Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Smik_4.3548.255ON69869836010.0
YDR108W (TRS85)8.255ON69869832640.0
Skud_4.3698.255ON69869731660.0
Suva_2.2688.255ON69569731590.0
NCAS0B038808.255ON70670423100.0
NDAI0J014108.255ON71670122620.0
ZYRO0C01826g8.255ON69969522470.0
CAGL0B01705g8.255ON67267322110.0
TDEL0F038208.255ON68768121890.0
Kpol_392.118.255ON67567521450.0
KAFR0B055708.255ON66967820440.0
TPHA0B032608.255ON71471919840.0
Kwal_56.235838.255ON70071918490.0
KLTH0G13860g8.255ON70871918100.0
SAKL0H17226g8.255ON71974517760.0
KNAG0H032708.255ON64871116400.0
TBLA0E043808.255ON88963714950.0
Ecym_43168.255ON62367012931e-170
AGR096C8.255ON62367312701e-166
KLLA0F18953g8.255ON64768111341e-146
NDAI0D025605.94ON1294104761.9
CAGL0D02464g3.14ON871213742.6
Suva_13.2172.612ON32471724.4
YAL029C (MYO4)7.68ON147161716.6
KAFR0A063804.173ON187761709.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Smik_4.354
         (698 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Smik_4.354 Chr4 (632598..634694) [2097 bp, 698 aa] {ON} YDR108W ...  1391   0.0  
YDR108W Chr4 (671269..673365) [2097 bp, 698 aa] {ON}  TRS85Subun...  1261   0.0  
Skud_4.369 Chr4 (642869..644965) [2097 bp, 698 aa] {ON} YDR108W ...  1224   0.0  
Suva_2.268 Chr2 (465716..467803) [2088 bp, 695 aa] {ON} YDR108W ...  1221   0.0  
NCAS0B03880 Chr2 complement(691369..693489) [2121 bp, 706 aa] {O...   894   0.0  
NDAI0J01410 Chr10 complement(323873..326023) [2151 bp, 716 aa] {...   875   0.0  
ZYRO0C01826g Chr3 complement(143874..145973) [2100 bp, 699 aa] {...   870   0.0  
CAGL0B01705g Chr2 (157245..159263) [2019 bp, 672 aa] {ON} highly...   856   0.0  
TDEL0F03820 Chr6 (699240..701303) [2064 bp, 687 aa] {ON} Anc_8.2...   847   0.0  
Kpol_392.11 s392 complement(30871..32898) [2028 bp, 675 aa] {ON}...   830   0.0  
KAFR0B05570 Chr2 complement(1140432..1142441) [2010 bp, 669 aa] ...   791   0.0  
TPHA0B03260 Chr2 complement(749568..751712) [2145 bp, 714 aa] {O...   768   0.0  
Kwal_56.23583 s56 (607721..609823) [2103 bp, 700 aa] {ON} YDR108...   716   0.0  
KLTH0G13860g Chr7 complement(1201656..1203782) [2127 bp, 708 aa]...   701   0.0  
SAKL0H17226g Chr8 complement(1526848..1529007) [2160 bp, 719 aa]...   688   0.0  
KNAG0H03270 Chr8 complement(609643..611589) [1947 bp, 648 aa] {O...   636   0.0  
TBLA0E04380 Chr5 (1112393..1115062) [2670 bp, 889 aa] {ON} Anc_8...   580   0.0  
Ecym_4316 Chr4 complement(683492..685363) [1872 bp, 623 aa] {ON}...   502   e-170
AGR096C Chr7 complement(917898..919769) [1872 bp, 623 aa] {ON} S...   493   e-166
KLLA0F18953g Chr6 (1737522..1739465) [1944 bp, 647 aa] {ON} simi...   441   e-146
NDAI0D02560 Chr4 (589972..593856) [3885 bp, 1294 aa] {ON} Anc_5....    34   1.9  
CAGL0D02464g Chr4 (250405..253020) [2616 bp, 871 aa] {ON} simila...    33   2.6  
Suva_13.217 Chr13 (351568..352542) [975 bp, 324 aa] {ON} YMR048W...    32   4.4  
YAL029C Chr1 complement(87855..92270) [4416 bp, 1471 aa] {ON}  M...    32   6.6  
KAFR0A06380 Chr1 complement(1288673..1294306) [5634 bp, 1877 aa]...    32   9.6  

>Smik_4.354 Chr4 (632598..634694) [2097 bp, 698 aa] {ON} YDR108W
           (REAL)
          Length = 698

 Score = 1391 bits (3601), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 673/698 (96%), Positives = 673/698 (96%)

Query: 1   MVFSYEHYMNLLFHLDNSKETVPPEIAKRIVSNAIAPVITVTSTPLFDKHIQEAYKVDSL 60
           MVFSYEHYMNLLFHLDNSKETVPPEIAKRIVSNAIAPVITVTSTPLFDKHIQEAYKVDSL
Sbjct: 1   MVFSYEHYMNLLFHLDNSKETVPPEIAKRIVSNAIAPVITVTSTPLFDKHIQEAYKVDSL 60

Query: 61  YMLLRFFGGCVSDRDQANEVKVGQDEHQVGDTNASMESFSKSKNLEVPNLPKKGSRSRSN 120
           YMLLRFFGGCVSDRDQANEVKVGQDEHQVGDTNASMESFSKSKNLEVPNLPKKGSRSRSN
Sbjct: 61  YMLLRFFGGCVSDRDQANEVKVGQDEHQVGDTNASMESFSKSKNLEVPNLPKKGSRSRSN 120

Query: 121 SLFQRDSTQSQYIRFTRPLDDLIETRDTNDMLFNYHSLEVFLDNYLKLVADNTDEMVPHD 180
           SLFQRDSTQSQYIRFTRPLDDLIETRDTNDMLFNYHSLEVFLDNYLKLVADNTDEMVPHD
Sbjct: 121 SLFQRDSTQSQYIRFTRPLDDLIETRDTNDMLFNYHSLEVFLDNYLKLVADNTDEMVPHD 180

Query: 181 LLKKSIYHSFFSLAISSTNNLSPYETFNHPILSLIALDISNGEVYEDARDLLVNFKNLNH 240
           LLKKSIYHSFFSLAISSTNNLSPYETFNHPILSLIALDISNGEVYEDARDLLVNFKNLNH
Sbjct: 181 LLKKSIYHSFFSLAISSTNNLSPYETFNHPILSLIALDISNGEVYEDARDLLVNFKNLNH 240

Query: 241 NTENFPLFMNTNEMLPVFLLCYNDESQEEFEKCXXXXXXXXXXXFVESVLLSLWKDSFIE 300
           NTENFPLFMNTNEMLPVFLLCYNDESQEEFEKC           FVESVLLSLWKDSFIE
Sbjct: 241 NTENFPLFMNTNEMLPVFLLCYNDESQEEFEKCQALAKKLKKQLFVESVLLSLWKDSFIE 300

Query: 301 ANNSAIQLHQPVMSSLEEILFFLQAPTQTSLSLPLINSIYDMLDYLVYDLMIPFMKRKVS 360
           ANNSAIQLHQPVMSSLEEILFFLQAPTQTSLSLPLINSIYDMLDYLVYDLMIPFMKRKVS
Sbjct: 301 ANNSAIQLHQPVMSSLEEILFFLQAPTQTSLSLPLINSIYDMLDYLVYDLMIPFMKRKVS 360

Query: 361 FWEETILQPRKSLFNGAKFFKKFMNKNPSNGNHHHNSLTSDNQGNEYFASSSSEFLMRKL 420
           FWEETILQPRKSLFNGAKFFKKFMNKNPSNGNHHHNSLTSDNQGNEYFASSSSEFLMRKL
Sbjct: 361 FWEETILQPRKSLFNGAKFFKKFMNKNPSNGNHHHNSLTSDNQGNEYFASSSSEFLMRKL 420

Query: 421 ADWSMMLSDFKTAYSTYESLMDDLDAFPKYLASCIEWCAVSLLMGAQRIVTVKMIKNDIN 480
           ADWSMMLSDFKTAYSTYESLMDDLDAFPKYLASCIEWCAVSLLMGAQRIVTVKMIKNDIN
Sbjct: 421 ADWSMMLSDFKTAYSTYESLMDDLDAFPKYLASCIEWCAVSLLMGAQRIVTVKMIKNDIN 480

Query: 481 PLIEKALATYENCXXXXXXXXXXXXXXNTVEPVRSYETRCMILASELFLSLSDKWTSTPY 540
           PLIEKALATYENC              NTVEPVRSYETRCMILASELFLSLSDKWTSTPY
Sbjct: 481 PLIEKALATYENCSKIQRSKSEKSSSSNTVEPVRSYETRCMILASELFLSLSDKWTSTPY 540

Query: 541 AIQYLETILDECKLGPCCQIMIWERLSDCYSLRVDPRIKHRVGAMKKGIRDTEDLRGGDG 600
           AIQYLETILDECKLGPCCQIMIWERLSDCYSLRVDPRIKHRVGAMKKGIRDTEDLRGGDG
Sbjct: 541 AIQYLETILDECKLGPCCQIMIWERLSDCYSLRVDPRIKHRVGAMKKGIRDTEDLRGGDG 600

Query: 601 NSTDHFTDDDILSEGLTRKRKAAFFRLIAARKWAEQKQWRQVSWCLKDIESIYSDIKFLN 660
           NSTDHFTDDDILSEGLTRKRKAAFFRLIAARKWAEQKQWRQVSWCLKDIESIYSDIKFLN
Sbjct: 601 NSTDHFTDDDILSEGLTRKRKAAFFRLIAARKWAEQKQWRQVSWCLKDIESIYSDIKFLN 660

Query: 661 GDGLILSKLHNQLNLKDLNSAPSPTEKNPTMTSVSFIG 698
           GDGLILSKLHNQLNLKDLNSAPSPTEKNPTMTSVSFIG
Sbjct: 661 GDGLILSKLHNQLNLKDLNSAPSPTEKNPTMTSVSFIG 698

>YDR108W Chr4 (671269..673365) [2097 bp, 698 aa] {ON}  TRS85Subunit
           of TRAPPIII (transport protein particle), a multimeric
           guanine nucleotide-exchange factor for Ypt1p, required
           for membrane expansion during autophagy and the CVT
           pathway; directs Ypt1p to the PAS; late post-replication
           meiotic role
          Length = 698

 Score = 1261 bits (3264), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 609/698 (87%), Positives = 636/698 (91%)

Query: 1   MVFSYEHYMNLLFHLDNSKETVPPEIAKRIVSNAIAPVITVTSTPLFDKHIQEAYKVDSL 60
           MVFSYEHYMNLLFHLDNSKETVPPEIAKRI+SNAIAPVITVTSTPLFDKHIQE YKVDSL
Sbjct: 1   MVFSYEHYMNLLFHLDNSKETVPPEIAKRIISNAIAPVITVTSTPLFDKHIQETYKVDSL 60

Query: 61  YMLLRFFGGCVSDRDQANEVKVGQDEHQVGDTNASMESFSKSKNLEVPNLPKKGSRSRSN 120
           YMLLRFFGGCVSDRDQANE KVGQ EH+V D + S +S  K+KNLEVPNL KKGSRSRSN
Sbjct: 61  YMLLRFFGGCVSDRDQANEAKVGQHEHEVCDASDSTDSIPKNKNLEVPNLSKKGSRSRSN 120

Query: 121 SLFQRDSTQSQYIRFTRPLDDLIETRDTNDMLFNYHSLEVFLDNYLKLVADNTDEMVPHD 180
           SLFQRDSTQSQYIRFTRPL DLIETRD NDMLFNYHSLEVFLDNYLKLVA NTDEMVPH+
Sbjct: 121 SLFQRDSTQSQYIRFTRPLGDLIETRDANDMLFNYHSLEVFLDNYLKLVAANTDEMVPHN 180

Query: 181 LLKKSIYHSFFSLAISSTNNLSPYETFNHPILSLIALDISNGEVYEDARDLLVNFKNLNH 240
           LLKKSIYHSFFSLAISSTNNLSPYETFNHPILSLIALDISNGEVYEDARDLLVNFKNLNH
Sbjct: 181 LLKKSIYHSFFSLAISSTNNLSPYETFNHPILSLIALDISNGEVYEDARDLLVNFKNLNH 240

Query: 241 NTENFPLFMNTNEMLPVFLLCYNDESQEEFEKCXXXXXXXXXXXFVESVLLSLWKDSFIE 300
           NTENFP+FMNTNEMLPVFLLCYND+SQEEFEKC           FVES+LL+LWKDSFI 
Sbjct: 241 NTENFPIFMNTNEMLPVFLLCYNDDSQEEFEKCQALAKKLKKQLFVESILLALWKDSFIY 300

