Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Smik_4.3558.257ON70470437540.0
YDR109C8.257ON71570629290.0
Skud_4.3708.257ON71470627750.0
Suva_2.2698.257ON72569726270.0
SAKL0H17160g8.257ON73971122130.0
Kwal_56.236078.257ON72570122020.0
KLTH0G13794g8.257ON72569621920.0
ZYRO0C01782g8.257ON73069821340.0
TDEL0F038408.257ON72671121220.0
KLLA0F19041g8.257ON76352420630.0
NCAS0B038708.257ON59652117580.0
Kpol_392.98.257ON59452017490.0
NDAI0J014008.257ON58860417420.0
KAFR0B055608.257ON60551617090.0
Ecym_43138.257ON59751816780.0
KNAG0H032608.257ON58052316590.0
TBLA0E044008.257ON58952416490.0
CAGL0B01727g8.257ON57751216030.0
TPHA0B032408.257ON58552215480.0
AGR092W8.257ON59652315040.0
Suva_14.931.111ON5435455012e-54
Skud_14.891.111ON5695644916e-53
Smik_14.861.111ON5435434661e-49
YNL249C (MPA43)1.111ON5425294529e-48
KLTH0F03080g1.111ON5335884501e-47
TDEL0C059001.111ON5435674441e-46
ZYRO0F16016g1.111ON5424704413e-46
Kwal_33.135301.111ON5345264325e-45
SAKL0C03432g1.111ON5475264246e-44
KNAG0F006601.111ON5355374017e-41
KLLA0C02937g1.111ON5165013024e-28
NCAS0A007801.111ON5495702181e-17
NDAI0H002204.9ON810132830.24
TPHA0K022804.9ON667108771.3
CAGL0L06776g2.395ON828174761.9
NCAS0C041608.127ON25079723.0
TBLA0C027801.289ON22066723.2
Kpol_1016.241.289ON21166696.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Smik_4.355
         (704 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Smik_4.355 Chr4 complement(634853..636967) [2115 bp, 704 aa] {ON...  1450   0.0  
YDR109C Chr4 complement(673520..675667) [2148 bp, 715 aa] {ON} P...  1132   0.0  
Skud_4.370 Chr4 complement(645143..647287) [2145 bp, 714 aa] {ON...  1073   0.0  
Suva_2.269 Chr2 complement(467973..470150) [2178 bp, 725 aa] {ON...  1016   0.0  
SAKL0H17160g Chr8 (1516854..1519073) [2220 bp, 739 aa] {ON} simi...   857   0.0  
Kwal_56.23607 s56 complement(618687..620864) [2178 bp, 725 aa] {...   852   0.0  
KLTH0G13794g Chr7 (1191104..1193281) [2178 bp, 725 aa] {ON} simi...   848   0.0  
ZYRO0C01782g Chr3 (137232..139424) [2193 bp, 730 aa] {ON} simila...   826   0.0  
TDEL0F03840 Chr6 complement(705363..707543) [2181 bp, 726 aa] {O...   822   0.0  
KLLA0F19041g Chr6 complement(1753543..1755834) [2292 bp, 763 aa]...   799   0.0  
NCAS0B03870 Chr2 (689411..691201) [1791 bp, 596 aa] {ON} Anc_8.257    681   0.0  
Kpol_392.9 s392 (24389..26173) [1785 bp, 594 aa] {ON} (24389..26...   678   0.0  
NDAI0J01400 Chr10 (321913..323679) [1767 bp, 588 aa] {ON} Anc_8....   675   0.0  
KAFR0B05560 Chr2 (1138380..1140197) [1818 bp, 605 aa] {ON} Anc_8...   662   0.0  
Ecym_4313 Chr4 (672950..674743) [1794 bp, 597 aa] {ON} similar t...   650   0.0  
KNAG0H03260 Chr8 (607908..609650) [1743 bp, 580 aa] {ON} Anc_8.2...   643   0.0  
TBLA0E04400 Chr5 complement(1119643..1121412) [1770 bp, 589 aa] ...   639   0.0  
CAGL0B01727g Chr2 complement(159373..161106) [1734 bp, 577 aa] {...   622   0.0  
TPHA0B03240 Chr2 (743153..744910) [1758 bp, 585 aa] {ON} Anc_8.2...   600   0.0  
AGR092W Chr7 (908750..910540) [1791 bp, 596 aa] {ON} Syntenic ho...   583   0.0  
Suva_14.93 Chr14 complement(174204..175835) [1632 bp, 543 aa] {O...   197   2e-54
Skud_14.89 Chr14 complement(168159..169868) [1710 bp, 569 aa] {O...   193   6e-53
Smik_14.86 Chr14 complement(158487..160118) [1632 bp, 543 aa] {O...   184   1e-49
YNL249C Chr14 complement(179394..181022) [1629 bp, 542 aa] {ON} ...   178   9e-48
KLTH0F03080g Chr6 complement(268621..270222) [1602 bp, 533 aa] {...   177   1e-47
TDEL0C05900 Chr3 (1062033..1063664) [1632 bp, 543 aa] {ON} Anc_1...   175   1e-46
ZYRO0F16016g Chr6 (1313995..1315623) [1629 bp, 542 aa] {ON} simi...   174   3e-46
Kwal_33.13530 s33 complement(268296..269900) [1605 bp, 534 aa] {...   171   5e-45
SAKL0C03432g Chr3 complement(325502..327145) [1644 bp, 547 aa] {...   167   6e-44
KNAG0F00660 Chr6 complement(114441..116048) [1608 bp, 535 aa] {O...   159   7e-41
KLLA0C02937g Chr3 complement(265205..266755) [1551 bp, 516 aa] {...   120   4e-28
NCAS0A00780 Chr1 complement(152317..153966) [1650 bp, 549 aa] {O...    89   1e-17
NDAI0H00220 Chr8 complement(30959..33391) [2433 bp, 810 aa] {ON}...    37   0.24 
TPHA0K02280 Chr11 (490104..492107) [2004 bp, 667 aa] {ON} Anc_4....    34   1.3  
CAGL0L06776g Chr12 (763580..766066) [2487 bp, 828 aa] {ON} some ...    34   1.9  
NCAS0C04160 Chr3 (852001..852753) [753 bp, 250 aa] {ON} Anc_8.12...    32   3.0  
TBLA0C02780 Chr3 complement(668605..669267) [663 bp, 220 aa] {ON...    32   3.2  
Kpol_1016.24 s1016 (61782..62417) [636 bp, 211 aa] {ON} (61782.....    31   6.7  

>Smik_4.355 Chr4 complement(634853..636967) [2115 bp, 704 aa] {ON}
           YDR109C (REAL)
          Length = 704

 Score = 1450 bits (3754), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 698/704 (99%), Positives = 698/704 (99%)

Query: 1   MQDKIWQSTTFPSQRTSDSRISQHESETKFYVGVDVGTGSTRACIIDKSGNILSLAEKPI 60
           MQDKIWQSTTFPSQRTSDSRISQHESETKFYVGVDVGTGSTRACIIDKSGNILSLAEKPI
Sbjct: 1   MQDKIWQSTTFPSQRTSDSRISQHESETKFYVGVDVGTGSTRACIIDKSGNILSLAEKPI 60

Query: 61  KREELLSNFITQSSREIWNAVCYCVRKVIQEAGVDPARIHGIGFDATCSLVVVSATDFKE 120
           KREELLSNFITQSSREIWNAVCYCVRKVIQEAGVDPARIHGIGFDATCSLVVVSATDFKE
Sbjct: 61  KREELLSNFITQSSREIWNAVCYCVRKVIQEAGVDPARIHGIGFDATCSLVVVSATDFKE 120

Query: 121 IAVGPDFTNNDQNIILWMDHRAMKETEEINFSGNTCLKYVGGQMSVEMEIPKIKWLKNNL 180
           IAVGPDFTNNDQNIILWMDHRAMKETEEINFSGNTCLKYVGGQMSVEMEIPKIKWLKNNL
Sbjct: 121 IAVGPDFTNNDQNIILWMDHRAMKETEEINFSGNTCLKYVGGQMSVEMEIPKIKWLKNNL 180

Query: 181 ESGIFQDCKFFDLPDYLTFRATGKENRSFSSVVCKQGFLPEGVEGSNLGWSKQFLDSIGL 240
           ESGIFQDCKFFDLPDYLTFRATGKENRSFSSVVCKQGFLPEGVEGSNLGWSKQFLDSIGL
Sbjct: 181 ESGIFQDCKFFDLPDYLTFRATGKENRSFSSVVCKQGFLPEGVEGSNLGWSKQFLDSIGL 240

Query: 241 SELTDNDFEKLGGSLRNQKNFLSAGECIGPLDGKAARQLGLTEYCVVSSGIIDAYAGWVG 300
           SELTDNDFEKLGGSLRNQKNFLSAGECIGPLDGKAARQLGLTEYCVVSSGIIDAYAGWVG
Sbjct: 241 SELTDNDFEKLGGSLRNQKNFLSAGECIGPLDGKAARQLGLTEYCVVSSGIIDAYAGWVG 300

Query: 301 TVAAKPESEIKGLTENEDYKHDFNGAIGRLAAVAGTSTCHILLSKSSIFVHGIWGPYRDV 360
           TVAAKPESEIKGLTENEDYKHDFNGAIGRLAAVAGTSTCHILLSKSSIFVHGIWGPYRDV
Sbjct: 301 TVAAKPESEIKGLTENEDYKHDFNGAIGRLAAVAGTSTCHILLSKSSIFVHGIWGPYRDV 360

Query: 361 LARGFWAAEGGQSCTGVLLDHVITTHPAFSKLSQLADAANVSKFEYLNSVLENLVEKRKE 420
           LARGFWAAEGGQSCTGVLLDHVITTHPAFSKLSQLADAANVSKFEYLNSVLENLVEKRKE
Sbjct: 361 LARGFWAAEGGQSCTGVLLDHVITTHPAFSKLSQLADAANVSKFEYLNSVLENLVEKRKE 420

Query: 421 RSVIFLAKHLFFYGDYRGNRSPIADPNMRACIIGQSMDNSIDDLAVIYLGACEFISQQTR 480
           RSVIFLAKHLFFYGDYRGNRSPIADPNMRACIIGQSMDNSIDDLAVIYLGACEFISQQTR
Sbjct: 421 RSVIFLAKHLFFYGDYRGNRSPIADPNMRACIIGQSMDNSIDDLAVIYLGACEFISQQTR 480

Query: 481 QIIEVMLKSGHAINAVFMSGGQCRNGLLMRLLADCTGLPIVIPRYIDGAVVFGSALLGAA 540
           QIIEVMLKSGHAINAVFMSGGQCRNGLLMRLLADCTGLPIVIPRYIDGAVVFGSALLGAA
Sbjct: 481 QIIEVMLKSGHAINAVFMSGGQCRNGLLMRLLADCTGLPIVIPRYIDGAVVFGSALLGAA 540

Query: 541 ASKVFDLNKRRRVIXXXXXXLVQTEFLEGLYPSIQNLPLENHSTNVVASYKLACSNLNAP 600
           ASKVFDLNKRRRVI      LVQTEFLEGLYPSIQNLPLENHSTNVVASYKLACSNLNAP
Sbjct: 541 ASKVFDLNKRRRVIKSKKSSLVQTEFLEGLYPSIQNLPLENHSTNVVASYKLACSNLNAP 600

Query: 601 ARTSSDLFPISKEQPADMISDKSSKGISLDKGRENLEEERDIDKNILWKVMQELTGNAKV 660
           ARTSSDLFPISKEQPADMISDKSSKGISLDKGRENLEEERDIDKNILWKVMQELTGNAKV
Sbjct: 601 ARTSSDLFPISKEQPADMISDKSSKGISLDKGRENLEEERDIDKNILWKVMQELTGNAKV 660

Query: 661 ICPNTKTHPDRILLDTKYQIFLDMVETQRNYRRMVDKVEETFSR 704
           ICPNTKTHPDRILLDTKYQIFLDMVETQRNYRRMVDKVEETFSR
Sbjct: 661 ICPNTKTHPDRILLDTKYQIFLDMVETQRNYRRMVDKVEETFSR 704

>YDR109C Chr4 complement(673520..675667) [2148 bp, 715 aa] {ON}
           Putative kinase
          Length = 715

 Score = 1132 bits (2929), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 541/706 (76%), Positives = 605/706 (85%), Gaps = 2/706 (0%)

Query: 1   MQDKIWQSTTFPSQRTSDSRISQHESETKFYVGVDVGTGSTRACIIDKSGNILSLAEKPI 60
           MQ++  +     SQ TS SRIS  + E KFYVGVDVGTGS RAC+ID+SGN+LSLAEKPI
Sbjct: 10  MQNETREPAVLSSQETSISRISPQDPEAKFYVGVDVGTGSARACVIDQSGNMLSLAEKPI 69

Query: 61  KREELLSNFITQSSREIWNAVCYCVRKVIQEAGVDPARIHGIGFDATCSLVVVSATDFKE 120
           KRE+L+SNFITQSSREIWNAVCYCVR V++E+GVDP R+ GIGFDATCSLVVVSAT+F+E
Sbjct: 70  KREQLISNFITQSSREIWNAVCYCVRTVVEESGVDPERVRGIGFDATCSLVVVSATNFEE 129

Query: 121 IAVGPDFTNNDQNIILWMDHRAMKETEEINFSGNTCLKYVGGQMSVEMEIPKIKWLKNNL 180
           IAVGPDFTNNDQNIILWMDHRAMKETEEIN SG+ CLKYVGGQMSVEMEIPKIKWLKNNL
Sbjct: 130 IAVGPDFTNNDQNIILWMDHRAMKETEEINSSGDKCLKYVGGQMSVEMEIPKIKWLKNNL 189

Query: 181 ESGIFQDCKFFDLPDYLTFRATGKENRSFSSVVCKQGFLPEGVEGSNLGWSKQFLDSIGL 240
           E+GIFQDCKFFDLPDYLTF+ATGKENRSF S VCKQGFLP GVEGS++GWSK+FL+SIGL
Sbjct: 190 EAGIFQDCKFFDLPDYLTFKATGKENRSFCSAVCKQGFLPVGVEGSDIGWSKEFLNSIGL 249

Query: 241 SELTDNDFEKLGGSLRNQKNFLSAGECIGPLDGKAARQLGLTEYCVVSSGIIDAYAGWVG 300
           SELT NDFE+LGGSLR +KNFL+AGECI PLD KAA QLGLTE+CVVSSGIIDAYAGWVG
Sbjct: 250 SELTKNDFERLGGSLREKKNFLTAGECISPLDKKAACQLGLTEHCVVSSGIIDAYAGWVG 309

Query: 301 TVAAKPESEIKGLTENEDYKHDFNGAIGRLAAVAGTSTCHILLSKSSIFVHGIWGPYRDV 360
           TVAAKPES +KGL E E+YK DFNGAIGRLAAVAGTSTCHILLSK+ IFVHG+WGPYRDV
Sbjct: 310 TVAAKPESAVKGLAETENYKKDFNGAIGRLAAVAGTSTCHILLSKNPIFVHGVWGPYRDV 369

Query: 361 LARGFWAAEGGQSCTGVLLDHVITTHPAFSKLSQLADAANVSKFEYLNSVLENLVEKRKE 420
           LARGFWAAEGGQSCTGVLLDH+ITTHPAF++LS +A+ A VSKFEYLN +LE LVEKRK 
Sbjct: 370 LARGFWAAEGGQSCTGVLLDHLITTHPAFTELSHMANLAGVSKFEYLNKILETLVEKRKV 429

Query: 421 RSVIFLAKHLFFYGDYRGNRSPIADPNMRACIIGQSMDNSIDDLAVIYLGACEFISQQTR 480
           RSVI LAKHLFFYGDY GNRSPIADPNMRACIIGQSMDNSI+DLAV+YL ACEFISQQTR
Sbjct: 430 RSVISLAKHLFFYGDYHGNRSPIADPNMRACIIGQSMDNSIEDLAVMYLSACEFISQQTR 489

Query: 481 QIIEVMLKSGHAINAVFMSGGQCRNGLLMRLLADCTGLPIVIPRYIDGAVVFGSALLGAA 540
           QIIEVMLKSGH INA+FMSGGQCRN LLMRLLADCTGLPIVIPRY+D AVVFGSALLGAA
Sbjct: 490 QIIEVMLKSGHEINAIFMSGGQCRNSLLMRLLADCTGLPIVIPRYVDAAVVFGSALLGAA 549

Query: 541 ASKVFDLNKRRRVIXXXXXXLVQTEFLEGLYPSIQNLPLE--NHSTNVVASYKLACSNLN 598
           AS+ FD  + +R +        +TE     Y SIQ L +E  N +   V+ + L  S  +
Sbjct: 550 ASEDFDYTREKRTLKGQKSSQTKTERFNDSYSSIQKLSMEDRNSTNGFVSPHNLQLSTPS 609

Query: 599 APARTSSDLFPISKEQPADMISDKSSKGISLDKGRENLEEERDIDKNILWKVMQELTGNA 658
           APA+ ++   PI  +QP D  S++SSK  SL  G+E+L E R    + LWKVMQELTGNA
Sbjct: 610 APAKINNYSLPICTQQPLDKTSEESSKDASLTVGQESLGEGRYNGTSFLWKVMQELTGNA 669

Query: 659 KVICPNTKTHPDRILLDTKYQIFLDMVETQRNYRRMVDKVEETFSR 704
           +++ PN KTHPDRILLDTKYQIFLDM+ETQR YRRMVDKVE +FSR
Sbjct: 670 RIVNPNEKTHPDRILLDTKYQIFLDMIETQRKYRRMVDKVEGSFSR 715

>Skud_4.370 Chr4 complement(645143..647287) [2145 bp, 714 aa] {ON}
           YDR109C (REAL)
          Length = 714

 Score = 1073 bits (2775), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 523/706 (74%), Positives = 587/706 (83%), Gaps = 3/706 (0%)

Query: 1   MQDKIWQSTTFPSQRTSDSRISQHESETKFYVGVDVGTGSTRACIIDKSGNILSLAEKPI 60
           MQ K       PS++ S S I   + E KFYVGVDVGTGS RACIID+SGN+LSLAEKPI
Sbjct: 10  MQIKTCHLEVSPSKKISLSTIPLKDPEVKFYVGVDVGTGSARACIIDQSGNMLSLAEKPI 69

Query: 61  KREELLSNFITQSSREIWNAVCYCVRKVIQEAGVDPARIHGIGFDATCSLVVVSATDFKE 120
           KREEL  NFITQSSREIW+AVC+CV+ VIQE+ VDP R+HG+GFDATCSLVVVSATD K 
Sbjct: 70  KREELRPNFITQSSREIWDAVCHCVKAVIQESRVDPDRVHGMGFDATCSLVVVSATDAKG 129

Query: 121 IAVGPDFTNNDQNIILWMDHRAMKETEEINFSGNTCLKYVGGQMSVEMEIPKIKWLKNNL 180
           +AVGPDFT NDQNIILWMDHRAMKETEEIN S + CLKYVGGQMSVEMEIPKIKWLKNNL
Sbjct: 130 VAVGPDFTKNDQNIILWMDHRAMKETEEINSSEDKCLKYVGGQMSVEMEIPKIKWLKNNL 189

Query: 181 ESGIFQDCKFFDLPDYLTFRATGKENRSFSSVVCKQGFLPEGVEGSNLGWSKQFLDSIGL 240
            S +FQDCKFFDLPDYLTF+ATGKENRSFSS VCKQGFLP GVEGSNLGWS++FL++IGL
Sbjct: 190 RSELFQDCKFFDLPDYLTFKATGKENRSFSSAVCKQGFLPAGVEGSNLGWSEEFLNTIGL 249

Query: 241 SELTDNDFEKLGGSLRNQKNFLSAGECIGPLDGKAARQLGLTEYCVVSSGIIDAYAGWVG 300
           SEL ++DFEKLGGSLR++KNFLSAGECIG LD KAAR+LGLTE CVVSSG+IDAYAGWVG
Sbjct: 250 SELIESDFEKLGGSLRHKKNFLSAGECIGSLDWKAARELGLTENCVVSSGLIDAYAGWVG 309

Query: 301 TVAAKPESEIKGLTENEDYKHDFNGAIGRLAAVAGTSTCHILLSKSSIFVHGIWGPYRDV 360
           TVAAKPES I+GL ENED  +++NGAIGRLAAVAGTSTCHILLSK  IFVHGIWGPYRDV
Sbjct: 310 TVAAKPESPIRGLAENEDNTYNYNGAIGRLAAVAGTSTCHILLSKDPIFVHGIWGPYRDV 369

