Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Smik_4.3568.262ON57657627920.0
YDR110W (FOB1)8.262ON56657723290.0
Skud_4.3718.262ON58058023040.0
Suva_2.2708.262ON63258222570.0
KAFR0B055408.262ON5193648261e-103
TDEL0F038908.262ON4763698211e-103
NCAS0B038508.262ON5885287881e-96
SAKL0H17028g8.262ON5504957641e-93
ZYRO0C01650g8.262ON5863677217e-87
NDAI0J013808.262ON6243657108e-85
Ecym_43088.262ON5293406923e-83
KLTH0G13684g8.262ON5083376861e-82
Kwal_56.237998.262ON4883356832e-82
Kpol_392.68.262ON4573376682e-80
AGR086C8.262ON5343516523e-77
Kpol_543.388.262ON4423786444e-77
KLLA0F19140g8.262ON5273566462e-76
KNAG0H032408.262ON5193816061e-70
CAGL0B01771g8.262ON5363896018e-70
TBLA0E044308.262ON4813384797e-53
TPHA0J007408.262ON4083334372e-47
TPHA0A018108.262ON4573374077e-43
TBLA0F030708.262ON4453733901e-40
NDAI0B06160singletonON1403121990.003
NDAI0G00600singletonON48892940.008
NDAI0G00550singletonON41256920.013
KAFR0B06620singletonON1185107820.24
Kpol_1035.3singletonON113098810.31
NDAI0D03010na 1ON778155800.44
Kwal_36.16338singletonON604127790.52
Kwal_27.11219singletonON744127780.75
Kwal_39.16409singletonON734127780.77
Kwal_33.15089singletonON478127761.0
NCAS0I017703.243ON72464751.6
Kwal_27.12438singletonON641127751.7
Kwal_13.691singletonON865127751.9
Kpol_2000.35singletonON704144751.9
Kwal_54.19470singletonON54299742.1
Kwal_60.24910singletonON52499732.9
Kwal_26.7891singletonON31099723.0
Kpol_1037.34singletonON1295105714.9
Suva_9.2392.651ON97144715.0
Kwal_55.19799singletonON35499706.0
Kwal_50.19418singletonON34866696.6
YIR023W (DAL81)2.651ON97082706.6
Kwal_47.17665singletonON62566706.8
NDAI0D004107.483ON320103697.4
Kwal_14.764singletonON35899697.8
Kpol_1066.30singletonON262110679.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Smik_4.356
         (576 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Smik_4.356 Chr4 (637418..639148) [1731 bp, 576 aa] {ON} YDR110W ...  1080   0.0  
YDR110W Chr4 (676102..677802) [1701 bp, 566 aa] {ON}  FOB1Nucleo...   901   0.0  
Skud_4.371 Chr4 (647726..649468) [1743 bp, 580 aa] {ON} YDR110W ...   892   0.0  
Suva_2.270 Chr2 (470408..472306) [1899 bp, 632 aa] {ON} YDR110W ...   874   0.0  
KAFR0B05540 Chr2 complement(1134547..1136106) [1560 bp, 519 aa] ...   322   e-103
TDEL0F03890 Chr6 (724664..726094) [1431 bp, 476 aa] {ON} Anc_8.2...   320   e-103
NCAS0B03850 Chr2 complement(685424..687190) [1767 bp, 588 aa] {O...   308   1e-96
SAKL0H17028g Chr8 complement(1495187..1496839) [1653 bp, 550 aa]...   298   1e-93
ZYRO0C01650g Chr3 complement(117323..119083) [1761 bp, 586 aa] {...   282   7e-87
NDAI0J01380 Chr10 complement(317185..319059) [1875 bp, 624 aa] {...   278   8e-85
Ecym_4308 Chr4 complement(654030..655619) [1590 bp, 529 aa] {ON}...   271   3e-83
KLTH0G13684g Chr7 complement(1171645..1173171) [1527 bp, 508 aa]...   268   1e-82
Kwal_56.23799 s56 complement(708590..710056) [1467 bp, 488 aa] {...   267   2e-82
Kpol_392.6 s392 complement(8453..9826) [1374 bp, 457 aa] {ON} co...   261   2e-80
AGR086C Chr7 complement(888758..890362) [1605 bp, 534 aa] {ON} S...   255   3e-77
Kpol_543.38 s543 (84712..86040) [1329 bp, 442 aa] {ON} (84712..8...   252   4e-77
KLLA0F19140g Chr6 (1773327..1774910) [1584 bp, 527 aa] {ON} some...   253   2e-76
KNAG0H03240 Chr8 complement(603920..605479) [1560 bp, 519 aa] {O...   238   1e-70
CAGL0B01771g Chr2 (163063..164673) [1611 bp, 536 aa] {ON} weakly...   236   8e-70
TBLA0E04430 Chr5 (1136737..1138182) [1446 bp, 481 aa] {ON} Anc_8...   189   7e-53
TPHA0J00740 Chr10 (175036..176262) [1227 bp, 408 aa] {ON} Anc_8....   172   2e-47
TPHA0A01810 Chr1 complement(365982..367355) [1374 bp, 457 aa] {O...   161   7e-43
TBLA0F03070 Chr6 complement(745795..747132) [1338 bp, 445 aa] {O...   154   1e-40
NDAI0B06160 Chr2 (1494425..1498636) [4212 bp, 1403 aa] {ON}            43   0.003
NDAI0G00600 Chr7 complement(130877..132343) [1467 bp, 488 aa] {O...    41   0.008
NDAI0G00550 Chr7 complement(116985..118223) [1239 bp, 412 aa] {O...    40   0.013
KAFR0B06620 Chr2 complement(1376088..1379645) [3558 bp, 1185 aa]...    36   0.24 
Kpol_1035.3 s1035 complement(5707..9099) [3393 bp, 1130 aa] {ON}...    36   0.31 
NDAI0D03010 Chr4 complement(712188..714524) [2337 bp, 778 aa] {O...    35   0.44 
Kwal_36.16338 s36 (3460..5271) [1812 bp, 604 aa] {ON} YPL060C-A ...    35   0.52 
Kwal_27.11219 s27 complement(690913..693147) [2235 bp, 744 aa] {...    35   0.75 
Kwal_39.16409 s39 (7556..9760) [2205 bp, 734 aa] {ON} YLR035C-A ...    35   0.77 
Kwal_33.15089 s33 complement(956930..958366) [1437 bp, 478 aa] {...    34   1.0  
NCAS0I01770 Chr9 complement(326908..329082) [2175 bp, 724 aa] {O...    33   1.6  
Kwal_27.12438 s27 (1219039..1220964) [1926 bp, 641 aa] {ON} YOR3...    33   1.7  
Kwal_13.691 s13 complement(2834..5431) [2598 bp, 865 aa] {ON} YB...    33   1.9  
Kpol_2000.35 s2000 complement(68315..70429) [2115 bp, 704 aa] {O...    33   1.9  
Kwal_54.19470 s54 (253..1881) [1629 bp, 542 aa] {ON} YDR261C-D -...    33   2.1  
Kwal_60.24910 s60 (1218..2792) [1575 bp, 524 aa] {ON} YDR261W-B ...    33   2.9  
Kwal_26.7891 s26 complement(557640..558572) [933 bp, 310 aa] {ON...    32   3.0  
Kpol_1037.34 s1037 (80237..84124) [3888 bp, 1295 aa] {ON} (80237...    32   4.9  
Suva_9.239 Chr9 (384251..384478,384971..387658) [2916 bp, 971 aa...    32   5.0  
Kwal_55.19799 s55 complement(132471..133535) [1065 bp, 354 aa] {...    32   6.0  
Kwal_50.19418 s50 complement(1189..2235) [1047 bp, 348 aa] {ON} ...    31   6.6  
YIR023W Chr9 (399777..402689) [2913 bp, 970 aa] {ON}  DAL81Posit...    32   6.6  
Kwal_47.17665 s47 complement(505870..507747) [1878 bp, 625 aa] {...    32   6.8  
NDAI0D00410 Chr4 (86277..87239) [963 bp, 320 aa] {ON}                  31   7.4  
Kwal_14.764 s14 (32697..33773) [1077 bp, 358 aa] {ON} YLR035C-A ...    31   7.8  
Kpol_1066.30 s1066 complement(52257..53045) [789 bp, 262 aa] {ON...    30   9.8  

>Smik_4.356 Chr4 (637418..639148) [1731 bp, 576 aa] {ON} YDR110W
           (REAL)
          Length = 576

 Score = 1080 bits (2792), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 526/576 (91%), Positives = 526/576 (91%)

Query: 1   MTKPRYNGVLFDDDDSLPSESATRKAPSQGRKATXXXXXXXXXXXXLLILPSMGESYTEY 60
           MTKPRYNGVLFDDDDSLPSESATRKAPSQGRKAT            LLILPSMGESYTEY
Sbjct: 1   MTKPRYNGVLFDDDDSLPSESATRKAPSQGRKATSSRESRDSSKDRLLILPSMGESYTEY 60

Query: 61  VDSYXXXXXXXXXXXXTPIFLESLTRQLTQKIYELIKTKSLTADTLQQISDKYDGVVAEN 120
           VDSY            TPIFLESLTRQLTQKIYELIKTKSLTADTLQQISDKYDGVVAEN
Sbjct: 61  VDSYLNLELLERGERETPIFLESLTRQLTQKIYELIKTKSLTADTLQQISDKYDGVVAEN 120

Query: 121 KLLFLQRQYYVDDEGNVRDGRNNDKIYCEPNHIYDMVMATHLINKHLRGKTLHSFLFSYF 180
           KLLFLQRQYYVDDEGNVRDGRNNDKIYCEPNHIYDMVMATHLINKHLRGKTLHSFLFSYF
Sbjct: 121 KLLFLQRQYYVDDEGNVRDGRNNDKIYCEPNHIYDMVMATHLINKHLRGKTLHSFLFSYF 180

Query: 181 ANISHAIIDWVQQFCSKCNKKGKIKPLKEYKRPDMYDKLLPMERIHIEVFEPFSGETIEG 240
           ANISHAIIDWVQQFCSKCNKKGKIKPLKEYKRPDMYDKLLPMERIHIEVFEPFSGETIEG
Sbjct: 181 ANISHAIIDWVQQFCSKCNKKGKIKPLKEYKRPDMYDKLLPMERIHIEVFEPFSGETIEG 240

Query: 241 KYSYVLLCRDYRSSFMWLLPLKSTKFKHLIPVISSLFLSFARVPIFVTSSTLDKDDLYDI 300
           KYSYVLLCRDYRSSFMWLLPLKSTKFKHLIPVISSLFLSFARVPIFVTSSTLDKDDLYDI
Sbjct: 241 KYSYVLLCRDYRSSFMWLLPLKSTKFKHLIPVISSLFLSFARVPIFVTSSTLDKDDLYDI 300

Query: 301 CEEIASKYGLRIGLGLKSSARFHTGGILCIHYALNSYKEECLADWGKCLRYGPYXXXXXX 360
           CEEIASKYGLRIGLGLKSSARFHTGGILCIHYALNSYKEECLADWGKCLRYGPY      
Sbjct: 301 CEEIASKYGLRIGLGLKSSARFHTGGILCIHYALNSYKEECLADWGKCLRYGPYRFNRRR 360

Query: 361 XXXXXXXPAQVLLSEIPGHNAKFETKRERVIENTYSRNMFKTAGGKGLIYLEDVNTFALA 420
                  PAQVLLSEIPGHNAKFETKRERVIENTYSRNMFKTAGGKGLIYLEDVNTFALA
Sbjct: 361 NKRTKRKPAQVLLSEIPGHNAKFETKRERVIENTYSRNMFKTAGGKGLIYLEDVNTFALA 420

Query: 421 NKADNSYNNGSSHXXXXXXXXXXXXXQKQFDLTEQNYIDEYDDLAHESSEGEFGPSTLTP 480
           NKADNSYNNGSSH             QKQFDLTEQNYIDEYDDLAHESSEGEFGPSTLTP
Sbjct: 421 NKADNSYNNGSSHNNDVDNDNFEEEVQKQFDLTEQNYIDEYDDLAHESSEGEFGPSTLTP 480

Query: 481 EEKNTRIDEEERIGSASGVAQLNENTRQEIGELEKKHQKDADATPQTEPEVDQSLEIAKP 540
           EEKNTRIDEEERIGSASGVAQLNENTRQEIGELEKKHQKDADATPQTEPEVDQSLEIAKP
Sbjct: 481 EEKNTRIDEEERIGSASGVAQLNENTRQEIGELEKKHQKDADATPQTEPEVDQSLEIAKP 540

Query: 541 ETSYFQTMESPSTKRQKLDQQNHGDVTRDFGMSMEL 576
           ETSYFQTMESPSTKRQKLDQQNHGDVTRDFGMSMEL
Sbjct: 541 ETSYFQTMESPSTKRQKLDQQNHGDVTRDFGMSMEL 576

>YDR110W Chr4 (676102..677802) [1701 bp, 566 aa] {ON}  FOB1Nucleolar
           protein that binds the rDNA replication fork barrier
           (RFB) site; required for replication fork blocking,
           recombinational hotspot activity, condensin recruitment
           to RFB and rDNA repeat segregation; related to
           retroviral integrases
          Length = 566

 Score =  901 bits (2329), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 458/577 (79%), Positives = 482/577 (83%), Gaps = 12/577 (2%)

Query: 1   MTKPRYNGVLFDDDDSLPSESATRKAPSQGRKATXXXXXXXXXXXXLLILPSMGESYTEY 60
           MTKPRYN VLFDDDDS+PSES TRK  SQ RKAT            LLILPSMGESYTEY
Sbjct: 1   MTKPRYNDVLFDDDDSVPSESVTRK--SQRRKATSPGESRESSKDRLLILPSMGESYTEY 58

Query: 61  VDSYXXXXXXXXXXXXTPIFLESLTRQLTQKIYELIKTKSLTADTLQQISDKYDGVVAEN 120
           VDSY            TPIFLESLTRQLTQKIYELIKTKSLTADTLQQISDKYDGVVAEN
Sbjct: 59  VDSYLNLELLERGERETPIFLESLTRQLTQKIYELIKTKSLTADTLQQISDKYDGVVAEN 118