Query: 301 ANNSAIQLHQPVMSSLEEILFFLQAPTQTSLSLPLINSIYDMLDYLVYDLMIPFMKRKVS 360
             NS IQLHQPVMSSLEEILFFLQAPTQT+LSL LINSIYDMLDYLVYDLMIPFMKRKVS
Sbjct: 301 DENSVIQLHQPVMSSLEEILFFLQAPTQTTLSLALINSIYDMLDYLVYDLMIPFMKRKVS 360

Query: 361 FWEETILQPRKSLFNGAKFFKKFMNKNPSNGNHHHNSLTSDNQGNEYFASSSSEFLMRKL 420
           FWEETILQPRKSLFNGAKFFKKFMNKNP NGNH HNSLT D+QGNEYFASSSSEFLMRKL
Sbjct: 361 FWEETILQPRKSLFNGAKFFKKFMNKNPVNGNHQHNSLTRDSQGNEYFASSSSEFLMRKL 420

Query: 421 ADWSMMLSDFKTAYSTYESLMDDLDAFPKYLASCIEWCAVSLLMGAQRIVTVKMIKNDIN 480
           ADWSMMLSDFKTAYSTYESLMDDLDAFPKYLASCIEWCAVSLLMGAQ IVTVKMIKNDIN
Sbjct: 421 ADWSMMLSDFKTAYSTYESLMDDLDAFPKYLASCIEWCAVSLLMGAQSIVTVKMIKNDIN 480

Query: 481 PLIEKALATYENCXXXXXXXXXXXXXXNTVEPVRSYETRCMILASELFLSLSDKWTSTPY 540
           PLIE+ALATYENC              +  EPVRSYETRCMILASELFLSLS+ WTSTPY
Sbjct: 481 PLIERALATYENCSRIQRGKGKESNSLDVTEPVRSYETRCMILASELFLSLSNTWTSTPY 540

Query: 541 AIQYLETILDECKLGPCCQIMIWERLSDCYSLRVDPRIKHRVGAMKKGIRDTEDLRGGDG 600
           AIQYLETILDECKLGPC QIM+WERLSDCY+LRVDPRIKHRVGAMKK  +DTEDLRG   
Sbjct: 541 AIQYLETILDECKLGPCSQIMVWERLSDCYNLRVDPRIKHRVGAMKKDAKDTEDLRGEHK 600

Query: 601 NSTDHFTDDDILSEGLTRKRKAAFFRLIAARKWAEQKQWRQVSWCLKDIESIYSDIKFLN 660
            STDHFTD+DILSEGLTR+RKAAFFRLIAA+KWAEQKQWRQVSWCLKDIES YS+IKFL+
Sbjct: 601 YSTDHFTDEDILSEGLTRRRKAAFFRLIAAKKWAEQKQWRQVSWCLKDIESTYSEIKFLH 660

Query: 661 GDGLILSKLHNQLNLKDLNSAPSPTEKNPTMTSVSFIG 698
           G+GLILSKL NQLNLKD++SAP P+EKN T TSVSFIG
Sbjct: 661 GNGLILSKLKNQLNLKDVDSAPRPSEKNLTRTSVSFIG 698

>Skud_4.369 Chr4 (642869..644965) [2097 bp, 698 aa] {ON} YDR108W
           (REAL)
          Length = 698

 Score = 1224 bits (3166), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 591/697 (84%), Positives = 629/697 (90%)

Query: 1   MVFSYEHYMNLLFHLDNSKETVPPEIAKRIVSNAIAPVITVTSTPLFDKHIQEAYKVDSL 60
           MVFSYEHYMNLLFHLDNS+E VPPEIAKRIVSNAIAPVITVTSTPLFDKHIQE Y VDSL
Sbjct: 1   MVFSYEHYMNLLFHLDNSEEIVPPEIAKRIVSNAIAPVITVTSTPLFDKHIQETYNVDSL 60

Query: 61  YMLLRFFGGCVSDRDQANEVKVGQDEHQVGDTNASMESFSKSKNLEVPNLPKKGSRSRSN 120
           YMLLRFFGGCVSDRDQANE KVG +EH+V DT+ SMES SK++NL VPN  KKGSRSRSN
Sbjct: 61  YMLLRFFGGCVSDRDQANEGKVGPNEHEVSDTSVSMESLSKNQNLGVPNALKKGSRSRSN 120

Query: 121 SLFQRDSTQSQYIRFTRPLDDLIETRDTNDMLFNYHSLEVFLDNYLKLVADNTDEMVPHD 180
           SLFQRDSTQSQYIRFTRPL DLIETRDTNDMLFNYHSLEV+LDNYLKLV +NT+E  PHD
Sbjct: 121 SLFQRDSTQSQYIRFTRPLGDLIETRDTNDMLFNYHSLEVYLDNYLKLVTENTNETAPHD 180

Query: 181 LLKKSIYHSFFSLAISSTNNLSPYETFNHPILSLIALDISNGEVYEDARDLLVNFKNLNH 240
           LLKKSIYHSFFSLAISSTNNLSPYETFNHPILSLIALDISNGEVYEDARDLLVNFKNLNH
Sbjct: 181 LLKKSIYHSFFSLAISSTNNLSPYETFNHPILSLIALDISNGEVYEDARDLLVNFKNLNH 240

Query: 241 NTENFPLFMNTNEMLPVFLLCYNDESQEEFEKCXXXXXXXXXXXFVESVLLSLWKDSFIE 300
           NTENFP+FMNTNEMLPVFL+CYNDESQEEFEKC           FVES+ L LWK+SFI+
Sbjct: 241 NTENFPIFMNTNEMLPVFLICYNDESQEEFEKCQALAKKLKKQLFVESIFLPLWKESFID 300

Query: 301 ANNSAIQLHQPVMSSLEEILFFLQAPTQTSLSLPLINSIYDMLDYLVYDLMIPFMKRKVS 360
             NS+I+LHQPVMSSLEEILFFLQAPTQT+LSLPLINSIYD+LDYLVYDLMIPFMKRKVS
Sbjct: 301 DENSSIKLHQPVMSSLEEILFFLQAPTQTTLSLPLINSIYDILDYLVYDLMIPFMKRKVS 360

Query: 361 FWEETILQPRKSLFNGAKFFKKFMNKNPSNGNHHHNSLTSDNQGNEYFASSSSEFLMRKL 420
           FWEETILQPRKSLFNGAKFFKKFMNKNP+NG+H HNSLT D QGNEYF+SSSSEFLMRKL
Sbjct: 361 FWEETILQPRKSLFNGAKFFKKFMNKNPANGSHQHNSLTRDRQGNEYFSSSSSEFLMRKL 420

Query: 421 ADWSMMLSDFKTAYSTYESLMDDLDAFPKYLASCIEWCAVSLLMGAQRIVTVKMIKNDIN 480
           ADWSMMLSDFKTAYSTYESLMDDLDAFPKYLASCIEWCAVSLLMGAQ IVTVKMIKNDIN
Sbjct: 421 ADWSMMLSDFKTAYSTYESLMDDLDAFPKYLASCIEWCAVSLLMGAQSIVTVKMIKNDIN 480

Query: 481 PLIEKALATYENCXXXXXXXXXXXXXXNTVEPVRSYETRCMILASELFLSLSDKWTSTPY 540
           PLIE+ALATYE C              +  EPVRSYETRCMILASELFLSLSD WTSTPY
Sbjct: 481 PLIERALATYEKCSQIQRHKGKELSSSSVTEPVRSYETRCMILASELFLSLSDTWTSTPY 540

Query: 541 AIQYLETILDECKLGPCCQIMIWERLSDCYSLRVDPRIKHRVGAMKKGIRDTEDLRGGDG 600
           AIQYLETILDECKLGPC QIMIWERLSDCY+LRVDPRIKHRVG MKK  ++TEDLR GD 
Sbjct: 541 AIQYLETILDECKLGPCSQIMIWERLSDCYNLRVDPRIKHRVGVMKKSFKETEDLRNGDE 600

Query: 601 NSTDHFTDDDILSEGLTRKRKAAFFRLIAARKWAEQKQWRQVSWCLKDIESIYSDIKFLN 660
           + TDHF ++DILSEGLTR+RKAAFFRLIAA+KWAEQK WRQVSWCLKDIES YS+IKFL+
Sbjct: 601 HYTDHFIEEDILSEGLTRRRKAAFFRLIAAKKWAEQKHWRQVSWCLKDIESTYSEIKFLH 660

Query: 661 GDGLILSKLHNQLNLKDLNSAPSPTEKNPTMTSVSFI 697
            +  ILSKL +QLNLKDL+SAP PTEKNPT TS++FI
Sbjct: 661 CNDSILSKLKSQLNLKDLDSAPGPTEKNPTTTSINFI 697

>Suva_2.268 Chr2 (465716..467803) [2088 bp, 695 aa] {ON} YDR108W
           (REAL)
          Length = 695

 Score = 1221 bits (3159), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 587/697 (84%), Positives = 627/697 (89%), Gaps = 3/697 (0%)

Query: 1   MVFSYEHYMNLLFHLDNSKETVPPEIAKRIVSNAIAPVITVTSTPLFDKHIQEAYKVDSL 60
           MVFSYEHYMNLLFHLD+S+ETVPPEIAKRIVSNAIAPVITVTSTPLFDKHIQEAY VDSL
Sbjct: 1   MVFSYEHYMNLLFHLDHSRETVPPEIAKRIVSNAIAPVITVTSTPLFDKHIQEAYSVDSL 60

Query: 61  YMLLRFFGGCVSDRDQANEVKVGQDEHQVGDTNASMESFSKSKNLEVPNLPKKGSRSRSN 120
           YMLLRFFGGCVSDRDQANE K  QDE    + + S+ES SK++NL VP+  K+GSRSRSN
Sbjct: 61  YMLLRFFGGCVSDRDQANEGKFEQDEQ---NASPSIESSSKNQNLGVPSALKRGSRSRSN 117

Query: 121 SLFQRDSTQSQYIRFTRPLDDLIETRDTNDMLFNYHSLEVFLDNYLKLVADNTDEMVPHD 180
           SLFQRDSTQSQY+RFTRPL DLIETRDTNDMLFNYHSLEVFLDNYLKLVA NTDE VPHD
Sbjct: 118 SLFQRDSTQSQYVRFTRPLGDLIETRDTNDMLFNYHSLEVFLDNYLKLVAGNTDEKVPHD 177

Query: 181 LLKKSIYHSFFSLAISSTNNLSPYETFNHPILSLIALDISNGEVYEDARDLLVNFKNLNH 240
           LLKKSIYHSFFSLAISSTNNLSPYETFNHPILSLIALDIS GEVYEDARDLLVNFKNLNH
Sbjct: 178 LLKKSIYHSFFSLAISSTNNLSPYETFNHPILSLIALDISYGEVYEDARDLLVNFKNLNH 237

Query: 241 NTENFPLFMNTNEMLPVFLLCYNDESQEEFEKCXXXXXXXXXXXFVESVLLSLWKDSFIE 300
           NTE+FP+FMNTNEMLPVFLLCYNDESQEEFEKC           FVES+LL LWKDSF++
Sbjct: 238 NTESFPIFMNTNEMLPVFLLCYNDESQEEFEKCQALAKKLKKQLFVESILLPLWKDSFVD 297

Query: 301 ANNSAIQLHQPVMSSLEEILFFLQAPTQTSLSLPLINSIYDMLDYLVYDLMIPFMKRKVS 360
             NS IQLHQPVMSSLEEILFFL+APTQT LSLPLINSIYDMLDYLVYDLMIPFMKRK+S
Sbjct: 298 VENSNIQLHQPVMSSLEEILFFLRAPTQTKLSLPLINSIYDMLDYLVYDLMIPFMKRKIS 357

Query: 361 FWEETILQPRKSLFNGAKFFKKFMNKNPSNGNHHHNSLTSDNQGNEYFASSSSEFLMRKL 420
           FWEETILQPRKSLFNGAKFFKKFMNK P NGNH HNSLT DNQGNEYFASSSSEFLMRKL
Sbjct: 358 FWEETILQPRKSLFNGAKFFKKFMNKAPVNGNHQHNSLTKDNQGNEYFASSSSEFLMRKL 417

Query: 421 ADWSMMLSDFKTAYSTYESLMDDLDAFPKYLASCIEWCAVSLLMGAQRIVTVKMIKNDIN 480
           ADWSMMLSDFKTAYSTYESLMDDLDAFPKYLASCIEWCAVSLLMGAQ IVTVKMIKNDIN
Sbjct: 418 ADWSMMLSDFKTAYSTYESLMDDLDAFPKYLASCIEWCAVSLLMGAQSIVTVKMIKNDIN 477