Query: 361 LARGFWAAEGGQSCTGVLLDHVITTHPAFSKLSQLADAANVSKFEYLNSVLENLVEKRKE 420
           LARGFWAAEGGQSCTGVLLDHVI  HPA+++LSQL +AA VSKFEYLNS+LE +V+KR E
Sbjct: 370 LARGFWAAEGGQSCTGVLLDHVIKIHPAYTELSQLTNAAGVSKFEYLNSMLETMVKKRNE 429

Query: 421 RSVIFLAKHLFFYGDYRGNRSPIADPNMRACIIGQSMDNSIDDLAVIYLGACEFISQQTR 480
           RSVI LA+HLFFYGDY GNRSPIAD NMRACIIGQSMDNS++DLA+ YL ACEFISQQTR
Sbjct: 430 RSVISLARHLFFYGDYHGNRSPIADSNMRACIIGQSMDNSVEDLAITYLSACEFISQQTR 489

Query: 481 QIIEVMLKSGHAINAVFMSGGQCRNGLLMRLLADCTGLPIVIPRYIDGAVVFGSALLGAA 540
           QI+EVMLKSGH I+A+FMSGGQCRN LL RLLADC+GLPIVIPRYIDGAVVFGSALLGAA
Sbjct: 490 QIVEVMLKSGHKIDAIFMSGGQCRNDLLTRLLADCSGLPIVIPRYIDGAVVFGSALLGAA 549

Query: 541 ASKVFDLNKRRRVIXXXXXXLVQTEFLEGLYPSIQNLPL--ENHSTNVVASYKLACSNLN 598
           AS+ FDL K RR +        Q EF    YPS QN  +  +N +++V  SY L  S  +
Sbjct: 550 ASEAFDLAKGRRTLTTKKSSSAQ-EFFINSYPSPQNSAMRHQNLASDVTCSYNLPNSISS 608

Query: 599 APARTSSDLFPISKEQPADMISDKSSKGISLDKGRENLEEERDIDKNILWKVMQELTGNA 658
           AP   +     ISK+   DM S++SSKG        +LEE+R     ILWKVMQELTG+A
Sbjct: 609 APDTMNRHSSTISKQSRGDMSSEESSKGTLNTVALRSLEEKRYRGTGILWKVMQELTGDA 668

Query: 659 KVICPNTKTHPDRILLDTKYQIFLDMVETQRNYRRMVDKVEETFSR 704
           K + PN  THPDRILLDTKYQIFLDM ETQ+ YR MVD +EE+FS+
Sbjct: 669 KAVNPNKATHPDRILLDTKYQIFLDMAETQKRYRHMVDNLEESFSK 714

>Suva_2.269 Chr2 complement(467973..470150) [2178 bp, 725 aa] {ON}
           YDR109C (REAL)
          Length = 725

 Score = 1016 bits (2627), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 496/697 (71%), Positives = 568/697 (81%), Gaps = 5/697 (0%)

Query: 8   STTFPSQRTSDSRISQHESETKFYVGVDVGTGSTRACIIDKSGNILSLAEKPIKREELLS 67
           S   PSQ     + S  +S+ KF+VGVDVGTGSTRACIID+ G ILSLAEKPIKREE+ S
Sbjct: 21  SGQLPSQNKLLPQTSLQDSQEKFHVGVDVGTGSTRACIIDQFGKILSLAEKPIKREEVRS 80

Query: 68  NFITQSSREIWNAVCYCVRKVIQEAGVDPARIHGIGFDATCSLVVVSATDFKEIAVGPDF 127
           NFITQSS+EIW+AVC+CV+ V+QE+ VDP ++HGIGFDATCSLVVVSATD K IAVGPDF
Sbjct: 81  NFITQSSKEIWDAVCHCVKAVLQESEVDPKKVHGIGFDATCSLVVVSATDLKGIAVGPDF 140

Query: 128 TNNDQNIILWMDHRAMKETEEINFSGNTCLKYVGGQMSVEMEIPKIKWLKNNLESGIFQD 187
           +NNDQNIILWMDHRAMKETEEIN +G+ CLKYVGGQMSVEM+IPKIKWLKNNLE+ IF+D
Sbjct: 141 SNNDQNIILWMDHRAMKETEEINSTGDKCLKYVGGQMSVEMDIPKIKWLKNNLEAEIFKD 200

Query: 188 CKFFDLPDYLTFRATGKENRSFSSVVCKQGFLPEGVEGSNLGWSKQFLDSIGLSELTDND 247
           CKFF+LPDYLTF+ATGKENRSF+S VCKQGFLP GVE S LGWS++FL+SIGLSELT ND
Sbjct: 201 CKFFNLPDYLTFKATGKENRSFASAVCKQGFLPAGVESSKLGWSEEFLNSIGLSELTTND 260

Query: 248 FEKLGGSLRNQKNFLSAGECIGPLDGKAARQLGLTEYCVVSSGIIDAYAGWVGTVAAKPE 307
           FE+LGGSLR++KNFLSAGEC+G LD  +A +LGLT++C+V SGIIDAYAGWVGTVAAKP 
Sbjct: 261 FERLGGSLRDKKNFLSAGECVGFLDVNSACELGLTQHCIVGSGIIDAYAGWVGTVAAKPS 320

Query: 308 SEIKGLTENEDYKHDFNGAIGRLAAVAGTSTCHILLSKSSIFVHGIWGPYRDVLARGFWA 367
           S I GL+ENE  K+D N AIGRLAAVAGTSTCHILLSK  IFVHG+WGPYRDVLAR FW 
Sbjct: 321 SAIPGLSENEHEKNDINSAIGRLAAVAGTSTCHILLSKDPIFVHGVWGPYRDVLARNFWT 380

Query: 368 AEGGQSCTGVLLDHVITTHPAFSKLSQLADAANVSKFEYLNSVLENLVEKRKERSVIFLA 427
           AEGGQSCTG LL HVI THPAF++LSQLADAA++S FEYLNS+LE LV+KR ERSV+ LA
Sbjct: 381 AEGGQSCTGALLAHVIKTHPAFTELSQLADAASISIFEYLNSMLETLVQKRNERSVVSLA 440

Query: 428 KHLFFYGDYRGNRSPIADPNMRACIIGQSMDNSIDDLAVIYLGACEFISQQTRQIIEVML 487
           KH FFYGDY GNRSPIADPNMRACIIGQSMDNS++DLAV YLGACEFISQQTRQIIE ML
Sbjct: 441 KHFFFYGDYHGNRSPIADPNMRACIIGQSMDNSVEDLAVTYLGACEFISQQTRQIIEAML 500

Query: 488 KSGHAINAVFMSGGQCRNGLLMRLLADCTGLPIVIPRYIDGAVVFGSALLGAAASKVFDL 547
           ++GH I+A+FMSGGQCRNGLLMRLLADCTGLPI+IPRYID AVVFGSALLGAAAS+  DL
Sbjct: 501 ENGHRIDAIFMSGGQCRNGLLMRLLADCTGLPIMIPRYIDAAVVFGSALLGAAASEASDL 560

Query: 548 NKRRRVIXXXXXXLVQTE-FLEGLYPSIQNLPLE--NHSTNVVASYKLACSNLNAPARTS 604
              + +       L Q E  +   Y  IQNL  E  N + +V           N PA  +
Sbjct: 561 ANEKTICQTRRSSLSQKEKVVNDPYKPIQNLSGEDQNLAFDVSPPNSTPSYIKNIPATLN 620

Query: 605 SDLFPISKEQPADMIS--DKSSKGISLDKGRENLEEERDIDKNILWKVMQELTGNAKVIC 662
           S + PI + Q   ++S  +++ K  S       L++ER    ++LWKVMQELTG AKV+ 
Sbjct: 621 SHISPIVERQLHVVVSARNRNDKDTSTSTVTRGLQKERCNSGDLLWKVMQELTGEAKVVN 680

Query: 663 PNTKTHPDRILLDTKYQIFLDMVETQRNYRRMVDKVE 699
           PN KTHPDRILLDTKYQIFLDM E QR YR MVD+VE
Sbjct: 681 PNDKTHPDRILLDTKYQIFLDMAENQRKYRNMVDRVE 717

>SAKL0H17160g Chr8 (1516854..1519073) [2220 bp, 739 aa] {ON} similar
           to uniprot|P53583 Saccharomyces cerevisiae YNL249C MPA43
           Mitochondrial protein of unknown function and similar to
           uniprot|Q04585 Saccharomyces cerevisiae YDR109C
           Hypothetical ORF
          Length = 739

 Score =  857 bits (2213), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 424/711 (59%), Positives = 522/711 (73%), Gaps = 31/711 (4%)

Query: 17  SDSRISQHESETKFYVGVDVGTGSTRACIIDKSGNILSLAEKPIKREELLSNFITQSSRE 76
           S S +S  +++  +YVGVDVGTGS RACIID  GNILSLAE+PI+R+EL  ++ITQSS+E
Sbjct: 21  SMSALSMEQNKMTYYVGVDVGTGSARACIIDNMGNILSLAERPIQRQELKPSYITQSSQE 80

Query: 77  IWNAVCYCVRKVIQEAGVDPARIHGIGFDATCSLVVVSATDFKEIAVGPDFTNNDQNIIL 136
           IW A+CYCV+ V++++GV P +IHGIGFDATCSLVVV     KE+AVGPDF N +QNIIL
Sbjct: 81  IWLAICYCVKSVVKDSGVLPEKIHGIGFDATCSLVVVEDDSDKEVAVGPDFFNTEQNIIL 140

Query: 137 WMDHRAMKETEEINFSGNTCLKYVGGQMSVEMEIPKIKWLKNNLESGIFQDCKFFDLPDY 196
           WMDHRA+ ET+EIN + + CLKYVGGQMSVEMEIPKIKWLKNNL    F+ CKFFDL DY
Sbjct: 141 WMDHRAIDETKEINATNDKCLKYVGGQMSVEMEIPKIKWLKNNLPREKFEKCKFFDLADY 200

Query: 197 LTFRATGKENRSFSSVVCKQGFLPEGVEGSNLGWSKQFLDSIGLSELTDNDFEKLGGSLR 256
           LTF+ATG E RS+ S VCKQG LP GVE S  GWSK+FL +IGL +L  +DF KLGGS++
Sbjct: 201 LTFKATGLETRSYCSTVCKQGLLPVGVESSKQGWSKEFLTNIGLEDLCQDDFRKLGGSIK 260

Query: 257 NQ----KNFLSAGECIGPLDGKAARQLGLTEYCVVSSGIIDAYAGWVGTVAAKPESEIKG 312
           +       FLSAGECIG LD  AA +LGL  +CVV SG+IDAYAGWVGTVAA+ + +I  
Sbjct: 261 SDGSGGSTFLSAGECIGSLDPSAAEELGLPAHCVVGSGVIDAYAGWVGTVAARTDVDIPE 320

Query: 313 LTENEDYKHDFNGAIGRLAAVAGTSTCHILLSKSSIFVHGIWGPYRDVLARGFWAAEGGQ 372
           L E ++ K   + A GRLAAVAGTSTCHI +SK  IFV G+WGPYRDV+A GFW AEGGQ
Sbjct: 321 LVEADNEKTGIDHATGRLAAVAGTSTCHIAMSKDPIFVDGVWGPYRDVMAPGFWCAEGGQ 380

Query: 373 SCTGVLLDHVITTHPAFSKLSQLADAANVSKFEYLNSVLENLVEKRKERSVIFLAKHLFF 432
           SCTG LL HV+T HPA+++LS L+DAA+VSKF+YLNS LE L ++R  RSV+ LAKHLFF
Sbjct: 381 SCTGALLAHVLTIHPAYTELSHLSDAASVSKFDYLNSRLEVLTQQRGARSVVALAKHLFF 440

Query: 433 YGDYRGNRSPIADPNMRACIIGQSMDNSIDDLAVIYLGACEFISQQTRQIIEVMLKSGHA 492
           YGDY GNRSPIADP+MRA +IGQSMDNSIDDLA++YLGACEFI+QQTRQI+E M  SGH 
Sbjct: 441 YGDYHGNRSPIADPSMRAAVIGQSMDNSIDDLAIMYLGACEFIAQQTRQIVEKMSVSGHR 500

Query: 493 INAVFMSGGQCRNGLLMRLLADCTGLPIVIPRYIDGAVVFGSALLGAAASKVFDLNKRRR 552
           I A+FMSGGQCRNGLLMRLLADCTGLPIVIPRYID AVVFGSALLGA AS+ F+LN +  
Sbjct: 501 IAAIFMSGGQCRNGLLMRLLADCTGLPIVIPRYIDAAVVFGSALLGAVASESFNLNHKSG 560

Query: 553 VIXXXXXXLVQTEFLEGLYPSIQNLPLENHSTNV--VASYKLACSNLNAPARTSSD---- 606
            +       +  ++ E  +     +P +N  + +   AS  L  S   AP+ T+S     
Sbjct: 561 SLSRRRKSSLSGKYEE--FKDSMEIPKKNFLSKLGGTASGDLP-SPYTAPSATASTSQIA 617

Query: 607 ------LFPISKEQPADMIS----DKSSKGISLDKGRENLEEERDIDK--------NILW 648
                  FP++ +    +I     ++++  +S    +   +E+  ++K        + LW
Sbjct: 618 STVGGFPFPVTSDDSVAIIEEDDPEEANAALSFGSKKATAQEQLALEKEKSASGKGDALW 677

Query: 649 KVMQELTGNAKVICPNTKTHPDRILLDTKYQIFLDMVETQRNYRRMVDKVE 699
            VM  +TG  KV+ P++  HPDR+LLD KY+IFLDM ETQR YR  VDKVE
Sbjct: 678 DVMYNMTGGGKVVQPSSDDHPDRVLLDAKYKIFLDMAETQRRYREAVDKVE 728

>Kwal_56.23607 s56 complement(618687..620864) [2178 bp, 725 aa] {ON}
           YDR109C - Hypothetical ORF [contig 176] FULL
          Length = 725

 Score =  852 bits (2202), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 416/701 (59%), Positives = 517/701 (73%), Gaps = 20/701 (2%)

Query: 21  ISQHESETKFYVGVDVGTGSTRACIIDKSGNILSLAEKPIKREELLSNFITQSSREIWNA 80
           +S  + +  +Y+GVDVGTGS RACIID  GNILSLAE+PI+RE+L  NFITQSS+EIW A
Sbjct: 25  LSLEQQKMLYYIGVDVGTGSARACIIDSMGNILSLAERPIQREQLKPNFITQSSQEIWQA 84

Query: 81  VCYCVRKVIQEAGVDPARIHGIGFDATCSLVVVSATDFKEIAVGPDFTNNDQNIILWMDH 140
           VC+CV+ V++++GV   +IHGIGFDATCSLVVV     KE+AVGPDF N +QNIILWMDH
Sbjct: 85  VCHCVKSVVRDSGVPSEKIHGIGFDATCSLVVVEEGSNKEVAVGPDFQNTNQNIILWMDH 144

Query: 141 RAMKETEEINFSGNTCLKYVGGQMSVEMEIPKIKWLKNNLESGIFQDCKFFDLPDYLTFR 200
           RA++ETE+IN +G+ CLKYVGGQMSVEMEIPKIKWLKN+L +  F +CKFFDL DYLTF+
Sbjct: 145 RAIEETEQINATGDKCLKYVGGQMSVEMEIPKIKWLKNHLPNNKFDECKFFDLADYLTFK 204

Query: 201 ATGKENRSFSSVVCKQGFLPEGVEGSNLGWSKQFLDSIGLSELTDNDFEKLGGSLRNQ-- 258
           A+GKE RSF S VCKQG LP GVEGS  GWS++FL  IGL +  ++DF K+GGS++N   
Sbjct: 205 ASGKETRSFCSTVCKQGLLPVGVEGSKEGWSREFLTEIGLEDFIEDDFRKIGGSVKNSDK 264

Query: 259 -KNFLSAGECIGPLDGKAARQLGLTEYCVVSSGIIDAYAGWVGTVAAKPESEIKGLTENE 317
            KNFLSAGE +G +D   A +LGL+ +CVV SG+IDAYAGWVGTVAA+ +  I  L + +
Sbjct: 265 GKNFLSAGEFVGAIDPAVAEELGLSNHCVVGSGVIDAYAGWVGTVAARTDVSIPALVKID 324

Query: 318 DYKHDFNGAIGRLAAVAGTSTCHILLSKSSIFVHGIWGPYRDVLARGFWAAEGGQSCTGV 377
             K   + A GRLAAVAGTSTCHI +S+  IFV G+WGPYRD LA  FW AEGGQSCTG 
Sbjct: 325 QEKVGMDRATGRLAAVAGTSTCHIAMSRDPIFVDGVWGPYRDALATNFWCAEGGQSCTGA 384

Query: 378 LLDHVITTHPAFSKLSQLADAANVSKFEYLNSVLENLVEKRKERSVIFLAKHLFFYGDYR 437
           LL HV+TTHPA+++LSQLADAA+VSKF+YLNS LE L +++K RSV+ LA+HLFFYGDY 
Sbjct: 385 LLAHVMTTHPAYTELSQLADAASVSKFDYLNSRLETLAQQQKSRSVVHLARHLFFYGDYH 444

Query: 438 GNRSPIADPNMRACIIGQSMDNSIDDLAVIYLGACEFISQQTRQIIEVMLKSGHAINAVF 497
           GNRSPIADP+MRA IIGQSMDNSIDDLA++YLGACEFI+QQTRQI+E M  SGH + A+F
Sbjct: 445 GNRSPIADPSMRAAIIGQSMDNSIDDLALMYLGACEFIAQQTRQIVEKMTTSGHDMAAIF 504

Query: 498 MSGGQCRNGLLMRLLADCTGLPIVIPRYIDGAVVFGSALLGAAASKVFDLNKRRRVIXXX 557
           MSGGQCRNGLLMRLLADCTGLPIVIPRYID AVVFGSALLGA AS+ FDL+     +   
Sbjct: 505 MSGGQCRNGLLMRLLADCTGLPIVIPRYIDAAVVFGSALLGAVASESFDLSGTTSELSVS 564

Query: 558 XXXLVQTEFLEGLYP-----------SIQNLPLENHSTNVVASYKLACSNLNAPARTSSD 606
               +     +G  P              +LP    + +  AS     S +  P  T  D
Sbjct: 565 RKSSIAGHPTDGSQPKKSAVSKLGQFGSDDLPSPYTAPSATASTSQIASTVGFPFPTPDD 624

Query: 607 LFPISKEQPADMISDKSSK--GISLDKGRENLEEE---RDIDK-NILWKVMQELTGNAKV 660
            + + ++   D  +D SS+    +  K ++++E+    R  D  + +W VM  +TG  KV
Sbjct: 625 PYALGEQTEPDADNDNSSELNFKAHSKWKKDMEDRMKGRSSDNGDAMWNVMYNMTGGGKV 684

Query: 661 ICPNTKTHPDRILLDTKYQIFLDMVETQRNYRRMVDKVEET 701
           + P  + +PDR LLD KY+IFLDM ETQR YR +V++VE++
Sbjct: 685 VQPCPEDNPDRKLLDVKYKIFLDMAETQRKYRNLVNEVEKS 725

>KLTH0G13794g Chr7 (1191104..1193281) [2178 bp, 725 aa] {ON} similar
           to uniprot|Q04585 Saccharomyces cerevisiae YDR109C
           Hypothetical ORF
          Length = 725

 Score =  848 bits (2192), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 416/696 (59%), Positives = 509/696 (73%), Gaps = 20/696 (2%)

Query: 21  ISQHESETKFYVGVDVGTGSTRACIIDKSGNILSLAEKPIKREELLSNFITQSSREIWNA 80
           +S  + +  +YVGVDVGTGS RACIID  GNILSLAE+PI+RE+L +NFITQSS+EIW A
Sbjct: 25  LSLEQQKMLYYVGVDVGTGSARACIIDSMGNILSLAERPIQREQLKANFITQSSQEIWQA 84

Query: 81  VCYCVRKVIQEAGVDPARIHGIGFDATCSLVVVSATDFKEIAVGPDFTNNDQNIILWMDH 140
           VC+CV+ V++++GV   +IHGIGFDATCSLVVV     KE+AVGPDF+N DQNIILWMDH
Sbjct: 85  VCHCVKSVVRDSGVPAEKIHGIGFDATCSLVVVEEQTNKEVAVGPDFSNTDQNIILWMDH 144

Query: 141 RAMKETEEINFSGNTCLKYVGGQMSVEMEIPKIKWLKNNLESGIFQDCKFFDLPDYLTFR 200
           RA++ET+ IN +G+ CLKYVGGQMSVEMEIPKIKWLKN+L    F +CKFFDL DYLTF+
Sbjct: 145 RAIEETQLINATGDKCLKYVGGQMSVEMEIPKIKWLKNHLPENKFNECKFFDLADYLTFK 204