Query: 121 KLLFLQRQYYVDDEGNVRDGRNNDKIYCEPNHIYDMVMATHLINKHLRGKTLHSFLFSYF 180
           KLLFLQRQYYVDDEGNVRDGRNNDKIYCEP H+YDMVMATHL+NKHLRGKTLHSFLFS+F
Sbjct: 119 KLLFLQRQYYVDDEGNVRDGRNNDKIYCEPKHVYDMVMATHLMNKHLRGKTLHSFLFSHF 178

Query: 181 ANISHAIIDWVQQFCSKCNKKGKIKPLKEYKRPDMYDKLLPMERIHIEVFEPFSGETIEG 240
           ANISHAIIDWVQQFCSKCNKKGKIKPLKEYKRPDMYDKLLPMERIHIEVFEPF+GE IEG
Sbjct: 179 ANISHAIIDWVQQFCSKCNKKGKIKPLKEYKRPDMYDKLLPMERIHIEVFEPFNGEAIEG 238

Query: 241 KYSYVLLCRDYRSSFMWLLPLKSTKFKHLIPVISSLFLSFARVPIFVTSSTLDKDDLYDI 300
           KYSYVLLCRDYRSSFMWLLPLKSTKFKHLIPV+SSLFL+FARVPIFVTSSTLDKDDLYDI
Sbjct: 239 KYSYVLLCRDYRSSFMWLLPLKSTKFKHLIPVVSSLFLTFARVPIFVTSSTLDKDDLYDI 298

Query: 301 CEEIASKYGLRIGLGLKSSARFHTGGILCIHYALNSYKEECLADWGKCLRYGPYXXXXXX 360
           CEEIASKYGLRIGLGLKSSARFHTGGILCI YALNSYK+ECLADWGKCLRYGPY      
Sbjct: 299 CEEIASKYGLRIGLGLKSSARFHTGGILCIQYALNSYKKECLADWGKCLRYGPYRFNRRR 358

Query: 361 XXXXXXXPAQVLLSEIPGHNAKFETKRERVIENTYSRNMFKTAGGKGLIYLEDVNTFALA 420
                  P QVLLSE+PGHNAKFETKRERVIENTYSRNMFK AGGKGLIYLEDVNTFALA
Sbjct: 359 NKRTKRKPVQVLLSEVPGHNAKFETKRERVIENTYSRNMFKMAGGKGLIYLEDVNTFALA 418

Query: 421 NKADNS-YNNGSSHXXXXXXXXXXXXXQKQFDLTEQNYIDEYDDLAHESSEGEFGPSTLT 479
           N+ADNS  NNG  H             QKQFDLTE+NYIDEYDDLAH+SSEGEF P+TLT
Sbjct: 419 NEADNSCNNNGILHNNNIGNDNFEEEVQKQFDLTEKNYIDEYDDLAHDSSEGEFEPNTLT 478

Query: 480 PEEKNTRIDEEERIGSASGVAQLNENTRQEIGELEKKHQKDADATPQTEPEVDQSLEIAK 539
           PEEK     +E+RI S +GVA   + T     E EK  QK++D   Q    VDQS+EI +
Sbjct: 479 PEEKPPHNVDEDRIES-TGVAAPMQGTE----EPEKGDQKESDGASQ----VDQSVEITR 529

Query: 540 PETSYFQTMESPSTKRQKLDQQNHGDVTRDFGMSMEL 576
           PETSY+QT+ESPSTKRQKLDQQ +GD TRDFG SMEL
Sbjct: 530 PETSYYQTLESPSTKRQKLDQQGNGDQTRDFGTSMEL 566

>Skud_4.371 Chr4 (647726..649468) [1743 bp, 580 aa] {ON} YDR110W
           (REAL)
          Length = 580

 Score =  892 bits (2304), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 452/580 (77%), Positives = 481/580 (82%), Gaps = 4/580 (0%)

Query: 1   MTKPRYNGVLFDD-DDSLPSESATRKAPSQGRKATXXXXXXXXXXXXLLILPSMGESYTE 59
           MT  RYNG LFDD DDSLPS S TRK+  Q RK T            LLILPSMGESYT 
Sbjct: 1   MTNSRYNGALFDDGDDSLPSGSVTRKSSPQMRKTTSPRESREPLKDRLLILPSMGESYTA 60

Query: 60  YVDSYXXXXXXXXXXXXTPIFLESLTRQLTQKIYELIKTKSLTADTLQQISDKYDGVVAE 119
           YVDSY            TPIFLESLTRQLTQ+IYELIKTKSLTADTLQQISDKYDGVVAE
Sbjct: 61  YVDSYLNLELLERGERETPIFLESLTRQLTQQIYELIKTKSLTADTLQQISDKYDGVVAE 120

Query: 120 NKLLFLQRQYYVDDEGNVRDGRNNDKIYCEPNHIYDMVMATHLINKHLRGKTLHSFLFSY 179
           NKLLFLQRQYYVD+EGNVRDGRNNDKIYCEP HIYDMVMATHL+NKHLRGKTLHSFLFS+
Sbjct: 121 NKLLFLQRQYYVDNEGNVRDGRNNDKIYCEPKHIYDMVMATHLMNKHLRGKTLHSFLFSH 180

Query: 180 FANISHAIIDWVQQFCSKCNKKGKIKPLKEYKRPDMYDKLLPMERIHIEVFEPFSGETIE 239
           FAN SHAIIDWVQQFCSKCNKKGKIKPLKEYKRPDMYDKLLPMERIHIEVFEPF+G  IE
Sbjct: 181 FANTSHAIIDWVQQFCSKCNKKGKIKPLKEYKRPDMYDKLLPMERIHIEVFEPFTGGAIE 240

Query: 240 GKYSYVLLCRDYRSSFMWLLPLKSTKFKHLIPVISSLFLSFARVPIFVTSSTLDKDDLYD 299
           GKY YVLLCRDYRSSFMWLLPLKSTKFKHLIPVISSLFLSFARVPIFVTSSTLDKDDLYD
Sbjct: 241 GKYPYVLLCRDYRSSFMWLLPLKSTKFKHLIPVISSLFLSFARVPIFVTSSTLDKDDLYD 300

Query: 300 ICEEIASKYGLRIGLGLKSSARFHTGGILCIHYALNSYKEECLADWGKCLRYGPYXXXXX 359
           ICEEIASKYGL IGLGLKSSARFHTGGILCI YALNSYKEECLADWGKCLRYGPY     
Sbjct: 301 ICEEIASKYGLCIGLGLKSSARFHTGGILCIQYALNSYKEECLADWGKCLRYGPYRFNRR 360

Query: 360 XXXXXXXXPAQVLLSEIPGHNAKFETKRERVIENTYSRNMFKTAGGKGLIYLEDVNTFAL 419
                   PAQVLLSE+PGHNAKFETKRERVIENTYSRNMFK AGGKGLIYLEDVNTFAL
Sbjct: 361 RNKRTKRKPAQVLLSEVPGHNAKFETKRERVIENTYSRNMFKMAGGKGLIYLEDVNTFAL 420

Query: 420 ANKADNSYNNGSSHXXXX-XXXXXXXXXQKQFDLTEQNYIDEYDDLAHESSEGEFGPSTL 478
           AN+A+N+ NN  +H              QKQFDLTEQNYIDEYDDLAH+SSEGEF P+TL
Sbjct: 421 ANEAENNGNNNRNHPDNNFGNDDFEEEVQKQFDLTEQNYIDEYDDLAHDSSEGEFEPNTL 480

Query: 479 TPEEKNTRIDEEERIGSASGVAQLNENTRQEIGELEKKHQ--KDADATPQTEPEVDQSLE 536
           TPEEK + I EE+RIGS S    L+ NT+QE+ E E+ +   ++ D T Q +P+VDQS+E
Sbjct: 481 TPEEKASHIVEEKRIGSTSETTDLDGNTKQEVDEPEEVNHNIEETDGTRQADPQVDQSVE 540

Query: 537 IAKPETSYFQTMESPSTKRQKLDQQNHGDVTRDFGMSMEL 576
           I +P+TSY+QT  SPS KRQKL+QQ HGDVTRDFG SMEL
Sbjct: 541 ITRPDTSYYQTAASPSIKRQKLNQQRHGDVTRDFGASMEL 580

>Suva_2.270 Chr2 (470408..472306) [1899 bp, 632 aa] {ON} YDR110W
           (REAL)
          Length = 632

 Score =  874 bits (2257), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 434/582 (74%), Positives = 469/582 (80%), Gaps = 6/582 (1%)

Query: 1   MTKPRYNGVLFDDD-DSLPSESATRKAPSQGRKATXXXXXXXXXXXXLLILPSMGESYTE 59
           M K RY G LFDD+ DSLPSESA  K+  Q RK T            LLILP MGESYTE
Sbjct: 51  MAKLRYKGTLFDDEGDSLPSESAKSKSSPQRRKTTSPRESRESLKDRLLILPLMGESYTE 110

Query: 60  YVDSYXXXXXXXXXXXXTPIFLESLTRQLTQKIYELIKTKSLTADTLQQISDKYDGVVAE 119
           YVDSY            TPIFLESLTRQLTQKIYELIKTKSLTA+TLQQISDKYDGV AE
Sbjct: 111 YVDSYLNLELLERGERETPIFLESLTRQLTQKIYELIKTKSLTAETLQQISDKYDGVAAE 170

Query: 120 NKLLFLQRQYYVDDEGNVRDGRNNDKIYCEPNHIYDMVMATHLINKHLRGKTLHSFLFSY 179
           NKLLFL+RQYYVD+EGNVRD RNNDKIYCEP HIYDMVMATHL+NKHLRGKTLHSFLFS+
Sbjct: 171 NKLLFLERQYYVDNEGNVRDRRNNDKIYCEPKHIYDMVMATHLMNKHLRGKTLHSFLFSH 230

Query: 180 FANISHAIIDWVQQFCSKCNKKGKIKPLKEYKRPDMYDKLLPMERIHIEVFEPFSGETIE 239
           FAN SHAIIDWVQQFCSKCNKKGKIKPLKEYKRPDMYDKLLPMERIHIEVFEP+ G+ IE
Sbjct: 231 FANTSHAIIDWVQQFCSKCNKKGKIKPLKEYKRPDMYDKLLPMERIHIEVFEPYGGKAIE 290

Query: 240 GKYSYVLLCRDYRSSFMWLLPLKSTKFKHLIPVISSLFLSFARVPIFVTSSTLDKDDLYD 299
           GKY YVLLCRDYRSSFMWLLPLKSTKFKHLIPV+SSLFLSFAR+PIFVTSSTLDKDDLYD
Sbjct: 291 GKYPYVLLCRDYRSSFMWLLPLKSTKFKHLIPVVSSLFLSFARIPIFVTSSTLDKDDLYD 350

Query: 300 ICEEIASKYGLRIGLGLKSSARFHTGGILCIHYALNSYKEECLADWGKCLRYGPYXXXXX 359
           ICEEIASKYGLRIGLGLKSSARFHTGGILCI YALNSYKEECLADWGKCLRYGPY     
Sbjct: 351 ICEEIASKYGLRIGLGLKSSARFHTGGILCIQYALNSYKEECLADWGKCLRYGPYRFNRR 410

Query: 360 XXXXXXXXPAQVLLSEIPGHNAKFETKRERVIENTYSRNMFKTAGGKGLIYLEDVNTFAL 419
                   P QVLLSE+PGHNAKFETKRERVIENTY+RNMF  AGGKGLIYLEDVNTFAL
Sbjct: 411 RNKRTKRKPTQVLLSEVPGHNAKFETKRERVIENTYARNMFTMAGGKGLIYLEDVNTFAL 470

Query: 420 ANKADNSYNNGSSHXXXXXXXXXXXXXQKQFDLTEQNYIDEYDDLAHESSEGEFGPSTLT 479
            N+ ++S NN + +             QKQFDLTEQNYIDEYDDLAH+SSEGE+ PSTLT
Sbjct: 471 VNEGESSNNNENLNNTNIGNDNFEEEVQKQFDLTEQNYIDEYDDLAHDSSEGEYEPSTLT 530

Query: 480 PEEKNTRIDEEERIGSASGVAQLNENTRQEIGELEKKHQKDADAT-----PQTEPEVDQS 534
           PEE  +   EEERI S S    L+ NT++E  E E+++    +A      PQTE   D+S
Sbjct: 531 PEENTSHNVEEERIESTSETTDLDGNTKEERDESEERNLNSVEAVNAVTAPQTEANGDRS 590

Query: 535 LEIAKPETSYFQTMESPSTKRQKLDQQNHGDVTRDFGMSMEL 576
           +EI  PETSY+QT E PSTKRQK+ +Q HGD+TRDFG+SMEL
Sbjct: 591 VEITSPETSYYQTEELPSTKRQKVGKQGHGDITRDFGLSMEL 632

>KAFR0B05540 Chr2 complement(1134547..1136106) [1560 bp, 519 aa]
           {ON} Anc_8.262 YDR110W
          Length = 519

 Score =  322 bits (826), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 154/364 (42%), Positives = 230/364 (63%), Gaps = 2/364 (0%)

Query: 49  ILPSMGESYTEYVDSYXXXXXXXXXXXXTPIFLESLTRQLTQKIYELIKTKSLTADTLQQ 108
           I+P MGESYT Y DS+               F +S+   LT++ Y+LI+T SLT +TL  
Sbjct: 48  IVPRMGESYTSYTDSFMNLELLKRGEREVFKFQQSINGHLTEETYDLIRTDSLTPETLAS 107

Query: 109 ISDKYDGVVAENKLLFLQRQYYVDDEGNVRDGRNNDKIYCEPNHIYDMVMATHLINKHLR 168
            + K+  + AE + LFL+R+YY D+ G + D    DKI CEP +++DM+M  HL+N H  
Sbjct: 108 TNPKWTKITAEPRYLFLKRRYYRDNNGLIHDHLRKDKIVCEPVYVFDMIMGCHLMNNHGF 167