Query: 481 PLIEKALATYENCXXXXXXXXXXXXXXNTVEPVRSYETRCMILASELFLSLSDKWTSTPY 540
           PLIE+ALATYENC                +EPVRSYETRCMILASELFLSLSD WTSTPY
Sbjct: 478 PLIERALATYENCSRMQRRNSKELTSSGVLEPVRSYETRCMILASELFLSLSDTWTSTPY 537

Query: 541 AIQYLETILDECKLGPCCQIMIWERLSDCYSLRVDPRIKHRVGAMKKGIRDTEDLRGGDG 600
           AIQYLETILDECKLGPC QIM+WERLSDCY+LRVDPR+KH+VG MKK +++TEDLR  D 
Sbjct: 538 AIQYLETILDECKLGPCSQIMVWERLSDCYNLRVDPRVKHKVGGMKKSVKNTEDLRNDDE 597

Query: 601 NSTDHFTDDDILSEGLTRKRKAAFFRLIAARKWAEQKQWRQVSWCLKDIESIYSDIKFLN 660
             TDHFT++DILSEGLTR+RKAAFFRL+AA+KWAEQKQWRQVSWCLKDIE+ YSDI FL+
Sbjct: 598 YDTDHFTEEDILSEGLTRRRKAAFFRLMAAKKWAEQKQWRQVSWCLKDIENTYSDIDFLH 657

Query: 661 GDGLILSKLHNQLNLKDLNSAPSPTEKNPTMTSVSFI 697
           G+GLILS L NQLN KD++SAP+PTEKNPT TS+++I
Sbjct: 658 GNGLILSNLKNQLNSKDVDSAPTPTEKNPTKTSINYI 694

>NCAS0B03880 Chr2 complement(691369..693489) [2121 bp, 706 aa] {ON}
           Anc_8.255 YDR108W
          Length = 706

 Score =  894 bits (2310), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 446/704 (63%), Positives = 524/704 (74%), Gaps = 26/704 (3%)

Query: 1   MVFSYEHYMNLLFHLDNSKETVPPEIAKRIVSNAIAPVITVTSTPLFDKHIQEAYKVDSL 60
           M FSYEHYMNLLFHLD  KETVP EIAKRIVSNAI+PVI VTST   D HI E Y +DSL
Sbjct: 1   MNFSYEHYMNLLFHLDYGKETVPSEIAKRIVSNAISPVIAVTSTSELDHHILETYNIDSL 60

Query: 61  YMLLRFFGGCVSDRDQANEVKVGQDEHQVGDTNASMESFSKSKNLEVPNLPKKGSRSRSN 120
           YMLLRFF GCVSDRDQANE++  Q +    +   ++ + S      +P +  +G RSRSN
Sbjct: 61  YMLLRFFSGCVSDRDQANELEKSQKDKISSNNTLTLPTTSP-----LPKVRTRG-RSRSN 114

Query: 121 SLFQRDSTQSQYIRFTRPLDDLIETRDTNDMLFNYHSLEVFLDNYLKLVADNTDEMVPHD 180
           SLFQRDSTQSQYIRFT+PL D+I T++ NDMLF+YHSLE++L NYL L+  NTD+  P++
Sbjct: 115 SLFQRDSTQSQYIRFTKPLGDVIATKNANDMLFDYHSLEIYLQNYLDLIQKNTDDNTPYE 174

Query: 181 LLKKSIYHSFFSLAISSTNNLSPYETFNHPILSLIALDISNGEVYEDARDLLVNFKNLNH 240
           LLKKSIYHSFFSLAISST  LSPYE FNHP++SLIA+DIS G+ Y+D RDLLV+FKNLN 
Sbjct: 175 LLKKSIYHSFFSLAISSTTILSPYECFNHPVVSLIAVDISLGQNYDDVRDLLVDFKNLNS 234

Query: 241 NTENFPLFMNTNEMLPVFLLCYNDESQEEFEKCXXXXXXXXXXXFVESVLLSLWKDSFIE 300
           +T NFP+FMNTN+MLPV LLCY+D+  E+FE C           FVE + L LWKDS+  
Sbjct: 235 STHNFPIFMNTNDMLPVVLLCYDDQFIEQFETCQALTKKIKKQLFVECISLPLWKDSY-- 292

Query: 301 ANNSAIQLHQPVMSSLEEILFFLQAPTQTSLSLPLINSIYDMLDYLVYDLMIPFMKRKVS 360
            ++  + LHQPVMSSLEE+++FL  P + +L   LI SIY++LD LVY+LMIPFMKRK++
Sbjct: 293 PSDPQVHLHQPVMSSLEEMIYFLNQPKEVTLPYELIQSIYNILDSLVYNLMIPFMKRKIA 352

Query: 361 FWEETILQPRKSLFNGAKFFKKFMNKNPSNGNHHHNSLTSDNQGNEYFASSSSEFLMRKL 420
           FW+ETILQPRKSLF+GAKF KKFM K  +   H  N LT D QGNEYF S+SSEFLMRKL
Sbjct: 353 FWDETILQPRKSLFHGAKFLKKFMTK--TALTHQENLLTKDAQGNEYFTSASSEFLMRKL 410

Query: 421 ADWSMMLSDFKTAYSTYESLMDDLDAFPKYLASCIEWCAVSLLMGAQRIVTVKMIKNDIN 480
           ADWSMMLSDFKTAY+TYESL  DL++FPKY ASC+EWCAVSLLMGAQ IVTVKM+KNDIN
Sbjct: 411 ADWSMMLSDFKTAYATYESLTHDLESFPKYSASCLEWCAVSLLMGAQNIVTVKMLKNDIN 470

Query: 481 PLIEKALATYENCXXXXXXXXXXXXXXNTVEPVRSYETRCMILASELFLSLSDKWTSTPY 540
           PLIEKAL+TYENC                V PVRSYETRCMILASELFLSLSD WTSTPY
Sbjct: 471 PLIEKALSTYENCATVLPETDKRNTDELIVVPVRSYETRCMILASELFLSLSDTWTSTPY 530

Query: 541 AIQYLETILDECKLGPCCQIMIWERLSDCYSLRVDPRIKHRVGA---------------M 585
           AI YLETIL ECKLG C QIMIWERLSDCY LRVDPRIKH+                  M
Sbjct: 531 AISYLETILVECKLGACSQIMIWERLSDCYELRVDPRIKHKAAGTIANTSSPKKSSESDM 590

Query: 586 KKGIRDTEDLRGGD-GNSTDHFTDDDILSEGLTRKRKAAFFRLIAARKWAEQKQWRQVSW 644
           +  +     L   D  N  ++ TD DI+S+G TRKRKAAFFRL+AA+KWAEQK+WRQVSW
Sbjct: 591 QGHVMTPSPLTKEDVSNDANNDTDQDIVSKGFTRKRKAAFFRLMAAKKWAEQKRWRQVSW 650

Query: 645 CLKDIESIYSDIKFLNGDGLILSKLHNQLNLKDLNSAPSPTEKN 688
           CL+ I+  YS I   + D LIL K+ N+L   +  +  +  EKN
Sbjct: 651 CLQSIDDTYSKIGLADRDDLILKKIQNKLKTAETETIDAGAEKN 694

>NDAI0J01410 Chr10 complement(323873..326023) [2151 bp, 716 aa] {ON}
           Anc_8.255 YDR108W
          Length = 716

 Score =  875 bits (2262), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 446/701 (63%), Positives = 524/701 (74%), Gaps = 38/701 (5%)

Query: 1   MVFSYEHYMNLLFHLDNSKETVPPEIAKRIVSNAIAPVITVTSTPLFDKHIQEAYKVDSL 60
           MVFSYEHYMNLLFHLD++KE+VPPEIAKRIVSNAIAPVITVTSTP  D HIQE Y +DSL
Sbjct: 1   MVFSYEHYMNLLFHLDHAKESVPPEIAKRIVSNAIAPVITVTSTPQLDNHIQETYNIDSL 60

Query: 61  YMLLRFFGGCVSDRDQANEVKVGQDEHQVGD-TNAS--MESFSKSKNLEVPNLPKKGSRS 117
           YMLLR+FGGCVSDRDQANE+ VG+ E  V   TN S  + S       + P L  +  RS
Sbjct: 61  YMLLRYFGGCVSDRDQANEL-VGKQELDVTHPTNPSNPVSSLIVPSGQQQPPLKARRGRS 119

Query: 118 RSNSLFQRDSTQSQYIRFTRPLDDLIETRDTNDMLFNYHSLEVFLDNYLKLVADNTDEMV 177
           RSNSLFQRDSTQSQYIRFT+P+DD++  + +NDMLF+YHSLE++L+ YL+L+A NT+   
Sbjct: 120 RSNSLFQRDSTQSQYIRFTKPIDDIVAIKSSNDMLFDYHSLEIYLEQYLQLIATNTNNST 179

Query: 178 PHDLLKKSIYHSFFSLAISSTNNLSPYETFNHPILSLIALDISNGEVYEDARDLLVNFKN 237
           P++LLK SIYH+FFSLAISST  LSPYETFNHPI+SLIA+DIS G+ Y+D RDLLV FKN
Sbjct: 180 PYELLKNSIYHNFFSLAISSTTQLSPYETFNHPIVSLIAVDISMGQTYDDIRDLLVEFKN 239

Query: 238 LNHNTENFPLFMNTNEMLPVFLLCYNDESQEEFEKCXXXXXXXXXXXFVESVLLSLWKDS 297
           LN  T NFP+FMNTN+MLP+FLLCY+   QE+FE C           FVES++L LW + 
Sbjct: 240 LNTTTPNFPIFMNTNDMLPIFLLCYDANYQEQFEICQSLTKRLKKQLFVESLILPLWNEQ 299

Query: 298 FIEANNSAIQLHQPVMSSLEEILFFLQAPTQTSLSLPLINSIYDMLDYLVYDLMIPFMKR 357
           +    +  + LHQP+MSSLEE+++FLQ P    LS+ LINSIY++LD L+YDLM+PFMKR
Sbjct: 300 Y--EIDIKVDLHQPIMSSLEEMIYFLQTPFSAKLSISLINSIYNILDSLIYDLMLPFMKR 357

Query: 358 KVSFWEETILQPRKSLFNGAKFFKKFMNKNPSNGNHHHNSLTSDNQGNEYFASSSSEFLM 417
           K+ FWEETILQPR+SLF+GAKF KKFM KN  N     N LT D++GNEYFA SS+E LM
Sbjct: 358 KLLFWEETILQPRRSLFHGAKFLKKFMTKN--NNGPQENILTKDSEGNEYFAFSSTELLM 415

Query: 418 RKLADWSMMLSDFKTAYSTYESLMDDLDAFPKYLASCIEWCAVSLLMGAQRIVTVKMIKN 477
           RKLADWSMM+SDFKTAYSTYESL  DLD FPKYLASC+EWCA SLLMGAQ IVTVKMIKN
Sbjct: 416 RKLADWSMMISDFKTAYSTYESLSRDLDTFPKYLASCLEWCATSLLMGAQSIVTVKMIKN 475

Query: 478 DINPLIEKALATYENCXXXXXXXXXXXX-XXNTVEPVRSYETRCMILASELFLSLSDKWT 536
           DINPLIE+AL TYENC                +VEP+RSYETRCMIL SELFLSLSD WT
Sbjct: 476 DINPLIERALQTYENCAITLIQDTTNKVFAEQSVEPLRSYETRCMILLSELFLSLSDTWT 535

Query: 537 STPYAIQYLETILDECKLGPCCQIMIWERLSDCYSLRVDPRIKHRVGAMK---------- 586
           STPYAI YLETIL ECKLGPC QI IWERLSDCY LR+DPRI++++              
Sbjct: 536 STPYAITYLETILTECKLGPCSQIQIWERLSDCYKLRIDPRIRYKINDTATTTTTVTTTT 595

Query: 587 -------------KGIRDTEDLRGGDGNSTDHFTDDDILSEGLTRKRKAAFFRLIAARKW 633
                        K I+   DL    G+        +ILS+G TR+RK+AFFRLIAA+KW
Sbjct: 596 ADKVVATPSTDKPKTIQWESDLESKLGSG------KNILSKGFTRRRKSAFFRLIAAKKW 649

Query: 634 AEQKQWRQVSWCLKDIESIYSDIKFLNGDGLILSKLHNQLN 674
           AEQKQWRQV+WCLKD+ESIY        D LI++KL N L+
Sbjct: 650 AEQKQWRQVAWCLKDMESIYDATDLGKRDDLIVAKLRNLLD 690

>ZYRO0C01826g Chr3 complement(143874..145973) [2100 bp, 699 aa] {ON}
           similar to uniprot|P46944 Saccharomyces cerevisiae
           YDR108W GSG1 Subunit of TRAPP (transport protein
           particle) a multi-subunit complex involved in targeting
           and/or fusion of ER-to-Golgi transport vesicles with
           their acceptor compartment protein has late meiotic role
           following DNA replication
          Length = 699

