRKLIDLACLYDILIITDDVYE--- 258

Query: 291 FNGVKFHSMKKVLRKLQRLYPGKFDNVQLASLHSISKGFMGECGQRGGYMEVVG---FSK 347
           F   K +    V+       P +F +++      +  G    C   G Y  VV    FSK
Sbjct: 259 FLNYKVNPATSVI-------PKRFVDIEREMWRDLPDG----CDLEGMYGHVVSNATFSK 307

Query: 348 DIRDAL 353
            I   L
Sbjct: 308 IIAPGL 313

>TBLA0H01890 Chr8 complement(447319..450657) [3339 bp, 1112 aa] {ON}
           Anc_5.367 YDR325W
          Length = 1112

 Score = 31.6 bits (70), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 17/46 (36%), Positives = 29/46 (63%), Gaps = 1/46 (2%)

Query: 85  LTFTRQVLSILEYPE-ILRVGPDKLASLNLFRKDALGRAEHLLEDI 129
           LT  R +LSI+E P+ ++++G + L SL++  KD +     L+ DI
Sbjct: 438 LTVVRNMLSIIELPDSLIKIGFNVLKSLSINEKDFVTMGIELINDI 483

>KLLA0F03377g Chr6 complement(317185..318615) [1431 bp, 476 aa] {ON}
           similar to uniprot|P41814 Saccharomyces cerevisiae
           YNL062C GCD10 Subunit of tRNA (1-methyladenosine)
           methyltransferase with Gcd14p required for the
           modification of the adenine at position 58 in tRNAs
           especially tRNAi-Met first identified as a negative
           regulator of GCN4 expression
          Length = 476

 Score = 31.2 bits (69), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 33/134 (24%), Positives = 62/134 (46%), Gaps = 12/134 (8%)

Query: 258 GAVLSEDTIAKICLIA--AKYGIAIISDEVYQENVFNGVKFHSMKKVLRKLQRLYPGKFD 315
           G+V+ E ++A+I  +   A  G AIIS  +     F+    HS +K L++ ++ +  KF 
Sbjct: 111 GSVVQEMSMAEIEAMKREAASGDAIISKMIESHKSFHQKTVHSQEKYLKRKKQKF-AKFF 169

Query: 316 NVQLASLHSISKGFMGECGQRGGYMEVVGFSKDIRDALFKLMSIS-----ICSVVTGQAV 370
            V+       S G +    ++G  + V+  S++       L +I+     +C   TG  +
Sbjct: 170 TVEYLD----SSGLLHYLIEKGDVLRVMDISQESLGMALNLANINSNGQYLCIDETGGLI 225

Query: 371 VDLMVKPPQPGDES 384
           V  M++    GD +
Sbjct: 226 VYAMLERMFAGDSN 239

>KAFR0D01420 Chr4 (284515..285993) [1479 bp, 492 aa] {ON} Anc_3.511
           YGL202W
          Length = 492

 Score = 31.2 bits (69), Expect = 7.1,   Method: Compositional matrix adjust.
 Identities = 17/44 (38%), Positives = 25/44 (56%), Gaps = 1/44 (2%)

Query: 244 KPSVLIVINPG-NPTGAVLSEDTIAKICLIAAKYGIAIISDEVY 286
           KP +L  I  G NPTG+ L  +  +++  IA K+   I+ DE Y
Sbjct: 206 KPKLLYTIPTGQNPTGSSLDAERKSQVYKIAQKHDFLIVEDEPY 249

>Smik_7.69 Chr7 (111132..112634) [1503 bp, 500 aa] {ON} YGL202W
           (REAL)
          Length = 500

 Score = 31.2 bits (69), Expect = 7.4,   Method: Compositional matrix adjust.
 Identities = 18/59 (30%), Positives = 29/59 (49%), Gaps = 1/59 (1%)

Query: 229 DEIEKVVKDALEKGIKPSVLIVINPG-NPTGAVLSEDTIAKICLIAAKYGIAIISDEVY 286
           +++ K++ +      KP +L  I  G NPTG  ++      I  IA K+   I+ DE Y
Sbjct: 193 EKLAKIMDNWTPNAPKPKLLYTIPTGQNPTGTSIANHRKEAIYKIAQKHDFLIVEDEPY 251