Query: 201 ATGKENRSFSSVVCKQGFLPEGVEGSNLGWSKQFLDSIGLSELTDNDFEKLGGSLRNQ-- 258
           A+GKE RSF S VCKQG LP GVEGS  GWS++FL  IGL EL ++DF ++GGS++N   
Sbjct: 205 ASGKETRSFCSTVCKQGLLPVGVEGSAEGWSREFLTEIGLEELIEDDFRRIGGSVKNSDK 264

Query: 259 -KNFLSAGECIGPLDGKAARQLGLTEYCVVSSGIIDAYAGWVGTVAAKPESEIKGLTENE 317
            KNFLSAGE IG +D   A +LGL+ +CVV SG+IDAYAGWVGTVAA+ +  I  L + +
Sbjct: 265 GKNFLSAGEFIGAIDATVAEELGLSNHCVVGSGVIDAYAGWVGTVAARTDVSIPALVKTD 324

Query: 318 DYKHDFNGAIGRLAAVAGTSTCHILLSKSSIFVHGIWGPYRDVLARGFWAAEGGQSCTGV 377
             K   + A GRLAAVAGTSTCHI +S+  IFV G+WGPYRD LA  FW AEGGQSCTG 
Sbjct: 325 QEKVGMDRATGRLAAVAGTSTCHIAMSRDPIFVDGVWGPYRDALATNFWCAEGGQSCTGA 384

Query: 378 LLDHVITTHPAFSKLSQLADAANVSKFEYLNSVLENLVEKRKERSVIFLAKHLFFYGDYR 437
           LL HV+TTHPA+++LSQLADAA+VSKF+YLNS LE L +++K RSV+ LAKHLFFYGDY 
Sbjct: 385 LLAHVLTTHPAYTELSQLADAASVSKFDYLNSRLETLAQQQKARSVVHLAKHLFFYGDYH 444

Query: 438 GNRSPIADPNMRACIIGQSMDNSIDDLAVIYLGACEFISQQTRQIIEVMLKSGHAINAVF 497
           GNRSPIADP+MRA IIGQSMDNSIDDLA++YLGACEFI+QQTRQI++ M  SGH ++A+F
Sbjct: 445 GNRSPIADPSMRAAIIGQSMDNSIDDLALMYLGACEFIAQQTRQIVDKMCTSGHDLSAIF 504

Query: 498 MSGGQCRNGLLMRLLADCTGLPIVIPRYIDGAVVFGSALLGAAASKVFDLNKRRRVIXXX 557
           MSGGQCRNGLLMRLLADCTGLPIVIPRYID AVVFGSALLGA AS+ FDL+     +   
Sbjct: 505 MSGGQCRNGLLMRLLADCTGLPIVIPRYIDAAVVFGSALLGAVASESFDLSGTHSALSVS 564

Query: 558 XXXLVQTEFLEGLYPSIQ-----------NLPLENHSTNVVASYKLACSNLNAPARTSSD 606
               +  E      P              +LP    + +  AS     S +  P  T  D
Sbjct: 565 RKSSIAGEPANAGQPKKSAVSKFGQLGGDDLPSPYTAPSATASTSQIASTIGFPFPTPED 624

Query: 607 LFPISK--EQPADMISDKSSKGISLDKGRENLEEE---RDIDK-NILWKVMQELTGNAKV 660
            + I +  EQ  D          +  K ++++E+    R  D  + +W VM  +TG  KV
Sbjct: 625 AYAIDEHVEQEKDEGESTELNFKAHSKWKKDMEDRMKGRSSDNGDAMWNVMYNMTGGGKV 684

Query: 661 ICPNTKTHPDRILLDTKYQIFLDMVETQRNYRRMVD 696
           + P  + + DR+LL+ KY+IFLDM ETQR YR +VD
Sbjct: 685 VQPAAEENADRVLLNAKYKIFLDMAETQRKYRTIVD 720

>ZYRO0C01782g Chr3 (137232..139424) [2193 bp, 730 aa] {ON} similar
           to uniprot|Q04585 Saccharomyces cerevisiae YDR109C
           Hypothetical ORF
          Length = 730

 Score =  826 bits (2134), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 411/698 (58%), Positives = 504/698 (72%), Gaps = 27/698 (3%)

Query: 25  ESETKFYVGVDVGTGSTRACIIDKSGNILSLAEKPIKREELLSNFITQSSREIWNAVCYC 84
           E    +Y+GVDVGTGS RAC+ID  GNI+SLAEKPI+REEL   +ITQSS+EIW+A+CYC
Sbjct: 28  EQRMIYYIGVDVGTGSARACLIDSMGNIMSLAEKPIQREELKPTYITQSSKEIWSAICYC 87

Query: 85  VRKVIQEAGVDPARIHGIGFDATCSLVVVSATDFKEIAVGPDFTNNDQNIILWMDHRAMK 144
           V+ V++++GVD  RIHGIGFDATCSLV V++ D  ++ VGPDF N DQNIILWMDHRA++
Sbjct: 88  VKTVVRDSGVDIERIHGIGFDATCSLVAVNSKDGADVPVGPDFENPDQNIILWMDHRAVQ 147

Query: 145 ETEEINFSGNTCLKYVGGQMSVEMEIPKIKWLKNNLESGIFQDCKFFDLPDYLTFRATGK 204
           ET EIN + +  LKYVGGQMS+EMEIPKIKWLKN++    F D  FFDL D+LT++ATG 
Sbjct: 148 ETAEINSTNHPVLKYVGGQMSIEMEIPKIKWLKNHMPREKFNDTVFFDLADFLTYKATGL 207

Query: 205 ENRSFSSVVCKQGFLPEGVEGSNLGWSKQFLDSIGLSELTDNDFEKLGGSLR-----NQK 259
             RSF+S VCKQG LP GVEGSN GWS +FL+ I L EL  NDF KLGGS++     ++ 
Sbjct: 208 GTRSFNSSVCKQGLLPLGVEGSNNGWSGEFLNLIDLPELVANDFAKLGGSVKPKGDDHRS 267

Query: 260 NFLSAGECIGPLDGKAARQLGLTEYCVVSSGIIDAYAGWVGTVAAKPESEIKGLTENEDY 319
           NFLSAG+ +G L  +AA  LGL ++CVV SG+IDAYAGWVGTVAA+ + EI  L + E  
Sbjct: 268 NFLSAGQYVGALSPEAAADLGLADHCVVGSGVIDAYAGWVGTVAAQTDEEIPELAKCEKG 327

Query: 320 KHDFNGAIGRLAAVAGTSTCHILLSKSSIFVHGIWGPYRDVLARGFWAAEGGQSCTGVLL 379
           K   + A GRLAAVAGTSTCH+ LS+  IFV G+WGPYRDV+A GFW AEGGQSCTG LL
Sbjct: 328 KLGVDKATGRLAAVAGTSTCHVALSRDPIFVPGVWGPYRDVMAPGFWCAEGGQSCTGALL 387

Query: 380 DHVITTHPAFSKLSQLADAANVSKFEYLNSVLENLVEKRKERSVIFLAKHLFFYGDYRGN 439
            HV++THPA++ L  L+++A +SKF+YLNS LE LV  RKERSV+ LAKHLFFYGDY GN
Sbjct: 388 AHVLSTHPAYTDLEHLSESAGLSKFDYLNSRLEYLVNARKERSVVALAKHLFFYGDYHGN 447

Query: 440 RSPIADPNMRACIIGQSMDNSIDDLAVIYLGACEFISQQTRQIIEVMLKSGHAINAVFMS 499
           RSPIAD  MRA IIGQSMDNS+DDLA+ YLGACEFI+QQTRQI+E+M KSGH I+++FMS
Sbjct: 448 RSPIADNTMRAAIIGQSMDNSVDDLALQYLGACEFIAQQTRQIVEIMCKSGHNISSIFMS 507

Query: 500 GGQCRNGLLMRLLADCTGLPIVIPRYIDGAVVFGSALLGAAASKVF-------DLNKRR- 551
           GGQCRNGLLMRLLADCTGLPI+IPRYID AVVFGSALLGA AS+ +       DL KRR 
Sbjct: 508 GGQCRNGLLMRLLADCTGLPIIIPRYIDAAVVFGSALLGAVASESYNAHHTKTDLRKRRA 567

Query: 552 --------RVIXXXXXXLVQTEFLEGLYPSIQNLPLENHSTNVVASYKLACSNLNAPART 603
                    +       L +   L+   PS    P    S+++           +A A  
Sbjct: 568 SSLGSKDQAIAGLGKGGLSKLSELQTDQPSPYTAPHATSSSHMGGGSYFPIVGSDAAANL 627

Query: 604 SSDLFPISKEQPADMISDKSSKGISLDKGRENLEEERDIDKN--ILWKVMQELTGNAKVI 661
           S        E   + ++ KS K  +    +ENL E+ D + N   LWKVM ++TG  KV+
Sbjct: 628 SPGEAIAETEDEEEPVTFKSVKSTT----QENLAEKTDTNSNGEELWKVMYDMTGGGKVV 683

Query: 662 CPNTKTHPDRILLDTKYQIFLDMVETQRNYRRMVDKVE 699
            PN  T+PDR+LL+ KY+IFLDM  TQR YR  +D+VE
Sbjct: 684 RPNPDTNPDRVLLNAKYKIFLDMANTQRQYRSAIDRVE 721

>TDEL0F03840 Chr6 complement(705363..707543) [2181 bp, 726 aa] {ON}
           Anc_8.257 YDR109C
          Length = 726

 Score =  822 bits (2122), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 412/711 (57%), Positives = 505/711 (71%), Gaps = 44/711 (6%)

Query: 25  ESETKFYVGVDVGTGSTRACIIDKSGNILSLAEKPIKREELLSNFITQSSREIWNAVCYC 84
           E    +YVGVDVGTGS RACIID +GNILSLAEKPI+REEL  N+ITQSS+EIW ++C+C
Sbjct: 29  EQAMIYYVGVDVGTGSARACIIDNTGNILSLAEKPIQREELKPNYITQSSQEIWQSICHC 88

Query: 85  VRKVIQEAGVDPARIHGIGFDATCSLVVVSATDFKEIAVGPDFTNNDQNIILWMDHRAMK 144
           V+ V++++GV   RIHGIGFDATCSLVVV   D KE+ VGP F NNDQNI+LWMDHRA+ 
Sbjct: 89  VKSVVRDSGVPVERIHGIGFDATCSLVVVDDED-KEVGVGPVFANNDQNIVLWMDHRAIA 147

Query: 145 ETEEINFSGNTCLKYVGGQMSVEMEIPKIKWLKNNLESGIFQDCKFFDLPDYLTFRATGK 204
           ET EIN + + CLKYVGGQMSVEMEIPKIKWLKNNL    F  CKFFDL DYLTF+AT K
Sbjct: 148 ETNEINATNDKCLKYVGGQMSVEMEIPKIKWLKNNLPKEQFDKCKFFDLADYLTFKATNK 207

Query: 205 ENRSFSSVVCKQGFLPEGVEGSNLGWSKQFLDSIGLSELTDNDF------EKLGGSLRNQ 258
           + RSF S VCKQG +P GVEGS  GWSK FL++I L EL +N F           +    
Sbjct: 208 DTRSFCSTVCKQGLIPIGVEGSKEGWSKDFLNTINLPELVENVFCQDRWPATATAADGTT 267

Query: 259 KNFLSAGECIGPLDGKAARQLGLTEYCVVSSGIIDAYAGWVGTVAAKPESEIKGLTENED 318
            +FLSAGE +G LD +AA +LGL  +CVV SG+IDAYAGWVGTVAA+ + E+  L E + 
Sbjct: 268 HSFLSAGEYVGALDEEAAEELGLPVHCVVGSGVIDAYAGWVGTVAAQTDVELPDLAEADR 327

Query: 319 YKHDFNGAIGRLAAVAGTSTCHILLSKSSIFVHGIWGPYRDVLARGFWAAEGGQSCTGVL 378
            K   + A GRLAAVAGTSTCHI LS+  +FV+G+WGPYRDV+A GFWAAEGGQSCTG L
Sbjct: 328 TKKGIDRATGRLAAVAGTSTCHIALSRDPVFVNGVWGPYRDVMAHGFWAAEGGQSCTGAL 387

Query: 379 LDHVITTHPAFSKLSQLADAANVSKFEYLNSVLENLVEKRKERSVIFLAKHLFFYGDYRG 438
           L HV++THPAF++LS L+DAAN+SKF+YLNS LE LV++R +RSV+ LAKHL+FYGDY G
Sbjct: 388 LAHVMSTHPAFTELSHLSDAANISKFDYLNSRLETLVQQRGDRSVVALAKHLYFYGDYHG 447

Query: 439 NRSPIADPNMRACIIGQSMDNSIDDLAVIYLGACEFISQQTRQIIEVMLKSGHAINAVFM 498
           NRSPIADP+MRA IIGQSMDNSIDDLA++YLGACEFI+QQTRQI+E M  +GH I+ +FM
Sbjct: 448 NRSPIADPSMRAAIIGQSMDNSIDDLAIMYLGACEFIAQQTRQIVEKMCDAGHQISTIFM 507

Query: 499 SGGQCRNGLLMRLLADCTGLPIVIPRYIDGAVVFGSALLGAAASKVF-------DLNKRR 551
           SGGQCRNGLLMRLLADCTGLPI+IPRYID AVVFGSALLGA AS+ F       ++ +RR
Sbjct: 508 SGGQCRNGLLMRLLADCTGLPIIIPRYIDAAVVFGSALLGAVASESFNSHHAKSEITRRR 567

Query: 552 RV-----------IXXXXXXLVQTEFLEGLYPSIQNLPLENHSTNVVASYKLACSNLNAP 600
           +                   L Q   ++   PS    P    ST+ +A            
Sbjct: 568 KSSLTNLDPSSLPSASGKGPLSQLGKMKPDLPSPYTAPHATSSTSQIA------------ 615

Query: 601 ARTSSDLFPISKEQPADMI--SDKSSKGISLDKGRENLEE---ERDIDKN--ILWKVMQE 653
           A + S  FP+  E    +   ++ S   +S    R   +E    R+   N   LW VM +
Sbjct: 616 ATSGSFPFPVVGESSEAITEEANDSEGPVSFKPTRATSQEGLATRNPPNNGDALWDVMYQ 675

Query: 654 LTGNAKVICPNTKTHPDRILLDTKYQIFLDMVETQRNYRRMVDKVEETFSR 704
           +TG  KV+ P+ +  PDR+LL+ KY+IFLDM ++QR YR  +DKVE+  ++
Sbjct: 676 MTGGGKVVRPSPEDDPDRVLLNAKYKIFLDMADSQRRYREAIDKVEKAIAK 726

>KLLA0F19041g Chr6 complement(1753543..1755834) [2292 bp, 763 aa]
           {ON} similar to uniprot|Q04585 Saccharomyces cerevisiae
           YDR109C Hypothetical ORF
          Length = 763

 Score =  799 bits (2063), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 374/524 (71%), Positives = 439/524 (83%), Gaps = 2/524 (0%)

Query: 23  QHESETKFYVGVDVGTGSTRACIIDKSGNILSLAEKPIKREELLSNFITQSSREIWNAVC 82
           Q+E +  +YVGVDVGTGS RAC+ID  GNILSLAE+PI+R EL  N+ITQSS+EIWNA+C
Sbjct: 29  QNERKMVYYVGVDVGTGSARACVIDNLGNILSLAERPIQRHELKPNYITQSSQEIWNAIC 88

Query: 83  YCVRKVIQEAGVDPARIHGIGFDATCSLVVVSATDFKEIAVGPDFTNNDQNIILWMDHRA 142
           YCV+ V++++GVDP  IHGIGFDATCSLVVV   + +++ VGPDFT+N QNIILWMDHRA
Sbjct: 89  YCVKNVVRDSGVDPRTIHGIGFDATCSLVVVDNNN-EDVGVGPDFTDNLQNIILWMDHRA 147

Query: 143 MKETEEINFSGNTCLKYVGGQMSVEMEIPKIKWLKNNLESGIFQDCKFFDLPDYLTFRAT 202
           ++ETEEIN +G+ CLKYVGGQMSVEMEIPKIKWLKNN+    F  CKFFDL DYLTF+AT
Sbjct: 148 IEETEEINATGDKCLKYVGGQMSVEMEIPKIKWLKNNIPEKKFAQCKFFDLADYLTFKAT 207

Query: 203 GKENRSFSSVVCKQGFLPEGVEGSNLGWSKQFLDSIGLSELTDNDFEKLGGSLRNQKNFL 262
           G E RS+ S VCKQG LP GVEGS  GWSK+FL  IGL EL  +DF KLGGS+  +  FL
Sbjct: 208 GSEIRSYCSTVCKQGLLPLGVEGSKNGWSKEFLQEIGLEELIADDFAKLGGSV-TETTFL 266

Query: 263 SAGECIGPLDGKAARQLGLTEYCVVSSGIIDAYAGWVGTVAAKPESEIKGLTENEDYKHD 322
           SAGECIG L  ++A +LGL+ +CVV SG+IDAYAGWVGTVAA+ + EI  L ++++ KH 
Sbjct: 267 SAGECIGTLTEESAAELGLSTHCVVGSGVIDAYAGWVGTVAARTDVEIPALVKSDEVKHG 326

Query: 323 FNGAIGRLAAVAGTSTCHILLSKSSIFVHGIWGPYRDVLARGFWAAEGGQSCTGVLLDHV 382
            + A GRLAAVAGTSTCHI +SK  IFV G+WGPYRDV+A GFW AEGGQSCTG LL HV
Sbjct: 327 IDRATGRLAAVAGTSTCHIAMSKDPIFVKGVWGPYRDVMAPGFWLAEGGQSCTGALLAHV 386

Query: 383 ITTHPAFSKLSQLADAANVSKFEYLNSVLENLVEKRKERSVIFLAKHLFFYGDYRGNRSP 442
           +TTHPA+++LSQL+DAANVSKF+YLNS LE L ++RK  SV+ LAKHLFFYGDY GNRSP
Sbjct: 387 LTTHPAYAELSQLSDAANVSKFDYLNSRLELLAQQRKASSVVALAKHLFFYGDYHGNRSP 446

Query: 443 IADPNMRACIIGQSMDNSIDDLAVIYLGACEFISQQTRQIIEVMLKSGHAINAVFMSGGQ 502
           IADP+MRA IIGQSMDNSIDDL+++YLGACEFI+QQTRQI+E M  SGH + A+FMSGGQ
Sbjct: 447 IADPSMRAAIIGQSMDNSIDDLSIMYLGACEFIAQQTRQIVEQMCNSGHELAAIFMSGGQ 506

Query: 503 CRNGLLMRLLADCTGLPIVIPRYIDGAVVFGSALLGAAASKVFD 546
           CRNGLLMRLLADCTGLPIVIPRYID AVVFGSALLGA AS+ F+
Sbjct: 507 CRNGLLMRLLADCTGLPIVIPRYIDAAVVFGSALLGAVASESFN 550

 Score = 79.3 bits (194), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 35/83 (42%), Positives = 54/83 (65%)

Query: 617 DMISDKSSKGISLDKGRENLEEERDIDKNILWKVMQELTGNAKVICPNTKTHPDRILLDT 676
           D  ++KS +  +      N +  RD+ K+ LW+VM  +TG  KV+ P  +  PDR+LL+ 
Sbjct: 681 DAKTEKSKEAATSAANHNNAKVLRDVTKDKLWEVMYNMTGGGKVVWPTEEDAPDRLLLNA 740

Query: 677 KYQIFLDMVETQRNYRRMVDKVE 699
           KY+IFLDM  TQ+ YR++VD+V+
Sbjct: 741 KYKIFLDMAATQQKYRKLVDEVK 763

>NCAS0B03870 Chr2 (689411..691201) [1791 bp, 596 aa] {ON} Anc_8.257
          Length = 596

 Score =  681 bits (1758), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 316/521 (60%), Positives = 404/521 (77%), Gaps = 9/521 (1%)

Query: 25  ESETKFYVGVDVGTGSTRACIIDKSGNILSLAEKPIKREELLSNFITQSSREIWNAVCYC 84
           + +T +YVG+DVGTGS RAC++D  GN+LSL EK I REEL  NFITQS+REIW A C+C
Sbjct: 11  DEQTGYYVGIDVGTGSVRACVVDSCGNMLSLVEKSINREELKPNFITQSTREIWQACCFC 70

Query: 85  VRKVIQEAGVDPARIHGIGFDATCSLVVVSATDFKEIAVGPDFTNNDQNIILWMDHRAMK 144
           V+  I++  VD + + GIGFDATCSLV +     K++ VGP+F N D N+ILWMDHRA+K
Sbjct: 71  VKTAIEQCKVDKSLVLGIGFDATCSLVAIEKGTDKQVGVGPNFENRDMNVILWMDHRAVK 130