 Score =  870 bits (2247), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 430/695 (61%), Positives = 528/695 (75%), Gaps = 36/695 (5%)

Query: 1   MVFSYEHYMNLLFHLDNSKETVPPEIAKRIVSNAIAPVITVTSTPLFDKHIQEAYKVDSL 60
           M  SYE+YMNLLFHLD+ +ETVPP+IA+RIVSNA++PVITV+STP  D+HI++ Y +DSL
Sbjct: 1   MKLSYENYMNLLFHLDHGQETVPPDIARRIVSNAVSPVITVSSTPELDRHIRDTYHLDSL 60

Query: 61  YMLLRFFGGCVSDRDQANE---VKVGQDEHQVGDTNASMESF---SKSKNLEVPNLPKKG 114
           YM LRFFG CVSDRDQANE   ++  ++   V +  +  ++    S+  +L+VP+     
Sbjct: 61  YMFLRFFGDCVSDRDQANEYQPLRSKEEPELVAEPPSKADNLIENSRKSSLKVPSTSSDT 120

Query: 115 S-------------RSRSNSLFQRDSTQSQYIRFTRPLDDLIETRDTNDMLFNYHSLEVF 161
                         R RSNSLFQRD TQSQY+RFTRP+DDLIE+ D+NDMLF+YHSLEVF
Sbjct: 121 KNTTTSTSGTTGGTRKRSNSLFQRDQTQSQYVRFTRPIDDLIESSDSNDMLFDYHSLEVF 180

Query: 162 LDNYLKLVADNTDEMVPHDLLKKSIYHSFFSLAISSTNNLSPYETFNHPILSLIALDISN 221
           L+N L+LV + TD+  P +LLKKS+YH FFSLAISST  LSPYETFNHP++SLIA+DIS 
Sbjct: 181 LENTLRLVEEYTDDNTPFELLKKSLYHKFFSLAISSTTYLSPYETFNHPVVSLIAIDISA 240

Query: 222 GEVYEDARDLLVNFKNLNHNTENFPLFMNTNEMLPVFLLCYNDESQEEFEKCXXXXXXXX 281
           G+ YE+ARDLL+ FKNLNH  ENFP+FM+T ++LPVFLLCYNDES++E   C        
Sbjct: 241 GQGYEEARDLLIKFKNLNHTVENFPIFMSTGDILPVFLLCYNDESEDEQNACQQLANQLK 300

Query: 282 XXXFVESVLLSLWKDSFIEANNSAIQLHQPVMSSLEEILFFLQAPTQTSLSLPLINSIYD 341
              FVES+LL LWK S+  +++  ++LHQP+MSSLEE+L+FLQ+PT T L L LIN  Y+
Sbjct: 301 KQLFVESLLLPLWKRSY--SDHGEVELHQPIMSSLEEMLYFLQSPTPTRLPLQLINVTYN 358

Query: 342 MLDYLVYDLMIPFMKRKVSFWEETILQPRKSLFNGAKFFKKFMNKNPSNGNHHHN--SLT 399
           +L+ LV DLM+PFMKRK+SFWEETILQPRKSLF+GA FFKK M+KN SNG+++H   SL 
Sbjct: 359 ILEKLVKDLMVPFMKRKISFWEETILQPRKSLFHGANFFKKLMSKN-SNGSNNHQPISLG 417

Query: 400 SDNQGNEYFASSSSEFLMRKLADWSMMLSDFKTAYSTYESLMDDLDAFPKYLASCIEWCA 459
            D  GNEYF +SS+EFLMRKLADWSMMLSDFKTAYSTYESL+ DL+ FPKYLASC EWCA
Sbjct: 418 KDKNGNEYFVASSTEFLMRKLADWSMMLSDFKTAYSTYESLVHDLENFPKYLASCFEWCA 477

Query: 460 VSLLMGAQRIVTVKMIKNDINPLIEKALATYENCXXXXXXXXXXXXXXNTVEPVRSYETR 519
           VS+LMGAQ IVTVKMIKNDI+PLI++AL TYENC                  PVRSYETR
Sbjct: 478 VSVLMGAQNIVTVKMIKNDIDPLIQRALETYENCAADEDSTGEELYV-----PVRSYETR 532

Query: 520 CMILASELFLSLSDKWTSTPYAIQYLETILDECKLGPCCQIMIWERLSDCYSLRVDPRIK 579
           CM LASELFLSLSD WTSTPYA+  LETIL EC+LGPC +IMIWERLSDCY  R+DPRI+
Sbjct: 533 CMFLASELFLSLSDTWTSTPYALNSLETILTECRLGPCSEIMIWERLSDCYYQRIDPRIR 592

Query: 580 HRVGAMKKGIRDTEDLRGGDGNSTDHFTDDDILSEGLTRKRKAAFFRLIAARKWAEQKQW 639
           H+  A  +G +   D    D  S     +++I++ GLTRKRKAAFFRLIAA KW EQKQW
Sbjct: 593 HKTSA--QGAKAMTDELAPDEES-----NEEIVTRGLTRKRKAAFFRLIAANKWVEQKQW 645

Query: 640 RQVSWCLKDIESIYSDIKFLNGDGLILSKLHNQLN 674
           +Q  WCLK+IE  Y+ + F+N + LIL++L  Q+N
Sbjct: 646 KQAFWCLKEIEEAYAGLDFVNREDLILARLKRQMN 680

>CAGL0B01705g Chr2 (157245..159263) [2019 bp, 672 aa] {ON} highly
           similar to uniprot|P46944 Saccharomyces cerevisiae
           YDR108w GSG1
          Length = 672

 Score =  856 bits (2211), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 416/673 (61%), Positives = 508/673 (75%), Gaps = 8/673 (1%)

Query: 1   MVFSYEHYMNLLFHLDNSKETVPPEIAKRIVSNAIAPVITVTSTPLFDKHIQEAYKVDSL 60
           MVFSYEHYMNL++HLD++ ETVP +IAKR+VSNA+APVITVTST L D+HI+E Y +DSL
Sbjct: 1   MVFSYEHYMNLIYHLDDANETVPSDIAKRVVSNAMAPVITVTSTVLLDRHIEETYGIDSL 60

Query: 61  YMLLRFFGGCVSDRDQANEVKVGQDEHQVGDTNASMESFSKSKNLEVPNLPKKGSRSRSN 120
           YMLLRFFGGCVSDRDQANEVK+G D  +V +     E    +  L VP   +   RS SN
Sbjct: 61  YMLLRFFGGCVSDRDQANEVKLGTDGLKVTEEGVENEK-DGTNGLTVPR--QTRVRSNSN 117

Query: 121 SLFQRDSTQSQYIRFTRPLDDLIETRDTNDMLFNYHSLEVFLDNYLKLVADNTDEMVPHD 180
           SL+QRD+TQSQY+RFT+PL DLI T+D NDMLF+YHSLEV+L  YL +V       +PH 
Sbjct: 118 SLYQRDATQSQYVRFTKPLADLINTQDANDMLFDYHSLEVYLQEYLSVVDKKFSPHIPHH 177

Query: 181 LLKKSIYHSFFSLAISSTNNLSPYETFNHPILSLIALDISNGEVYEDARDLLVNFKNLNH 240
           LLK SIYHSFF+LAISST+ LSP+E FNHPI+SL+A+DI+  E YE A + L  FK++N+
Sbjct: 178 LLKTSIYHSFFALAISSTSKLSPFECFNHPIVSLLAIDITRNEDYETAAEQLKEFKSMNN 237

Query: 241 NTENFPLFMNTNEMLPVFLLCYNDESQEEFEKCXXXXXXXXXXXFVESVLLSLWKDSFIE 300
           N  +FP F+NTN++LPVFLLCYN +++ EFE+C           FVES++L LW   F  
Sbjct: 238 NIPSFPSFINTNDILPVFLLCYNKDNETEFEECQTLAGKLKKQLFVESIILPLWSTEF-- 295

Query: 301 ANNSAIQLHQPVMSSLEEILFFLQAPTQTSLSLPLINSIYDMLDYLVYDLMIPFMKRKVS 360
            +N  + LHQPVMSS+EEI+FFLQ P    L L L+N IYD +D +VYDLM PFMKRK++
Sbjct: 296 TDNLVVSLHQPVMSSIEEIMFFLQNPVDHKLPLKLVNCIYDQIDMIVYDLMKPFMKRKMT 355

Query: 361 FWEETILQPRKSLFNGAKFFKKFMNKNPSNGNHHHNSLTSDNQGNEYFASSSSEFLMRKL 420
           FWEETIL PRKSLF+GAKFFKKFMNK+ +      NSL  +N G+ Y +S+S EFLMRKL
Sbjct: 356 FWEETILTPRKSLFHGAKFFKKFMNKS-TQALSQPNSLLKENHGSNYLSSTSPEFLMRKL 414

Query: 421 ADWSMMLSDFKTAYSTYESLMDDLDAFPKYLASCIEWCAVSLLMGAQRIVTVKMIKNDIN 480
           ADWSMM+SDFKTAY+TYESL  D +  PKYLASC EWCAVSLLMGAQ IVT KM+KN+IN
Sbjct: 415 ADWSMMVSDFKTAYTTYESLCQDFERMPKYLASCSEWCAVSLLMGAQNIVTAKMLKNEIN 474

Query: 481 PLIEKALATYENCXXXXXXXXXXXXXXNTVEPVRSYETRCMILASELFLSLSDKWTSTPY 540
           P IE+AL  YE C              +   PVRSYETRCM LASELFLSLSD WTSTP+
Sbjct: 475 PAIERALGAYELCATESNAHRKFGDSDDLSAPVRSYETRCMFLASELFLSLSDTWTSTPF 534

Query: 541 AIQYLETILDECKLGPCCQIMIWERLSDCYSLRVDPRIKHRVGAMKKGIRDTEDLRGGDG 600
           AI YLETIL+ECKLGP  +IMIWERLSDCY +R+DPRIKHR+G ++   +  E++   D 
Sbjct: 535 AIAYLETILNECKLGPLSEIMIWERLSDCYGMRIDPRIKHRIGNLELLQKKEENM--DDP 592

Query: 601 NSTDHFTDDDILSEGLTRKRKAAFFRLIAARKWAEQKQWRQVSWCLKDIESIYSDIKFLN 660
            + D FT +DILS+GLTR RKAA F+LIAARKW EQKQWR++SWCL D+ES YSD+K  N
Sbjct: 593 KNADVFTTEDILSKGLTRNRKAALFKLIAARKWCEQKQWRELSWCLDDLESTYSDLKCFN 652

Query: 661 GDGLILSKLHNQL 673
            + L+ ++L N+L
Sbjct: 653 KENLLYTRLRNEL 665

>TDEL0F03820 Chr6 (699240..701303) [2064 bp, 687 aa] {ON} Anc_8.255
           YDR108W
          Length = 687

 Score =  847 bits (2189), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 419/681 (61%), Positives = 513/681 (75%), Gaps = 19/681 (2%)

Query: 3   FSYEHYMNLLFHLDNSKETVPPEIAKRIVSNAIAPVITVTSTPLFDKHIQEAYKVDSLYM 62
            SYE+YMNLL HLD+  + VP +IAKRIVSNAI+PVI VTSTP  D+HIQE + +DSLYM
Sbjct: 4   LSYENYMNLLLHLDHGDDRVPADIAKRIVSNAISPVICVTSTPELDRHIQETHHLDSLYM 63

Query: 63  LLRFFGGCVSDRDQANEVKVGQDEHQVGDTNASMESFSKSKNLEVPNLPKKGSRSRSNSL 122
           LLRFFG CV DRDQA+E          GD  A     S S  L V + P   SR RSNSL
Sbjct: 64  LLRFFGDCVGDRDQAHECTSAGSPS--GDDRAEK---SSSSTLAVASGP---SRKRSNSL 115

Query: 123 FQRDSTQSQYIRFTRPLDDLIETRDTNDMLFNYHSLEVFLDNYLKLVADNTDEMVPHDLL 182
           FQRD+TQSQYIRFTRPL DL+E+ DTNDMLF+YH+LE FL+N L L+  +T++  PH LL
Sbjct: 116 FQRDATQSQYIRFTRPLRDLVESADTNDMLFDYHTLESFLENILLLIEKSTNDKTPHKLL 175

Query: 183 KKSIYHSFFSLAISSTNNLSPYETFNHPILSLIALDISNGEVYEDARDLLVNFKNLNHNT 242
           KKS+YH FFSLAISST  LSPYETFNHP++SLIALDI  G+ YE+ARDLL  FKNLNH T
Sbjct: 176 KKSLYHRFFSLAISSTAYLSPYETFNHPVVSLIALDIPIGQGYEEARDLLTKFKNLNHTT 235