Query: 169 GKTLHSFLFSYFANISHAIIDWVQQFCSKCNKKGKIKPLKEYKRPDMYDKLLPMERIHIE 228
            K +H  L ++++NI+  +     +FCS CN + KI  L+++K  ++Y++L+P+ER+HIE
Sbjct: 168 VKKIHHSLSTFYSNITRDLCLKALKFCSVCNPEQKIGKLEKFKHRNIYNELMPLERVHIE 227

Query: 229 VFEPFSGETIEGKYSYVLLCRDYRSSFMWLLPLKSTKFKHLIPVISSLFLSFARVPIFVT 288
           +FEPF  E IE KYS++L CRDY S ++W+LPLK+TKFKHL+P ++SLFLSF R PIF+ 
Sbjct: 228 IFEPFPNEKIEKKYSHILYCRDYHSRYIWMLPLKNTKFKHLVPTMASLFLSFIRQPIFIE 287

Query: 289 SSTLDKDDLYDICEEIASKYGLRIGLGLKSSARFHTGGILCIHYALNSYKEECLADWGKC 348
           +++LD  D++DICE+IA +Y L+IGLG      FH  GI  +   L +++EECL  W  C
Sbjct: 288 TASLDWQDMFDICEKIAFEYDLQIGLGTSKPNTFHAAGIRQMKAKLEAHREECLLSWNLC 347

Query: 349 LRYGPYXXXXXXXXXXXXXPAQVLLSEIPGHNAKFETKRERVIENTYSRNMFKTAGGKGL 408
           L+YG Y             P  +L S+I   + KF+ K  +++EN  S ++ +     GL
Sbjct: 348 LKYGSYDHNIRHNDRAGGVPGDLLSSQIQECSLKFKEKIIQILENAVSESVLRV--DNGL 405

Query: 409 IYLE 412
           I+LE
Sbjct: 406 IFLE 409

>TDEL0F03890 Chr6 (724664..726094) [1431 bp, 476 aa] {ON} Anc_8.262
           YDR110W
          Length = 476

 Score =  320 bits (821), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 155/369 (42%), Positives = 226/369 (61%), Gaps = 3/369 (0%)

Query: 48  LILPSMGESYTEYVDSYXXXXXXXXXXXXTPIFLESLTRQLTQKIYELIKTKSLTADTLQ 107
            + PSMGESY EY +SY               + ES+  Q+   IYELI+T SLT +TL 
Sbjct: 39  FLAPSMGESYKEYANSYMNMELLERGEQDLLKYQESINGQVLHPIYELIRTNSLTPETLA 98

Query: 108 QISDKYDGVVAENKLLFLQRQYYVDDEGNVRDGRNNDKIYCEPNHIYDMVMATHLINKHL 167
             SDK+D   AE+K +FL R+YY ++ G VRD R  DKI CEP  I+D++M  HL+N H+
Sbjct: 99  SNSDKWDKDSAESKYMFLMRRYYAEN-GIVRDRRKGDKIVCEPLCIFDLIMCAHLMNDHM 157

Query: 168 RGKTLHSFLFSYFANISHAIIDWVQQFCSKCNKKGKIKPLKEYKRPDMYDKLLPMERIHI 227
             + +++ L   ++NI+   +    ++CS CN  G  +PL++Y+  +++  LLP+ER+HI
Sbjct: 158 TYRPIYTCLNKIYSNITRDFVQMAVRYCSSCNPDGHFRPLEKYRHKNIFKGLLPLERVHI 217

Query: 228 EVFEPFSGETIEGKYSYVLLCRDYRSSFMWLLPLKSTKFKHLIPVISSLFLSFARVPIFV 287
           E+FE F  E+I  K++ VL CRDY + F+WL PLK+TKFKHL+  + +L L    VPIF+
Sbjct: 218 EIFEVFDNESISNKFTNVLYCRDYHTRFVWLAPLKNTKFKHLVSAVGTLLLGMTYVPIFM 277

Query: 288 TSSTLDKDDLYDICEEIASKYGLRIGLGLKSSARFHTGGILCIHYALNSYKEECLADWGK 347
            SSTLDK DL+DICE++  KY +++GLG  SS++FH  GI  +   LN+ K +C++DW  
Sbjct: 278 ESSTLDKQDLFDICEQLCGKYNMKLGLGANSSSQFHINGIKRMKKLLNTRKVDCISDWNM 337

Query: 348 CLRYGPYXXXXXXXXXXXXXPAQVLLSEIPGHNAKFETKRERVIENTYSRNMFKTAGGKG 407
           CLRYGPY             P  +L      +   F  K+E +I+   ++N+      KG
Sbjct: 338 CLRYGPYHLNRRHNTLAGGIPNDLLYHSDHTNRKHFRPKQEMIIDELPAQNVVHV--NKG 395

Query: 408 LIYLEDVNT 416
           L+YLED N+
Sbjct: 396 LLYLEDENS 404

 Score = 34.7 bits (78), Expect = 0.67,   Method: Compositional matrix adjust.
 Identities = 18/41 (43%), Positives = 26/41 (63%), Gaps = 1/41 (2%)

Query: 521 ADATPQTEPE-VDQSLEIAKPETSYFQTMESPSTKRQKLDQ 560
           A  TP+   E +  S EI++P TS++Q + SPS KR +L Q
Sbjct: 436 ATQTPERSVEAMHHSPEISEPNTSFYQELVSPSKKRSRLAQ 476

>NCAS0B03850 Chr2 complement(685424..687190) [1767 bp, 588 aa] {ON}
           Anc_8.262 YDR110W
          Length = 588

 Score =  308 bits (788), Expect = 1e-96,   Method: Compositional matrix adjust.
 Identities = 178/528 (33%), Positives = 276/528 (52%), Gaps = 46/528 (8%)

Query: 49  ILPSMGESYTEYVDSYXXXXXXXXXXXXTPIFLESLTRQLTQKIYELIKTKSLTADTLQQ 108
           ++P++GE Y +YVD                 F +++  QL +  YELIKT SLT +TL  
Sbjct: 83  LIPNIGEKYKDYVDEDMDLAFVQRGEREFFEFQKTINGQLNESTYELIKTNSLTQETLSA 142

Query: 109 ISDKYDGVVAENKLLFLQRQYYVDDEGNVRDGRNNDKIYCEPNHIYDMVMATHLINKHLR 168
            + K D   A ++L+FL R+Y +D++GNVRD    +++ CEP  IYDM+M  HLIN H R
Sbjct: 143 TALKMDKFRAASRLVFLNRRYGLDEQGNVRDKLRQNRMVCEPVFIYDMIMTWHLINDHGR 202

Query: 169 GKTLHSFLFSYFANISHAIIDWVQQFCSKCNKKGKIKPLKEYKRPDMYDKLLPMERIHIE 228
            +  H  L   ++NI+   ++ + QFCS CN   +  P K+YK  + +  LLP+ER+ +E
Sbjct: 203 PRKCHQLLGPMYSNITRFFVERICQFCSVCNPSKETIPFKKYKHINWFKGLLPLERVQVE 262

Query: 229 VFEPFSGETIEGKYSYVLLCRDYRSSFMWLLPLKSTKFKHLIPVISSLFLSFARVPIFVT 288
           VFEPF GE + GKY  +L  RDYRS F+W++PL+++KF HL+ +IS +  S  R+PIF  
Sbjct: 263 VFEPFPGEKLGGKYPQILYFRDYRSRFIWMVPLRNSKFGHLVDLISKMIFSMIRIPIFFE 322

Query: 289 SSTLDKDDLYDICEEIASKYGLRIGLGLKSSARFHTGGILCIHYALNSYKEECLADWGKC 348
           ++T++  D +DI E+I  KY + IGLG K   +  T G+  I   L  +KEECLADW  C
Sbjct: 323 TTTIENQDFFDIFEKIVEKYQINIGLGTKLGGKRLTNGLPQIRKLLGPHKEECLADWIMC 382

Query: 349 LRYGPYXXXXXXXXXXXXXPAQVLLSEIPGHNAKFETKRERVIENTYSRNMFKTAGGKGL 408
           L+YGP+             P  +L  +IP    K   K E+++++  + N+ K   G+G 
Sbjct: 383 LKYGPHTFNNKMNDRACGVPGDLLTGDIPDLYTKSYDKIEQILQDLPTENIVKI--GRGC 440

Query: 409 IYLEDVNTFALANKADNSYNNGSSHXXXXXXXXXXXXXQKQFDLTEQNYIDEYDDLAHES 468
           IYLED N                               + +++    +  D  D++ H  
Sbjct: 441 IYLEDRNP---------------------------EDPEAEYEANTDDESDTEDNVEHRQ 473

Query: 469 SEGEFGPSTLTPEEKNTRIDEEERIGSASGVAQLNENTRQE-IGELE----------KKH 517
            + E   + ++P   NTR ++E   G  S     + N  +E + ++E          K +
Sbjct: 474 EDEEDIGAMMSPMIDNTRTEDELENGEKSHEDDNHSNDNEEGVTKVEGSVPTTPKRRKLN 533

Query: 518 QKDADATPQTEPEVDQSLEIAKPETSYFQTMESPSTKRQKLDQQNHGD 565
            K+   T +TE     S EI +P TSY+QT +  +T +  +   + GD
Sbjct: 534 NKNVTNTQETE-----SPEITEPSTSYYQTYQE-TTSQPTMKHDDSGD 575

>SAKL0H17028g Chr8 complement(1495187..1496839) [1653 bp, 550 aa]
           {ON} similar to uniprot|O13329 Saccharomyces cerevisiae
           YDR110W FOB1 Nucleolar protein required for DNA
           replication fork blocking and recombinational hotspot
           activities binds to the replication fork barrier site in
           the rDNA region related to retroviral integrases
          Length = 550

 Score =  298 bits (764), Expect = 1e-93,   Method: Compositional matrix adjust.
 Identities = 174/495 (35%), Positives = 269/495 (54%), Gaps = 30/495 (6%)

Query: 80  FLESLTRQLTQKIYELIKTKSLTADTLQQISDKYDGVVAENKLLFLQRQYYVDDEGNVRD 139
           +LES+  QLTQ  YELIKT +LT +TL  ++D      AE K LFL+R+YYVD +  VRD
Sbjct: 57  YLESVKGQLTQAQYELIKTDTLTLETLLAVTDGLIPSNAEAKYLFLKRRYYVDSDQIVRD 116

Query: 140 GRNNDKIYCEPNHIYDMVMATHLINKHLRGKTLHSFLFSYFANISHAIIDWVQQFCSKCN 199
            + +D I CEP  +Y+++++ HL+N HL  + LH FL S ++NI+   +    ++CS+CN
Sbjct: 117 HKRDDTIVCEPELMYELIVSGHLLNNHLHWRKLHRFLKSQYSNITRDFVQMCARYCSECN 176

Query: 200 KKGKIKPLKEYKRPDMYDKLLPMERIHIEVFEPF-SGETIEGKYSYVLLCRDYRSSFMWL 258
            + ++KP  ++K  + Y  LLP+ERIH+E+F+PF + E IE KYS+VL CRDY S F+WL
Sbjct: 177 PQEEVKPFTKFKHTNAYQGLLPLERIHVEIFKPFGTDELIEEKYSHVLYCRDYHSRFVWL 236

Query: 259 LPLKSTKFKHLIPVISSLFLSFARVPIFVTSSTLDKDDLYDICEEIASKYGLRIGLGLKS 318
            PL    F+ L+P ++   LS  R+PIF+ ++TLD+ D++D+CE IA KY L IGLGL +
Sbjct: 237 SPLTGITFQELVPQLTEFLLSLPRLPIFLETTTLDRQDMFDMCEYIARKYQLAIGLGLNN 296

Query: 319 SARFHTGGILCIHYALNSYKEECLADWGKCLRYGPYXXXXXXXXXXXXXPAQVLLSEIPG 378
           S+ F+  GI  + Y L + K++C  DWG CL+YG Y                +L +E+  
Sbjct: 297 SSHFYKNGIERMKYLLQTNKKKCAKDWGMCLKYGSYHNNTAYNPRIMGFSNDLLCNEVSS 356

Query: 379 HNAKFETKRERVIENTYSRNMFKTAGGKGLIYLEDVNT-FALANKADNSYNNGSSHXXXX 437
              KF+ KRE++I   ++ N+       G++Y+E+ N+ F + ++   S N  S      
Sbjct: 357 CGKKFKLKREKIIHELFAHNVVTLKDTGGMVYVENENSVFIMEDEDLISVNQDSQESGTP 416

Query: 438 XXXXXXXXXQKQFDLTEQNYIDEYD----DLAHESSEGEFGPSTLTPEEKNT-------- 485
                    +++ D      +        D+ H++++        TP+ K T        
Sbjct: 417 MATSGGQGVEQEMDEMPSMGLTPLKGSNGDMLHKTADS-------TPKVKRTSSLSRASS 469

Query: 486 -----RIDEEERIGSASGVAQLNENTRQEIGELEKKHQKDADATPQTEPEVDQSLEIAKP 540
                R    + I     V ++ EN R  +   E   Q +++A      E D S EI  P
Sbjct: 470 KRTGERASLSDTITPTKKVKKVGEN-RSRLSGSESVEQGNSEA---NRDEYDLSEEIPGP 525

Query: 541 ETSYFQTMESPSTKR 555
            TS+F T+    T R
Sbjct: 526 STSFFATVNHSRTAR 540

>ZYRO0C01650g Chr3 complement(117323..119083) [1761 bp, 586 aa] {ON}
           some similarities with uniprot|O13329 Saccharomyces
           cerevisiae YDR110W FOB1 Nucleolar protein required for
           DNA replication fork blocking and recombinational
           hotspot activities binds to the replication fork barrier
           site in the rDNA region related to retroviral integrases
          Length = 586

 Score =  282 bits (721), Expect = 7e-87,   Method: Compositional matrix adjust.
 Identities = 139/367 (37%), Positives = 221/367 (60%), Gaps = 4/367 (1%)

Query: 48  LILPSMGESYTEYVDSYXXXXXXXXXXXXTPIFLESLTRQLTQKIYELIKTKSLTADTLQ 107
            I+P M + +   +               +  F  ++  QLTQ+IYELI++ +L+   L+
Sbjct: 38  FIVPPMNQKFVSCLQLGMNLNLLEQGAEESLQFQGTVAGQLTQQIYELIRSDTLSIANLE 97