Query: 145 ETEEINFSGNTCLKYVGGQMSVEMEIPKIKWLKNNLESGIFQDCKFFDLPDYLTFRATGK 204
           E  EIN + + CLKYVGG MSVEM+IPKIKWLKNN++  +F+ C+FF+L DYLTF+ATGK
Sbjct: 131 EANEINATNDKCLKYVGGAMSVEMDIPKIKWLKNNMDPNMFKKCEFFELADYLTFKATGK 190

Query: 205 ENRSFSSVVCKQGFLPEGVEGSNLGWSKQFLDSIGLSELTDNDFEKLGGSLRN--QKNFL 262
             RSF SVVCKQGFLP GVEGS+ GWSK+FL SIGL +L  N ++ LGG+L+N  Q NF 
Sbjct: 191 RTRSFCSVVCKQGFLPNGVEGSSEGWSKEFLSSIGLEDLAGNSYDSLGGALKNDSQDNFQ 250

Query: 263 SAGECIGPLDGKAARQLGLTEYCVVSSGIIDAYAGWVGTVAAKPES--EIKGLTENEDYK 320
           S+G+C+GPL  +A  +LGL+E CVV +GIIDAYAG +GT+AA  E   +IK      D  
Sbjct: 251 SSGKCLGPLSNEAVIELGLSENCVVGAGIIDAYAGLIGTIAATSEGSHQIK-----NDSS 305

Query: 321 HDFNGAIGRLAAVAGTSTCHILLSKSSIFVHGIWGPYRDVLARGFWAAEGGQSCTGVLLD 380
                AIGRLA+VAGTSTCH+LLSK  +FV G+WGPYRDV+A G+W AEGGQ+CTG LL 
Sbjct: 306 IGLQNAIGRLASVAGTSTCHLLLSKDPVFVPGVWGPYRDVVADGYWCAEGGQTCTGELLS 365

Query: 381 HVITTHPAFSKLSQLADAANVSKFEYLNSVLENLVEKRKERSVIFLAKHLFFYGDYRGNR 440
           +V++ HPAF +L   +  A + KF+YLN++L+ L  K K  S + LAKH+FFYGDYRGNR
Sbjct: 366 YVLSIHPAFKELINASGVAKIDKFQYLNNMLDELTIKHKVNSKLQLAKHIFFYGDYRGNR 425

Query: 441 SPIADPNMRACIIGQSMDNSIDDLAVIYLGACEFISQQTRQIIEVMLKSGHAINAVFMSG 500
           SP ADP M A IIGQSM++++++LAV YL ACEFI+QQTRQI+E + K+G  ++ ++MSG
Sbjct: 426 SPYADPMMSAAIIGQSMNHNLENLAVTYLAACEFIAQQTRQIVETIRKAGTHVSYIYMSG 485

Query: 501 GQCRNGLLMRLLADCTGLPIVIPRYIDGAVVFGSALLGAAA 541
           GQCRN LLM+LL+DCTGLPI++P+Y+D AVVFG+A+LGA A
Sbjct: 486 GQCRNKLLMKLLSDCTGLPIMLPKYVDAAVVFGAAILGATA 526

 Score = 76.6 bits (187), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 36/74 (48%), Positives = 49/74 (66%), Gaps = 1/74 (1%)

Query: 626 GISLDKGRENLEEERDIDKNILWKVMQELTGNAKVICPNTKTHPDRILLDTKYQIFLDMV 685
           G + D  R+++E E D    +LW+ M  +T +  ++ PN   HPDR LLD KYQIFLDM 
Sbjct: 523 GATADASRKSVEIECDFGF-MLWETMDRMTPHGTLLEPNDVNHPDRKLLDVKYQIFLDMA 581

Query: 686 ETQRNYRRMVDKVE 699
           ETQR YR+MVD ++
Sbjct: 582 ETQRKYRQMVDDID 595

>Kpol_392.9 s392 (24389..26173) [1785 bp, 594 aa] {ON}
           (24389..26173) [1785 nt, 595 aa]
          Length = 594

 Score =  678 bits (1749), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 316/520 (60%), Positives = 400/520 (76%), Gaps = 4/520 (0%)

Query: 31  YVGVDVGTGSTRACIIDKSGNILSLAEKPIKREELLSNFITQSSREIWNAVCYCVRKVIQ 90
           Y+GVDVGTGS RAC+I+  G ILSL  K I +EEL  N+ITQSSREIW  +C CV  V+Q
Sbjct: 4   YIGVDVGTGSVRACVINDKGEILSLRSKDITKEELKPNYITQSSREIWQCICECVNYVLQ 63

Query: 91  EAGVDPARIHGIGFDATCSLVVVSATDFKEIAVGPDFTNNDQNIILWMDHRAMKETEEIN 150
           E+ + P+ + GIGFDATCSLVV+     +E+ VGP+F ++++NIILWMDHRA+KET+EIN
Sbjct: 64  ESQIIPSSVLGIGFDATCSLVVIDKETQQEVGVGPNFEDDNRNIILWMDHRAVKETDEIN 123

Query: 151 FSGNTCLKYVGGQMSVEMEIPKIKWLKNNLESGIFQDCKFFDLPDYLTFRATGKENRSFS 210
            +G+ CLKYVGG+MSVEME+PKIKWLKNNL  G+F +CKFFDL DYLT++AT K+ RSFS
Sbjct: 124 ATGDKCLKYVGGKMSVEMELPKIKWLKNNLADGVFSNCKFFDLVDYLTYKATDKDVRSFS 183

Query: 211 SVVCKQGFLPEGVEGSNLGWSKQFLDSIGLSELTDNDFEKLGGSLRNQK---NFLSAGEC 267
           S VCKQG LP GVEGS++GWSK+F   I L EL+ ++F  +GGS+ +++   N  S GE 
Sbjct: 184 STVCKQGLLPLGVEGSDIGWSKEFFTKIDLDELSSDNFSAIGGSIHSEQLENNIRSVGEY 243

Query: 268 IGPLDGKAARQLGLTEYCVVSSGIIDAYAGWVGTVAAKPESEIKGLTENEDYKHDFNGAI 327
           +G L   +A++LGL   C+V SGIIDAYAGWVGTVAAK E EI  +  ++D     + +I
Sbjct: 244 VGHLSEISAKELGLPTTCIVGSGIIDAYAGWVGTVAAKVE-EIGTINNDDDASSKLDSSI 302

Query: 328 GRLAAVAGTSTCHILLSKSSIFVHGIWGPYRDVLARGFWAAEGGQSCTGVLLDHVITTHP 387
           G LA +AGTSTCHI LS   IFV+GIWGPYRDVL+  FW AEGGQSCTG LL+H++TTHP
Sbjct: 303 GNLAVIAGTSTCHITLSSKPIFVNGIWGPYRDVLSHNFWCAEGGQSCTGALLEHILTTHP 362

Query: 388 AFSKLSQLADAANVSKFEYLNSVLENLVEKRKERSVIFLAKHLFFYGDYRGNRSPIADPN 447
           A+ +L +  +  +V  FE+LN+ L  L ++   RS+I L KH F YGDY GNRSPI+D +
Sbjct: 363 AYPELHEQCEKHSVGSFEFLNNRLAELQKENSARSIISLGKHFFLYGDYHGNRSPISDES 422

Query: 448 MRACIIGQSMDNSIDDLAVIYLGACEFISQQTRQIIEVMLKSGHAINAVFMSGGQCRNGL 507
           MRA IIGQSMD SID LA++YL ACEFISQQ+RQII  ++K+GH I  ++MSGGQ RN L
Sbjct: 423 MRAAIIGQSMDTSIDSLAIMYLSACEFISQQSRQIISELVKAGHTIKKIYMSGGQARNQL 482

Query: 508 LMRLLADCTGLPIVIPRYIDGAVVFGSALLGAAASKVFDL 547
           LMRLLADCTGLP+VIPRYID +V+FGSA+LGA A   +++
Sbjct: 483 LMRLLADCTGLPVVIPRYIDASVIFGSAILGAVAVDAYNI 522

 Score = 75.5 bits (184), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 32/58 (55%), Positives = 41/58 (70%)

Query: 647 LWKVMQELTGNAKVICPNTKTHPDRILLDTKYQIFLDMVETQRNYRRMVDKVEETFSR 704
           LW  M +LT    VI PN   HPDR+LL+ KY+IFLDM ETQR YRR +D++E +F+ 
Sbjct: 537 LWNKMCKLTPPGTVINPNAVNHPDRVLLNAKYKIFLDMAETQRKYRRQIDEIEASFNE 594

>NDAI0J01400 Chr10 (321913..323679) [1767 bp, 588 aa] {ON} Anc_8.257
          Length = 588

 Score =  675 bits (1742), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 323/604 (53%), Positives = 426/604 (70%), Gaps = 41/604 (6%)

Query: 25  ESETKFYVGVDVGTGSTRACIIDKSGNILSLAEKPIKREELLSNFITQSSREIWNAVCYC 84
           E +  +Y+GVDVGTGS RACIID  G I S AE  I R+EL ++ ITQSS+EIW AVC+C
Sbjct: 2   EKDIYYYIGVDVGTGSVRACIIDDLGTIKSQAELSIHRQELKTDCITQSSQEIWRAVCFC 61

Query: 85  VRKVIQEAGVDPARIHGIGFDATCSLVVVSATDFKEIAVGPDFTNNDQNIILWMDHRAMK 144
           V+KV+ E G    ++ GIGFDATCSLVVV     + +AVGPDF +++Q+IILWMDHRA+K
Sbjct: 62  VKKVVNELGCTRDQVKGIGFDATCSLVVVDKVTNRGVAVGPDFNDSNQDIILWMDHRALK 121

Query: 145 ETEEINFSGNTCLKYVGGQMSVEMEIPKIKWLKNNLESGIFQDCKFFDLPDYLTFRATGK 204
           ET+EIN + + CLKYVGGQMS+EME+PKIKWLK ++   +F  C+F+DL DYLTF+ATG+
Sbjct: 122 ETKEINSTNDECLKYVGGQMSIEMELPKIKWLKRHMSKDVFARCEFYDLADYLTFKATGR 181

Query: 205 ENRSFSSVVCKQGFLPEGVEGSNLGWSKQFLDSIGLSELTDNDFEKLGGSLRNQ--KNFL 262
           + RSF SVVCKQG +P GVEGS LGWSK FL +I L ELT ND+ KLGGS+     +NFL
Sbjct: 182 KTRSFCSVVCKQGMVPMGVEGSKLGWSKDFLRNIDLEELTYNDYAKLGGSVSGSHGRNFL 241

Query: 263 SAGECIGPLDGKAARQLGLTEYCVVSSGIIDAYAGWVGTVAAKPESEIKGLTENED-YKH 321
           +AGE I PL+ +A  +L L++ C+V SGIIDAYAGW+GTV +       G  + E  ++ 
Sbjct: 242 TAGEYIAPLNDQAIEELELSKECIVGSGIIDAYAGWLGTVGS-------GTVDLEQLFRV 294

Query: 322 DFNGAIGRLAAVAGTSTCHILLSKSSIFVHGIWGPYRDVLARGFWAAEGGQSCTGVLLDH 381
               AIGRLAAVAGTSTCHI+LSK  IFV G+WGPY+D + +G+W  EGGQSCTG LL H
Sbjct: 295 GMANAIGRLAAVAGTSTCHIVLSKDPIFVPGVWGPYKDTITKGYWCTEGGQSCTGALLQH 354

Query: 382 VITTHPAFSKLSQLADAANVSKFEYLNSVLENLVEKRKERSVIFLAKHLFFYGDYRGNRS 441
           V+ THP++ +L ++++   ++KF+YLN+ L  + ++  ERSV+ LAKH+FFYGD  GNRS
Sbjct: 355 VLQTHPSYKELEEISEKNGMNKFDYLNTRLAEMAKRSNERSVLCLAKHIFFYGDLHGNRS 414

Query: 442 PIADPNMRACIIGQSMDNSIDDLAVIYLGACEFISQQTRQIIEVMLKSGHAINAVFMSGG 501
           P+ADP+M+  I+G SMD S+D+LA  YL ACEFI+QQ RQIIE M  +GH I+A++MSGG
Sbjct: 415 PLADPSMKGAIVGLSMDTSLDNLAKTYLAACEFIAQQNRQIIEAMCDAGHEISAIYMSGG 474

Query: 502 QCRNGLLMRLLADCTGLPIVIPRYIDGAVVFGSALLGAAASKVFDLNKRRRVIXXXXXXL 561
           QCRN LLM+LLADC+GL ++IP YID AVVFG+A+LGA+ASK++ LN             
Sbjct: 475 QCRNSLLMKLLADCSGLSVIIPEYIDSAVVFGAAILGASASKLYQLNG------------ 522

Query: 562 VQTEFLEGLYPSIQNLPLENHSTNVVASYKLACSNLNAPARTSSDLFPISKEQPADMISD 621
                              + S  V+ +  +  S +N   +  S + P+ K+ P  ++ D
Sbjct: 523 -------------------SESDTVINTENILWSTMNKMTKVGSYIMPVPKDHPDRILLD 563

Query: 622 KSSK 625
              K
Sbjct: 564 AKYK 567

 Score = 71.2 bits (173), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 31/57 (54%), Positives = 39/57 (68%)

Query: 644 KNILWKVMQELTGNAKVICPNTKTHPDRILLDTKYQIFLDMVETQRNYRRMVDKVEE 700
           +NILW  M ++T     I P  K HPDRILLD KY+IFLDM + Q+ YR +VD VE+
Sbjct: 532 ENILWSTMNKMTKVGSYIMPVPKDHPDRILLDAKYKIFLDMADRQKRYRAIVDAVED 588

>KAFR0B05560 Chr2 (1138380..1140197) [1818 bp, 605 aa] {ON}
           Anc_8.257 YDR109C
          Length = 605

 Score =  662 bits (1709), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 309/516 (59%), Positives = 392/516 (75%), Gaps = 2/516 (0%)

Query: 31  YVGVDVGTGSTRACIIDKSGNILSLAEKPIKREELLSNFITQSSREIWNAVCYCVRKVIQ 90
           ++GVDVGTGS RAC+ID+ G+IL+L +KPI REEL   FITQSS EIW+++C+CVRKVI 
Sbjct: 21  FIGVDVGTGSVRACVIDRKGDILALVDKPISREELKPGFITQSSEEIWDSICFCVRKVIA 80

Query: 91  EAGVDPARIHGIGFDATCSLVVVSATDFKEIAVGPDFTNNDQNIILWMDHRAMKETEEIN 150
           +A +   ++ GIGFDATCSL VV     + +AVGP F+ NDQNII+WMDHRA +ET+EIN
Sbjct: 81  DAKIPANKVIGIGFDATCSLAVVDKDTLEGLAVGPQFSKNDQNIIMWMDHRASQETDEIN 140

Query: 151 FSGNTCLKYVGGQMSVEMEIPKIKWLKNNLESGIFQDCKFFDLPDYLTFRATGKENRSFS 210
              +  LKYVGG+MS+EME+PKIKWLKN++    F+   FFDLPDYLTF+ATG +NRS  
Sbjct: 141 SIYDAPLKYVGGKMSIEMEMPKIKWLKNHMPRETFRKAVFFDLPDYLTFKATGMQNRSLC 200

Query: 211 SVVCKQGFLPEGVEGSNLGWSKQFLDSIGLSELTDNDFEKLGGSLRNQKNFLSAGECIGP 270
           S VCKQG LP GVEGS  GWS+ FL + GL EL +N+FE++GG   N +NFLSAGE +  
Sbjct: 201 SAVCKQGLLPIGVEGSTEGWSRTFLSNTGLPELIENEFERIGGPGNNSRNFLSAGEYVST 260

Query: 271 LDGKAARQLGLTEYCVVSSGIIDAYAGWVGTVAAKPESEIKGLTENEDYKHDFNGAIGRL 330
           L   +  QLGLTE CVV SG+IDAYAG +GT+AA+ +   +  T+++    D   AIGRL
Sbjct: 261 LSKSSGEQLGLTESCVVGSGLIDAYAGLIGTIAARIDESAR--TQDDANGQDLQNAIGRL 318

Query: 331 AAVAGTSTCHILLSKSSIFVHGIWGPYRDVLARGFWAAEGGQSCTGVLLDHVITTHPAFS 390
           AAVAGTSTCHI LS   IFV+G+WGPY+D+LA+ +W AEGGQSCTG LL HVITTHPA+ 
Sbjct: 319 AAVAGTSTCHITLSDKPIFVNGVWGPYKDILAKDYWCAEGGQSCTGELLKHVITTHPAYE 378

Query: 391 KLSQLADAANVSKFEYLNSVLENLVEKRKERSVIFLAKHLFFYGDYRGNRSPIADPNMRA 450
           +L   A  + +  FE LN ++ +L E++   +++ L K LF YGDY GNRSPIADP MRA
Sbjct: 379 ELKIKAAKSKLDLFECLNEIIRDLAEQKGTCTILELTKGLFLYGDYHGNRSPIADPRMRA 438

Query: 451 CIIGQSMDNSIDDLAVIYLGACEFISQQTRQIIEVMLKSGHAINAVFMSGGQCRNGLLMR 510
            IIGQSMD +++ LA+IYL ACEFI+ QTR II  M ++GH+I +++MSGGQCRN +LM 
Sbjct: 439 SIIGQSMDTTVESLALIYLAACEFIAHQTRHIITKMNEAGHSIRSIYMSGGQCRNNILME 498

Query: 511 LLADCTGLPIVIPRYIDGAVVFGSALLGAAASKVFD 546
           LLAD TGLP+VIP+YID AVVFG+AL+GA A  VF+
Sbjct: 499 LLADFTGLPVVIPKYIDAAVVFGAALIGATAWDVFN 534

 Score = 59.3 bits (142), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 22/53 (41%), Positives = 35/53 (66%)

Query: 644 KNILWKVMQELTGNAKVICPNTKTHPDRILLDTKYQIFLDMVETQRNYRRMVD 696
           ++ LW  M ++TGN   I P    H  + LL+TKY+I++DM +TQ+ YR ++D
Sbjct: 547 EHTLWNAMVKMTGNGTTIAPKVNRHASQALLNTKYKIYMDMAKTQKKYRSLID 599

>Ecym_4313 Chr4 (672950..674743) [1794 bp, 597 aa] {ON} similar to
           Ashbya gossypii AGR092W
          Length = 597

 Score =  650 bits (1678), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 310/518 (59%), Positives = 390/518 (75%), Gaps = 9/518 (1%)

Query: 29  KFYVGVDVGTGSTRACIIDKSGNILSLAEKPIKREELLSNFITQSSREIWNAVCYCVRKV 88
           + Y+GVDVGT S RAC++D  G ILSLA KPI R+E+  N++TQSS EIW A+C+C+RK+
Sbjct: 3   QHYIGVDVGTESVRACVVDVHGTILSLASKPISRQEIQPNYLTQSSNEIWRAICFCIRKI 62

Query: 89  IQEAGVDPARIHGIGFDATCSLVVVSATDFKEIAVGPDFTNNDQNIILWMDHRAMKETEE 148
           I ++ V    I GIGFDATCSLVV+     K +AVGP+F + +Q+IILWMDHRA+ E  E
Sbjct: 63  ICDSQVVKDSIIGIGFDATCSLVVLEEVTNKGVAVGPNFDDFEQDIILWMDHRAIDEVNE 122

Query: 149 INFSGNTCLKYVGGQMSVEMEIPKIKWLKNNLESGIFQDCKFFDLPDYLTFRATGKENRS 208
           IN +G+ CLKYVGG+MS+EM+IPKIKWLKNNL  G F  C+F+DLPD+LT+RATG + RS
Sbjct: 123 INSTGHRCLKYVGGKMSIEMQIPKIKWLKNNLPQGKFDKCEFYDLPDFLTYRATGNKCRS 182

Query: 209 FSSVVCKQGFLPEGVEGSNLGWSKQFLDSIGLSELTDNDFEKLGGSLRNQ-KNFLSAGEC 267
           F S VCK G LP GV+GS  GW +   + IGL+EL   +F KLGG + +   NFLSAG+ 
Sbjct: 183 FCSTVCKMGLLPLGVDGSTKGWPQDLFEDIGLAELCRREFSKLGGVVSSTASNFLSAGDY 242

Query: 268 IGPLDGKAARQLGLTEYCVVSSGIIDAYAGWVGTVAAKPESEIKGLTENEDYKHDFNGAI 327
           +G L  +AA  LGLT  C+V+SG+IDAYAGWVGT+AA       G+T   D   +   A 
Sbjct: 243 VGHLSDEAAADLGLTTKCIVASGLIDAYAGWVGTIAA-------GITLGSD-GQESELAS 294