>Suva_9.78 Chr9 (137747..138907) [1161 bp, 386 aa] {ON} YIL116W
           (REAL)
          Length = 386

 Score = 30.8 bits (68), Expect = 8.1,   Method: Compositional matrix adjust.
 Identities = 44/147 (29%), Positives = 72/147 (48%), Gaps = 22/147 (14%)

Query: 192 LLIPIPQYPLYTASASLFNAQVLPYYLDEGSNWSTKSDEIEKVVKDALEKGIKPSVLIVI 251
           L++P P Y +Y+  A++ + +V+   L    N S + D +E V+   LE      ++ V 
Sbjct: 116 LVLP-PTYSMYSVCANINDIEVVQCPLVVSDN-SFQMD-VEAVLT-ILENDPLIKLVFVT 171

Query: 252 NPGNPTGAVLSEDTIAKICLIAAKYGIAIISDEVYQENVFNGVKFHSMKKVLRKLQRLYP 311
           +PGNPTGA +    I ++ L   + G+ ++ DE Y +  F G    S   ++ K    YP
Sbjct: 172 SPGNPTGAKIKTSLIEQV-LQNWQNGLVVV-DEAYID--FCG---GSTAPLVTK----YP 220

Query: 312 GKFDNVQLASLHSISKGFMGECGQRGG 338
                  L +L ++SK F G  G R G
Sbjct: 221 ------NLVTLQTLSKSF-GLAGIRLG 240

>Skud_7.69 Chr7 (120729..122231) [1503 bp, 500 aa] {ON} YGL202W
           (REAL)
          Length = 500

 Score = 30.8 bits (68), Expect = 8.2,   Method: Compositional matrix adjust.
 Identities = 18/59 (30%), Positives = 30/59 (50%), Gaps = 1/59 (1%)

Query: 229 DEIEKVVKDALEKGIKPSVLIVINPG-NPTGAVLSEDTIAKICLIAAKYGIAIISDEVY 286
           +++ K++ +      KP +L  I  G NPTG  +++     I  IA K+   I+ DE Y
Sbjct: 193 EKLAKIMDNWTAGAPKPKLLYTIPTGQNPTGTSIADHRKEAIYKIAQKHDFIIVEDEPY 251

>Suva_7.61 Chr7 (112022..113524) [1503 bp, 500 aa] {ON} YGL202W
           (REAL)
          Length = 500

 Score = 30.8 bits (68), Expect = 9.1,   Method: Compositional matrix adjust.
 Identities = 18/59 (30%), Positives = 30/59 (50%), Gaps = 1/59 (1%)

Query: 229 DEIEKVVKDALEKGIKPSVLIVINPG-NPTGAVLSEDTIAKICLIAAKYGIAIISDEVY 286
           +++ K++ +      KP +L  I  G NPTG  +++     I  IA K+   I+ DE Y
Sbjct: 193 EKLAKIMDNWTPGAPKPKLLYTIPTGQNPTGTSIADHRKEAIYKIAQKHDFLIVEDEPY 251

>Kpol_397.8 s397 (25467..27026) [1560 bp, 519 aa] {ON}
           (25467..27026) [1560 nt, 520 aa]
          Length = 519

 Score = 30.8 bits (68), Expect = 9.8,   Method: Compositional matrix adjust.
 Identities = 14/50 (28%), Positives = 23/50 (46%)

Query: 382 DESYDQDHSERMKIFHEMYTRATLLHETFNELEGIECQKPQGAMYLFPRL 431
           DE Y+ D +  +KI    + +    HE  NE+E I+    Q  +   P +
Sbjct: 248 DEDYEYDRNHNIKIHSRPFIKKEFEHEENNEIEDIDLYNIQNNLEFMPHV 297

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.137    0.403 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 52,916,128
Number of extensions: 2260233
Number of successful extensions: 5895
Number of sequences better than 10.0: 122
Number of HSP's gapped: 5958
Number of HSP's successfully gapped: 122
Length of query: 507
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 393
Effective length of database: 40,409,475
Effective search space: 15880923675
Effective search space used: 15880923675
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 68 (30.8 bits)