Query: 108 QISDKYDGVVAENKLLFLQRQYYVDDE-GNVRDGRNNDKIYCEPNHIYDMVMATHLINKH 166
           +   K+ G  +E +  +L+ +Y+V +E G V D + +D+I CEP  ++ +VM +HL N H
Sbjct: 98  RCH-KWKGESSEIEYYYLRSRYFVSEENGMVCDRKRDDRIVCEPASMFHLVMCSHLQNNH 156

Query: 167 LRGKTLHSFLFSYFANISHAIIDWVQQFCSKCNKKGKIKPLKEYKRPDMYDKLLPMERIH 226
           +    +H  L   +ANI+   I     +CSKCN   K KP ++ +  ++Y +LLP+ER+H
Sbjct: 157 VTSYNIHRNLVKTYANITRDYIVTAISYCSKCNPDLKAKPFQKKRHKNVYWELLPLERVH 216

Query: 227 IEVFEPFSGETIEGKYSYVLLCRDYRSSFMWLLPLKSTKFKHLIPVISSLFLSFARVPIF 286
           IEVFEPF GE I+G++S++L  RDY S ++W+LPL++ K KH+I  +SS  L   R+PIF
Sbjct: 217 IEVFEPFDGEKIQGRFSHLLYFRDYFSRYVWILPLQNDKRKHMIRAMSSFLLGLPRIPIF 276

Query: 287 VTSSTLDKDDLYDICEEIASKYGLRIGLGLKSSARFHTGGILCIHYALNSYKEECLADWG 346
           + S+T+D++ L+D+C +IA  Y L++GLG+K+S RFH  GI  +   L S+KEECL DW 
Sbjct: 277 LESTTIDREHLFDLCGQIAEHYSLKLGLGVKNSQRFHNNGIKDMKELLGSHKEECLQDWN 336

Query: 347 KCLRYGPYXXXXXXXXXXXXXPAQVLLSEIPGHNAKFETKRERVIENTYSRNMFKTAGGK 406
            CL+YGP+             P  +L + +P  N KF  KR  VI +T S+ +     G+
Sbjct: 337 LCLKYGPFHINQNINVSSDGRPGDLLFTSVPDCNRKFVKKRNDVILDTPSQQVVHL--GE 394

Query: 407 GLIYLED 413
           G+++LE+
Sbjct: 395 GVLFLEN 401

>NDAI0J01380 Chr10 complement(317185..319059) [1875 bp, 624 aa] {ON}
           Anc_8.262 YDR110W
          Length = 624

 Score =  278 bits (710), Expect = 8e-85,   Method: Compositional matrix adjust.
 Identities = 139/365 (38%), Positives = 211/365 (57%), Gaps = 5/365 (1%)

Query: 49  ILPSMGESYTEYVDSYXXXXXXXXXXXXTPIFLESLTRQLTQKIYELIKTKSLTADTLQQ 108
           ++P++GESY +YVD                 F  S+  QL + +YELI+TKSLT +TL  
Sbjct: 92  LIPNVGESYMDYVDPEVDVDLLKRGEVTFLNFQRSIHGQLDEVVYELIRTKSLTEETL-- 149

Query: 109 ISDKYDGVVAENKLLFLQRQYYVDDEGNVRDGRNNDKIYCEPNHIYDMVMATHLINKHLR 168
            +  +    A  +    +R+Y  D+EG VRD    ++I C+P  +Y+M+M  HL+N H +
Sbjct: 150 -AANFPHFHAPTRCALFKRRYVADNEGRVRDQLRGNRIVCDPVLLYEMMMTCHLMNDHAQ 208

Query: 169 GKTLHSFLFSYFANISHAIIDWVQQFCSKCNKKGKIKPLKEYKRPDMYDKLLPMERIHIE 228
            +  H  L S +ANI+   +    QFCS CN    + PL ++K  + Y  +LP+ER+HIE
Sbjct: 209 YRRCHVALSSIYANITRDFLYKAVQFCSVCNPSKLVGPLLKFKHVNYYKGMLPLERVHIE 268

Query: 229 VFEPFSGETIEGKYSYVLLCRDYRSSFMWLLPLKSTKFKHLIPVISSLFLSFARVPIFVT 288
           +FEPF+G+ IEGKYS+V+ CRDYRS ++ L PLK+TKFK+L+  I+ L  +  R+PIF+ 
Sbjct: 269 IFEPFNGKKIEGKYSHVIYCRDYRSRYIMLEPLKNTKFKNLVSAIAKLLFNLPRIPIFIE 328

Query: 289 SSTLDKDDLYDICEEIASKYGLRIGLGLKSSARFHTGGILCIHYALNSYKEECLADWGKC 348
           + +L+  D +DI E I  KY + +GLG+K++ RFHT G+  +   L  +++ECL DW  C
Sbjct: 329 TVSLNTQDAFDIFEAIVEKYQINVGLGMKTAKRFHTRGVKQMKILLEGHRKECLNDWTMC 388

Query: 349 LRYGPYXXXXXXXXXXXXXPAQVLLSEIPGHNAKFETKRERVIENTYSRNMFKTAGGKGL 408
           L+YGP+             P  +L   +     K   K E++I      N+ +   G G 
Sbjct: 389 LKYGPHNYNTKHNDRACGVPVDLLTCNVKDVTHKSIEKYEQIIRTLPKDNIVQI--GNGS 446

Query: 409 IYLED 413
           IYLE+
Sbjct: 447 IYLEE 451

>Ecym_4308 Chr4 complement(654030..655619) [1590 bp, 529 aa] {ON}
           similar to Ashbya gossypii AGR086C
          Length = 529

 Score =  271 bits (692), Expect = 3e-83,   Method: Compositional matrix adjust.
 Identities = 130/340 (38%), Positives = 200/340 (58%), Gaps = 4/340 (1%)

Query: 80  FLESLTRQLTQKIYELIKTKSLTADTLQQISDKYDGVVAENKLLFLQRQYYVDDEGNVRD 139
            + ++  QLTQ IYELI + +L+  TL +  DK      ENK + L+R+Y +  +GNV D
Sbjct: 66  LINTVKGQLTQDIYELISSNTLSTQTLLECCDKVTAGTVENKFVLLKRRYSIL-QGNVVD 124

Query: 140 GRNNDKIYCEPNHIYDMVMATHLINKHLRGKTLHSFLFSYFANISHAIIDWVQQFCSKCN 199
            +  D    EP+ ++D++MA HLIN HL  + +H  L + +AN++    + V  +CS CN
Sbjct: 125 HKREDLPVIEPDLVFDVIMAAHLINGHLPWRKIHQHLKNLYANVTRDFTNLVTLYCSHCN 184

Query: 200 KKGKIKPLKEYKRPDMYDKLLPMERIHIEVFEPF---SGETIEGKYSYVLLCRDYRSSFM 256
               +K    YK  ++YDK++P+ER H+E+F PF     E IE KYS+VL CRDY S F+
Sbjct: 185 TDRNMKRFLRYKHYNVYDKVMPLERCHVEIFAPFDDDGNEKIEDKYSHVLYCRDYHSRFV 244

Query: 257 WLLPLKSTKFKHLIPVISSLFLSFARVPIFVTSSTLDKDDLYDICEEIASKYGLRIGLGL 316
           W+LPL+   F+ L+P ++ L  S  R+PIF+ ++TLD+ D++D+CE IA KY L+IGLGL
Sbjct: 245 WMLPLEGITFRDLVPALTQLLCSMIRLPIFLETATLDRQDMFDVCEYIARKYKLKIGLGL 304

Query: 317 KSSARFHTGGILCIHYALNSYKEECLADWGKCLRYGPYXXXXXXXXXXXXXPAQVLLSEI 376
            S   F   G+  I      +KE+C+ +W  CLR                 P+ +L +EI
Sbjct: 305 NSGTDFQRNGVTRIKNLFAEHKEQCIKEWNMCLRLVLTRVNQNYSDRVRGIPSDLLCNEI 364

Query: 377 PGHNAKFETKRERVIENTYSRNMFKTAGGKGLIYLEDVNT 416
                KF+ K+ ++I+  Y+ ++ +     G+IYLED N+
Sbjct: 365 SNIAHKFKLKQRKIIDELYAHHVVQFREAGGMIYLEDDNS 404

>KLTH0G13684g Chr7 complement(1171645..1173171) [1527 bp, 508 aa]
           {ON} weakly similar to uniprot|O13329 Saccharomyces
           cerevisiae YDR110W FOB1 Nucleolar protein required for
           DNA replication fork blocking and recombinational
           hotspot activities binds to the replication fork barrier
           site in the rDNA region related to retroviral integrases
          Length = 508

 Score =  268 bits (686), Expect = 1e-82,   Method: Compositional matrix adjust.
 Identities = 132/337 (39%), Positives = 204/337 (60%), Gaps = 4/337 (1%)

Query: 80  FLESLTRQLTQKIYELIKTKSLTADTLQQISDKYDGVVAENKLLFLQRQYYVDDEGNVRD 139
           + ES+  QLTQ  ++L+++ SLT D L   SDK      E K L L+R+YYVD +G VRD
Sbjct: 50  YQESVKGQLTQDQFDLVRSCSLTEDNLMTTSDKLHAGNVETKFLLLKRRYYVDADGIVRD 109

Query: 140 GRNNDKIYCEPNHIYDMVMATHLINKHLRGKTLHSFLFSYFANISHAIIDWVQQFCSKCN 199
            + +D + CEP  ++D++M  HL N HL  + LHS+L   +AN + A      ++CS+CN
Sbjct: 110 YKCSDTVVCEPELMFDLIMCGHLKNGHLHWRRLHSYLRHNYANTTRAFAQICVKYCSQCN 169

Query: 200 KKGKIKPLKEYKRPDMYDKLLPMERIHIEVFEPFSGETIEGKYSYVLLCRDYRSSFMWLL 259
            + +++P K+++  ++Y  LLP+ER+H+E+  PFS E IEG YS+VL  RDY S F+W+ 
Sbjct: 170 PEEELRPYKKFRHTNIYSGLLPLERVHVEIISPFS-EAIEGTYSHVLFFRDYYSRFVWMQ 228

Query: 260 PLKSTKFKHLIPVISSLFLSFARVPIFVTSSTLDKDDLYDICEEIASKYGLRIGLGLKSS 319
           PLK    + +   + +  L   R+PIF+ +ST+D+ DL++ CE++A +Y L IGLG+  S
Sbjct: 229 PLKGDDVRDITKGLLATLLLLPRIPIFIETSTIDRQDLFEACEDVAGQYSLYIGLGMSQS 288

Query: 320 ARFHTGGILCIHYALNSYKEECLADWGKCLRYGPYXXXXXXXXXXXXXPAQVLLSEIPGH 379
           + F   G+  + Y L   +E+CL  W  CL+YG               P  +L S +  +
Sbjct: 289 STFQKNGVERLRYLLQRNEEQCLRSWYMCLKYGATNHNLNYNARILGVPGNLLHSTVCDY 348

Query: 380 NAKFETKRERVIENTYSRNM--FKTAG-GKGLIYLED 413
             +FE KRE +IE  ++RN+   K +G  +G+IYLED
Sbjct: 349 GRQFELKREDLIEKLFARNVVEIKVSGRRRGIIYLED 385

>Kwal_56.23799 s56 complement(708590..710056) [1467 bp, 488 aa] {ON}
           YDR110W (FOB1) - DNA replication fork blocking protein
           [contig 173] FULL
          Length = 488

 Score =  267 bits (683), Expect = 2e-82,   Method: Compositional matrix adjust.
 Identities = 127/335 (37%), Positives = 198/335 (59%), Gaps = 4/335 (1%)

Query: 82  ESLTRQLTQKIYELIKTKSLTADTLQQISDKYDGVVAENKLLFLQRQYYVDDEGNVRDGR 141
           ES+  QLTQ+ ++L+++ +LTA+ L   SDK      E K L L+R++YVD +G VRD +
Sbjct: 52  ESVKGQLTQEQFDLVRSSALTAENLMSTSDKLHSGNIETKFLLLKRRFYVDADGTVRDFK 111

Query: 142 NNDKIYCEPNHIYDMVMATHLINKHLRGKTLHSFLFSYFANISHAIIDWVQQFCSKCNKK 201
            +D + CEP  ++D++M  HL N H+  + LH +L   +AN + A      ++CS+CN +
Sbjct: 112 CDDTVVCEPESLFDLIMCGHLKNGHIHWRRLHHYLRRKYANTTRAFAQICVRYCSECNPE 171

Query: 202 GKIKPLKEYKRPDMYDKLLPMERIHIEVFEPFSGETIEGKYSYVLLCRDYRSSFMWLLPL 261
             ++P ++++  ++Y  LLP+ER+H+E+  PF  + IEG YS+VL  RDY S F+W+ PL
Sbjct: 172 EVLRPYRKFRHTNIYSGLLPLERVHVEIIAPFP-KLIEGLYSHVLYLRDYYSRFVWMQPL 230

Query: 262 KSTKFKHLIPVISSLFLSFARVPIFVTSSTLDKDDLYDICEEIASKYGLRIGLGLKSSAR 321
            S +   +     +  LS  RVPIFV +STL + DL+++CE IAS+YGL IGLG+  S  
Sbjct: 231 ASERVSEITKAFLTFLLSLPRVPIFVETSTLKRQDLFEVCENIASQYGLSIGLGMSRSTT 290

Query: 322 FHTGGILCIHYALNSYKEECLADWGKCLRYGPYXXXXXXXXXXXXXPAQVLLSEIPGHNA 381
           F   G+  + Y L   +E CL  W  CL++G               P  +L S +  +  
Sbjct: 291 FQRNGVERLRYLLQQNEEPCLKSWHMCLKFGVTNHNMTYNARVLGLPGNLLHSTVSDYGR 350

Query: 382 KFETKRERVIENTYSRNMFKT---AGGKGLIYLED 413
           +FE KRE +IE  ++ N+ +       +G+IYLED
Sbjct: 351 QFELKREELIEKLFASNVVELRNEGRRRGMIYLED 385

>Kpol_392.6 s392 complement(8453..9826) [1374 bp, 457 aa] {ON}
           complement(8453..9826) [1374 nt, 458 aa]
          Length = 457