Query: 328 GRLAAVAGTSTCHILLSKSSIFVHGIWGPYRDVLARGFWAAEGGQSCTGVLLDHVITTHP 387
            RLA VAGTSTCHI +SK   F+ G+WGPYRD L  G+W  EGGQSCTG LL HV+ +HP
Sbjct: 295 SRLATVAGTSTCHITISKCPHFMDGVWGPYRDALMPGYWVTEGGQSCTGALLAHVLKSHP 354

Query: 388 AFSKLSQLADAANVSKFEYLNSVLENLVEKRKERSVIFLAKHLFFYGDYRGNRSPIADPN 447
           A+  L +LA    +SKF+++N+ LE L E+R  +SV  L KHLFFYGDY GNRSPIADPN
Sbjct: 355 AYDTLCKLAKNQGISKFDFINNRLEELKEERGAQSVAALGKHLFFYGDYHGNRSPIADPN 414

Query: 448 MRACIIGQSMDNSIDDLAVIYLGACEFISQQTRQIIEVMLKSGHAINAVFMSGGQCRNGL 507
           MRA IIGQSMD S+DDLA++ LGACEFI+QQTRQI+E + +SGH I +++MSGGQCRN +
Sbjct: 415 MRATIIGQSMDVSVDDLAIMTLGACEFIAQQTRQIVEHIKQSGHEITSIYMSGGQCRNLV 474

Query: 508 LMRLLADCTGLPIVIPRYIDGAVVFGSALLGAAASKVF 545
           L++LLA+CT LPIV+P+YID AVVFGSALLG AAS+ +
Sbjct: 475 LIKLLANCTKLPIVLPKYIDAAVVFGSALLGVAASEKY 512

 Score = 62.8 bits (151), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 49/82 (59%), Gaps = 2/82 (2%)

Query: 620 SDKSSKGISLDKGRENLEEERDIDKNILWKVMQELTGNAKVICPNTKTHPDRILLDTKYQ 679
           SD +S    +D+ R  +  E    ++ILW VM  LTG  ++I P+     +  LLD KY+
Sbjct: 517 SDTASVSTIVDQQR--ITSELKPKQSILWTVMANLTGIGQIIEPSNMLDSEIRLLDQKYE 574

Query: 680 IFLDMVETQRNYRRMVDKVEET 701
           IFLDM+ETQ+ YR +V + E +
Sbjct: 575 IFLDMIETQKRYRDLVTRAENS 596

>KNAG0H03260 Chr8 (607908..609650) [1743 bp, 580 aa] {ON} Anc_8.257
           YDR109C
          Length = 580

 Score =  643 bits (1659), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 304/523 (58%), Positives = 387/523 (73%), Gaps = 14/523 (2%)

Query: 27  ETKFYVGVDVGTGSTRACIIDKSGNILSLAEKPIKREELLSNFITQSSREIWNAVCYCVR 86
           E  +Y+GVDVGTGS RA ++   G  L+L E PIKR+EL  +FITQSS EIW+AVC+CVR
Sbjct: 3   EAGYYIGVDVGTGSARAVMLQHDGAALALEEHPIKRQELRVDFITQSSSEIWSAVCHCVR 62

Query: 87  KVIQEAGVDPARIHGIGFDATCSLVVVSATDFKEIAVGPDFTNNDQNIILWMDHRAMKET 146
            V+ ++GV+P  + GIGFDATCSLV V A     + VGP+F ++ QNIILWMDHRA +ET
Sbjct: 63  GVVTKSGVNPRLVKGIGFDATCSLVAVDAVTGDAVPVGPNFDDSTQNIILWMDHRATRET 122

Query: 147 EEINFSGNTCLKYVGGQMSVEMEIPKIKWLKNNLESGIFQDCKFFDLPDYLTFRATGKEN 206
           + IN +G+ CLKYVGGQMSVEME+PKIKWLK ++  G F  CKFFDLPDYLTF AT K+ 
Sbjct: 123 DAINATGDRCLKYVGGQMSVEMELPKIKWLKGHMPRGQFTKCKFFDLPDYLTFMATAKDR 182

Query: 207 RSFSSVVCKQGFLPEGVEGSNLGWSKQFLDSIGLSELTDNDFEKLGGSLRNQKNFLSAGE 266
           RSF S VCKQG LP GV+GS   WS +FL+++GLSEL D +F +LGG+  ++  FL+AG+
Sbjct: 183 RSFCSAVCKQGLLPPGVDGSEGHWSPEFLEAVGLSELIDTNFVQLGGTSESKPKFLTAGQ 242

Query: 267 CIGPLDGKAARQLGLTEYCVVSSGIIDAYAGWVGTVAAKPESEIKGLTENEDYKHDFNG- 325
            +G L  +A+ Q GL+  C+V+SG+IDAYAGW+G+V AK            D  H  +G 
Sbjct: 243 PVGQLTLEASEQFGLSTSCIVASGVIDAYAGWIGSVGAK-----------FDQSHKSSGL 291

Query: 326 --AIGRLAAVAGTSTCHILLSKSSIFVHGIWGPYRDVLARGFWAAEGGQSCTGVLLDHVI 383
             AI RLA +AGTSTCHI+LSK   FV G+WGPYRDVL  G+W AEGGQSCTG LL H++
Sbjct: 292 DVAITRLALIAGTSTCHIMLSKGPQFVPGVWGPYRDVLIPGYWCAEGGQSCTGALLAHIL 351

Query: 384 TTHPAFSKLSQLADAANVSKFEYLNSVLENLVEKRKERSVIFLAKHLFFYGDYRGNRSPI 443
            THPA  +L +LA    VS FEYL  +L+ L+ KR+ R+V+ L++  F YGD+ GNRSP+
Sbjct: 352 ETHPAHEELVRLAAKQQVSHFEYLGLMLDTLMMKRQVRNVLELSRSFFLYGDFHGNRSPL 411

Query: 444 ADPNMRACIIGQSMDNSIDDLAVIYLGACEFISQQTRQIIEVMLKSGHAINAVFMSGGQC 503
           ADP+MRA +IGQSMD SI+ LAV YL ACEFI+ QTRQI+E M+++GH +  V+MSGGQC
Sbjct: 412 ADPSMRATVIGQSMDVSIESLAVEYLAACEFIALQTRQIVETMVRNGHVVECVYMSGGQC 471

Query: 504 RNGLLMRLLADCTGLPIVIPRYIDGAVVFGSALLGAAASKVFD 546
           RN LLM+L+AD  G+P+V+P+Y D  VVFG+ALL   ASK  D
Sbjct: 472 RNSLLMQLIADSVGVPVVLPKYTDCCVVFGAALLACCASKGCD 514

 Score = 50.1 bits (118), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 38/68 (55%), Gaps = 3/68 (4%)

Query: 631 KGRENLEEERDIDKNILWKVMQELTGNAKVICPNTKTHPDRILLDTKYQIFLDMVETQRN 690
           KG + +E ++      LW +M  +T     + PN  +  +R  +D KY IFLDM+E Q+ 
Sbjct: 511 KGCDGIEADQSTR---LWDIMTAMTPMGTRVLPNDDSSFERKYMDAKYGIFLDMIERQKL 567

Query: 691 YRRMVDKV 698
           YR  +D+V
Sbjct: 568 YRSQMDQV 575

>TBLA0E04400 Chr5 complement(1119643..1121412) [1770 bp, 589 aa]
           {ON} Anc_8.257 YDR109C
          Length = 589

 Score =  639 bits (1649), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 299/524 (57%), Positives = 399/524 (76%), Gaps = 12/524 (2%)

Query: 30  FYVGVDVGTGSTRACIIDKSGNILSLAEKPIKREELLSNFITQSSREIWNAVCYCVRKVI 89
           +Y+GVDVGTGS RAC+ID +G+ILS+ E  I R+EL   +ITQS+ +IWN +C C+R ++
Sbjct: 3   YYIGVDVGTGSARACLIDLNGDILSIKELAIDRQELKPGYITQSTNQIWNNICICIRNIL 62

Query: 90  QEAGVD--PARIHGIGFDATCSLVVVSATDFKEIAVGPDFTNNDQNIILWMDHRAMKETE 147
           QE+ VD   ++I GIGFDATCSLVV+++   +E+AVGP+F +NDQN+ILWMDHRA+ ET 
Sbjct: 63  QESNVDDISSKIKGIGFDATCSLVVLNSKTDQEVAVGPNFEDNDQNVILWMDHRALIETV 122

Query: 148 EINFSGNTCLKYVGGQMSVEMEIPKIKWLKNNLESGIFQDCKFFDLPDYLTFRATGKENR 207
           EIN + + CLKYVGGQMSVEMEIPKIKWLKNN+   +++DCKF DLPD+LT++ATG   R
Sbjct: 123 EINSTDSKCLKYVGGQMSVEMEIPKIKWLKNNMNPAVYKDCKFLDLPDFLTYKATGNSIR 182

Query: 208 SFSSVVCKQGFLPEGVEGSNLGWSKQFLDSIGLSELTDNDFEKLGGSLRNQK----NFLS 263
           SF S VCKQG LP GVEGS  GW+++FL +IGL +L +++F KLGG ++       +F +
Sbjct: 183 SFCSAVCKQGLLPLGVEGSTKGWTEEFLLNIGLEDLMEDNFVKLGGPVKQDSQGKVSFST 242

Query: 264 AGECIGPLDGKAARQLGLTEYCVVSSGIIDAYAGWVGTVAAKPESEIKGLTENEDYKHDF 323
           AGE IG L  K+++ +G++  C VSSGIIDAYAGW+GT+AA  +  I+ L    +++ + 
Sbjct: 243 AGEFIGYLSDKSSKIMGISSKCAVSSGIIDAYAGWIGTIAASTKEPIEQLN---NFQDNL 299

Query: 324 NGAI---GRLAAVAGTSTCHILLSKSSIFVHGIWGPYRDVLARGFWAAEGGQSCTGVLLD 380
           NG I   GRLA VAGTSTCHI L+   IFV G+WGPYRDVL   FW AEGGQSCTG LL 
Sbjct: 300 NGMICSSGRLAVVAGTSTCHISLTNKPIFVPGVWGPYRDVLGHNFWCAEGGQSCTGALLQ 359

Query: 381 HVITTHPAFSKLSQLADAANVSKFEYLNSVLENLVEKRKERSVIFLAKHLFFYGDYRGNR 440
           HV+ THPA+ +L  ++   ++S FE LN+ +  L  +R     + L K+LFFYGD+ GNR
Sbjct: 360 HVLETHPAYKELCAISKQQDISVFEVLNNKIRELTHQRDLIDEVHLIKNLFFYGDFHGNR 419

Query: 441 SPIADPNMRACIIGQSMDNSIDDLAVIYLGACEFISQQTRQIIEVMLKSGHAINAVFMSG 500
           SP+AD  MR  IIG SMD+S++DL  +YLGACEFI+QQTR I+++M KSG+ +++++MSG
Sbjct: 420 SPVADEAMRGNIIGLSMDSSLNDLCRMYLGACEFIAQQTRHIVDIMTKSGYNLHSLYMSG 479

Query: 501 GQCRNGLLMRLLADCTGLPIVIPRYIDGAVVFGSALLGAAASKV 544
           GQCRN LLM+L+++C GLP+VIP+ ID AVVFGSAL+GA AS++
Sbjct: 480 GQCRNELLMQLISNCVGLPVVIPKNIDTAVVFGSALMGACASEL 523

 Score = 52.8 bits (125), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 32/51 (62%)

Query: 646 ILWKVMQELTGNAKVICPNTKTHPDRILLDTKYQIFLDMVETQRNYRRMVD 696
           ILW VM ++TG   V+ P   +     LL  KYQI+LDM+ TQ+ YR MV+
Sbjct: 537 ILWDVMCKMTGQGIVVSPQDPSSQVCKLLTVKYQIYLDMIATQKRYRSMVN 587

>CAGL0B01727g Chr2 complement(159373..161106) [1734 bp, 577 aa] {ON}
           similar to uniprot|Q04585 Saccharomyces cerevisiae
           YDR109c
          Length = 577

 Score =  622 bits (1603), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 295/512 (57%), Positives = 372/512 (72%), Gaps = 6/512 (1%)

Query: 30  FYVGVDVGTGSTRACIIDKSGNILSLAEKPIKREELLSNFITQSSREIWNAVCYCVRKVI 89
           +Y+GVDVG+GS RAC++D  G +LS+A + I +EE L   +TQSS EIW+AVCYCV+  I
Sbjct: 3   YYIGVDVGSGSVRACVVDDQGAMLSMATRDISKEEKLPGHVTQSSNEIWDAVCYCVKSAI 62

Query: 90  QEAGVDPARIHGIGFDATCSLVVVSATDFKEIAVGPDFTNNDQNIILWMDHRAMKETEEI 149
             + V+   I GIGFDATCSLVV++   F+ +A GP+F NN+QNII+WMDHRA++ET+EI
Sbjct: 63  GNSNVNNGDILGIGFDATCSLVVLNKDSFEPVAAGPNFDNNNQNIIMWMDHRAIEETKEI 122

Query: 150 NFSGNTCLKYVGGQMSVEMEIPKIKWLKNNLESGIFQDCKFFDLPDYLTFRATGKENRSF 209
           N SG+ CLKYVGGQMSVEMEIPKIKWLKN++    F+   F DLPDYLTF A+G   RS+
Sbjct: 123 NRSGDPCLKYVGGQMSVEMEIPKIKWLKNHMAPEEFKKLVFMDLPDYLTFMASGVNTRSY 182

Query: 210 SSVVCKQGFLPEGVEGSNLGWSKQFLDSIGLSELTDNDFEKLGGSLRNQKNFLSAGECIG 269
            S VCKQGFLP+GVEGS+ GWS +FL  IGL E++ ++F  LGG      NF  AG  + 
Sbjct: 183 CSAVCKQGFLPKGVEGSSKGWSTEFLTKIGLEEISQSNFNALGGP-NESGNFTYAGNQLS 241

Query: 270 PLDGKAARQLGLTEYCVVSSGIIDAYAGWVGTVAAKPESEIKGLTENEDYKHDFNGAIGR 329
            +     +   +   C+V SGIIDAYAGW+GTVA+   S I+    N     D     GR
Sbjct: 242 TVSESFIKSTNINPGCIVGSGIIDAYAGWIGTVAS---STIE--VPNNKEVVDIEECAGR 296

Query: 330 LAAVAGTSTCHILLSKSSIFVHGIWGPYRDVLARGFWAAEGGQSCTGVLLDHVITTHPAF 389
           LAAVAGTSTCHI+LSK+SIFV G+WGPYRDVL   +W AEGGQS TG LL H+++ HP+ 
Sbjct: 297 LAAVAGTSTCHIVLSKTSIFVPGVWGPYRDVLVPDYWCAEGGQSFTGALLAHILSIHPSA 356

Query: 390 SKLSQLADAANVSKFEYLNSVLENLVEKRKERSVIFLAKHLFFYGDYRGNRSPIADPNMR 449
           ++LS L    NV KF +LN+ +  L  K    + + L K  F YGDY GNRSPIADPNMR
Sbjct: 357 NELSNLVKQRNVDKFSFLNNYILELSRKNNLETPLLLTKDFFLYGDYHGNRSPIADPNMR 416

Query: 450 ACIIGQSMDNSIDDLAVIYLGACEFISQQTRQIIEVMLKSGHAINAVFMSGGQCRNGLLM 509
           A IIGQSMD S+DDLA  YL ACEFI+ QT+ II+ ++ +GH I A++MSGGQCRN +LM
Sbjct: 417 AAIIGQSMDTSMDDLARTYLAACEFIAHQTKHIIDTLMNAGHTIKAIYMSGGQCRNNILM 476

Query: 510 RLLADCTGLPIVIPRYIDGAVVFGSALLGAAA 541
           +L+A+CTGLP++IP+YID AVVFGSA+LGA A
Sbjct: 477 QLIANCTGLPLIIPKYIDSAVVFGSAILGAMA 508

 Score = 50.1 bits (118), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 35/52 (67%)

Query: 645 NILWKVMQELTGNAKVICPNTKTHPDRILLDTKYQIFLDMVETQRNYRRMVD 696
           ++LW  M  +T +   + P T+   +R L++ K++IFLDM +TQ+ YR++V+
Sbjct: 522 DLLWSTMSNMTPDGTTVFPATEDSIERKLINVKHKIFLDMAKTQQTYRQLVE 573

>TPHA0B03240 Chr2 (743153..744910) [1758 bp, 585 aa] {ON} Anc_8.257
           YDR109C
          Length = 585

 Score =  600 bits (1548), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 286/522 (54%), Positives = 377/522 (72%), Gaps = 3/522 (0%)

Query: 31  YVGVDVGTGSTRACIIDKSGNILSLAEKPIKREELLSNFITQSSREIWNAVCYCVRKVIQ 90
           Y+GVDVGTGS RACI +K+G IL++  K I ++EL   FITQSS EIW+A+   +++VI 
Sbjct: 4   YIGVDVGTGSARACITNKNGEILAVEVKDISKQELQLGFITQSSNEIWDAILDIIKRVID 63

Query: 91  EAGVDPARIHGIGFDATCSLVVVSATDFKEIAVGPDFTNNDQNIILWMDHRAMKETEEIN 150
            + VDP+ I GI FDATCSLVV      + IAVGP+F +++QNIILWMDHRA  ET+ IN
Sbjct: 64  ISNVDPSSIDGIAFDATCSLVVFDKNSLEPIAVGPNFDDSNQNIILWMDHRAASETDLIN 123

Query: 151 FSGNTCLKYVGGQMSVEMEIPKIKWLKNNLESGIFQDCKFFDLPDYLTFRATGKENRSFS 210
            + +  LKYVGG+MSVE E+PKIKWLK++L    F  C F DL D+LT++ATGK   SFS
Sbjct: 124 STNDKRLKYVGGKMSVEFELPKIKWLKDHLSPETFHRCVFLDLADFLTYKATGKIVHSFS 183

Query: 211 SVVCKQGFLPEGVEGSNLGWSKQFLDSIGLSELTDNDFEKLGGSLR-NQKNFLSAGECIG 269
           S VCKQG LP GVEGS LGWSK+FL+ IGL EL+ N+FEKLGGS+   + NFL  G+ +G
Sbjct: 184 SAVCKQGLLPTGVEGSKLGWSKEFLEKIGLEELSTNNFEKLGGSINLKEGNFLIPGDLVG 243

Query: 270 PLDGKAARQLGLTEYCVVSSGIIDAYAGWVGTVAAKPESEIKGLTENEDYKHDFNGAIGR 329
            +D K A    L  +CVV +G+IDAY+GWVGTVA+     +   +  E  K    G++GR
Sbjct: 244 HVDKKFAGLANLPNHCVVGTGVIDAYSGWVGTVASDVSDRVCSDSPQELNK--IEGSLGR 301

Query: 330 LAAVAGTSTCHILLSKSSIFVHGIWGPYRDVLARGFWAAEGGQSCTGVLLDHVITTHPAF 389
           +A V+GTSTCHI+LSK  +F+ G+WGPYRDVLA   WA EGGQS TG LLD++I THPA+
Sbjct: 302 IAVVSGTSTCHIVLSKQPLFISGVWGPYRDVLAENMWATEGGQSFTGALLDNIIETHPAY 361

Query: 390 SKLSQLADAANVSKFEYLNSVLENLVEKRKERSVIFLAKHLFFYGDYRGNRSPIADPNMR 449
            +L ++    N + F YL+  LE L   RK  SV +L K++F YGDY GNRSP+ADP M 
Sbjct: 362 QELERITSRQNKNIFVYLDEKLEELRVNRKLDSVFYLTKNMFIYGDYYGNRSPLADPLMS 421

Query: 450 ACIIGQSMDNSIDDLAVIYLGACEFISQQTRQIIEVMLKSGHAINAVFMSGGQCRNGLLM 509
             IIGQ+MD+SI+DLA+ YL ACEFI+ QTR II+ ++  GH I A++MSGG C+N LLM
Sbjct: 422 GMIIGQTMDSSINDLAIKYLAACEFIALQTRHIIDTLVTHGHGITAIYMSGGHCKNKLLM 481

Query: 510 RLLADCTGLPIVIPRYIDGAVVFGSALLGAAASKVFDLNKRR 551
            L+++C  LP+V+ +YID +VVFG+A+LG+ A+K+  + + +
Sbjct: 482 ELISNCCVLPLVLSKYIDSSVVFGAAILGSVAAKINSMKENK 523

 Score = 42.4 bits (98), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 18/58 (31%), Positives = 34/58 (58%), Gaps = 3/58 (5%)

Query: 645 NILWKVMQELTGNAKVICPNTKTHPDRILLDTKYQIFLDMVETQRNYRRMVDKVEETF 702
           ++LW  M+ +T    ++ P ++    R  L  KY+++LDM++T   YR+   K+EE +
Sbjct: 530 DVLWSQMKLMTPKGTLMMPKSEKSVLRKYLQAKYEVYLDMIDTNIKYRK---KMEEVY 584