Query: 243 ENFPLFMNTNEMLPVFLLCYNDESQEEFEKCXXXXXXXXXXXFVESVLLSLWKDSFIEAN 302
           +NFP+F+NTN++LPVFLLCYN +S+E++E C           FVE +LL LWKD++  A 
Sbjct: 236 KNFPVFLNTNDVLPVFLLCYNGDSEEQYEICQSLTKKLKKQLFVEGILLPLWKDNYKTA- 294

Query: 303 NSAIQLHQPVMSSLEEILFFLQAPTQTSLSLPLINSIYDMLDYLVYDLMIPFMKRKVSFW 362
            + + LHQP+M+SL+E+L+FL+ P++  LSL LINSIYD+L+ L+  LMIPFM+RK+SFW
Sbjct: 295 -TQVILHQPIMTSLDEVLYFLREPSRIELSLELINSIYDVLEILINGLMIPFMQRKISFW 353

Query: 363 EETILQPRKSLFNGAKFFKKFMNKNPSNGN-HHHNSLTSDNQGNEYFASSSSEFLMRKLA 421
           EETILQPR+SLF+G+KF K+FM+K  S  N H   S+  D  G EYF SSS+EFLMRKLA
Sbjct: 354 EETILQPRRSLFHGSKFLKRFMSKTTSGTNIHQQASIAKDANGKEYFVSSSAEFLMRKLA 413

Query: 422 DWSMMLSDFKTAYSTYESLMDDLDAFPKYLASCIEWCAVSLLMGAQRIVTVKMIKNDINP 481
           DWSMMLSD+KTAYSTY+SL  DL+ +PKYLASC+EWC+VS+LMGAQ IVT KM+K DI+P
Sbjct: 414 DWSMMLSDYKTAYSTYDSLSHDLEHYPKYLASCLEWCSVSVLMGAQNIVTAKMLKTDIDP 473

Query: 482 LIEKALATYENCXXXXXXXXXXXXXXNTVEPVRSYETRCMILASELFLSLSDKWTSTPYA 541
           LI++A+ TYENC              N++ PVRSYETRCM LASELFLSLSD WTSTPYA
Sbjct: 474 LIQRAVETYENC-ALYDTQLSGSKKSNSMAPVRSYETRCMFLASELFLSLSDTWTSTPYA 532

Query: 542 IQYLETILDECKLGPCCQIMIWERLSDCYSLRVDPRIKHRV--GAMKKGIRDTEDLRGGD 599
           ++ LETIL EC+LGPC QIMIWERLS+CY  R+D RI+H+V  GAM     + E +   D
Sbjct: 533 LRNLETILAECRLGPCSQIMIWERLSNCYQQRIDHRIRHKVNDGAMS----NEEKVENED 588

Query: 600 GNSTDHFTDDDILSEGLTRKRKAAFFRLIAARKWAEQKQWRQVSWCLKDIESIYSDIKFL 659
            +  +H T  DI++ GLTR RKAAFF+LIAA KWAEQKQWRQ SWCLKD E  Y+ I+F+
Sbjct: 589 DSEKEH-THADIVTRGLTRMRKAAFFQLIAANKWAEQKQWRQASWCLKDTEDAYAGIEFV 647

Query: 660 NGDGLILSKLHNQLNLKDLNS 680
           N   L L+KL   L   +++S
Sbjct: 648 NRKDLALAKLKETLKNVEIDS 668

>Kpol_392.11 s392 complement(30871..32898) [2028 bp, 675 aa] {ON}
           complement(30871..32898) [2028 nt, 676 aa]
          Length = 675

 Score =  830 bits (2145), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 408/675 (60%), Positives = 511/675 (75%), Gaps = 17/675 (2%)

Query: 3   FSYEHYMNLLFHLDNSKETVPPEIAKRIVSNAIAPVITVTSTPLFDKHIQEAYKVDSLYM 62
           FSYE+YMNL++HLD   E VP +I+KRIVSNAIAPVITV ST   D+H+Q++Y +DSLY+
Sbjct: 6   FSYENYMNLVYHLDRVNEPVPQDISKRIVSNAIAPVITVMSTSELDQHVQDSYNIDSLYL 65

Query: 63  LLRFFGGCVSDRDQANE-VKVGQDEH--QVGDTNASMESFSKSKNLEVPNLPKKGSRSRS 119
           L+R+FGGC+SDRDQANE VK    E+  Q G  +  +E    S  LE+P   ++ SRSRS
Sbjct: 66  LMRYFGGCISDRDQANEYVKKANVENTAQEGVNDQIIEEQRNSNTLELPK-SERYSRSRS 124

Query: 120 NSLFQRDSTQSQYIRFTRPLDDLIETRDTNDMLFNYHSLEVFLDNYLKLVADNTDEMVPH 179
           NSLFQRDSTQS YIRFT+P++DLI +RD++DMLF+YHSLEV+L+  L L+  NT++   H
Sbjct: 125 NSLFQRDSTQSHYIRFTKPIEDLINSRDSHDMLFDYHSLEVYLEKCLSLIDKNTNDETDH 184

Query: 180 DLLKKSIYHSFFSLAISSTNNLSPYETFNHPILSLIALDISNGEVYEDARDLLVNFKNLN 239
             LK S++H FFS AISST  LSPYE+FNHP++SL+ALDIS G+ YEDARDLL+ FKN N
Sbjct: 185 KALKMSLFHRFFSSAISSTTYLSPYESFNHPLISLVALDISKGQNYEDARDLLIKFKNQN 244

Query: 240 HNTENFPLFMNTNEMLPVFLLCYNDESQEEFEKCXXXXXXXXXXXFVESVLLSLWKDSFI 299
           +  E FP FM+TN++L VFLLCY+ +S+E+ E C           F ES++L LW  S  
Sbjct: 245 NAVEEFPPFMSTNDILLVFLLCYDGDSEEQKEICQDVVKKLKKQLFAESLMLPLWNKSHS 304

Query: 300 EANNSAIQLHQPVMSSLEEILFFLQAPTQTSLSLPLINSIYDMLDYLVYDLMIPFMKRKV 359
           E  +  ++LHQP MSSL+E+L+F + P+   L L LIN+IYD+++ LV DLMIPFM+RK+
Sbjct: 305 E--DVQVELHQPAMSSLDEMLYFFERPSVHELPLNLINTIYDLMEKLVVDLMIPFMQRKI 362

Query: 360 SFWEETILQPRKSLFNGAKFFKKFMNKNPSNGNHHHNSLTSDNQGNEYFASSSSEFLMRK 419
           SFWEETILQPRKSLF+G K F+KFMN++ S   + +N++  D++GNEYF SSS EFL+RK
Sbjct: 363 SFWEETILQPRKSLFHGNKLFRKFMNRSSSQTANQYNNIVKDSRGNEYFTSSSPEFLLRK 422

Query: 420 LADWSMMLSDFKTAYSTYESLMDDLDAFPKYLASCIEWCAVSLLMGAQRIVTVKMIKNDI 479
           LADWSMM+SDFKTAYSTYE+L+ DL+A PKYLASC+EWCA+S+LMGAQ IVT KMIKND+
Sbjct: 423 LADWSMMISDFKTAYSTYETLISDLEAHPKYLASCLEWCAISILMGAQNIVTAKMIKNDV 482

Query: 480 NPLIEKALATYENCXXXXXXXXXXXXXXNTVEPVRSYETRCMILASELFLSLSDKWTSTP 539
           NPLIE++L TYE C              +  EPVRSYETRCM+L SELFLSL+D WTSTP
Sbjct: 483 NPLIERSLDTYEQCSILAQNSLENDELLS--EPVRSYETRCMLLTSELFLSLNDTWTSTP 540

Query: 540 YAIQYLETILDECKLGPCCQIMIWERLSDCYSLRVDPRIKHRVGAMKKGIRDTEDLRGGD 599
           YA+  LETIL ECKLG C QIMIWERLSDCY++R DPRI+HRV  + K     E+  GG 
Sbjct: 541 YALSNLETILAECKLGICSQIMIWERLSDCYNMRTDPRIRHRVETVTK----IENNEGGQ 596

Query: 600 GNSTDHFTDDDILSEGLTRKRKAAFFRLIAARKWAEQKQWRQVSWCLKDIESIYSDIKFL 659
              T     DDI+S+GL RKRKAAFFRL+AA+KWAEQKQWRQVSWCL+D+E IY D+ F 
Sbjct: 597 QLQT-----DDIVSKGLARKRKAAFFRLLAAKKWAEQKQWRQVSWCLRDVEYIYDDLSFS 651

Query: 660 NGDGLILSKLHNQLN 674
               LI  KL ++LN
Sbjct: 652 KRPELIYQKLKDELN 666

>KAFR0B05570 Chr2 complement(1140432..1142441) [2010 bp, 669 aa]
           {ON} Anc_8.255 YDR108W
          Length = 669

 Score =  791 bits (2044), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 402/678 (59%), Positives = 499/678 (73%), Gaps = 23/678 (3%)

Query: 3   FSYEHYMNLLFHLDNSKETVPPEIAKRIVSNAIAPVITVTSTPLFDKHIQEAYKVDSLYM 62
           FSYEHYMNLLFHL+ S E +P EIA+RIVS+AIAPVITVTSTP  DKHIQ+ Y +DSLYM
Sbjct: 4   FSYEHYMNLLFHLECSDENIPSEIARRIVSHAIAPVITVTSTPELDKHIQDTYSIDSLYM 63

Query: 63  LLRFFGGCVSDRDQANEVKVGQDEHQVGDTNASMESFSKSKNLEVPNLPKKGSRSRSNSL 122
           LLRFFGGCVSDRDQA+E K          T                      +RSRSNSL
Sbjct: 64  LLRFFGGCVSDRDQASESKANAPHSSSSLTTTKTTR----------------ARSRSNSL 107

Query: 123 FQRDSTQSQYIRFTRPLDDLIETRDTNDMLFNYHSLEVFLDNYLKLVADNTDEMVPHDLL 182
           FQRDSTQSQYIRFTRPL DL+E  D NDMLF++HSLE +L  YL+LV   T +   H LL
Sbjct: 108 FQRDSTQSQYIRFTRPLPDLVERHDKNDMLFDHHSLESYLRQYLELVEKFTFDSTSHQLL 167

Query: 183 KKSIYHSFFSLAISSTNNLSPYETFNHPILSLIALDISNGEVYEDARDLLVNFKNLNHNT 242
           KKS+YH+FFSLAISST  LSP+E+FNHPI+SLIALDI+N + YEDA+ LL+ FKNL++  
Sbjct: 168 KKSLYHNFFSLAISSTTTLSPFESFNHPIMSLIALDITNSQSYEDAKGLLIKFKNLHNTI 227

Query: 243 ENFPLFMNTNEMLPVFLLCYNDESQEEFEKCXXXXXXXXXXXFVESVLLSLWKDSFIEAN 302
           + FP+++NT +MLPVFLLCYN +S EE ++C           FVES+ L LWK+S+    
Sbjct: 228 DKFPIYINTYDMLPVFLLCYNADSPEEVQQCEELSVKIKKQLFVESISLPLWKNSY--QT 285

Query: 303 NSAIQLHQPVMSSLEEILFFLQAPTQTSLSLPLINSIYDMLDYLVYDLMIPFMKRKVSFW 362
              I+LHQPVMSSL+E+++FLQ+  Q +L + L N+ YDML+ LVY L+IPFM+RK++FW
Sbjct: 286 EPFIKLHQPVMSSLDEMIYFLQSDEQNTLPIELTNTTYDMLEKLVYALLIPFMQRKIAFW 345

Query: 363 EETILQPRKSLFNGAKFFKKFMNKNPSNGNHHHNSLTSDNQGNEYFASSSSEFLMRKLAD 422
           EET+LQP+KS+F+G+KF KK M++  ++ +   N LT D+ GNEYFASSS E L+RKLAD
Sbjct: 346 EETVLQPKKSIFHGSKFLKKLMSRASTSSHQQQNILTKDHDGNEYFASSSPELLLRKLAD 405

Query: 423 WSMMLSDFKTAYSTYESLMDDLDAFPKYLASCIEWCAVSLLMGAQRIVTVKMIKNDINPL 482
           WS+MLSDFKT Y+TYE L  DL+ FPKYLASC+EW AVSLLMGAQ IVTVKM+KNDI+PL
Sbjct: 406 WSIMLSDFKTGYATYEILSHDLELFPKYLASCLEWEAVSLLMGAQNIVTVKMMKNDISPL 465