 Score =  261 bits (668), Expect = 2e-80,   Method: Compositional matrix adjust.
 Identities = 139/337 (41%), Positives = 203/337 (60%), Gaps = 4/337 (1%)

Query: 80  FLESLTRQLTQKIYELIKTKSLTADTLQQISDKYDGVVAENKLLFLQRQYYVDDEGN-VR 138
           F  ++   L+Q+IY+LI T  LT   + +   K+     E K  FL+ +YYV D+G  VR
Sbjct: 92  FQSTINGYLSQRIYDLILTDKLTPKKVSREKVKWANKSNE-KYYFLKNRYYVSDKGTTVR 150

Query: 139 DGRNNDKIYCEPNHIYDMVMATHLINKHLRGKTLHSFLFSYFANISHAIIDWVQQFCSKC 198
           D RN+DKI C PN + ++V+ THLIN+H   K++H  L   +ANIS  I      +CS C
Sbjct: 151 DRRNDDKILCPPNKVLEVVLCTHLINEHAAHKSVHRNLHKRYANISRTITRISLLYCSFC 210

Query: 199 NKKGKIKPLKEYKRPDMYDKLLPMERIHIEVFEPFSGE-TIEGKYSYVLLCRDYRSSFMW 257
           N    +KPLK+ K+ ++Y+ LLP ERIHIE+F+PF  E  IEG YS++L  RDY S ++W
Sbjct: 211 NPSEHVKPLKKSKKNEVYEGLLPFERIHIEIFKPFGDEKLIEGTYSHILYIRDYYSRYVW 270

Query: 258 LLPLKSTKFKHLIPVISSLFLSFARVPIFVTSSTLDKDDLYDICEEIASKYGLRIGLGLK 317
           L PLK T FK L   + + F +  + PI++ SST++++DL  + ++IA KY LRIG+G+ 
Sbjct: 271 LYPLKKTAFKELTQTLVTYFFTITKTPIYIESSTINRNDLIAMVQKIALKYDLRIGIGIG 330

Query: 318 SSARFHTGGILCIHYALNSYKEECLADWGKCLRYGPYXXXXXXXXXXXXXPAQVLL-SEI 376
           +S+ FH  G+  +   L  +++ECL DWG CL+YG               P  +LL S I
Sbjct: 331 NSSYFHYNGLETMKQLLLLHEDECLGDWGMCLKYGKNLHNNLKNRKVLGMPINLLLNSGI 390

Query: 377 PGHNAKFETKRERVIENTYSRNMFKTAGGKGLIYLED 413
              + K+++K+  VI+ T+  NM     GK  IYLED
Sbjct: 391 SECSIKYKSKKNTVIDETFPHNMIVLDNGKSEIYLED 427

>AGR086C Chr7 complement(888758..890362) [1605 bp, 534 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR110W
           (FOB1)
          Length = 534

 Score =  255 bits (652), Expect = 3e-77,   Method: Compositional matrix adjust.
 Identities = 132/351 (37%), Positives = 209/351 (59%), Gaps = 8/351 (2%)

Query: 80  FLESLTRQLTQKIYELIKTKSLTADTLQQISDKYDGVVAENKLLFLQRQYYVDDEGNVRD 139
            ++++  QLTQ+IY+LI + +L+   L +  DK      ENK + L+R+Y V   G V D
Sbjct: 60  IMKTVKGQLTQEIYDLIASDTLSTQKLLECCDKVTPNTVENKYVLLKRRY-VAKGGIVID 118

Query: 140 GRNNDKIYCEPNHIYDMVMATHLINKHLRGKTLHSFLFSYFANISHAIIDWVQQFCSKCN 199
            +  D    EP+ ++DM+M+ HLIN H+  + ++  +   +AN++  + + V  +CS CN
Sbjct: 119 RKRKDAPVIEPDSLFDMIMSAHLINDHMPWRKVYQHMKGLYANVTRELTNMVTGYCSHCN 178

Query: 200 KKGKIKPLKEYKRPDMYDKLLPMERIHIEVFEPFSGETIE---GKYSYVLLCRDYRSSFM 256
               ++    YK  ++++KL+P+ER H+EVF PF  E +E   GKYS+ L CRDY S F+
Sbjct: 179 MDRSVRRFSRYKHYNVHEKLMPLERCHVEVFAPFDDEGVEKIQGKYSHFLYCRDYHSRFI 238

Query: 257 WLLPLKSTKFKHLIPVISSLFLSFARVPIFVTSSTLDKDDLYDICEEIASKYGLRIGLGL 316
           WLLPL+   F++L+P ++ L  +  RVPIF+ ++TLD+ D++DICE IA +Y  +IGLGL
Sbjct: 239 WLLPLEGIAFRYLLPALAQLLCTMIRVPIFLETATLDRQDMFDICEVIARRYKFKIGLGL 298

Query: 317 KSSARFHTGGILCIHYALNSYKEECLADWGKCLRYGPYXXXXXXXXXXXXXPAQVLLSEI 376
            S   F   GI  +   L+ YKEEC  DW  CLR                 P+ +L +EI
Sbjct: 299 NSGTEFQKNGIKRVKQLLSEYKEECQDDWNMCLRLVLSRVNQTYADRVRGIPSDLLCNEI 358

Query: 377 PGHNAKFETKRERVIENTYSRNM--FKTAGGKGLIYLEDVNTFALANKADN 425
           P  + KF+ K++++I+  Y+ ++  FK AG  G+IYLED  +  + +  D+
Sbjct: 359 PNISMKFKQKQKKIIDQLYAHHVVHFKEAG--GMIYLEDEESAFVMDDPDD 407

>Kpol_543.38 s543 (84712..86040) [1329 bp, 442 aa] {ON}
           (84712..86040) [1329 nt, 443 aa]
          Length = 442

 Score =  252 bits (644), Expect = 4e-77,   Method: Compositional matrix adjust.
 Identities = 129/378 (34%), Positives = 213/378 (56%), Gaps = 1/378 (0%)

Query: 51  PSMGESYTEYVDSYXXXXXXXXXXXXTPIFLESLTRQLTQKIYELIKTKSLTADTLQQIS 110
           P +G +  EY+DS                +L+S+   L+Q +YELI+   L  DTL +  
Sbjct: 46  PKVGATLYEYIDSSYSVPFLEFGRGAAKEYLDSIIGTLSQTVYELIRDDLLDVDTLSE-K 104

Query: 111 DKYDGVVAENKLLFLQRQYYVDDEGNVRDGRNNDKIYCEPNHIYDMVMATHLINKHLRGK 170
            ++  + A  K L+L+R+Y +  +G V D    +KI  EP+  YD +++TH++N+HL  +
Sbjct: 105 TRWSRINANAKCLYLKRRYKLTKKGTVIDLTRENKIVYEPDLRYDYIISTHILNRHLGYQ 164

Query: 171 TLHSFLFSYFANISHAIIDWVQQFCSKCNKKGKIKPLKEYKRPDMYDKLLPMERIHIEVF 230
            +H  L + ++N+S   I  V  FCS CN    I  L++    ++Y+K LP+ER+ +++F
Sbjct: 165 GIHKRLKAIYSNLSRDYIKMVLDFCSHCNPDKVIPNLEKTVHMNIYEKYLPLERVQLDIF 224

Query: 231 EPFSGETIEGKYSYVLLCRDYRSSFMWLLPLKSTKFKHLIPVISSLFLSFARVPIFVTSS 290
           EPF  E I+ +YS+++  RDYRS F+W+ PLK+TKFK L   I  L L   R+PI++ ++
Sbjct: 225 EPFENEKIQNRYSHIIYIRDYRSRFVWIYPLKNTKFKTLASEIGMLLLDLPRIPIYIDTT 284

Query: 291 TLDKDDLYDICEEIASKYGLRIGLGLKSSARFHTGGILCIHYALNSYKEECLADWGKCLR 350
           T+++ D+  IC+ IA KY + +G+G    + F++ G+  +   LN  K++CL DW  CL+
Sbjct: 285 TIERRDMLAICKRIAEKYEISLGIGTIEPSSFYSIGLSRLKCLLNENKDKCLKDWNMCLK 344

Query: 351 YGPYXXXXXXXXXXXXXPAQVLLSEIPGHNAKFETKRERVIENTYSRNMFKTAGGKGLIY 410
            G Y             P+++ L E+      FE+KR  +I +   +N +KT+  KGL+Y
Sbjct: 345 LGSYYYNKKSITTARGVPSELFLDEMECSATTFESKRTEIINSLPIQNSYKTSTNKGLVY 404

Query: 411 LEDVNTFALANKADNSYN 428
            +D       NK+ N  N
Sbjct: 405 AQDEILTTSKNKSSNMEN 422

>KLLA0F19140g Chr6 (1773327..1774910) [1584 bp, 527 aa] {ON} some
           similarities with uniprot|O13329 Saccharomyces
           cerevisiae YDR110W FOB1 Nucleolar protein required for
           DNA replication fork blocking and recombinational
           hotspot activities binds to the replication fork barrier
           site in the rDNA region related to retroviral integrases
          Length = 527

 Score =  253 bits (646), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 126/356 (35%), Positives = 198/356 (55%), Gaps = 11/356 (3%)

Query: 81  LESLTRQLTQKIYELIKTKSLTADTLQQISDKYDGVVAENKLLFLQRQYYVDDEGNVRDG 140
           + ++  QLTQ IY+L+ + +LT + L + SDK      ENK + L+R+YYV  E  + D 
Sbjct: 89  INTVKGQLTQPIYDLLHSDALTKENLLRASDKVTNSTVENKFVLLKRRYYVQ-ENLLHDV 147

Query: 141 RNNDKIYCEPNHIYDMVMATHLINKHLRGKTLHSFLFSYFANISHAIIDWVQQFCSKCNK 200
           +  D +  EPN ++D++M+ H++N H+  K +++ L +++AN++ +    V  FCSKCN+
Sbjct: 148 KRKDLVVYEPNELFDLIMSVHVLNSHVSSKGIYNELSTFYANVTQSFCKLVTSFCSKCNE 207

Query: 201 KGKIKPLKEYKRPDMYDKLLPMERIHIEVFEPFSGE----------TIEGKYSYVLLCRD 250
            G     K++K  +++  L+P+ R H+E+F PF              IEGKY +VL CRD
Sbjct: 208 SGNKISYKKFKHENIHANLIPLGRCHVEIFAPFDSAYQGNDNTDELKIEGKYPFVLYCRD 267

Query: 251 YRSSFMWLLPLKSTKFKHLIPVISSLFLSFARVPIFVTSSTLDKDDLYDICEEIASKYGL 310
           Y S ++WL PLKS     L+PV++ L  S  R+PIF+ + TLD+ D++D+CE IA  Y +
Sbjct: 268 YYSRYVWLEPLKSVTLSDLLPVMTKLLFSMIRMPIFIDTCTLDRQDMFDVCENIARIYKI 327

Query: 311 RIGLGLKSSARFHTGGILCIHYALNSYKEECLADWGKCLRYGPYXXXXXXXXXXXXXPAQ 370
           +IGLG+ SS  F   GI  +      +KEECL DW  CL+                 P+ 
Sbjct: 328 KIGLGMNSSTSFQKTGIKRMKSLFLQHKEECLHDWNMCLKLVVSRLNQNYSDRVRGVPSD 387

Query: 371 VLLSEIPGHNAKFETKRERVIENTYSRNMFKTAGGKGLIYLEDVNTFALANKADNS 426
           +L S     + KF T +  VI      ++ +     G+IYLED N+  L    D++
Sbjct: 388 LLCSTQQDLHKKFRTLQRNVISRLLGHHVVQFEEAGGMIYLEDENSPNLLLSGDDN 443

>KNAG0H03240 Chr8 complement(603920..605479) [1560 bp, 519 aa] {ON}
           Anc_8.262 YDR110W
          Length = 519

 Score =  238 bits (606), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 129/381 (33%), Positives = 211/381 (55%), Gaps = 11/381 (2%)

Query: 49  ILPSMGESYTEYVDSYXXXXXXXXXXXXTPIFLESLTRQLTQKIYELIKTKSLTADTLQQ 108
           ++P +G+ ++ Y D                 +  +   +++Q++Y L K   +T + + +
Sbjct: 35  LVPVIGDKWSNYADEKLDIEFCKRGERDITAYAPTQPGRMSQELYALFKNDDVTKENIAR 94

Query: 109 ISDKYDGVVAENKLLFLQRQYYVDDEGNVRDGRNNDKIYCEPNHIYDMVMATHLINKHLR 168
           +           K++++ R+YY D  G +RD   N++I  +P H +D++M+ HL+NKHL 
Sbjct: 95  LYPTDRSGDESRKMMYITRRYYKDANGMIRDATMNNRIVYDPIHTFDIIMSCHLMNKHLG 154

Query: 169 GKTLHSFLFSYFANISHAIIDWVQQFCSKCNKKGKIKPLKEYKRPDMYDKLLPMERIHIE 228
            + ++  L  ++AN    +I    ++CS CN   K+ P K   +P +++K LP+ERI IE
Sbjct: 155 SERVYRCLREFYANGGPLLIKRTLEYCSVCNPSLKLTP-KVQPKPYLFEKALPLERITIE 213

Query: 229 VFEPFSGETIEGKYSYVLLCRDYRSSFMWLLPLKSTKFKHLIPVISSLFLSFARVPIFVT 288
           + EPF  E +EGKYS +++ +D+   F WL PLK+TKFK+++PV++ + LSF RVPI+V 
Sbjct: 214 IIEPFPNEKVEGKYSNMVVMKDFIGRFEWLEPLKNTKFKNIVPVVAKMILSFPRVPIWVE 273

Query: 289 SSTLDKDDLYDICEEIASKYGLRIGLGL--KSSARFHTGGILCIHYALNSYKEECLADWG 346
           S+TLD  DL+DI E I +KYG++IGLG   +SSA   T     I+  LN + +ECL D+ 
Sbjct: 274 SNTLDWSDLFDIFEMIVTKYGIKIGLGCTTRSSAAQATAR---INRDLNDHHDECLFDFN 330