>AGR092W Chr7 (908750..910540) [1791 bp, 596 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR109C and
           Non-syntenic homolog of Saccharomyces cerevisiae YNL249C
           (MPA43)
          Length = 596

 Score =  583 bits (1504), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 287/523 (54%), Positives = 365/523 (69%), Gaps = 13/523 (2%)

Query: 29  KFYVGVDVGTGSTRACIIDKSGNILSLAEKPIKREELLSNFITQSSREIWNAVCYCVRKV 88
           ++YVGVDVGT   RACIIDKSG IL+  + PI R +   + ITQSS EIW AVC  VR  
Sbjct: 8   QYYVGVDVGTEFARACIIDKSGAILATTQNPISRSQPKHDHITQSSSEIWGAVCKSVRAA 67

Query: 89  IQEAGVDPARIHGIGFDATCSLVVVSATDFKEIAVGPDFTNNDQNIILWMDHRAMKETEE 148
           + E+ V    + GI FDATCSLVV+      E+AVGPDF++N QN+ILWMDHRA+ E  E
Sbjct: 68  VAESQVAVDEVAGINFDATCSLVVLDEDSDGEVAVGPDFSDNRQNVILWMDHRAVAEASE 127

Query: 149 INFSGNTCLKYVGGQMSVEMEIPKIKWLKNNLESGIFQDCKFFDLPDYLTFRATGKENRS 208
           IN +G++ L+YVGG+MSVEM++PKIKWL+ ++  G F  CKF+DLPD+LT++ATG E+RS
Sbjct: 128 INSTGHSVLRYVGGKMSVEMQMPKIKWLQRHMPRGEFAKCKFYDLPDFLTYQATGIESRS 187

Query: 209 FSSVVCKQGFLPEGVEGSNLGWSKQFLDSIGLSELTDNDFEKLGGSLRNQ-KNFLSAGEC 267
           F S VCK G +P GV+ S  GWS++FL+ IGL EL ++ F +LGG+L      F SAGE 
Sbjct: 188 FCSTVCKMGLVPNGVDSSTSGWSREFLEQIGLEELCEDGFRRLGGALDEPGSEFRSAGEP 247

Query: 268 IGPLDGKAARQLGLTEYCVVSSGIIDAYAGWVGTVAAKPES--EIKGLTENEDYKHDFNG 325
           +G L   AA  LGLT  CVV SG+IDAYAGWVGTV A P+   E  G+ E          
Sbjct: 248 VGLLSEAAAASLGLTPRCVVGSGVIDAYAGWVGTVGASPDGARESGGVEE---------- 297

Query: 326 AIGRLAAVAGTSTCHILLSKSSIFVHGIWGPYRDVLARGFWAAEGGQSCTGVLLDHVITT 385
             GRLAAVAGTSTC I+LS++  FV G+WGPYRDVLARG+W  EGGQSCTG LL H + T
Sbjct: 298 LAGRLAAVAGTSTCLIMLSQTPHFVEGVWGPYRDVLARGYWCTEGGQSCTGALLAHTLHT 357

Query: 386 HPAFSKLSQLADAANVSKFEYLNSVLENLVEKRKERSVIFLAKHLFFYGDYRGNRSPIAD 445
           HPA+++L Q A    ++ F+Y+N  L+ L  +   RS+  LAKH F YGDY GNRSP+AD
Sbjct: 358 HPAYTELHQAAQQRGLTDFDYINWRLDKLRAETGARSIRALAKHRFLYGDYHGNRSPLAD 417

Query: 446 PNMRACIIGQSMDNSIDDLAVIYLGACEFISQQTRQIIEVMLKSGHAINAVFMSGGQCRN 505
           P+MRA ++G SMD S DDLA+  L A EFI+ Q R I++ M  +G  ++ V++SGGQ RN
Sbjct: 418 PSMRAAMVGLSMDVSQDDLALAVLTAFEFIALQARHILDHMAAAGLHVDTVYLSGGQARN 477

Query: 506 GLLMRLLADCTGLPIVIPRYIDGAVVFGSALLGAAASKVFDLN 548
            LL +LLAD    P+V PR++  AVVFGSALL AAA + +  N
Sbjct: 478 PLLTQLLADAVRRPVVTPRHVGAAVVFGSALLAAAAVENYLAN 520

 Score = 60.5 bits (145), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 25/55 (45%), Positives = 36/55 (65%)

Query: 647 LWKVMQELTGNAKVICPNTKTHPDRILLDTKYQIFLDMVETQRNYRRMVDKVEET 701
           LW++M  LT    V+ P+    PD  LL+ KY++FL+M E Q+ YR++VD VE T
Sbjct: 541 LWQIMSRLTVPGNVVSPSPDADPDIRLLEAKYKVFLEMAEAQKLYRKLVDDVENT 595

>Suva_14.93 Chr14 complement(174204..175835) [1632 bp, 543 aa] {ON}
           YNL249C (REAL)
          Length = 543

 Score =  197 bits (501), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 154/545 (28%), Positives = 245/545 (44%), Gaps = 95/545 (17%)

Query: 32  VGVDVGTGSTRACIIDKSGNIL-SLAEKPIKREELLSNFITQSSREIW------NAVCYC 84
           +G+D+G+ S R  I D   ++L ++A++P+        +   SS++ W        +   
Sbjct: 9   IGIDIGSSSARVGIYDYYNDVLLAMAQEPVP-------YYHDSSKKSWKFWQKSTEIIKA 61

Query: 85  VRKVIQEAGVDPARIHGIGFDATCSLVVVSATDFKEIAVGPDFTN-------NDQNIILW 137
           ++   QE  +    +   G  ATCSL +             D TN       N+ N+I W
Sbjct: 62  LQNCFQELKITQYNVRSCGVSATCSLAIFQK----------DLTNGNLIPYPNEDNVIFW 111

Query: 138 MDHRAMKETEEINFS-GNTCLKYVGGQMSVEMEIPKIKWLKNNLESGIFQDCKFFDLPDY 196
           MD  A+ E E +N       L Y+GG+   EM IPK+K+  N       +    FDL  Y
Sbjct: 112 MDSSAVDECEWLNEKCSQQLLDYLGGKFIPEMGIPKLKYFLNEHSHNQEKQFHIFDLHQY 171

Query: 197 LTFRATGKENRSFSSVVCKQGFLPEGVEGSNLGWSKQFLDSIGLSELTDNDFEKLGGSLR 256
           + +        +   +  ++     G +G   GWS  F           ND  KL  ++ 
Sbjct: 172 IAYELGRLYRWNTDELSARENINGIGNDGEASGWSSSFY----------NDIMKLPSNV- 220

Query: 257 NQKNFLSAGECIGPLDGKAARQLGLTEYCVVSSGIIDAYAGWVGTVAAKPESEIKGLTEN 316
                      IG     +      T  C      ID+YA W    +   E+        
Sbjct: 221 ----------TIGLTGLNSNNSSSTTTVC----SCIDSYASWFAVSSPNLEAS------- 259

Query: 317 EDYKHDFNGAIGRLAAVAGTSTCHILLSK-SSIFVHGIWGPYRDVLARG--FWAAEGGQS 373
                        L  +AGTSTC++  S  ++  + G+WGP+  +L     +     GQS
Sbjct: 260 -------------LFMIAGTSTCYMYGSPVTTTKIPGVWGPFDTILETNGNYSVYTAGQS 306

Query: 374 CTGVLLDHVITTHPAFSKLSQLADAANVSKFEYLNSVLENLVEKRKERSVIFLAKHLFFY 433
           CTG L++H+  +HPA  K+ +  +      +E L + +++ +EK+  +S+  LAKH+FFY
Sbjct: 307 CTGKLIEHLFKSHPAARKIQRSGEDI----YEVLENSIQD-IEKKNRKSIHILAKHMFFY 361

Query: 434 GDYRGNRSPIADPNMRACIIGQSMDNSIDDLAVIYLGACEFISQQTRQIIEVM--LKSGH 491
           GDY GNR+P AD  MR   IG+S D SI +L   Y+   EF+S QT+ II+      SG 
Sbjct: 362 GDYEGNRTPFADSQMRGSFIGESTDTSILNLTYKYVSMLEFLSFQTKLIIDTFQGQNSGA 421

Query: 492 AINAVFMSGGQCRNGLLMRLLADCT-GLPIVIP-RYIDGAVVFGSALLGAAASKVFDLNK 549
            I  + +SG Q +NG L+ L++    G+ I  P   ID   V G+ +LG +A      N+
Sbjct: 422 RIEELRVSGSQAKNGRLLSLISLVNDGIKIKRPNENIDLMGVMGAYMLGKSA------NE 475

Query: 550 RRRVI 554
           ++++I
Sbjct: 476 KKQII 480

 Score = 32.7 bits (73), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 13/26 (50%), Positives = 18/26 (69%)

Query: 673 LLDTKYQIFLDMVETQRNYRRMVDKV 698
           LL  KY+I LDM + Q+ Y R+VD+ 
Sbjct: 513 LLSVKYRIHLDMAKQQQQYHRLVDEA 538

>Skud_14.89 Chr14 complement(168159..169868) [1710 bp, 569 aa] {ON}
           YNL249C (REAL)
          Length = 569

 Score =  193 bits (491), Expect = 6e-53,   Method: Compositional matrix adjust.
 Identities = 152/564 (26%), Positives = 259/564 (45%), Gaps = 82/564 (14%)

Query: 10  TFPSQRTSDS----RISQHESETKFYVGVDVGTGSTRACIIDKSGN-ILSLAEKPIKREE 64
           TFP +RT +      I   +   +  +G+DVG+ S R  I +   + +L +A++P+    
Sbjct: 8   TFPRKRTHNETSMLEIKMTKDSARIGIGIDVGSSSARVGIYNYENDALLGMAQEPVP--- 64

Query: 65  LLSNFITQSSREIW------NAVCYCVRKVIQEAGVDPARIHGIGFDATCSLVVVSATDF 118
               +   SSR  W        +   ++K +Q+  +    +   G  ATCSL +    D 
Sbjct: 65  ----YYQDSSRTSWKFWQRSTEIIKALQKCLQKLKITEYNVKSCGVSATCSLAIFEK-DK 119

Query: 119 KEIAVGPDFTNNDQNIILWMDHRAMKETEEINFS-GNTCLKYVGGQMSVEMEIPKIKWLK 177
           +  ++ P    N+ N+I WMD  A+ E +++N       L ++GG    EM IPK+K+  
Sbjct: 120 RNGSLIP--YPNEDNVIFWMDSSAIDECKQLNAECSQQLLDFLGGSFVPEMGIPKLKYFL 177

Query: 178 NNLESGIFQDCKFFDLPDYLTFRATGKENRSFSSVVCKQGFLPEGVEGSNLGWSKQFLDS 237
           N       +    FDL  Y+ +  +     +   ++ ++     GV+G   GWS  F ++
Sbjct: 178 NEYSHNQDKQFHIFDLHQYIAYELSHLYQWNNEVLLKRENNKMVGVDGEASGWSPSFYEN 237

Query: 238 IGLSELTDNDFEKLGGSLRNQKNFLSAGECIGPLDGKAARQLGLTEYCVVSSGIIDAYAG 297
           I                       L +   IG  +G   +++  +    +    ID+YA 
Sbjct: 238 IM---------------------HLPSNVIIGS-NGATCKKIASS---AIVRSCIDSYAS 272

Query: 298 WVGTVAAKPESEIKGLTENEDYKHDFNGAIGRLAAVAGTSTCHILLSK-SSIFVHGIWGP 356
           W    +   E+                     L  +AGTSTC++  +  + I + G+WGP
Sbjct: 273 WFAVSSPHLETS--------------------LFMIAGTSTCYMYGTPITDIKIPGVWGP 312

Query: 357 YRDVLARG--FWAAEGGQSCTGVLLDHVITTHPAFSKLSQLADAANVSKFEYLNSVLENL 414
           +  +L     F     GQSCTG L++H+  THP   ++  L   A++  ++ L   + + 
Sbjct: 313 FDSILDSNSHFSVYAAGQSCTGKLIEHLFVTHPCAKEI--LKRGADI--YQVLERTIHD- 367

Query: 415 VEKRKERSVIFLAKHLFFYGDYRGNRSPIADPNMRACIIGQSMDNSIDDLAVIYLGACEF 474
           +EK+  +SV    K +FFYGDY GNR+P ADP M+   IG++ D SI +L   Y+   EF
Sbjct: 368 IEKQNGQSVHVFTKDIFFYGDYEGNRTPFADPRMKGSFIGETTDTSILNLIHKYICILEF 427

Query: 475 ISQQTRQIIEVMLKS--GHAINAVFMSGGQCRNGLLMRLLADC-TGLPIVIPR-YIDGAV 530
           +S QTR II+   +   G  I  + +SG Q +N  L+ L++    G+ I  P+  +D   
Sbjct: 428 LSFQTRLIIDTFKRQNIGMCIQELRISGSQAKNKRLLSLISLVNNGITINKPKDNVDLMG 487

Query: 531 VFGSALLGAAAS---KVFDLNKRR 551
           V G+ LL  +A+   ++ D+ + R
Sbjct: 488 VRGAYLLAKSANEGKQIIDVIRER 511

>Smik_14.86 Chr14 complement(158487..160118) [1632 bp, 543 aa] {ON}
           YNL249C (REAL)
          Length = 543

 Score =  184 bits (466), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 155/543 (28%), Positives = 250/543 (46%), Gaps = 84/543 (15%)

Query: 32  VGVDVGTGSTRACIIDKSGN-ILSLAEKPIKREELLSNFITQSSREIWNA---VCYCVRK 87
           +G+D+G+ S R  I     + +L +A++P+   +      T+ S + W     +   ++K
Sbjct: 9   IGIDLGSSSARVGIYSYYNDALLGMAQEPVPYYQDF----TKKSWKFWQKSTEIIEALQK 64

Query: 88  VIQEAGVDPARIHGIGFDATCSLVVVSATDFKEIAVGPDFTNNDQNIILWMDHRAMKETE 147
             Q+  +    +   G  ATCSL +       E A+ P    N+ N+I WMD  A  E E
Sbjct: 65  CFQKLKITEYNVKSCGVSATCSLAIFERVHTSE-ALIP--YPNENNVIFWMDSSATDECE 121

Query: 148 EINFS-GNTCLKYVGGQMSVEMEIPKIKWLKNNLESGIFQDCKF--FDLPDYLTFRATGK 204
            +N       L Y+GG+   EM IPK+K+  N  E    QD +F  FDL  Y+ +     
Sbjct: 122 WLNAECSKQLLDYLGGRFVPEMGIPKLKYFLN--EYSHRQDKRFHIFDLHQYIAYELGRL 179

Query: 205 ENRSFSSVVCKQGFLPEGVEGSNLGWSKQFLDSIGLSELTDNDFEKLGGSLRNQKNFLSA 264
              +   ++  +     G +G   GWS  F                     +N  N + +
Sbjct: 180 YQWNIDGLLRGENINGIGNDGEASGWSSSFY--------------------KNIMN-IPS 218

Query: 265 GECIGPLDGKAARQLGLTEYCVVSSGI----IDAYAGWVGTVAAKPESEIKGLTENEDYK 320
              IGP+        GL    V+S+ +    ID+YA W        E             
Sbjct: 219 NVIIGPV--------GLVSKKVISTTVVRSCIDSYASWFAVSPPFLERS----------- 259

Query: 321 HDFNGAIGRLAAVAGTSTCHILLSK-SSIFVHGIWGPYRDVL--ARGFWAAEGGQSCTGV 377
                    L  +AGTS+C++  +  S+  + G+WGP+ ++L     F     GQSCTG 
Sbjct: 260 ---------LFMIAGTSSCYMYGTPVSNTKIPGVWGPFNNILDDKGDFSVYAAGQSCTGK 310

Query: 378 LLDHVITTHPAFSKLSQLADAANVSKFEYLNSVLENLVEKRKERSVIFLAKHLFFYGDYR 437
           L++H+  +HP   K+  L   A++  ++ L   +   +EK+K  S+  LAK +FFYGDY 
Sbjct: 311 LIEHLFESHPCARKI--LKSGADI--YQVLEQTIHG-IEKKKGLSIHILAKDMFFYGDYE 365

Query: 438 GNRSPIADPNMRACIIGQSMDNSIDDLAVIYLGACEFISQQTRQIIEVM--LKSGHAINA 495
           GNR+P ADP M+   IG++ D SI +L   Y+   EF+S QT+ II+     K+   I  
Sbjct: 366 GNRTPFADPRMKGSFIGETTDTSILNLTYKYISILEFLSFQTKLIIDTFQSQKACIRIQE 425

Query: 496 VFMSGGQCRNGLLMRLLADC-TGLPIVIPR-YIDGAVVFGSALLGAAAS---KVFDLNKR 550
           + +SG Q RN  L+ L++    G+ I  PR  +D   + G+ +L  +A+   ++ D+ + 
Sbjct: 426 LRISGSQARNERLLSLISLVNNGMSINRPRDNVDMMGIKGAYILAKSANEKKQLVDVIRE 485

Query: 551 RRV 553
           R V
Sbjct: 486 RDV 488

 Score = 33.9 bits (76), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 24/67 (35%), Positives = 35/67 (52%), Gaps = 10/67 (14%)

Query: 639 ERDI-DKNILWKVMQELT-GNAKVICPNTKTHPDRILLDTKYQIFLDMVETQRNYRRMVD 696
           ERD+ D N  ++ + E   GN   +  N        LL  KY+I LDM + Q+ Y ++VD
Sbjct: 485 ERDVGDDNEKFQPLSEYCLGNDSTLLKN--------LLCVKYRIHLDMAKQQKYYYKLVD 536

Query: 697 KVEETFS 703
           +V   FS
Sbjct: 537 EVISPFS 543

>YNL249C Chr14 complement(179394..181022) [1629 bp, 542 aa] {ON}
           MPA43Putative protein of unknown function; the
           authentic, non-tagged protein is detected in highly
           purified mitochondria in high-throughput studies
          Length = 542

 Score =  178 bits (452), Expect = 9e-48,   Method: Compositional matrix adjust.
 Identities = 142/529 (26%), Positives = 242/529 (45%), Gaps = 79/529 (14%)

Query: 32  VGVDVGTGSTRACIIDKSGN-ILSLAEKPIKREELLSNFITQSSREIW------NAVCYC 84
           +G+DVG+ S R  + +   + +L +A++P+        +   SS++ W        +   
Sbjct: 9   IGIDVGSSSARIGVYNYYNDALLEMAQEPVP-------YYQDSSKKSWKFWQKSTEIIKA 61

Query: 85  VRKVIQEAGVDPARIHGIGFDATCSLVVVSATDFKEIAVGPDFTNNDQNIILWMDHRAMK 144
           ++K +Q+  +    +   G  ATCSL +        + +      N+ N+I WMD  A+ 
Sbjct: 62  LQKCLQKLNIREYEVKSCGVSATCSLAIFERDRTSNMLIP---YPNEDNVIFWMDSSAVN 118

Query: 145 ETEEINFS-GNTCLKYVGGQMSVEMEIPKIKWLKNNLESGIFQDCKF--FDLPDYLTFRA 201
           E + +N       L Y+GG+   EM +PK+K+  +  E    +D  F  FDL  Y+ +  
Sbjct: 119 ECQWLNMQCPQQLLDYLGGKFVPEMGVPKLKYFLD--EYSHLRDKHFHIFDLHQYIAYEL 176

Query: 202 TGKENRSFSSVVCKQGFLPEGVEGSNLGWSKQFLDSIGLSELTDNDFEKLGGSLRNQKNF 261
           +     +   ++ ++     G +G   GWS  F                     +N  N 
Sbjct: 177 SRLYEWNIEGLLGRENLNGIGNDGEVSGWSSSFY--------------------KNIIN- 215

Query: 262 LSAGECIGPLDGKAARQLGLTEYCVVSSGIIDAYAGWVGTVAAKPESEIKGLTENEDYKH 321
           L +   IG     A + +  T    V    ID+YA W    +   E+             
Sbjct: 216 LPSNVSIGTTSLVANKHISTT----VVRSCIDSYASWFAVASPHLETS------------ 259

Query: 322 DFNGAIGRLAAVAGTSTCHIL-LSKSSIFVHGIWGPYRDVL-ARG-FWAAEGGQSCTGVL 378
                   L  +AGTS+C++   + S   + G+WGP+  +L  RG F     GQSCTG L
Sbjct: 260 --------LFMIAGTSSCYMYGTTISDTRIPGVWGPFDTILDNRGDFSVYAAGQSCTGKL 311