Query: 483 IEKALATYENCXXXXXXXXXXXXXXN---TVEPVRSYETRCMILASELFLSLSDKWTSTP 539
           I++AL  Y+ C              N   ++EPV SYETRC+IL+SELFLSLSD WTSTP
Sbjct: 466 IDRALDAYDACAANTHLSNKKIGPTNESTSLEPVLSYETRCLILSSELFLSLSDTWTSTP 525

Query: 540 YAIQYLETILDECKLGPCCQIMIWERLSDCYSLRVDPRIKHRVGAMKK--GIRDTEDLRG 597
           YAI YLE+IL+E +LGPC +IMIWERLSDCY LRVDPRIK +V  ++K   + +  D   
Sbjct: 526 YAINYLESILEESRLGPCSRIMIWERLSDCYDLRVDPRIKSKVEQVQKQDNLEEPADNEH 585

Query: 598 GDGNSTDHFTDDDILSEGLTRKRKAAFFRLIAARKWAEQKQWRQVSWCLKDIESIYSDIK 657
              NS D     +I+S+GLTRKRKAAFFRL+AA+ WAEQ QW+QV WCL +I  IYS + 
Sbjct: 586 RILNSQDDLNPSNIVSQGLTRKRKAAFFRLLAAKMWAEQGQWKQVKWCLDNITDIYSRVG 645

Query: 658 FLNGDGLILSKLHNQLNL 675
            +N D LIL++L  + N+
Sbjct: 646 LVNRDDLILTRLREEYNI 663

>TPHA0B03260 Chr2 complement(749568..751712) [2145 bp, 714 aa] {ON}
           Anc_8.255 YDR108W
          Length = 714

 Score =  768 bits (1984), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 389/719 (54%), Positives = 485/719 (67%), Gaps = 57/719 (7%)

Query: 1   MVFSYEHYMNLLFHLDNSKETVPPEIAKRIVSNAIAPVITVTSTPLFDKHIQEAYKVDSL 60
           M F+YE+YMNL+FHLD   E VP +I+KRIVSNAIAPVITVT+T   D HI E Y +DS 
Sbjct: 1   MTFTYENYMNLIFHLDKVHENVPQDISKRIVSNAIAPVITVTATVELDSHISEEYGIDSF 60

Query: 61  YMLLRFFGGCVSDRDQANE-VKVGQDE---HQVGDTNASM---------------ESFSK 101
           Y LLR+FGGC+SDRDQ+NE +K  +DE   H +   N +                E    
Sbjct: 61  YTLLRYFGGCISDRDQSNEYIKKTEDEQKSHALNKVNLTTIEETKVKLNEDEKMEEELQS 120

Query: 102 SKNLEVPN-------------------LPKKG----SRSRSNSLFQRDSTQSQYIRFTRP 138
            +N+  P                    LPK      +RSRSNSLFQRDSTQSQ+IRFTRP
Sbjct: 121 DQNVINPTNDPTVNNNYLDVDTKTDNLLPKSSQTTRNRSRSNSLFQRDSTQSQFIRFTRP 180

Query: 139 LDDLIETRDTNDMLFNYHSLEVFLDNYLKLVADNTDEMVPHDLLKKSIYHSFFSLAISST 198
           ++DL+ +  T DMLF+YH+LE+FL + LK+V   T + + H  L+KS+YH FFS AISST
Sbjct: 181 IEDLLYSGGTGDMLFDYHTLEIFLGSCLKMVEKYTTDDIDHKTLQKSLYHRFFSSAISST 240

Query: 199 NNLSPYETFNHPILSLIALDISNGEVYEDARDLLVNFKNLNHNTENFPLFMNTNEMLPVF 258
           N LSPYE+FNHPI+SLIA+DI+ G+ YE ARDLL+ FKN N    NFP+FM+TN++LPVF
Sbjct: 241 NCLSPYESFNHPIVSLIAIDITKGQNYELARDLLIAFKNQNTTINNFPIFMSTNDILPVF 300

Query: 259 LLCYNDESQEEFEKCXXXXXXXXXXXFVESVLLSLWKDSFIEANNSAIQLHQPVMSSLEE 318
           +LCYN  S EE EK            F E + + LW   +  +++  ++LHQP MSSL+E
Sbjct: 301 VLCYNGSSAEESEKSTELSKKIKKQLFAECIRMPLWDKRY--SDDITVKLHQPAMSSLDE 358

Query: 319 ILFFLQAPTQTSLSLPLINSIYDMLDYLVYDLMIPFMKRKVSFWEETILQPRKSLFNGAK 378
           +L+  Q      L L LIN IYD L+ L  DLMIPFM+RK++FWEETILQP+KSLF G K
Sbjct: 359 MLYVFQTSKTDKLPLTLINLIYDQLEILTNDLMIPFMQRKITFWEETILQPKKSLFQGTK 418

Query: 379 FFKKFMNKNPSNGNHHHNSLTSDNQGNEYFASSSSEFLMRKLADWSMMLSDFKTAYSTYE 438
            F+KFM +         N    DNQGNEYFAS+S+ FL+RKLADWSMM+SDFKTAY+T+E
Sbjct: 419 LFRKFMGRPSMTNGRQENIPIKDNQGNEYFASTSNVFLLRKLADWSMMISDFKTAYTTFE 478

Query: 439 SLMDDLDAFPKYLASCIEWCAVSLLMGAQRIVTVKMIKNDINPLIEKALATYENCXXXXX 498
           SL++D++ +PKYLASC+EWCAV +LMGAQ IVT KMIKND+NPLIE++L  Y NC     
Sbjct: 479 SLLEDIEMYPKYLASCLEWCAVCILMGAQNIVTTKMIKNDVNPLIERSLDVYGNCALLLN 538

Query: 499 XXXXXXXXXNTVEPVRSYETRCMILASELFLSLSDKWTSTPYAIQYLETILDECKLGPCC 558
                    +T EPVRSYETRCM++ SELFLSLSD WTSTPYA+  LETIL ECKLG C 
Sbjct: 539 SIAESEESPDT-EPVRSYETRCMLITSELFLSLSDTWTSTPYALSNLETILSECKLGACS 597

Query: 559 QIMIWERLSDCYSLRVDPRIKHR----VGAMKKGIRDTEDLRGGDGNSTDHFTDDDILSE 614
           QIMIWERLSDCY+LR DPR+KH+    +          E+++  D +S        I+ +
Sbjct: 598 QIMIWERLSDCYNLRTDPRVKHKLRSNISTSSVSEVSEEEIKKQDVSS--------IVLK 649

Query: 615 GLTRKRKAAFFRLIAARKWAEQKQWRQVSWCLKDIESIYSDIKFLNGDGLILSKLHNQL 673
           GLTR+RKA+FFRL+AA+KWAEQ QWRQVSWCL DI  +Y D  F   + LI  KL   L
Sbjct: 650 GLTRQRKASFFRLLAAKKWAEQHQWRQVSWCLNDISEMYQDTVFGKRESLIYQKLKRNL 708

>Kwal_56.23583 s56 (607721..609823) [2103 bp, 700 aa] {ON} YDR108W
           (GSG1) - involved in meiosis [contig 176] FULL
          Length = 700

 Score =  716 bits (1849), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 372/719 (51%), Positives = 470/719 (65%), Gaps = 72/719 (10%)

Query: 1   MVFSYEHYMNLLFHLDNSKETVPPEIAKRIVSNAIAPVITVTSTPLFDKHIQEAYKVDSL 60
           M  SYE YMNL+ HLD++ E VP EI+++IVSNA++PV+TVTS+   DKHIQE+Y +DSL
Sbjct: 1   MPLSYERYMNLVSHLDSASEPVPSEISRKIVSNAVSPVVTVTSSAALDKHIQESYGLDSL 60

Query: 61  YMLLRFFGGCVSDRDQANEVKVGQDEHQVGDTNASMESFSKSKNLEVPNLPKKGSRSRSN 120
           YMLLR+FG C+SDRDQA+       E + G                 PN  K  +RSRS 
Sbjct: 61  YMLLRYFGDCISDRDQAD------SEQESGVE---------------PN--KSRARSRSG 97

Query: 121 SLFQRDSTQSQYIRFTRPLDDLIETRDTNDMLFNYHSLEVFLDNYLKLVADNTDEMVPHD 180
           SLFQR +  SQ++RFTRPL D+I TR+T D+LF+YHSLEVFL  YL+LV   T    PH 
Sbjct: 98  SLFQRQA--SQFLRFTRPLSDIIGTRETRDLLFDYHSLEVFLQKYLELVDVKTSPDTPHT 155

Query: 181 LLKKSIYHSFFSLAISSTNNLSPYETFNHPILSLIALDISNGEVYEDARDLLVNFKNLNH 240
           LL+ SIYH FF+ AISST +LSPYE FNHP+ SL+ALDIS  E YEDARDLLV FKN+++
Sbjct: 156 LLQHSIYHKFFTTAISSTAHLSPYECFNHPVCSLLALDISQNEGYEDARDLLVTFKNMHN 215

Query: 241 NTENFPLFMNTNEMLPVFLLCYNDESQEEFEKCXXXXXXXXXXXFVESVLLSLWKDSFIE 300
            T +FP F+N N++LPVFLLCY + S+E+FE C           FVES+LL  W  +F  
Sbjct: 216 KTPHFPSFINVNDILPVFLLCYEEGSREQFETCQSLAKMMKKQLFVESLLLPCWSVNFTA 275

Query: 301 ANNSAIQLHQPVMSSLEEILFFLQAPTQTSLSLPLINSIYDMLDYLVYDLMIPFMKRKVS 360
            +     LHQP+MSSLEE +F +   +   L LP I  IYD L  LV +LMIPFMKRK+S
Sbjct: 276 KDTPTRVLHQPIMSSLEETMFSMLKDSAFDLPLPFIEHIYDRLTKLVDELMIPFMKRKIS 335

Query: 361 FWEETILQPRKSLFNGAKFFKKFMNKNPSNGNHHHNSLTSDNQGNEYFASSSSEFLMRKL 420
           FWEE+ILQPR+S+F  +KFF+K ++K P+    +++S T   QG  YFA++S+E L+RKL
Sbjct: 336 FWEESILQPRRSIFPNSKFFRKLISKAPTPST-NNDSATHSEQGLAYFAATSNELLLRKL 394

Query: 421 ADWSMMLSDFKTAYSTYESLMDDLDAFPKYLASCIEWCAVSLLMGAQRIVTVKMIKNDIN 480
           ADWS MLSDFKTAYSTYE L  D +  P+YLA C+EWCA+S+LMGAQ IVTVKMIKNDI+
Sbjct: 395 ADWSFMLSDFKTAYSTYELLSKDFEQHPEYLAPCLEWCALSVLMGAQSIVTVKMIKNDID 454

Query: 481 PLIEKALATYENCXXXXXXXXXXXXXX----------NTVEPV----------------- 513
           PLI +AL +YE C                        N  E +                 
Sbjct: 455 PLITRALKSYELCASKAKERNGLLKSKLQNRDHDKSLNGFETISNSHDDRVSGTTDFEIS 514

Query: 514 -------RSYETRCMILASELFLSLSDKWTSTPYAIQYLETILDECKLGPCCQIMIWERL 566
                  +SYETRCM+LA+ELFLSLSD WT+TPYAI+YLETILD+C +G   +I+IWERL
Sbjct: 515 STPSQSAQSYETRCMLLAAELFLSLSDTWTATPYAIKYLETILDQCTVGALSEIVIWERL 574

Query: 567 SDCYSLRVDPRIKHRVGAMKKGIRDT-----EDLRGGDGNSTDH-------FTDDDILSE 614
           + CY+LRVDPR+K R+ A +    D      E+  G D +S D         +   I S 
Sbjct: 575 AYCYALRVDPRVKSRLTASEIQSSDQNEKLDEESEGSDNDSGDESQVCQHKMSQSCIASS 634

Query: 615 GLTRKRKAAFFRLIAARKWAEQKQWRQVSWCLKDIESIYSDIKFLNGDGLILSKLHNQL 673
           GLTRKRKA  FRLIA +KW E KQWRQ  W  +D+E +YS + F N + LIL KL  ++
Sbjct: 635 GLTRKRKATLFRLIATKKWTESKQWRQACWSFQDLEVMYSHLVFANREDLILKKLEKRI 693

>KLTH0G13860g Chr7 complement(1201656..1203782) [2127 bp, 708 aa]
           {ON} similar to uniprot|P46944 Saccharomyces cerevisiae
           YDR108W GSG1 Subunit of TRAPP (transport protein
           particle) a multi-subunit complex involved in targeting
           and/or fusion of ER-to-Golgi transport vesicles with
           their acceptor compartment protein has late meiotic role
           following DNA replication
          Length = 708

 Score =  701 bits (1810), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 361/719 (50%), Positives = 472/719 (65%), Gaps = 72/719 (10%)