Query: 347 KCLRYGPYXXXXXXXXXXXXXPAQVLLSEIPGHNAKFETKRERVIENTYSRNMFKTAGGK 406
            CL+YGP              P  ++        AKF  KR  +++++ S  +     G 
Sbjct: 331 NCLKYGPTKYNQIKYLGFHKSPCDIISHSETQLKAKFRAKRAFILKHSPSSCVMNR--GM 388

Query: 407 GLIYLEDVNTF---ALANKAD 424
           G +YLE  N     A A+ AD
Sbjct: 389 GTLYLESPNGIQEDAAASSAD 409

>CAGL0B01771g Chr2 (163063..164673) [1611 bp, 536 aa] {ON} weakly
           similar to uniprot|O13329 Saccharomyces cerevisiae
           YDR110w FOB1 DNA replication fork blocking protein
          Length = 536

 Score =  236 bits (601), Expect = 8e-70,   Method: Compositional matrix adjust.
 Identities = 128/389 (32%), Positives = 209/389 (53%), Gaps = 20/389 (5%)

Query: 48  LILPSMGESYTEYV---DSYXXXXXXXXXXXXTPIFLESLTRQLTQKIYELIKTKSLTAD 104
            ++P++ E+Y +Y+   DS                F E L  +LTQ+ Y L+   +LT +
Sbjct: 60  FVMPALDETYEDYLVGEDSTIDVDFLKRGEKDMRRFAEGLAGKLTQETYTLLMNNNLTME 119

Query: 105 TLQQISDKYDGVVAENKLLFLQRQYYVDDEGNVRDGRNNDKIYCEPNHIYDMVMATHLIN 164
           T+ +  + +    AE K   L +++Y D EGN+RD + ++ I  EP+ ++++++  HL N
Sbjct: 120 TVMKAMNIWPPNAAETKYSNLIKRFYKDKEGNIRDAKVDNNIVLEPDKLFNLILTAHLKN 179

Query: 165 KHLRGKTLHSFLFSYFANISHAIIDWVQQFCSKCNKKGKIKPLKEYKRPDMYDKLLPMER 224
            HL+   L   L   +AN +   +     +C++CN    IKP+++ +  ++ ++LLP+ER
Sbjct: 180 GHLKTAVLFQCLREVYANCTRDFVQTALFYCNRCNPDRYIKPIEKVRHRNINEELLPLER 239

Query: 225 IHIEVFEPFSGE--------------TIEGKYSYVLLCRDYRSSFMWLLPLKSTKFKHLI 270
           +HIEVF PF  E               IEGKYS+V  CRD+R+ ++W  PLK+ KFK L+
Sbjct: 240 VHIEVFAPFEKEEGDIKQEDSQNPYIKIEGKYSHVFYCRDFRTRYVWCFPLKNMKFKTLV 299

Query: 271 PVISSLFLS-FARVPIFVTSSTLDKDDLYDICEEIASKYGLRIGLGLKSSARFHTGGILC 329
             I++ F++     PIFV SST+D+DDL +I E +ASKYGL++GLG  +  +FH  GI  
Sbjct: 300 DNIATFFMTVLYDPPIFVESSTIDRDDLKEIFELLASKYGLKLGLGFANFTKFHAQGIKR 359

Query: 330 IHYALNSYKEECLADWGKCLRYGPYXXXXXXXXXXXXXPAQVLLSEIPGHNAK-FETKRE 388
               L+  K EC  DW  CL+ G Y              + +L +E+ G   +    K+ 
Sbjct: 360 FKTHLHRAKSECADDWLMCLKQGTYSANRVIERQLGKA-SNILFTELMGQFERDMRKKKL 418

Query: 389 RVIENTYSRNMFKTAGGKGLIYLEDVNTF 417
           + IE ++S N+       G I++E V  +
Sbjct: 419 KYIEQSFSENIKTYPKSGGCIFIEHVQDY 447

>TBLA0E04430 Chr5 (1136737..1138182) [1446 bp, 481 aa] {ON}
           Anc_8.262 YDR110W
          Length = 481

 Score =  189 bits (479), Expect = 7e-53,   Method: Compositional matrix adjust.
 Identities = 111/338 (32%), Positives = 179/338 (52%), Gaps = 14/338 (4%)

Query: 88  LTQKIYELIKTKSLTADTLQQISDKY-DGVVAENKLLFLQRQYYVDDEGNVRDGRNNDKI 146
           LTQ+  +++ T +L+ + + +   K  +   A  K  F  R+YY++++ N+ D R   +I
Sbjct: 73  LTQEYCDMLNTGTLSPENIIKYDTKLTNHSKALEKYNFTSRRYYLNEDNNIIDKRKPGRI 132

Query: 147 YCEPNHIYDMVMATHLINKHLRGKTLHSFLFSYFANISHAIIDWVQQFCSKC--NKKGKI 204
            CEP ++YD+V+A HL  K      +   L  +F+N+    ID+  ++CSKC  ++   +
Sbjct: 133 ICEPKYMYDIVIAYHL--KLHSSYAVSERLKKFFSNVGRQYIDYCAKYCSKCFPDETEHM 190

Query: 205 KPLKE---YK--RPDMYDK-LLPMERIHIEVFEPFSGETIEGKYSYVLLCRDYRSSFMWL 258
           K   +   +K  R ++ D+ L PMERIHIE+F PF    IE KY  +L  RDY + ++W 
Sbjct: 191 KLFTDDITFKNIRNNIIDRPLFPMERIHIEIFNPFDDLKIENKYQRILYIRDYSTRYIWT 250

Query: 259 LPLKSTKFKHLIPVISSLFLSFA-RVPIFVTSSTLDKDDLYDICEEIASKYGLRIGLGLK 317
             LK  K KH+  +++  FLS A  VPIF+ SST+D  DL+DICE+I+ +Y + +GLG  
Sbjct: 251 FTLKKLKLKHITNILTEFFLSIATNVPIFLQSSTIDNTDLFDICEKISREYHISLGLGTN 310

Query: 318 SSA-RFHTGGILCIHYALNSYKEECLADWGKCLRYGPYXXXXXXXXXXXXXPAQVL-LSE 375
           +    FH  GI      +N  K +CL  W   L +G               P  ++  + 
Sbjct: 311 NKHDHFHLSGIEMFKQLVNLNKSKCLKSWSNFLVFGSVLHNNKFNSRILSKPIDIINCNN 370

Query: 376 IPGHNAKFETKRERVIENTYSRNMFKTAGGKGLIYLED 413
           +     KF  +R R+I+ T + N  K      +I++ED
Sbjct: 371 LAQGKKKFRDRRLRIIKQTITDNYVKLGNVASIIFIED 408

>TPHA0J00740 Chr10 (175036..176262) [1227 bp, 408 aa] {ON} Anc_8.262
           YDR110W
          Length = 408

 Score =  172 bits (437), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 104/333 (31%), Positives = 164/333 (49%), Gaps = 10/333 (3%)

Query: 88  LTQKIYELIKTKSLTADTLQQI-------SDKYDGVVAENKLLFLQRQYYVDDEGNVRDG 140
           LTQK+Y LI+ K+   +T ++        S KY G  A  K + ++ +Y +++ G + D 
Sbjct: 62  LTQKMYTLIREKNFNYETFEEAMKSHYTDSGKYMGT-ANKKFMLMEDRYQLNELGQITDK 120

Query: 141 RNNDKIYCEPNHIYDMVMATHLINKHLRGKTLHSFLFSYFANISHAIIDWVQQFCSKCNK 200
           RN+ K+   PN IYD++M  H +N HL    +H  L   ++NIS A++    Q CS CN 
Sbjct: 121 RNDYKLIVPPNQIYDLIMHCHFLNDHLGSTKIHHSLREKYSNISRALVRLSLQNCSHCNP 180

Query: 201 KGKIKPLKEYKRPDMYDKLLPMERIHIEVFEPFSG-ETIEGKYSYVLLCRDYRSSFMWLL 259
           K   K + EY R    DK    E+IH+E+F+PF   +T   K+S+V+  RDY + ++WL 
Sbjct: 181 KSTYKHI-EYTRHFSCDKNFAFEKIHVEIFQPFEDVDTFANKFSHVIYIRDYFTRYVWLY 239

Query: 260 PLKSTKFKHLIPVISSLFLSFARVPIFVTSSTLDKDDLYDICEEIASKYGLRIGLGLKSS 319
           PL+    K L   +++  L   R+PI++ S TLD+ +L  I + I+    L +G+G    
Sbjct: 240 PLEKISVKELANTLATHLLLSLRIPIYIESLTLDESNLLKILKRISKTTNLILGVGTTKL 299

Query: 320 ARFHTGGILCIHYALNSYKEECLADWGKCLRYGPYXXXXXXXXXXXXXPAQVLLSEIPGH 379
             F   GI  +       +E C  +W K +                  P  ++  E    
Sbjct: 300 DEFQASGINHMKELFVQNREYCGNNWNKYVIRCQNHYNTTYNKWIYGIPLNLMAQETLAD 359

Query: 380 NAKFETKRERVIENTYSRNMFKTAGGKGLIYLE 412
           N  ++ KR+R I  T S+N      GK  +Y E
Sbjct: 360 NKTYKKKRQRTILLTLSKNTILLKNGKSALYKE 392

>TPHA0A01810 Chr1 complement(365982..367355) [1374 bp, 457 aa] {ON}
           Anc_8.262 YDR110W
          Length = 457

 Score =  161 bits (407), Expect = 7e-43,   Method: Compositional matrix adjust.
 Identities = 97/337 (28%), Positives = 169/337 (50%), Gaps = 6/337 (1%)

Query: 83  SLTRQLTQKIYELIKTKSLTADTLQQISDKYDGVVAENKLLFLQRQYYVDDEGNVRDGRN 142
           S T  L++++Y+L+K   LT   +  ++   D   A  +L+ L+ +YY D +  V D   
Sbjct: 63  SKTNYLSKELYDLVKNDDLTRKNVA-VALNLDEKNAITRLIPLKHRYYRDSKLMVHDRSK 121

Query: 143 NDKIYCEPNHIYDMVMATHLINKHLRGKTLHSFLFSYFANISHAIIDWVQQFCSKCNKKG 202
            +KI  +P H + MVM THL+N HL    ++  L   FAN+S   I    ++CS CN   
Sbjct: 122 QNKIVIDPAHRFRMVMTTHLLNDHLTRGAIYRTLSKCFANLSDPFIKTSIEYCSICNSNK 181

Query: 203 KIKPLKEYKRPDMYDK--LLPMERIHIEVFEPFSGETIEGKYSYVLLCRDYRSSFMWLLP 260
             K ++  K P + +   +L  ER+ ++V  PF  + I+ +Y+++L   D+ + FMW  P
Sbjct: 182 --KNIRRKKEPQLSNSPDILFYERLILDVVAPFGAKKIQKRYTHILTITDFHTKFMWSFP 239

Query: 261 LKSTKFKHLIPVISSLFLSFARVPIFVTSSTLDKDDLYDICEEIASKYGLRIGLGLKSSA 320
           LK+ K + +I  ++   ++    P+F++S TL  +D++++C  +A +Y + IGLG ++  
Sbjct: 240 LKNLKLRTIISKVTEFIVALPVKPVFISSFTLSLNDIFELCCYLAREYNISIGLGTRNMQ 299

Query: 321 RFHTGGILCIHYALNSYKEECLADWGKCLRYGPYXXXXXXXXXXXXXPAQVLLSEIPGHN 380
           + ++     +   LNS+K ECL  W  CL++                    L S +    
Sbjct: 300 KAYSKNPY-VTRILNSHKTECLKSWFMCLKWLADRQSNSKFDIRPPNKNYGLFSGMTDFL 358

Query: 381 AKFETKRERVIENTYSRNMFKTAGGKGLIYLEDVNTF 417
            K+E + + +I    S N      G   IY ED  +F
Sbjct: 359 KKYEERSKMIIGRLPSENFINIDEGSHFIYSEDEFSF 395

>TBLA0F03070 Chr6 complement(745795..747132) [1338 bp, 445 aa] {ON}
           Anc_8.262 YDR110W
          Length = 445

 Score =  154 bits (390), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 103/373 (27%), Positives = 183/373 (49%), Gaps = 11/373 (2%)

Query: 51  PSMGESYTEYVDSYXXXXXXXXXXXXTPIFLESLTRQLTQKIYELIKTKSLTADTLQQIS 110
           P +G+    Y DSY            T  F  +L + +T  +Y  ++ +SL  D     +
Sbjct: 31  PPIGDDDEIYYDSYIDSDMLKRGEKETMEFRNTLKKHITSDLYYAMRDESLLEDDAPIPA 90

Query: 111 DKYDGVVAENKLLFLQRQYYVDDEGNVRDGRNNDKIYCEPNHIYDMVMATHLINKHLRGK 170
                 +  +K ++LQ +Y  + +G++ + + N K+ CEP +IY + M  H +N H+R  
Sbjct: 91  SL---KIKTSKKMYLQIRYSKNSDGDLIETKTN-KLLCEPKYIYKLTMKAHFMNNHMRSN 146

Query: 171 TLHSFLFSYFANISHAIIDWVQQFCSKCNKKGKIKPLK-EYKRPDMYDKLLPMERIHIEV 229
            L+  L   + NI + ++  V Q+CS CN  GKI+ ++  Y + + Y   LP+ER+ I++
Sbjct: 147 KLYRNLSMKYCNIPNLLVVLVLQYCSHCNTTGKIRDIRSNYGQRNQYIDYLPLERLQIDI 206

Query: 230 FEPFSGETIE--GKYSYVLLCRDYRSSFMWLLPLKSTKFKHLIPVISSLFLSFARVPIFV 287
            +PF+   I+   KYS++LL RDY S + W+ PLKS   K++   +    ++  R PIF+
Sbjct: 207 TKPFNDSDIKIANKYSHILLIRDYHSRYSWIFPLKSPNIKNISTELGKFLVTLPRTPIFL 266

Query: 288 TSSTLDKDDLYDICEEIASKYGLRIGLGLKSSAR--FHTGGILCIHYALN--SYKEECLA 343
            S  + +  L  I  +I  +Y ++I +G+       F   GI  + Y LN    KE+C +
Sbjct: 267 HSIGIPESQLIKILTKILLEYKIKIRIGIGGIKGRMFLRKGISRLVYLLNLKENKEKCKS 326