Query: 379 LDHVITTHPAFSKLSQLADAANVSKFEYLNSVLENLVEKRKERSVIFLAKHLFFYGDYRG 438
           ++H+  +HP   K+  L D A++  ++ L   + + +EK    S+  L K +FFYGDY G
Sbjct: 312 IEHLFESHPCARKI--LKDGADI--YQVLEQTIRD-IEKNNGLSIHILTKDMFFYGDYEG 366

Query: 439 NRSPIADPNMRACIIGQSMDNSIDDLAVIYLGACEFISQQTRQIIEVML--KSGHAINAV 496
           NR+P ADP ++   IG+S D S+ +L   Y+   EF+S QT+ II+      S   I  +
Sbjct: 367 NRTPFADPRIKGSFIGESTDTSMLNLTYKYICILEFLSFQTKLIIDTFQNENSNIHIKEL 426

Query: 497 FMSGGQCRNGLLMRLLADC-TGLPIVIPRY-IDGAVVFGSALLGAAASK 543
            +SG Q +N  L+ L++    G+ I+ P+  +D   + G+ +L  +A +
Sbjct: 427 RISGSQAKNERLLSLISLVNNGVAIIKPKENVDMMGIKGAYVLAKSAKE 475

 Score = 33.1 bits (74), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 14/28 (50%), Positives = 19/28 (67%)

Query: 671 RILLDTKYQIFLDMVETQRNYRRMVDKV 698
           R LL  KY I LDM + Q+ Y ++VD+V
Sbjct: 511 RKLLCVKYHIHLDMAKQQKRYHKLVDEV 538

>KLTH0F03080g Chr6 complement(268621..270222) [1602 bp, 533 aa] {ON}
           similar to uniprot|P53583 Saccharomyces cerevisiae
           YNL249C MPA43
          Length = 533

 Score =  177 bits (450), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 165/588 (28%), Positives = 264/588 (44%), Gaps = 98/588 (16%)

Query: 26  SETKFYVGVDVGTGSTRACIID-KSGNILSLAEKPIKREELLSNFITQSSREIWNAVCYC 84
           S T   +G+D+G+ + R  I D K+  ++ +  KP+       N +TQSS +I +A+  C
Sbjct: 5   SPTSAGLGIDLGSTAVRVGIYDLKTDKLIDIVAKPVPYTNHGGNRVTQSSTDIMSAIHGC 64

Query: 85  VRKVIQEAGVDPARIHGIGFDATCSLVVVSA--TDFKEIAVGPDFTNNDQNIILWMDHRA 142
               IQ+   D   +   G  ATCSL V +    D K + +         N++ WMD  A
Sbjct: 65  ----IQDLNPDLKSVLSCGVAATCSLAVFTQDIEDLKPLDIHGVKQEPCHNVVFWMDSSA 120

Query: 143 MKETEEINFSGNTCLKYVGGQMSVEMEIPKIKWLKNNLESGIFQDCKFFDLPDYLTFRAT 202
             E E +N +     +++GG    EM IPK+  +    E+      + FDL  Y+ +   
Sbjct: 121 TLECEIVNKTAGRLKEFMGGSFVPEMGIPKLASIFKKPEAE-GHKLEVFDLHSYIAYELA 179

Query: 203 GKENRSFSSVVCKQGFLPEGVEGSNLGWSKQFLDSIGLSELTDNDFEKLGGSLRNQKNFL 262
            K     S ++ K      G +G   GW   F           ND  KL  +++      
Sbjct: 180 IKYGWDTSRIINKPNENRIGHDGELKGWDAGFY----------NDVLKLPANVK------ 223

Query: 263 SAGECIGPLDGKAARQLGLTEYCVVSSGIIDAYAGWVGTVAAKPESEIKGLTENEDYKHD 322
                IGP+          TE  V  +  ID Y+ W    ++ P +              
Sbjct: 224 -----IGPIHALN------TESPVRVASCIDCYSNWFSMCSSSPNNS------------- 259

Query: 323 FNGAIGRLAAVAGTSTCHILL-SKSSIFVHGIWGPYRDVL----ARGFWAAEGGQSCTGV 377
                  L   AGTSTC++   +++   + G+WGP+ ++L    A+ +   E GQS TG 
Sbjct: 260 -------LFMAAGTSTCYLYANTENKGCIPGVWGPFTNILDGSEAKEWSVYEAGQSTTGK 312

Query: 378 LLDHVITTHPAFSKLSQLADAANVSKFEYLNSVLENLVEKRKE---RSVIFLAKHLFFYG 434
           L++H+  THPA       A A ++ K + L S +E+ +EK ++    SV F +KH+F YG
Sbjct: 313 LIEHLFETHPA-------ARAYSMDKSK-LFSAIESAIEKLEQDFGESVHFRSKHMFTYG 364

Query: 435 DYRGNRSPIADPNMRACIIGQSMDNSIDDLAVIYLGACEFISQQTRQIIEVMLKSGHAIN 494
           + +GNR+P  D +M    IG++ D S  DL + Y+   EF++ Q + I E        I 
Sbjct: 365 ELQGNRTPYCDSSMSGMFIGETTDTSFQDLVLKYVTILEFLAFQVKHIKECFKAE---IK 421

Query: 495 AVFMSGGQCRNGLLMRLLADCTG-LPIVIP-RYIDGAVVFGSALLGAAASK---VFDL-N 548
            + ++G Q +N  L+ L +     + + IP +  D   V G+ LLG AA K   + DL +
Sbjct: 422 DIRIAGSQAKNTRLLTLFSLVNDQITVKIPAQRTDYMGVEGAYLLGKAAHKNINIIDLID 481

Query: 549 KRRRVIXXXXXXLVQTEFLEGLYPSIQNLPLENHSTNVV----ASYKL 592
           KR R         +Q+  LE     +  + L NH+T +     A YK+
Sbjct: 482 KRDR---------LQSHILE-----LGPMKLGNHNTKLKQLLEAKYKI 515

 Score = 39.3 bits (90), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 16/26 (61%), Positives = 20/26 (76%)

Query: 673 LLDTKYQIFLDMVETQRNYRRMVDKV 698
           LL+ KY+I+LDM +TQ  YR MVD V
Sbjct: 508 LLEAKYKIYLDMAQTQMRYRAMVDSV 533

>TDEL0C05900 Chr3 (1062033..1063664) [1632 bp, 543 aa] {ON}
           Anc_1.111 YNL249C
          Length = 543

 Score =  175 bits (444), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 156/567 (27%), Positives = 252/567 (44%), Gaps = 82/567 (14%)

Query: 32  VGVDVGTGSTRACIIDKSGNILSLAEKP-----IKREELLSNFITQSSREIWNAVCYCVR 86
           +G+D+G+ S R  +     +++    K         +  L  + TQS+ EI   +  C  
Sbjct: 6   IGIDLGSSSVRVGLFTLEDDLMVQCVKQKISYYYHGDSALWEY-TQSTDEIMKVIERC-- 62

Query: 87  KVIQEAGVDPARIHGIGFDATCSLVVVSATDFKEIAVGPDFTNNDQNIILWMDHRAMKET 146
             + +  +D   I   G  ATCS+ +                ++ QN+I WMD+ +  E 
Sbjct: 63  --LHDLKIDEYNIKSCGVSATCSMALFIKEHNHLEPFNTISGSHRQNVIFWMDNSSKTEC 120

Query: 147 EEINFSGNTCLK----YVGGQMSVEMEIPKIKWLKNNLESG-IFQDCKF--FDLPDYLTF 199
           + +N   N C K    ++GG+   EM IPKI  L N L+S    Q+      DL  YL +
Sbjct: 121 KLLN---NLCEKRLRDFMGGKFIPEMGIPKINRLINYLKSSDDLQNLSVVAMDLHRYLAY 177

Query: 200 RATGKENRSFSSVVCKQGFLPEGVEGSNLGWSKQFLDSIGLSELTDNDFEKLGGSLRNQK 259
               +   +F  ++    F   G +G   GWS +F                   +L+   
Sbjct: 178 EIAKRFKWNFDRLLNTTNFNEIGHDGELSGWSSKFYID----------------TLKIPS 221

Query: 260 NFLSAGECIGPLDGKAARQLGLTEYCV-VSSGIIDAYAGWVGTVAAKPESEIKGLTENED 318
           N     E   PL+          EYC  + +  ID Y+ W+   +  PE           
Sbjct: 222 NITIGPE--PPLEDDF-------EYCKGIVASCIDCYSSWLSLCSPTPEES--------- 263

Query: 319 YKHDFNGAIGRLAAVAGTSTCHILLSKSSIFVHGIWGPYRDVL--ARGFWAAEGGQSCTG 376
                      L  V GTSTC++  +     + G+WGP+ D+L  +  +   EGGQSCTG
Sbjct: 264 -----------LFIVGGTSTCYLYATTRMKTIPGVWGPFTDILDNSNTYAVYEGGQSCTG 312

Query: 377 VLLDHVITTHPAFSKLSQLADAANVSKFEYLNSVLENLVEKRKERSVIFLAKHLFFYGDY 436
            L++H++ THPA S +++      + K E   S     +E++  RS+ F  KH+FFYGD+
Sbjct: 313 KLIEHLLQTHPASSSIAKDDWPLLLEKIEQEISA----IEEQTGRSIHFKTKHMFFYGDF 368

Query: 437 RGNRSPIADPNMRACIIGQSMDNSIDDLAVIYLGACEFISQQTRQIIEVMLKS--GHAIN 494
           +GNR+P ADP M    IG++ D S ++L + Y+   EF++ Q + +I +  K+     I 
Sbjct: 369 QGNRTPYADPEMSGMTIGETTDVSFNNLILRYICILEFLAFQIKYMISIFNKAQGQDKIT 428

Query: 495 AVFMSGGQCRNGLLMRLLADC-TGLPIVIPRY-IDGAVVFGSALLGAAASKVFDLNKRRR 552
            + + G Q +N  L+ L++    G  I +P+  ++ + V G+ LLG +A     LNK   
Sbjct: 429 EIRICGSQAKNKRLLSLISLLHEGGTIKLPKTDVELSGVSGAFLLGKSAL----LNKSPL 484

Query: 553 VIXXXXXXLVQTEFLEGLYPSIQNLPL 579
            +        Q +  E   PS  N PL
Sbjct: 485 DLIQEKDDQKQVDIFET--PSSINQPL 509

 Score = 38.9 bits (89), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 16/38 (42%), Positives = 25/38 (65%)

Query: 663 PNTKTHPDRILLDTKYQIFLDMVETQRNYRRMVDKVEE 700
           P++   P  +LL+ KY+I LDM + Q  YR M++K+ E
Sbjct: 502 PSSINQPLSMLLEAKYEIHLDMAKQQLIYREMINKIPE 539

>ZYRO0F16016g Chr6 (1313995..1315623) [1629 bp, 542 aa] {ON} similar
           to uniprot|P53583 Saccharomyces cerevisiae YNL249C MPA43
           Mitochondrial protein
          Length = 542

 Score =  174 bits (441), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 137/470 (29%), Positives = 214/470 (45%), Gaps = 76/470 (16%)

Query: 32  VGVDVGTGSTRACIID-KSGNILSLAEKPIK---REELLSNFITQSSREIWNAVCYCVRK 87
           +G+D+G+ S R  + + ++  I++   K +      E  +   TQSSREI  A+  C   
Sbjct: 10  IGIDLGSSSVRVSLFNFQNDQIIAYKIKTVPYYFTPESTNWKYTQSSREILTAIDQC--- 66

Query: 88  VIQEAGVDPARIHGIGFDATCSLVVVSATDFKEIAVGPDFTNNDQNIILWMDHRAMKETE 147
             QE  +D   I   G  ATCSL +    D   I    D  + D+N++ WMD  A+KET+
Sbjct: 67  -FQELNIDKHEIKSCGVGATCSLAIFQTKDNALIPWNLD--DPDKNVVFWMDSIAIKETQ 123

Query: 148 EIN-FSGNTCLKYVGGQMSVEMEIPKIKW----LKNNLESGIFQDCKFFDLPDYLTFRAT 202
           E+N  +      ++GG    EM +PK++     LKN   +  F+     DL  Y+     
Sbjct: 124 EVNKLATPEVQAHMGGSFVPEMAVPKLRHFIDILKNTDNNSTFE---IIDLHRYIAMSLA 180

Query: 203 GKENRSFSSVVCKQGFLPEGVEGSNLGWSKQFLDSIGLSELTDNDFEKLGGSLRNQKNFL 262
            +    +++V         G +G   GWS  F +++                L+   N +
Sbjct: 181 QQNGWDYTNVCNFPNLNEIGHDGELAGWSSAFYENV----------------LQLPPNIV 224

Query: 263 SAGECIGPL-DGKAARQLGLTEYCVVSSGIIDAYAGWVGTVAAKPESEIKGLTENEDYKH 321
                IGP    + + + GL       S  ID Y+ W   + +  ++             
Sbjct: 225 -----IGPTKHSQHSSKQGLK-----VSSCIDCYSNWFALLPSNLQNS------------ 262

Query: 322 DFNGAIGRLAAVAGTSTCHILLSKSSIFVH---GIWGPYRDVLARG--FWAAEGGQSCTG 376
                   L  V GTSTC+  L  SS F H   G+WGP+ ++  R   F   E GQSCTG
Sbjct: 263 --------LFIVGGTSTCY--LYASSEFSHHIPGVWGPFSNIFDRSDQFSIYEAGQSCTG 312

Query: 377 VLLDHVITTHPAFSKLSQLADAANVSKFEYLNSVLENLVEKRKERSVIFLAKHLFFYGDY 436
            L++H+  THPA S +    D  ++  F  +N  +E  VE+  + S+    KH+FFYGD 
Sbjct: 313 KLIEHLFKTHPASSHIDT-RDWPHL--FSQINDFIEK-VEQNTQDSIHMQTKHMFFYGDL 368

Query: 437 RGNRSPIADPNMRACIIGQSMDNSIDDLAVIYLGACEFISQQTRQIIEVM 486
            GNR+P ADP+M    IG++ D S  +L   Y+   EFI+ Q + ++ + 
Sbjct: 369 DGNRTPYADPSMSGMFIGETTDTSFRNLVYKYVSILEFIAFQIKHMLAIF 418

 Score = 37.4 bits (85), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 15/32 (46%), Positives = 22/32 (68%)

Query: 673 LLDTKYQIFLDMVETQRNYRRMVDKVEETFSR 704
           LL+ KYQI+ +M E QR YR+ V+ V E  ++
Sbjct: 507 LLEVKYQIYFNMAEQQRKYRKQVNNVIENRTK 538

>Kwal_33.13530 s33 complement(268296..269900) [1605 bp, 534 aa] {ON}
           YNL249C (MPA43) - Overexpression leads to increased
           levels of the lyase PDC1 [contig 116] FULL
          Length = 534

 Score =  171 bits (432), Expect = 5e-45,   Method: Compositional matrix adjust.
 Identities = 153/526 (29%), Positives = 229/526 (43%), Gaps = 82/526 (15%)

Query: 32  VGVDVGTGSTRACIID-KSGNILSLAEKPIKREELLSNFITQSSREIWNAVCYCVRKVIQ 90
           +G+D+G+   R    + ++   +++  + +   E      TQSS EI  A+  C     +
Sbjct: 8   LGIDLGSTGVRVGAYNLETDEPIAVVSRTVNYYEQEKGRYTQSSAEIMRAIVEC----FE 63

Query: 91  EAGVDPARIHGIGFDATCSLVVV---SATDFKEIAVGPDFTN-NDQNIILWMDHRAMKET 146
              +D   +   G  ATCSL V    S    +   V  D    NDQN++ WMD  A++E 
Sbjct: 64  SLNIDIWAVQSCGVAATCSLAVFIRNSTKGLQPFGVYEDLRPLNDQNVVFWMDSNAIEEC 123

Query: 147 EEINFSGNTCLKYVGGQMSVEMEIPKIKWL-----KNNLESGIFQDCKFFDLPDYLTFRA 201
             IN        Y GG    EM +PK+        KNN       D + FDL  Y+ +  
Sbjct: 124 SNINDLAINEKAYFGGSFIPEMGVPKLASFLKSCSKNN------SDFEVFDLHTYVAYDL 177

Query: 202 TGKENRSFSSVVCKQGFLPEGVEGSNLGWSKQFLDSIGLSELTDNDFEKLGGSLRNQKNF 261
             +     S ++ +      G +G   GW  +F +             KL  ++R     
Sbjct: 178 ANRYGWDASFLINRPNHNGIGHDGEIKGWKDEFYEKT----------LKLPPNVR----- 222

Query: 262 LSAGECIGPLDGKAARQLGLTEYCVVSSGIIDAYAGWVGTVAAKPESEIKGLTENEDYKH 321
                 IGPL     R+       V  +  ID Y+ W    ++ PE              
Sbjct: 223 ------IGPL--CINRRFS----PVKVASCIDCYSSWFSMFSSTPERS------------ 258

Query: 322 DFNGAIGRLAAVAGTSTCHILLS-KSSIFVHGIWGPYRDVLARG---FWAA-EGGQSCTG 376
                   L   AGTSTC++  + K S  + GIWGP+ D+L       W+  E GQS TG
Sbjct: 259 --------LFMAAGTSTCYLYANNKPSECLPGIWGPFTDILDSKDPPSWSVYEAGQSTTG 310

Query: 377 VLLDHVITTHPAFSKLSQLADAANVSKFEYLNSVLENLVEKRKERSVIFLAKHLFFYGDY 436
            L++H+  +HPA        +  NV  F  L + + NL+E++   SV F  KH+F YG+ 
Sbjct: 311 KLIEHLFESHPA---AKPYLEDRNV-LFNRLETEI-NLIEQQSAESVHFKTKHMFNYGEL 365

Query: 437 RGNRSPIADPNMRACIIGQSMDNSIDDLAVIYLGACEFISQQTRQIIEVMLKSGHAINAV 496
           +GNR+P  DP M    IG+S D S  DL + Y+   EF++ Q R I E +   G  IN +
Sbjct: 366 QGNRTPYCDPEMSGMFIGESADTSFRDLTLKYVTVLEFLAFQVRHIKECL---GAPINDI 422

Query: 497 FMSGGQCRNGLLMRLLADCT-GLPIVIP-RYIDGAVVFGSALLGAA 540
            ++G Q +N  L+ L++    G  + IP    D   V G+ LLG A
Sbjct: 423 RVAGSQAKNNRLLSLISFVNHGSRVRIPATRADYVGVQGAYLLGKA 468

 Score = 37.4 bits (85), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 14/26 (53%), Positives = 20/26 (76%)

Query: 671 RILLDTKYQIFLDMVETQRNYRRMVD 696
           R L + KY+I+L+M +TQR YR MV+
Sbjct: 505 RALFEIKYKIYLNMAQTQRQYREMVN 530

>SAKL0C03432g Chr3 complement(325502..327145) [1644 bp, 547 aa] {ON}
           similar to uniprot|P53583 Saccharomyces cerevisiae
           YNL249C MPA43 Mitochondrial protein of unknown function
          Length = 547

 Score =  167 bits (424), Expect = 6e-44,   Method: Compositional matrix adjust.
 Identities = 149/526 (28%), Positives = 250/526 (47%), Gaps = 78/526 (14%)

Query: 32  VGVDVGTGSTRACIID-KSGNILSLAEKPIKREEL-LSNFITQSSREIWNAVCYCVRKVI 89
           VGVD+G+ S R  I   ++ ++L + E+P++      S   TQS+ EI  A+  C    +
Sbjct: 13  VGVDLGSSSVRVGIYSLENDSLLHVVERPVRYYSCGSSGRFTQSTGEIMAALQEC----L 68

Query: 90  QEAGVDPA--RIHGIGFDATCSLVVVSATDFKEIAVGP-DFT----NNDQNIILWMDHRA 142
            E G+ P    I   G  ATCS+ V +  +  + ++ P D +    ++D+N++ WMD  A
Sbjct: 69  DELGLRPGGRSIVSCGVAATCSMAVFT-VEAGDGSLAPLDMSGLDGSSDKNVVFWMDSVA 127

Query: 143 MKETEEINFSGNTCLKY-VGGQMSVEMEIPKIKWLKNNLESGIFQDCKFFDLPDYLTFRA 201
            +  + ++   +T +K  + G    EM +PK+  L         +  + FDL  Y+ +  
Sbjct: 128 SEACDALDKRVSTHVKAALCGGFIPEMGVPKLLHLVGQFPG---RSLEVFDLHKYIAYDL 184

Query: 202 TGKENRSFSSVVCKQGFLPEGVEGSNLGWSKQFLDSIGLSELTDNDFEKLGGSLRNQKNF 261
             +     +++  +      G +G   GW ++F  ++                L+     
Sbjct: 185 ARRYGWDMAALANRPNSNGIGHDGEVGGWPQEFYRNV----------------LK----- 223