Query: 1   MVFSYEHYMNLLFHLDNSKETVPPEIAKRIVSNAIAPVITVTSTPLFDKHIQEAYKVDSL 60
           M  S+  YMNL FHLD++ E VP EI+++IVS+A++PV+TVTST   D+HIQE+Y VDSL
Sbjct: 1   MPLSFGKYMNLAFHLDSALEPVPTEISRKIVSSAVSPVVTVTSTAALDEHIQESYGVDSL 60

Query: 61  YMLLRFFGGCVSDRDQANEVKVGQDEHQVGDTNASMESFSKSKNLEVPNLPKKGSRSRSN 120
           YMLLR+FG CVSDRDQA      +   ++G  +                  K  +R+RSN
Sbjct: 61  YMLLRYFGDCVSDRDQA------EAGPELGTESG-----------------KNRNRARSN 97

Query: 121 SLFQRDSTQSQYIRFTRPLDDLIETRDTNDMLFNYHSLEVFLDNYLKLVADNTDEMVPHD 180
           SLFQR +  S Y+RFTRPL DLI+ R++ D+LF+YHSLEVFL+ YL LV  NT    PH 
Sbjct: 98  SLFQRQA--SHYLRFTRPLTDLIDVRESRDLLFDYHSLEVFLEKYLSLVEANTTSDTPHT 155

Query: 181 LLKKSIYHSFFSLAISSTNNLSPYETFNHPILSLIALDISNGEVYEDARDLLVNFKNLNH 240
           LL+ SIYH FF+ AISST +LSPYE+FNHP+ SL+ALDIS  + YE+ARDLL+ FKN+++
Sbjct: 156 LLQHSIYHKFFTTAISSTAHLSPYESFNHPVASLLALDISKDQGYEEARDLLIAFKNMHN 215

Query: 241 NTENFPLFMNTNEMLPVFLLCYNDESQEEFEKCXXXXXXXXXXXFVESVLLSLWKDSFIE 300
            T +FP F+N N++LPVFLLCY ++S+E+FE C           FVES+LL  W  +   
Sbjct: 216 TTPHFPAFINVNDILPVFLLCYEEDSREQFELCQSLSKTIKKQLFVESLLLPCWGQNINA 275

Query: 301 ANNSAIQLHQPVMSSLEEILFFLQAPTQTSLSLPLINSIYDMLDYLVYDLMIPFMKRKVS 360
             + +  LHQP+MSSLEE ++ +   +  +L L LIN IYD L  L+ +LMIPFMKRK+S
Sbjct: 276 GASPSRILHQPIMSSLEETMYSMMKESTITLPLSLINYIYDRLTNLIDELMIPFMKRKIS 335

Query: 361 FWEETILQPRKSLFNGAKFFKKFMNKNPSNGNHHHNSLTSDNQGNEYFASSSSEFLMRKL 420
           FW+E+ILQPRKS+F  +KFF+K ++K P+      +S T   QG  YFA++S+EF++RKL
Sbjct: 336 FWDESILQPRKSIFPNSKFFRKLISKTPAPPP-ASDSATHSQQGVAYFAATSNEFILRKL 394

Query: 421 ADWSMMLSDFKTAYSTYESLMDDLDAFPKYLASCIEWCAVSLLMGAQRIVTVKMIKNDIN 480
           ADWS MLSDFK AYSTYE L  D +  P+YLASC+EWCA+S+LMGAQ IVTVKMIKNDI+
Sbjct: 395 ADWSFMLSDFKNAYSTYELLSKDFEQRPEYLASCLEWCALSVLMGAQSIVTVKMIKNDID 454

Query: 481 PLIEKALATYE----------------NCXXXXXXXXXXXXXXNTVEPVRS--------- 515
           PLI +AL +YE                                +TV    S         
Sbjct: 455 PLINRALKSYELSARKAKEKNAQLKSSALAKKAEKDSKSATLPSTVSDEHSGQELDEGVS 514

Query: 516 ---------YETRCMILASELFLSLSDKWTSTPYAIQYLETILDECKLGPCCQIMIWERL 566
                    YETRCM+LA+ELFLSLSD WT+TPYAI+YLETILDEC LG   +I++WERL
Sbjct: 515 SAPSQSAQSYETRCMLLAAELFLSLSDTWTATPYAIKYLETILDECTLGSLSEIVLWERL 574

Query: 567 SDCYSLRVDPRIKHRVGAMKKGIRDTEDLRGGDGNSTDHFTDDD-----------ILSEG 615
           + CY+LRVDPR+K ++ ++  G     + RG +   +D   D+            + S G
Sbjct: 575 AYCYALRVDPRVKGKLPSL-DGQSGQNEKRGEESEGSDESDDETQKYDHKISQNCMASLG 633

Query: 616 LTRKRKAAFFRLIAARKWAEQKQWRQVSWCLKDIESIYSDIKFLNGDGLILSKLHNQLN 674
           L R+RK+  FRLIA +KW E KQWRQ  W LKDIE +YS++ F N D LIL KL  +++
Sbjct: 634 LARRRKSTLFRLIATKKWTESKQWRQAYWGLKDIEVVYSELDFANRDDLILEKLRKKIH 692

>SAKL0H17226g Chr8 complement(1526848..1529007) [2160 bp, 719 aa]
           {ON} similar to uniprot|P46944 Saccharomyces cerevisiae
           YDR108W GSG1 Subunit of TRAPP (transport protein
           particle) a multi-subunit complex involved in targeting
           and/or fusion of ER-to-Golgi transport vesicles with
           their acceptor compartment protein has late meiotic role
           following DNA replication
          Length = 719

 Score =  688 bits (1776), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 372/745 (49%), Positives = 481/745 (64%), Gaps = 104/745 (13%)

Query: 1   MVFSYEHYMNLLFHLDNSKE--TVPPEIAKRIVSNAIAPVITVTSTPLFDKHIQEAYKVD 58
           M  SYE+YMNLL+H+D+S E  TV  E+AK+IVSNA++PV+ VTST L D H+QEAY + 
Sbjct: 1   MTLSYENYMNLLYHIDHSGESVTVNSEVAKKIVSNAVSPVVAVTSTSLLDSHLQEAYGLH 60

Query: 59  SLYMLLRFFGGCVSDRDQANEVKVGQDEHQVGDTNASMESFSKSKNLEVPNLPKKGSRSR 118
           S+YMLLRFFG CV+DRDQ NE           +TN                   KG R R
Sbjct: 61  SMYMLLRFFGDCVTDRDQENET----------ETNF------------------KG-RPR 91

Query: 119 SNSLFQRDSTQSQYIRFTRPLDDLIETRDTN-DMLFNYHSLEVFLDNYLKLVADNTDEMV 177
           SNSLFQR+S  S ++RFTRPL DL++ R ++  MLF+YHSLE+FLD YL+LV        
Sbjct: 92  SNSLFQRES--STFVRFTRPLIDLVDVRVSDHGMLFDYHSLELFLDKYLRLVDHRVSANT 149

Query: 178 PHDLLKKSIYHSFFSLAISSTNNLSPYETFNHPILSLIALDISNGEVYEDARDLLVNFKN 237
           PH LLK SIYH FF+ AISST  LSPYE+FNHP++SL+ALDIS G+ YE+ARDLL+ FKN
Sbjct: 150 PHRLLKHSIYHKFFTAAISSTAYLSPYESFNHPVMSLLALDISRGDTYENARDLLIRFKN 209

Query: 238 LNHNTEN---FPLFMNTNEMLPVFLLCYNDESQEEFEKCXXXXXXXXXXXFVESVLLSLW 294
           +N  T++   FP F+N N++LPVFLLCYND S E+FE C           FVES+LL LW
Sbjct: 210 MNSATKSAASFPTFININDILPVFLLCYNDSSHEQFEACQSLAKMLKKQLFVESILLPLW 269

Query: 295 KDSF-IEANNSAIQLHQPVMSSLEEILFFL--QAPTQTSLS--------------LPLIN 337
           +DS   +A      LH P+MSSLEE+L+FL  +AP + ++S              L L+ 
Sbjct: 270 RDSEDYDAEEPRRILHPPIMSSLEEMLYFLDLEAPGKDNISYTGSSNPISSFELPLALVE 329

Query: 338 SIYDMLDYLVYDLMIPFMKRKVSFWEETILQPRKSLFNGAKFFKKFMNKN-PSNGNHHHN 396
           +IYD L+ L+ +LMIPFMKRK+SFWEETILQPRKS+F  AKF ++F++K+ P+      N
Sbjct: 330 TIYDRLNLLITELMIPFMKRKISFWEETILQPRKSIFLNAKFLRRFVSKSAPATPAAPIN 389

Query: 397 SLTSDN--QGNEYFASSSSEFLMRKLADWSMMLSDFKTAYSTYESLMDDLDAFPKYLASC 454
           S  SD   Q + +F +SS+EFL+RKLADWS MLSD++TAY+TY++L  DL+   +YLA C
Sbjct: 390 S-KSDGAVQRSNFFPASSNEFLLRKLADWSFMLSDYRTAYATYDTLSKDLEHHLEYLAPC 448

Query: 455 IEWCAVSLLMGAQRIVTVKMIKNDINPLIEKALATYENCXXXXXXXXXXXXXXNT-VEPV 513
           +EWCAVS+LMGAQ IVTVKMIKNDI+PLI K+L  YE C                  +P 
Sbjct: 449 LEWCAVSVLMGAQSIVTVKMIKNDIDPLISKSLQCYEKCASKLTSPHVAEADSPVDSKPA 508

Query: 514 RSYETRCMILASELFLSLSDKWTSTPYAIQYLETILDECKLGPCCQIMIWERLSDCYSLR 573
           +SYETRCM+L++ELFLSLSD WT+TPYAI+YLETIL  C LGP  Q+++WE+L+ CY LR
Sbjct: 509 QSYETRCMLLSAELFLSLSDTWTATPYAIKYLETILQNCPLGPKSQVLLWEKLAYCYELR 568

Query: 574 VDPRIKHRVGAMKKGIRDTEDL------RGGDGNSTDHFTDD------------------ 609
           VDPR+ H     +    + E++      R    +S  HF+ +                  
Sbjct: 569 VDPRVSHIHAKQRHLQYEREEVISKSNERAPQHHSESHFSTEKNQTGNQEEQSDTDSKDE 628

Query: 610 ---------------------DILSEGLTRKRKAAFFRLIAARKWAEQKQWRQVSWCLKD 648
                                DI   GLTR+RKAAFFRLIAA KW EQKQW+Q SW L+D
Sbjct: 629 ALSNREKEHADFVNPNKLPYKDIALLGLTRRRKAAFFRLIAANKWCEQKQWKQASWLLRD 688

Query: 649 IESIYSDIKFLNGDGLILSKLHNQL 673
           ++++YS + F    GLIL +L  ++
Sbjct: 689 VDTVYSGLVFSYRKGLILERLVGEI 713

>KNAG0H03270 Chr8 complement(609643..611589) [1947 bp, 648 aa] {ON}
           Anc_8.255 YDR108W
          Length = 648

 Score =  636 bits (1640), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 335/711 (47%), Positives = 446/711 (62%), Gaps = 104/711 (14%)

Query: 1   MVFSYEHYMNLLFHLDNSKETVPPEIAKRIVSNAIAPVITVTSTPLFDKHIQEAYKVDSL 60
           M FSYEHYMNLL HL+ + ETVPP+IA+RIVS+A+APVITVTS+   D HI E+YKV S 
Sbjct: 1   MAFSYEHYMNLLSHLECASETVPPDIARRIVSHAVAPVITVTSSLALDDHIMESYKVQSA 60

Query: 61  YMLLRFFGGCVSDRDQANEVKVGQDEHQVGDTNASMESFSKSKNLEVPNLPKKGSRSRSN 120
           Y+L R FGGC+SDRDQ  E     D    G T                       R RSN
Sbjct: 61  YLLFRLFGGCISDRDQLMEHYTLDDSSTGGRT-----------------------RKRSN 97

Query: 121 SLFQRDSTQSQYIRFTRPLDDLIETRDTNDMLFNYHSLEVFLDNYL----KLVADNTDEM 176
           SLFQRD+TQSQ+IRF +PL DL+ +      LF+  SLE +L +YL    KL A + +++
Sbjct: 98  SLFQRDATQSQFIRFAQPLPDLLRSYTEQQGLFDNDSLEWYLTHYLSWIQKLTATDPEKV 157

Query: 177 ------------------VPHDLLKKSIYHSFFSLAISSTNNLSPYETFNHPILSLIALD 218
                             +PH LL+ ++YH+FF+LA+SST  +SP+ETFN P+++LIA+D
Sbjct: 158 EQLPDELTPSSPPQRGKPLPHKLLRNAVYHNFFALAVSSTTRISPFETFNVPVMNLIAID 217