Query: 344 DWGKCLRYGPYXXXXXXXXXXXXXPAQVLLSEIPGHNAKFETKRERVIENTYSRNMFKTA 403
           DW +C+R   +                ++  +    N  FE KR+ ++ +    N+ K  
Sbjct: 327 DWYQCIRNTTFKENRRFDRNTGSFANFLIGKQKAELNKVFENKRDALLSDLLEENVLKIG 386

Query: 404 GGKGLIYLEDVNT 416
               +IY ++ N+
Sbjct: 387 ECGSIIYFDNNNS 399

>NDAI0B06160 Chr2 (1494425..1498636) [4212 bp, 1403 aa] {ON} 
          Length = 1403

 Score = 42.7 bits (99), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 37/121 (30%), Positives = 53/121 (43%), Gaps = 11/121 (9%)

Query: 161 HLINKHLRGKTLHSFLFSYFANISHAIIDW--VQQF-CSKCNKKGKIKPLKEY--KRPDM 215
           H+  K +R K++ S L +   NI    +DW  + +F C  C   GKI   K     R   
Sbjct: 315 HINVKDIR-KSIESKLIT---NIRINDVDWSGIDKFQCKDC-LAGKITKHKHIVGSRLKY 369

Query: 216 YDKLLPMERIHIEVFEPFSGETIEGKYSYVLLCRDYRSSFMWLLPLKSTKFKHLIPVISS 275
                P E IH ++F P SG  I     Y +   D  + F W+ PLK     H++P+   
Sbjct: 370 QKSYEPFEYIHTDLFGPVSGVDITSP-KYFISFTDENTRFRWVFPLKKKDADHILPIFQQ 428

Query: 276 L 276
           L
Sbjct: 429 L 429

>NDAI0G00600 Chr7 complement(130877..132343) [1467 bp, 488 aa] {ON} 
          Length = 488

 Score = 40.8 bits (94), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 28/92 (30%), Positives = 41/92 (44%), Gaps = 6/92 (6%)

Query: 188 IDW--VQQF-CSKCNKKGKIKPLKEYKRPDMYDKLLPMERIHIEVFEPFSGETIEGKYSY 244
           +DW  + +F C  C   GK+   K      +  K  PM  IH ++F P SG  I     Y
Sbjct: 151 VDWSGIDKFQCKDC-LTGKLTKHKHIVGSRLNIKS-PMSYIHTDLFGPVSGVDITSP-KY 207

Query: 245 VLLCRDYRSSFMWLLPLKSTKFKHLIPVISSL 276
            +   D  + F W+ PLK     H++P+   L
Sbjct: 208 FISFTDENTRFRWVFPLKKKDADHILPIFQQL 239

>NDAI0G00550 Chr7 complement(116985..118223) [1239 bp, 412 aa] {ON} 
          Length = 412

 Score = 40.0 bits (92), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 19/56 (33%), Positives = 27/56 (48%), Gaps = 1/56 (1%)

Query: 221 PMERIHIEVFEPFSGETIEGKYSYVLLCRDYRSSFMWLLPLKSTKFKHLIPVISSL 276
           P E IH ++F P SG  I     Y +   D  + F W+ PLK     H++P+   L
Sbjct: 290 PFEYIHTDLFGPVSGVDITSP-KYFISFTDENTRFRWVFPLKKKDADHILPIFQQL 344

>KAFR0B06620 Chr2 complement(1376088..1379645) [3558 bp, 1185 aa]
           {ON} 
          Length = 1185

 Score = 36.2 bits (82), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 30/107 (28%), Positives = 52/107 (48%), Gaps = 8/107 (7%)

Query: 182 NISHAIIDW--VQQF-CSKCNKKGKIKPLKEYKRPDM-YDKLL-PMERIHIEVFEPFSGE 236
           NI+   IDW  + +F C +C   GK++  K      + Y +   P + IH ++F P S  
Sbjct: 623 NITADKIDWRGIDKFQCKEC-LAGKMRRHKHTVGSRLKYQQFFEPFQYIHTDLFGPMSDV 681

Query: 237 TIEGKYSYVLLCRDYRSSFMWLLPLKSTKFKHLIPVISSLFLSFARV 283
           +     +Y +   D  + F W+ PL+S   +H++ V   L ++F R 
Sbjct: 682 SATTP-TYFISFVDENTRFRWVYPLRSKSAEHILLVFRKL-VNFIRT 726

>Kpol_1035.3 s1035 complement(5707..9099) [3393 bp, 1130 aa] {ON}
           complement(5707..9099) [3393 nt, 1131 aa]
          Length = 1130

 Score = 35.8 bits (81), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 25/98 (25%), Positives = 43/98 (43%), Gaps = 5/98 (5%)

Query: 191 VQQFCSKCNKKGKIKPLKEYKRPDMYDKLLPMERIHIEVFEPFSGETIEGKYSYVLLCRD 250
           V + CS+C    K   L   + P+++   +   R H++   P         Y Y LL  D
Sbjct: 797 VVRLCSRCETYEKFSDL-PIELPEIHRTPV-FSRWHLDFAGPLPAH---NGYKYFLLAAD 851

Query: 251 YRSSFMWLLPLKSTKFKHLIPVISSLFLSFARVPIFVT 288
           Y S+ + + PL    F  +  +I  ++ +F R  + VT
Sbjct: 852 YTSNLILVRPLAEQSFTSVYDLIFDIYATFGRPHMLVT 889

>NDAI0D03010 Chr4 complement(712188..714524) [2337 bp, 778 aa] {ON} 
          Length = 778

 Score = 35.4 bits (80), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 33/155 (21%), Positives = 60/155 (38%), Gaps = 23/155 (14%)

Query: 146 IYCEPNHIYDMVMATH--------LINKHLRGKTLHSFLFSYFANISHAIIDWVQQFCSK 197
           I+C P  ++ ++   H         + KH     + S L + + NIS  +I  V   C  
Sbjct: 154 IWCPPTLLHYVIACVHENWDCDDYTLRKHRDENEIQSILAAKYHNISKFLIHDVVAACPD 213

Query: 198 CNKKGKIKPLKEYKRPDMYDKLLPM-----ERIHIEVFEPFSGETIEGK----YSYVLLC 248
           C      KPL   K       +LP+     +R+ +++        +  K     + +L  
Sbjct: 214 C------KPLSSKKFNITRVNVLPLTRYSFQRLQVKILSAADYSCVCPKDNCTKNAILYI 267

Query: 249 RDYRSSFMWLLPLKSTKFKHLIPVISSLFLSFARV 283
            DY S  +WL  L   +    I ++  +FL+   +
Sbjct: 268 GDYHSGAVWLFALDGEEDATDILLVLEMFLNVVLI 302

>Kwal_36.16338 s36 (3460..5271) [1812 bp, 604 aa] {ON} YPL060C-A -
           TyA Gag protein [contig 364] PARTIAL
          Length = 604

 Score = 35.0 bits (79), Expect = 0.52,   Method: Compositional matrix adjust.
 Identities = 28/127 (22%), Positives = 50/127 (39%), Gaps = 9/127 (7%)

Query: 160 THLINKHLRGKTLHSFLFSYFANISHAIIDWVQQF---CSKCNK-KGKIKPLKEYKRPDM 215
           +H+  K++R     S       ++  + +DW++     C  C   KGK        R   
Sbjct: 61  SHINVKYIRK----SVELGLIKDVKISDVDWIELEWFECESCMAGKGKRHNHIANSRDTY 116

Query: 216 YDKLLPMERIHIEVFEPFSGETIEGKYSYVLLCRDYRSSFMWLLPLKSTKFKHLIPVISS 275
            +K   +E +H ++F P       G   Y +   D R+ + W+ PL     + ++ V   
Sbjct: 117 QEKYADLEFLHTDIFGPMH-HMPSGVPKYFITFTDERTRYRWVFPLSRKSDEAVVAVFRK 175

Query: 276 LFLSFAR 282
           L    AR
Sbjct: 176 LIAHIAR 182

>Kwal_27.11219 s27 complement(690913..693147) [2235 bp, 744 aa] {ON}
           YPL060C-A - TyA Gag protein [contig 345] FULL
          Length = 744

 Score = 34.7 bits (78), Expect = 0.75,   Method: Compositional matrix adjust.
 Identities = 28/127 (22%), Positives = 50/127 (39%), Gaps = 9/127 (7%)

Query: 160 THLINKHLRGKTLHSFLFSYFANISHAIIDWVQQF---CSKCNK-KGKIKPLKEYKRPDM 215
           +H+  K++R     S       ++  + +DW++     C  C   KGK        R   
Sbjct: 116 SHINVKYIRK----SVELGLIKDVKISDVDWIELEWFECESCMAGKGKRHNHIANSRDTY 171

Query: 216 YDKLLPMERIHIEVFEPFSGETIEGKYSYVLLCRDYRSSFMWLLPLKSTKFKHLIPVISS 275
            +K   +E +H ++F P       G   Y +   D R+ + W+ PL     + ++ V   
Sbjct: 172 QEKYADLEFLHTDIFGPMH-HMPSGVPKYFITFTDERTRYRWVFPLSRKSDEAVVAVFRK 230

Query: 276 LFLSFAR 282
           L    AR
Sbjct: 231 LIAHIAR 237

>Kwal_39.16409 s39 (7556..9760) [2205 bp, 734 aa] {ON} YLR035C-A -
           Ty ORF [contig 372] FULL
          Length = 734

 Score = 34.7 bits (78), Expect = 0.77,   Method: Compositional matrix adjust.
 Identities = 28/127 (22%), Positives = 50/127 (39%), Gaps = 9/127 (7%)

Query: 160 THLINKHLRGKTLHSFLFSYFANISHAIIDWVQQF---CSKCNK-KGKIKPLKEYKRPDM 215
           +H+  K++R     S       ++  + +DW++     C  C   KGK        R   
Sbjct: 222 SHINVKYIR----KSVELGLIKDVKISDVDWIELEWFECESCMAGKGKRHNHIANSRDTY 277

Query: 216 YDKLLPMERIHIEVFEPFSGETIEGKYSYVLLCRDYRSSFMWLLPLKSTKFKHLIPVISS 275
            +K   +E +H ++F P       G   Y +   D R+ + W+ PL     + ++ V   
Sbjct: 278 QEKYADLEFLHTDIFGPMH-HMPSGVPKYFITFTDERTRYRWVFPLSRKSDEAVVAVFRK 336

Query: 276 LFLSFAR 282
           L    AR
Sbjct: 337 LIAHIAR 343

>Kwal_33.15089 s33 complement(956930..958366) [1437 bp, 478 aa] {ON}
           YPL060C-A - TyA Gag protein [contig 94] FULL
          Length = 478

 Score = 33.9 bits (76), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 29/127 (22%), Positives = 52/127 (40%), Gaps = 9/127 (7%)

Query: 160 THLINKHLRGKTLHSFLFSYFANISHAIIDW--VQQF-CSKC-NKKGKIKPLKEYKRPDM 215
           +H+  K++R     S       +++ + +DW  ++ F C  C   KGK        R   
Sbjct: 61  SHINVKYIRK----SVELGLIKDVTISDVDWSELEWFECESCMAGKGKRHNHIANSRDTY 116

Query: 216 YDKLLPMERIHIEVFEPFSGETIEGKYSYVLLCRDYRSSFMWLLPLKSTKFKHLIPVISS 275
            +K   +E +H ++F P       G   Y +   D R+ + W+ PL     + ++ V   
Sbjct: 117 QEKYADLEFLHTDIFGPMH-HMPSGVPKYFITFTDERTRYRWVFPLSRKSDEAVVAVFRK 175

Query: 276 LFLSFAR 282
           L    AR
Sbjct: 176 LIAHIAR 182

>NCAS0I01770 Chr9 complement(326908..329082) [2175 bp, 724 aa] {ON}
           Anc_3.243 YBR041W
          Length = 724

 Score = 33.5 bits (75), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 20/64 (31%), Positives = 29/64 (45%), Gaps = 10/64 (15%)

Query: 212 RPDMYDKLLPMERIHIEVF--------EPFSGETIEGKYSYVLLCRDYRSSFMWLLPLKS 263
           RPD++ K    ER HIEV          PF+  + +     +  CR+Y +   W L L+ 
Sbjct: 424 RPDIWQKF--RERFHIEVIGEFYAATEAPFATTSFQRGTFGIGACRNYGTIIQWFLSLQQ 481

Query: 264 TKFK 267
           T  K
Sbjct: 482 TLVK 485

>Kwal_27.12438 s27 (1219039..1220964) [1926 bp, 641 aa] {ON}
           YOR343C-B - TyB Gag-Pol protein [contig 457] FULL
          Length = 641

 Score = 33.5 bits (75), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 29/127 (22%), Positives = 52/127 (40%), Gaps = 9/127 (7%)

Query: 160 THLINKHLRGKTLHSFLFSYFANISHAIIDW--VQQF-CSKCNK-KGKIKPLKEYKRPDM 215
           +H+  K++R     S       +++ + +DW  ++ F C  C   KGK        R   
Sbjct: 222 SHINVKYIRK----SVELGLIKDVTISDVDWSELEWFECESCMAGKGKRHNHIANSRDTY 277

Query: 216 YDKLLPMERIHIEVFEPFSGETIEGKYSYVLLCRDYRSSFMWLLPLKSTKFKHLIPVISS 275
            +K   +E +H ++F P       G   Y +   D R+ + W+ PL     + ++ V   
Sbjct: 278 QEKYADLEFLHTDIFGPMH-HMPSGVPKYFITFTDERTRYRWVFPLSRKSDEAVVAVFRK 336

Query: 276 LFLSFAR 282
           L    AR
Sbjct: 337 LIAHIAR 343

>Kwal_13.691 s13 complement(2834..5431) [2598 bp, 865 aa] {ON}
           YBL101W-B - TyB Gag-Pol protein [contig 696] FULL
          Length = 865

 Score = 33.5 bits (75), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 29/127 (22%), Positives = 51/127 (40%), Gaps = 9/127 (7%)