Query: 262 LSAGECIGPLDGKAARQLGLTEYCVVSSGIIDAYAGWVGTVAAKPESEIKGLTENEDYKH 321
           L A   +GP      +++G+       +  ID YA W G  + +PE              
Sbjct: 224 LPATVAVGPASTFKGQRVGV-------ASCIDCYASWFGVCSTQPEQS------------ 264

Query: 322 DFNGAIGRLAAVAGTSTCHILLSKSS-IFVHGIWGPYRDVL--ARGFWAA-EGGQSCTGV 377
                   L  VAGTSTC++  S +S   + G+WGP+ ++L      W+  E GQS TG 
Sbjct: 265 --------LFLVAGTSTCYLYASAASKTVLPGMWGPFTNLLDGEEARWSVYEAGQSTTGR 316

Query: 378 LLDHVITTHPAFSKLSQLADAANVSKFEYLNSVLENLVEKRKERSVIFLAKHLFFYGDYR 437
           LL+H+  THPA    +   D   +  F+ L   + ++ E     S+  LA+H+F YG+ +
Sbjct: 317 LLEHLFETHPAARDYA--GDTGRL--FKDLEDRIADM-EADSGCSIHHLARHMFLYGELQ 371

Query: 438 GNRSPIADPNMRACIIGQSMDNSIDDLAVIYLGACEFISQQTRQIIE-VMLKSGHAINAV 496
           GNR+P ADP M    +G++ D S  +LA+ Y+   EF++ QTRQI+E     +  AI  +
Sbjct: 372 GNRTPYADPRMCGMFVGETTDTSFANLALKYVVVLEFLAFQTRQIVEGFRTGAAAAIGEL 431

Query: 497 FMSGGQCRNGLLMRLLADCTG-LPIVIP-RYIDGAVVFGSALLGAA 540
            ++G Q RN  L+ L++   G +P+ +P R    A V G+ LLG A
Sbjct: 432 RVAGSQARNRRLLSLMSLVNGNMPVRVPARAAPLAGVRGAYLLGKA 477

 Score = 33.9 bits (76), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 17/37 (45%), Positives = 22/37 (59%), Gaps = 1/37 (2%)

Query: 662 CPNTKTHPDRILLDTKYQIFLDMVETQRNYRRMVDKV 698
           C  TK +  R LL+ KY I LDM + Q+ YR  +D V
Sbjct: 509 CGATKENLRR-LLEAKYAIHLDMAQVQQRYRSEIDAV 544

>KNAG0F00660 Chr6 complement(114441..116048) [1608 bp, 535 aa] {ON}
           Anc_1.111 YNL249C
          Length = 535

 Score =  159 bits (401), Expect = 7e-41,   Method: Compositional matrix adjust.
 Identities = 155/537 (28%), Positives = 238/537 (44%), Gaps = 92/537 (17%)

Query: 28  TKFYVGVDVGTGSTRACIID-KSGNILSLAEKPI------KREELLSNFITQSSREIWNA 80
           T   +G+D+G+ S R  I      ++L +  KP+       R  L     TQ S EI  A
Sbjct: 4   TPIGIGIDLGSSSVRVGIYSLHDDSLLGVFSKPVPYYYESNRTSLWE--YTQDSAEILTA 61

Query: 81  VCYCVRKVIQEAGVDPARIHGIGFDATCSLVVV--SATDFKEIAVGPDFTNNDQNIILWM 138
           +    ++    A +    +   G  ATCSLV+   S  D  +   G     + +N++ WM
Sbjct: 62  I----KECFDMADLQKYDVKSCGVAATCSLVLCERSGDDTFQHCEG-----DSRNVVFWM 112

Query: 139 DHRAMKETEEINF-SGNTCLKYVGGQMSVEMEIPKI-KWLK--NNLESGIFQDCKFFDLP 194
           D  A +ET  +N       L ++GG    EM IPK+ ++LK  ++   G  Q  + FDL 
Sbjct: 113 DSMAKEETNSLNARCPQDILGHMGGGFIPEMGIPKLSRFLKSISDEPKGNIQ-WEVFDLH 171

Query: 195 DYLTFRATGK---ENRSFSSVVCKQGFLPEGVEGSNLGWSKQFLDSIGLSELTDNDFEKL 251
            Y+ ++   +        S+     G    G +G   GWSK F D I    L  N     
Sbjct: 172 KYVAYKLAQEYCWNTERLSNHPNSNGI---GHDGELAGWSKSFYDKI--VRLPPNVTIGC 226

Query: 252 GGSLRNQKNFLSAGECIGPLDGKAARQLGLTEYCVVSSGIIDAYAGWVGTVAAKPESEIK 311
             ++ N+ + +    C                        ID Y+ W         S ++
Sbjct: 227 PKTIENEDSLVIVDSC------------------------IDCYSSWF--------SPLQ 254

Query: 312 GLTENEDYKHDFNGAIGRLAAVAGTSTCHIL---LSKSSIFVHGIWGPYRDVLARGFWAA 368
            L +N             L  VAGTSTC+I      K+   V GIWGP+ D+L       
Sbjct: 255 SLNKN------------TLFLVAGTSTCYIYSPGTMKTETSVKGIWGPFTDILGANKVVY 302

Query: 369 EGGQSCTGVLLDHVITTHPAFSKLSQLADAANVSKFEYLNSVLE--NLVEKRKERSVIFL 426
           E G SC+G L++H+ T+HP+       A + N+S  + ++ + E  N+ E +   S+ F 
Sbjct: 303 ESGSSCSGKLIEHLFTSHPS-------AISLNLSTGQLISKLEEEINIWETQNATSIHFE 355

Query: 427 AKHLFFYGDYRGNRSPIADPNMRACIIGQSMDNSIDDLAVIYLGACEFISQQTRQIIEVM 486
           A + F YGD  GNR+P  DP MR   IG+S D S  DL V Y+   E ++ QT+ +++  
Sbjct: 356 ACNNFLYGDLDGNRTPFGDPYMRGMFIGESPDTSFRDLLVKYVCILECLAFQTKLMVDNF 415

Query: 487 LKSGHAINAVFMSGGQCRNGLLMRL--LADCTGLPIVIPRYIDGAVVFGSALLGAAA 541
            K  ++IN +F+ G Q +N  L++L  L +   L +V     D   V G+ LLG A 
Sbjct: 416 EKL-NSINELFICGSQAKNTRLLKLISLINDNALILVPKEKEDLMGVEGAYLLGKAG 471

>KLLA0C02937g Chr3 complement(265205..266755) [1551 bp, 516 aa] {ON}
           similar to uniprot|P53583 Saccharomyces cerevisiae
           YNL249C MPA43 Mitochondrial protein of unknown function
           and similar to uniprot|Q04585 Saccharomyces cerevisiae
           YDR109C Hypothetical ORF
          Length = 516

 Score =  120 bits (302), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 127/501 (25%), Positives = 204/501 (40%), Gaps = 91/501 (18%)

Query: 32  VGVDVGTGSTRACIIDKSGNILSLAEK---PIKREELLSNFITQSSREIWNAVCYCVRKV 88
           +GVD+G+   R  I D   + L    K   P  R    +  ITQ + +I  AV     K 
Sbjct: 6   IGVDLGSTEFRIGIFDYYTDSLVKETKEKVPYFRHG--NGIITQCTSDILTAV----EKA 59

Query: 89  IQEAGVDPARIHGIGFDATCSLVVVSATDFKEIAVG--PDFTNNDQNIILWMDHRAMKET 146
                +    I  +G  ATCS+VV    D   I      D      +II WM   A++ET
Sbjct: 60  FNTLYIQEYNICSLGVGATCSMVVGKQKDENLIPFNLIHDKNGRYHDIIFWMHSAAIEET 119

Query: 147 EEIN-FSGNTCLKYVGGQMSVEMEIPKIKWLKNNLESGIFQD--CKFFDLPDYLTFRATG 203
           E +N  +  + L + GG+   EM IPK+  L       +++D      DL  +L ++ + 
Sbjct: 120 EYLNNITDESILCHFGGKFFPEMAIPKLLHLNK-----LYKDDGLTVLDLHIWLLWKISL 174

Query: 204 KENRSFSSVVCKQGFLPEGVEGSNLGWSKQFLDSIGLSELTDNDFEKLGGSLRNQKNFLS 263
           K        V +      G +G   GWSK+F + + L+++                 F+ 
Sbjct: 175 KLGHKELMPVQEPNSNGIGHDGELFGWSKEFYEHLQLNKI-----------------FIG 217

Query: 264 AGECIGPLDGKAARQLGLTEYCVVSSGIIDAYAGWVGTVAAKPESEIKGLTENEDYKHDF 323
               I     K   Q G           ID YA W    +                    
Sbjct: 218 NNAVI-----KKNEQFG--------DSCIDCYASWFQCWST------------------- 245

Query: 324 NGAIGR-LAAVAGTSTCHILLSKS-SIFVHGIWGPYRDVLAR--------GFWAAEGGQS 373
              + R L  VAGTSTC +  S     F+ GIWGP++D+L           +   E G S
Sbjct: 246 -AMLNRTLFVVAGTSTCFLYASDCFESFIPGIWGPFKDILVNRKHISKHDNYSVYEAGIS 304

Query: 374 CTGVLLDHVITTHPAFSKLSQLADAANVSKFEYLNSVLE--NLVEKRKERSVIFLAKHLF 431
            TGVLL+ +++THPA             S   +L +V    +L+E+   +S+  + K+ F
Sbjct: 305 RTGVLLEKLLSTHPAVKD----------SDVNFLETVEHKIDLIEQSDTQSIHLMIKNTF 354

Query: 432 FYGDYRGNRSPIADPNMRACIIGQSMDNSIDDLAVIYLGACEFISQQTRQIIEVMLKSGH 491
           F+ DY    S     +    I+ +  + ++ DLA+ Y+   E ++ Q   +I    +   
Sbjct: 355 FHEDYEEFESSFVQKDTSGSILKEGYNPTLKDLALKYVVIIETLAFQIVDVINAFEEGHI 414

Query: 492 AINAVFMSGGQCRNGLLMRLL 512
            I+ + ++G Q +N  L+++L
Sbjct: 415 TISKLLITGSQAKNSRLLQIL 435

>NCAS0A00780 Chr1 complement(152317..153966) [1650 bp, 549 aa] {ON}
           Anc_1.111 YNL249C
          Length = 549

 Score = 88.6 bits (218), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 133/570 (23%), Positives = 224/570 (39%), Gaps = 114/570 (20%)

Query: 32  VGVDVGTGSTRACIID-KSGNILSLAEKPIKREELLSNFITQSSREIWNAV--CYCVRKV 88
           +G+DVG+ S R  I + + G  +    K I +E L  +   +   ++W+     + +R  
Sbjct: 5   IGIDVGSTSVRIGIFNYEDGTTI----KTIVKEMLYKH---EPDSKLWHYTQNAFVMRDS 57

Query: 89  I----QEAGVDPARIHGIGFDATCSLVVVS----ATDFKEIAVGPDFTNNDQNIILWMDH 140
           I    +E  V+   +   G  ATCS+V +     A   + + +  + TNN  +II W DH
Sbjct: 58  IFTALEELHVNSYIVKICGVSATCSMVFLQRDSPADHLRPLTIIHEETNNTDSIIFWKDH 117

Query: 141 RAMKETEEIN---------FSG--NTCLKYVGGQMSV--EMEIPKIKWLKNNLESGIFQD 187
            A  E + +N          SG  N  L  +G +     EM IPK+  L N ++ G ++ 
Sbjct: 118 TAQPEAQRLNNKLRTANEGLSGKENKILSTLGSRSGFIGEMAIPKLSRLINLIKEGFYET 177

Query: 188 ---CKFFDLPDYLTFRATGKENRSFSSVVCKQGFLPEGVEGSNLGWSKQFLDSIGLSELT 244
               + +DL  Y+      K + +   +  K      G++G   GW   F     +  L 
Sbjct: 178 PHILEVYDLHVYIAQTLAQKYDWNTVHLQNKPNVNGIGIDGELQGWDLSFY----VWALP 233

Query: 245 DNDFEKLGGSLRNQKNFLSAGECIGPLDGKAARQLGLTEYCVVSSGIIDAYAGWVGTVAA 304
           +  F                  CIGP   K   +  +    V     ID YA W  T A 
Sbjct: 234 ETSFPI----------------CIGP--SKVINETSI----VRPKSCIDCYASWFSTDAC 271

Query: 305 KPESEIKGLTENEDYKHDFNGAIGRLAAVAGTSTCHIL-LSKSSIFVHG--------IWG 355
             +                      L   AGTSTC +  + +S++   G         WG
Sbjct: 272 TKDD--------------------TLFMAAGTSTCCLYAMPRSALEYFGEQQQPLSLFWG 311

Query: 356 PYRDVLARGFWAA-EGGQSCTGVLLDHVITTHPAFSKLSQLADAANVSKFEYLNSVLENL 414
           P+ +VL +   ++ E G S TG+LL+ +   H       Q+  + +V+  E +N V   +
Sbjct: 312 PFTNVLDKDKKSSFEIGFSETGILLEKLFNKH-------QITASWSVA--ESINYVENQI 362

Query: 415 -VEKRKERSVIFLAKHLFFYGDYRGNRSPIA--DPNMRACIIGQSMDNSIDDLAVIYLGA 471
            + +RK+   I+L   ++ +  Y     P     P+         + +S   L   Y+  
Sbjct: 363 AIYERKKSHSIYLEPEIYLFLKYLTLNKPSGRDTPDTPDLFGNDGVTDSTLGLIFKYIAI 422

Query: 472 CEFISQQTRQIIEVMLKSGHAINAVFMSGGQCRNGLLMRL---LADCTGLPIVIPR---- 524
            E+++ Q   +I    K    IN + +SG Q +N  L+ L   + D T + I++P     
Sbjct: 423 LEYLAYQVSNLILQFQKEKIIINHLVLSGSQAQNKRLLDLILFMHDGT-IDIIVPAEDWK 481

Query: 525 --YIDGAVVFGSALLGAAASKVFDLNKRRR 552
              + GA   G A        + D  K R+
Sbjct: 482 FGAMKGAFYLGKAYF--LHQSIVDFLKSRK 509

>NDAI0H00220 Chr8 complement(30959..33391) [2433 bp, 810 aa] {ON}
           Anc_4.9 YHL032C
          Length = 810

 Score = 36.6 bits (83), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 35/132 (26%), Positives = 60/132 (45%), Gaps = 13/132 (9%)

Query: 430 LFFYGDYRGNRSPIADPNMRACIIGQSMDNSIDDLAVIYLGACEFISQQTRQIIEVM--- 486
           + F   + G  +P  DP+ RA I+G S   +   +A     A E +  Q R I++ M   
Sbjct: 610 VVFVPAFNGLFAPYWDPDTRATIMGISQSTTASHIA---RAAIEGVCFQVRAILKAMSGD 666

Query: 487 -LKSGHAINAVF---MSGGQCRNGLLMRLLADCTGLPIVIPRYIDGAVVFGSALLGAAAS 542
            ++ G+    V    + GG  ++  +M++ AD  G  I + R     +V  +AL  A A+
Sbjct: 667 KIEDGYEKGTVVTLSVDGGMSKSDEVMQIQADILGPCIKLRR---SPIVECTALGAAIAA 723

Query: 543 KVFDLNKRRRVI 554
            +   N   RV+
Sbjct: 724 NMAYKNVEDRVL 735

>TPHA0K02280 Chr11 (490104..492107) [2004 bp, 667 aa] {ON} Anc_4.9
           YHL032C
          Length = 667

 Score = 34.3 bits (77), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 29/108 (26%), Positives = 50/108 (46%), Gaps = 16/108 (14%)

Query: 430 LFFYGDYRGNRSPIADPNMRACIIGQSMDNSIDDLAVIYLGACEFISQQTRQII-----E 484
           + F   + G  +P  DPN RA I+G S   +    A I   A E +  Q R I+     +
Sbjct: 466 VVFVPAFSGLFAPYWDPNARASIMGMSQYTTA---AHIARAAVEGVCFQARAILKAMSSD 522

Query: 485 VMLKSG--------HAINAVFMSGGQCRNGLLMRLLADCTGLPIVIPR 524
           V+ +SG         A++ + + GG  R+  +M++ A+  G  + + R
Sbjct: 523 VLQESGDFEDTYEKSALSTLAVDGGMSRSDEVMQIQANILGPCVKVRR 570

>CAGL0L06776g Chr12 (763580..766066) [2487 bp, 828 aa] {ON} some
           similarities with uniprot|P40209 Saccharomyces
           cerevisiae YMR136w GAT2
          Length = 828

 Score = 33.9 bits (76), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 40/174 (22%), Positives = 72/174 (41%), Gaps = 21/174 (12%)

Query: 104 FDATCSLVVVSATDFKEIAVGPDFTNNDQNIILWMDHRAMKETE-EINFSGNTCLKYVGG 162
           F+   S   ++ +D K  +VG D +N  ++++  ++   ++     I  + N  L+Y   
Sbjct: 178 FNDDISETRINTSDIK--SVGEDVSNRLKSLVSRLERYGIENNSGNIYGTNNQNLRYETI 235

Query: 163 QMSVEMEIPKIKWLKNNLESGIFQDCKFFDLPDYLTFRATGKENRSFSSVVCKQGFL--- 219
           ++ +   I K+K L+  L        K FD    L +  TG E+   S+   + G +   
Sbjct: 236 KIELIETIRKVKELQQEL-------VKIFDNNTNLKYSTTGHEDSYKSTKRRRSGLVTTL 288

Query: 220 --------PEGVEGSNLGWSKQFLDSIGLSELTDNDFEKLGGSLRNQKNFLSAG 265
                   P   E +NL    QF  S G  + + ND++   G+  N   F  A 
Sbjct: 289 NDTEIDSAPNKFEPNNLEGKGQFHSSGGAYKNSLNDYKFPPGNTANSGAFFRAN 342

>NCAS0C04160 Chr3 (852001..852753) [753 bp, 250 aa] {ON} Anc_8.127
           YGL174W
          Length = 250

 Score = 32.3 bits (72), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 27/79 (34%), Positives = 41/79 (51%), Gaps = 9/79 (11%)

Query: 603 TSSDLFPISKEQPADMISDKSSKGISLDKGRENLEEERDIDKNIL----WKVMQELTGNA 658
           +SSD+ PI +  P++   ++  KG SL K   NLE    I+  ++     K  QEL+  A
Sbjct: 39  SSSDIVPIRR--PSERAGNRQEKGASLWK---NLETNELIETTVVTKQELKKEQELSIAA 93

Query: 659 KVICPNTKTHPDRILLDTK 677
           +V  P T+   + I  DTK
Sbjct: 94  RVDHPKTQPSQETIFRDTK 112

>TBLA0C02780 Chr3 complement(668605..669267) [663 bp, 220 aa] {ON}
           Anc_1.289 YKR014C
          Length = 220

 Score = 32.3 bits (72), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 18/66 (27%), Positives = 32/66 (48%), Gaps = 3/66 (4%)

Query: 440 RSPIADPNMRACIIGQSMDNSIDDLA---VIYLGACEFISQQTRQIIEVMLKSGHAINAV 496
           +S + D N+  C++G  +D   +D +   V+   A ++  +Q     EV  KSG  +  V
Sbjct: 103 KSKVGDENLVICLVGNKIDLCDEDESKRVVLTKDAKDYADEQNLMFYEVSAKSGENVKEV 162

Query: 497 FMSGGQ 502
           F   G+
Sbjct: 163 FQVIGE 168

>Kpol_1016.24 s1016 (61782..62417) [636 bp, 211 aa] {ON}
           (61782..62417) [636 nt, 212 aa]
          Length = 211

 Score = 31.2 bits (69), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 18/66 (27%), Positives = 33/66 (50%), Gaps = 3/66 (4%)

Query: 440 RSPIADPNMRACIIGQSMDNSIDD---LAVIYLGACEFISQQTRQIIEVMLKSGHAINAV 496
           ++ +AD  +  C++G  +D   +D    +V    A ++  +Q     EV  K+G  +N V
Sbjct: 104 KNKVADDKLVICLVGNKLDLCQEDSGKRSVEISDAKQYADEQGLLFFEVSAKTGEKVNDV 163

Query: 497 FMSGGQ 502
           F S G+
Sbjct: 164 FKSIGE 169

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.135    0.400 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 72,832,829
Number of extensions: 3124700
Number of successful extensions: 8343
Number of sequences better than 10.0: 40
Number of HSP's gapped: 8488
Number of HSP's successfully gapped: 64
Length of query: 704
Length of database: 53,481,399
Length adjustment: 117
Effective length of query: 587
Effective length of database: 40,065,477
Effective search space: 23518434999
Effective search space used: 23518434999
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 69 (31.2 bits)