Query: 160 THLINKHLRGKTLHSFLFSYFANISHAIIDW--VQQF-CSKCNK-KGKIKPLKEYKRPDM 215
           +H+  K++R     S       ++  + +DW  ++ F C  C   KGK        R   
Sbjct: 157 SHINVKYIR----KSVELGLIKDVKISDVDWSELEWFECESCMAGKGKRHNHIANSRDTY 212

Query: 216 YDKLLPMERIHIEVFEPFSGETIEGKYSYVLLCRDYRSSFMWLLPLKSTKFKHLIPVISS 275
            +K   +E +H ++F P       G   Y +   D R+ + W+ PL     + ++ V   
Sbjct: 213 QEKYADLEFLHTDIFGPMH-HMPSGVPKYFITFTDERTRYRWVFPLSRKSDEAVVAVFRK 271

Query: 276 LFLSFAR 282
           L    AR
Sbjct: 272 LIAHIAR 278

>Kpol_2000.35 s2000 complement(68315..70429) [2115 bp, 704 aa] {ON}
           complement(68315..70429) [2115 nt, 705 aa]
          Length = 704

 Score = 33.5 bits (75), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 30/144 (20%), Positives = 58/144 (40%), Gaps = 20/144 (13%)

Query: 187 IIDWVQQFCSKCNKKGKIK----PLKEYKRPDMYDKLLPMERIHIEVFEPFSGETIEGKY 242
           ++D V+Q C +C    K +     L E +R  ++       R H++   P   +     Y
Sbjct: 347 LLDVVKQ-CPRCETYQKFRDIPIELPEIRRIPVF------SRWHLDFAGPLKDK---DGY 396

Query: 243 SYVLLCRDYRSSFMWLLPLKSTKFKHLIPVISSLFLSFARVPIFVTSSTLDKDDLYDICE 302
            Y LL  DY S+ + + PL+   F  +  ++ +++  F    + +T      D+      
Sbjct: 397 KYFLLAADYTSNLILVKPLREQTFHSVYEIMRAIYAIFGSPHMLIT------DNGRQFAN 450

Query: 303 EIASKYGLRIGLGLKSSARFHTGG 326
            I  +    + L    S+ +H  G
Sbjct: 451 AIIPQVARSLKLKYYQSSAYHPRG 474

>Kwal_54.19470 s54 (253..1881) [1629 bp, 542 aa] {ON} YDR261C-D -
           TyB Gag-Pol protein [contig 416] FULL
          Length = 542

 Score = 33.1 bits (74), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 25/99 (25%), Positives = 40/99 (40%), Gaps = 5/99 (5%)

Query: 188 IDW--VQQF-CSKCNK-KGKIKPLKEYKRPDMYDKLLPMERIHIEVFEPFSGETIEGKYS 243
           +DW  ++ F C  C   KGK        R    +K   +E +H ++F P       G   
Sbjct: 181 VDWSELEWFECESCMAGKGKRHNHIANSRDTYQEKYADLEFLHTDIFGPMH-HMPSGVPK 239

Query: 244 YVLLCRDYRSSFMWLLPLKSTKFKHLIPVISSLFLSFAR 282
           Y +   D R+ + W+ PL     + ++ V   L    AR
Sbjct: 240 YFITFTDERTRYRWVFPLSRKSDEAVVAVFRKLIAHIAR 278

>Kwal_60.24910 s60 (1218..2792) [1575 bp, 524 aa] {ON} YDR261W-B -
           TyB Gag-Pol protein [contig 691] FULL
          Length = 524

 Score = 32.7 bits (73), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 25/99 (25%), Positives = 40/99 (40%), Gaps = 5/99 (5%)

Query: 188 IDWVQ--QF-CSKCNK-KGKIKPLKEYKRPDMYDKLLPMERIHIEVFEPFSGETIEGKYS 243
           +DW++   F C  C   KGK        R    +K   +E +H ++F P       G   
Sbjct: 381 VDWIELEWFECESCMAGKGKRHNHIANSRDTYQEKYADLEFLHTDIFGPMH-HMPSGVPK 439

Query: 244 YVLLCRDYRSSFMWLLPLKSTKFKHLIPVISSLFLSFAR 282
           Y +   D R+ + W+ PL     + ++ V   L    AR
Sbjct: 440 YFITFTDERTRYRWVFPLSRKSDEAVVAVFRKLIAHIAR 478

>Kwal_26.7891 s26 complement(557640..558572) [933 bp, 310 aa] {ON}
           YDR261C-D - TyB Gag-Pol protein [contig 55] FULL
          Length = 310

 Score = 32.3 bits (72), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 25/99 (25%), Positives = 40/99 (40%), Gaps = 5/99 (5%)

Query: 188 IDWVQ--QF-CSKCNK-KGKIKPLKEYKRPDMYDKLLPMERIHIEVFEPFSGETIEGKYS 243
           +DW++   F C  C   KGK        R    +K   +E +H ++F P       G   
Sbjct: 85  VDWIELEWFECESCMAGKGKRHNHIANSRDTYQEKYADLEFLHTDIFGPMH-HMPSGVPK 143

Query: 244 YVLLCRDYRSSFMWLLPLKSTKFKHLIPVISSLFLSFAR 282
           Y +   D R+ + W+ PL     + ++ V   L    AR
Sbjct: 144 YFITFTDERTRYRWVFPLSRKSDEAVVAVFRKLIAHIAR 182

>Kpol_1037.34 s1037 (80237..84124) [3888 bp, 1295 aa] {ON}
           (80237..84124) [3888 nt, 1296 aa]
          Length = 1295

 Score = 32.0 bits (71), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 29/105 (27%), Positives = 43/105 (40%), Gaps = 7/105 (6%)

Query: 182 NISHAIIDW--VQQF-CSKCNKKGKIKPLKEY--KRPDMYDKLLPMERIHIEVFEPFSGE 236
           NIS+  IDW     F C  C  KGK    K Y   R     +    E +H ++F P    
Sbjct: 182 NISYDNIDWSGFDTFQCPDC-LKGKSTQHKHYVGSRVKYQREYNTFEFLHTDLFGPVPNM 240

Query: 237 TIEGKYSYVLLCRDYRSSFMWLLPLKSTKFKHLIPVISSLFLSFA 281
                 +Y +   D +S F W+ PL+S     +  V  ++  +F 
Sbjct: 241 PTSSP-TYFISFTDEQSRFRWVFPLRSKDASTVTTVFRNIVATFG 284

>Suva_9.239 Chr9 (384251..384478,384971..387658) [2916 bp, 971 aa]
           {ON} YIR023W (REAL)
          Length = 971

 Score = 32.0 bits (71), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 14/44 (31%), Positives = 26/44 (59%)

Query: 249 RDYRSSFMWLLPLKSTKFKHLIPVISSLFLSFARVPIFVTSSTL 292
           RDY  +++W+L + S  F  L   ++++ L FA++P  +T   L
Sbjct: 707 RDYLRNYIWVLKIGSKYFDKLSNALNNMHLLFAQIPGLLTDEPL 750

>Kwal_55.19799 s55 complement(132471..133535) [1065 bp, 354 aa] {ON}
           YDR261C-D - TyB Gag-Pol protein [contig 159] FULL
          Length = 354

 Score = 31.6 bits (70), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 25/99 (25%), Positives = 40/99 (40%), Gaps = 5/99 (5%)

Query: 188 IDW--VQQF-CSKCNK-KGKIKPLKEYKRPDMYDKLLPMERIHIEVFEPFSGETIEGKYS 243
           +DW  ++ F C  C   KGK        R    +K   +E +H ++F P       G   
Sbjct: 170 VDWSELEWFECESCMAGKGKRHNHIANSRDTYQEKYADLEFLHTDIFGPMH-HMPSGVPK 228

Query: 244 YVLLCRDYRSSFMWLLPLKSTKFKHLIPVISSLFLSFAR 282
           Y +   D R+ + W+ PL     + ++ V   L    AR
Sbjct: 229 YFITFTDERTRYRWVFPLSRKSDEAVVAVFRKLIAHIAR 267

>Kwal_50.19418 s50 complement(1189..2235) [1047 bp, 348 aa] {ON}
           YPL060C-A - TyA Gag protein [contig 328] FULL
          Length = 348

 Score = 31.2 bits (69), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 16/66 (24%), Positives = 28/66 (42%), Gaps = 1/66 (1%)

Query: 217 DKLLPMERIHIEVFEPFSGETIEGKYSYVLLCRDYRSSFMWLLPLKSTKFKHLIPVISSL 276
           +K   +E +H ++F P       G   Y +   D R+ + W+ PL     + ++ V   L
Sbjct: 20  EKYADLEFLHTDIFGPMH-HMPSGVPKYFITFTDERTRYRWVFPLSRKSDEAVVAVFRKL 78

Query: 277 FLSFAR 282
               AR
Sbjct: 79  IAHIAR 84

>YIR023W Chr9 (399777..402689) [2913 bp, 970 aa] {ON}  DAL81Positive
           regulator of genes in multiple nitrogen degradation
           pathways; contains DNA binding domain but does not
           appear to bind the dodecanucleotide sequence present in
           the promoter region of many genes involved in allantoin
           catabolism
          Length = 970

 Score = 31.6 bits (70), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 20/82 (24%), Positives = 39/82 (47%), Gaps = 4/82 (4%)

Query: 245 VLLCRDYRSSFMWLLPLKSTKFKHLIPVISSLFLSFARVPIFVTSSTLDKDDLYDICEEI 304
            ++ RDY  ++ W+L + S  F  L   ++++ L FA++P  +T    D+  +      I
Sbjct: 704 AMIFRDYVRNYTWVLKIGSKYFDKLSNALNNMHLLFAQIPGLLT----DEPVVVSPNSNI 759

Query: 305 ASKYGLRIGLGLKSSARFHTGG 326
            S    R G+  +   +F+ G 
Sbjct: 760 NSVNPQRSGVQSQIPIQFNVGS 781

>Kwal_47.17665 s47 complement(505870..507747) [1878 bp, 625 aa] {ON}
           YDR261C-D - TyB Gag-Pol protein [contig 206] FULL
          Length = 625

 Score = 31.6 bits (70), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 16/66 (24%), Positives = 28/66 (42%), Gaps = 1/66 (1%)

Query: 217 DKLLPMERIHIEVFEPFSGETIEGKYSYVLLCRDYRSSFMWLLPLKSTKFKHLIPVISSL 276
           +K   +E +H ++F P       G   Y +   D R+ + W+ PL     + ++ V   L
Sbjct: 20  EKYADLEFLHTDIFGPMH-HMPSGVPKYFITFTDERTRYRWVFPLSRKSDEAVVAVFRKL 78

Query: 277 FLSFAR 282
               AR
Sbjct: 79  IAHIAR 84

>NDAI0D00410 Chr4 (86277..87239) [963 bp, 320 aa] {ON} 
          Length = 320

 Score = 31.2 bits (69), Expect = 7.4,   Method: Compositional matrix adjust.
 Identities = 29/103 (28%), Positives = 48/103 (46%), Gaps = 11/103 (10%)

Query: 145 KIYCEPNHIYDMVMATHLINKHLRGKTLHSFLFSYFANISHAIIDWVQQFCSKCNKKGKI 204
           KI C   H Y ++  T   N   + K ++SF ++        ++  V+Q  SKC K+G+ 
Sbjct: 2   KILCWFLHSYSIITQT---NNQAKNKEMNSFTYTSIQK-QKRLLTLVEQKLSKCAKQGET 57

Query: 205 K--PLKEY-KRPDMYDKLLPMERIHIEVFEPFSGETIEGKYSY 244
           K   L+E     ++ D+LL     +I+ FE F     +  Y Y
Sbjct: 58  KGYNLREMVGHANLLDQLLD----NIQNFENFENHQRQHSYYY 96

>Kwal_14.764 s14 (32697..33773) [1077 bp, 358 aa] {ON} YLR035C-A -
           Ty ORF [contig 245] FULL
          Length = 358

 Score = 31.2 bits (69), Expect = 7.8,   Method: Compositional matrix adjust.
 Identities = 25/99 (25%), Positives = 40/99 (40%), Gaps = 5/99 (5%)

Query: 188 IDW--VQQF-CSKCNK-KGKIKPLKEYKRPDMYDKLLPMERIHIEVFEPFSGETIEGKYS 243
           +DW  ++ F C  C   KGK        R    +K   +E +H ++F P       G   
Sbjct: 181 VDWSELEWFECESCMAGKGKRHNHIANSRDTYQEKYADLEFLHTDIFGPMH-HMPSGVPK 239

Query: 244 YVLLCRDYRSSFMWLLPLKSTKFKHLIPVISSLFLSFAR 282
           Y +   D R+ + W+ PL     + ++ V   L    AR
Sbjct: 240 YFITFTDERTRYRWVFPLSRKSDEAVVAVFRKLIAHIAR 278

>Kpol_1066.30 s1066 complement(52257..53045) [789 bp, 262 aa] {ON}
           complement(52257..53045) [789 nt, 263 aa]
          Length = 262

 Score = 30.4 bits (67), Expect = 9.8,   Method: Compositional matrix adjust.
 Identities = 32/110 (29%), Positives = 46/110 (41%), Gaps = 18/110 (16%)

Query: 182 NISHAIIDW--VQQFCSKCNKKGKIKPLKEY-----KRPDMYDKLLPMERIHIEVFEPFS 234
           NIS+  IDW   + F      KGK    K Y     K    Y+     E +H ++F P  
Sbjct: 46  NISYDNIDWSGFETFQFPDCLKGKSTQHKHYVGSCVKYQREYNTF---EFLHTDLFAPVP 102

Query: 235 GETIEGKYSYVLLCRDYRSSFMWLLPLKS-------TKFKHLIPVISSLF 277
                   +Y +   D RS F W  PL+S       T F++++  IS+ F
Sbjct: 103 NMPTSSP-TYFISFTDERSKFRWDFPLRSKDAAIVTTVFRNIVAFISTQF 151

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.134    0.388 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 59,703,599
Number of extensions: 2580549
Number of successful extensions: 10088
Number of sequences better than 10.0: 117
Number of HSP's gapped: 10408
Number of HSP's successfully gapped: 119
Length of query: 576
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 461
Effective length of database: 40,294,809
Effective search space: 18575906949
Effective search space used: 18575906949
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 68 (30.8 bits)