Query: 219 ISNGEVYEDARDLLVNFKNLNHNTENFPLFMNTNEMLPVFLLCYNDESQEEFEKCXXXXX 278
           +S G+ YE  RDL+  FKNLN   E+FP+F+N N++LP+ +LCY+   + +   C     
Sbjct: 218 VSRGQDYEVVRDLVTTFKNLNKFLEDFPVFINVNDILPMIVLCYDAADETQLATCEQLQR 277

Query: 279 XXXXXXFVESVLLSLWKDSFIEANNSAIQLHQPVMSSLEEILFFLQA------------- 325
                 FV+S+ L+LW +   +  +  + LH+P+MSSL+EI+ F  +             
Sbjct: 278 KIKKCLFVDSIPLALWDE---DPESPLVPLHEPIMSSLDEIVKFYSSNSSAGGDEVGTDG 334

Query: 326 PTQTSLSLPLINSIYDMLDYLVYDLMIPFMKRKVSFWEETILQPRKSLFNGAK-FFKKFM 384
            ++ +L L +I  +Y  LD LV +++IPFM RK  +WEE ILQPRKS+F+G+  FFKKF+
Sbjct: 335 HSRAALPLNIITHMYQALDVLVDEMLIPFMHRKTKYWEENILQPRKSIFHGSNNFFKKFI 394

Query: 385 NKNPSNGNHHHNSLTSDNQGNEYFASSSSEFLMRKLADWSMMLSDFKTAYSTYESLMDDL 444
            K  +           D    ++F +SS+E L+RKLADWS+MLSDFKTAY TY+SL +DL
Sbjct: 395 GKTTTQ---------RDPSDTQFFPASSTECLLRKLADWSLMLSDFKTAYLTYDSLSNDL 445

Query: 445 DAFPKYLASCIEWCAVSLLMGAQRIVTVKMIKNDINPLIEKALATYENCXXXXXXXXXXX 504
              P YLASC+EWCAVSLL+GAQ IVTVKMIK +I PLIE+A+ATY              
Sbjct: 446 QNSPNYLASCLEWCAVSLLLGAQNIVTVKMIKTEITPLIERAVATYRQ------------ 493

Query: 505 XXXNTVEPVRSYETRCMILASELFLSLSDKWTSTPYAIQYLETILDEC-KLGPCCQIMIW 563
                 +   SYETRCMIL++ELFL+L D WTSTPYAI+YLETIL +C +LG C Q+MIW
Sbjct: 494 ------QGRSSYETRCMILSAELFLALRDTWTSTPYAIRYLETILRDCPQLGACSQVMIW 547

Query: 564 ERLSDCYSLRVDPRIKHRVGAMKKGIRDTEDLRGGDGNSTDHFTDDDILSEGLTRKRKAA 623
           ERLSDCY  R DPR+   +        +T       GN        +IL++G TRKRKAA
Sbjct: 548 ERLSDCYQSRTDPRVASALST------NTSPGSAQPGN--------EILAQGFTRKRKAA 593

Query: 624 FFRLIAARKWAEQKQWRQVSWCLKDIESIYSDIKFLNGDGLILSKLHNQLN 674
           FFRLIAA+KWAEQ QWRQV WCL DI+ IY+     +  GL++ +L+ ++ 
Sbjct: 594 FFRLIAAKKWAEQGQWRQVQWCLHDIKDIYTASALYDKKGLLIDRLNTEVQ 644

>TBLA0E04380 Chr5 (1112393..1115062) [2670 bp, 889 aa] {ON}
           Anc_8.255 YDR108W
          Length = 889

 Score =  580 bits (1495), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 309/637 (48%), Positives = 413/637 (64%), Gaps = 76/637 (11%)

Query: 112 KKGSRSRSNSLFQRDSTQSQYIRFTRPLDDLIETRDTNDMLFNYHSLEVFLDNYLKLVAD 171
           ++ +R RSNSLFQRDSTQSQYIRFT+P+ DL+ TRD  D LF++ SLE  L  YLK++  
Sbjct: 181 RQKTRKRSNSLFQRDSTQSQYIRFTKPIPDLVNTRDPTDSLFDHQSLETLLKGYLKIIET 240

Query: 172 NTDEMVPHDLLKKSIYHSFFSLAISSTNNLSPYETFNHPILSLIALDISNGEVYEDARDL 231
           NT   +PH+ LKKS+YH FFS+ ++ST NL P+E+F+HPI+SL+++D++  + Y+ A+++
Sbjct: 241 NTTPDMPHNALKKSLYHRFFSMTVTSTTNLCPFESFDHPIVSLLSIDLTLNQNYDTAKEM 300

Query: 232 LVNFKNLNHNTENFPLFMNTNEMLPVFLLCYNDESQEEFEKCXXXXXXXXXXXFVESVLL 291
           L+ FKN++  T NFP+++N N++LPVFLLCY+  S E+ +             F ES+LL
Sbjct: 301 LIKFKNIHSKTPNFPVYLNINDILPVFLLCYDASSPEQLDIAKKISTKIKKQLFFESILL 360

Query: 292 SLWKDSFIEANNSAIQLHQPVMSSLEEILFFLQ-------APTQTSLSLPLINSIYDMLD 344
            LW D  I  N+  ++LH+P+MSS++E L+FLQ         T   L L L+  IY+M+ 
Sbjct: 361 PLWNDK-IYNNDKFVKLHEPMMSSVDETLYFLQQYLQKNSCVTDNKLPLSLVKYIYEMIA 419

Query: 345 YLVYDLMIPFMKRKVSFWEETILQPRKSLFNGAKFFKKFMNKN---------------PS 389
            L  +L+IPFM+RK+ FW+ETILQPRKS+F   K FK FMN+N                S
Sbjct: 420 NLSVNLIIPFMQRKIRFWDETILQPRKSIFRN-KLFKSFMNRNSNVSSSTGTSSSEISNS 478

Query: 390 NGNHHHNSLTSDNQGNEYFASSSSEFLMRKLADWSMMLSDFKTAYSTYESLMDDLDAFPK 449
              HHH+ LT D+ G+EYF++ S+EF +RKLADWSMM+SDFKTAY+TYESL  DL+   K
Sbjct: 479 ISKHHHSLLTKDSNGHEYFSALSTEFQLRKLADWSMMVSDFKTAYTTYESLSRDLENTSK 538

Query: 450 YLASCIEWCAVSLLMGAQRIVTVKMIKNDINPLIEKALATYENCXXXXXXXXXXXXXXNT 509
           Y+ASC+EW AVS+LMGAQ IVT KM+KND++PLIE AL +YE                N+
Sbjct: 539 YMASCLEWWAVSILMGAQNIVTAKMLKNDVDPLIESALESYEKPLPPVPNSRLPSNNINS 598

Query: 510 V--------------------EPVRSYETRCMILASELFLSLSDKWTSTPYAIQYLETIL 549
           +                      +RSYE RCM+L SELFLSLSD WTSTPYA++YLETIL
Sbjct: 599 LNSRSSISSATKAEVSLIENNHTIRSYEIRCMLLLSELFLSLSDTWTSTPYALRYLETIL 658

Query: 550 DECKLGPCCQIMIWERLSDCYSLRVDPRIKHR--VGAMKKG------------IRDTEDL 595
            + KLGPC Q ++WERLS CY LRVDPRIK +  +  + KG            I++  + 
Sbjct: 659 SDYKLGPCSQTILWERLSFCYDLRVDPRIKRKPTITNINKGTKATGSEASHSSIKEVNEK 718

Query: 596 RGGDGNSTDHFTDD------------------DILSEGLTRKRKAAFFRLIAARKWAEQK 637
              DG    +  D                   DILS+G TRKRKAAFF+LIAA+KW+EQK
Sbjct: 719 YRNDGKQEKYSIDRKNSLIIDVNSNEEYDCGYDILSDGFTRKRKAAFFKLIAAKKWSEQK 778

Query: 638 QWRQVSWCLKDIESIYSDIKFLNGDGLILSKLHNQLN 674
           QWRQ+ WCLKDIE++Y ++ F +   LIL KL +QLN
Sbjct: 779 QWRQLDWCLKDIENVYKEVGFSDRKDLILIKLKDQLN 815

 Score =  127 bits (318), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 54/79 (68%), Positives = 69/79 (87%)

Query: 1  MVFSYEHYMNLLFHLDNSKETVPPEIAKRIVSNAIAPVITVTSTPLFDKHIQEAYKVDSL 60
          M FSYE+YMNLLFHLD + E +P +IAKRIV N+IAP+I+VT+TP  DKH+Q++Y +DSL
Sbjct: 1  MPFSYENYMNLLFHLDRTNEEIPTDIAKRIVQNSIAPLISVTATPELDKHVQDSYNIDSL 60

Query: 61 YMLLRFFGGCVSDRDQANE 79
          YMLLR+FGGC+SDRDQ +E
Sbjct: 61 YMLLRYFGGCISDRDQYHE 79

>Ecym_4316 Chr4 complement(683492..685363) [1872 bp, 623 aa] {ON}
           similar to Ashbya gossypii AGR096C
          Length = 623

 Score =  502 bits (1293), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 290/670 (43%), Positives = 405/670 (60%), Gaps = 63/670 (9%)

Query: 2   VFSYEHYMNLLFHLDNSKETVPPEIAKRIVSNAIAPVITVTSTPLFDKHIQEAYKVDSLY 61
           + SYE YMNLL + D   + VP EI+++++ NA++P I+V ST   ++H++E +K+ SLY
Sbjct: 1   MLSYEKYMNLLHYPDQWSQPVPREISRKVICNALSPCISVQSTDALNQHLEEVFKIGSLY 60

Query: 62  MLLRFFGGCVSDRDQANEVKVGQDEHQVGDTNASMESFSKSKNLEVPNLPKKGSRSRSNS 121
            LLR+FG  + DRDQ ++             +A ++          PN      R R NS
Sbjct: 61  KLLRYFGDYIQDRDQLDD-----------KISAKLQ----------PN----NRRQRQNS 95

Query: 122 LFQRDSTQSQYIRFTRPLDDLIETRDTNDMLFNYHSLEVFLDNYLKLVADNTDEMVPHDL 181
           LFQR+S  S+YIRF  PL D+I   D + + FN   LE  L  +LK + ++T    P +L
Sbjct: 96  LFQRNS--SRYIRFQTPLTDIISVGDNHQVEFN--DLEESLSEFLKDIEEHTVNDSPCEL 151

Query: 182 LKKSIYHSFFSLAISSTNNLSPYETFNHPILSLIALDISNGEVYEDARDLLVNFKNLNHN 241
           LK SI+H F ++  S+T  LSPY +FNHPIL+L+ALDI+ GE YE AR+LL+ FKNL + 
Sbjct: 152 LKHSIFHKFITMLSSTT--LSPYHSFNHPILALLALDITQGEEYELARELLMEFKNLPNT 209

Query: 242 TENFPLFMNTNEMLPVFLLCYNDESQEEFEKCXXXXXXXXXXXFVESVLLSLWKDSFIEA 301
              FP F+NTN++LPVF+LC++  S +++E             FVESV L +    F   
Sbjct: 210 LSKFPAFINTNDVLPVFILCFDQSSPQQWETVQSLMKVIKKQLFVESVPLPI----FTNF 265

Query: 302 NNSAIQLHQPVMSSLEEILFFLQAPTQTSLSLPLINSIYDMLDYLVYDLMIPFMKRKVSF 361
            + +I LH P+ +SL+E L+    P    L   L+  IYD ++ +V DLMIPFM RK+SF
Sbjct: 266 RDRSIVLHPPITNSLQEQLYDSSHPVSLKLCPRLVKLIYDTINSMVEDLMIPFMNRKISF 325

Query: 362 WEETILQPRKSLFNGAKFFKKFMNKNPSNGNHHHNSLTSDNQGNEYFASSSSEFLMRKLA 421
           W+ETILQPRKS+F+  K  K+F++K  S+G+   +  TS    + +F +SS+EFL+RKLA
Sbjct: 326 WDETILQPRKSIFHSNKLLKRFISK--SSGSPTASMPTS---PDGHFLASSNEFLLRKLA 380

Query: 422 DWSMMLSDFKTAYSTYESLMDDLDAFPKYLASCIEWCAVSLLMGAQRIVTVKMIKNDINP 481
           DW  MLSD+KTAYS YE L+ D + +P Y++SC E+ A+SLLMGA  IVT KMIKNDI+P
Sbjct: 381 DWCFMLSDYKTAYSIYEILIRDFENYPLYMSSCQEFSALSLLMGAHSIVTAKMIKNDIDP 440

Query: 482 LIEKALATYENCXXXXXXXXXXXXXXNTVEPVRSYETRCMILASELFLSLSDKWTSTPYA 541
           LI K L    N                    +   + RCMI  +ELFLSLSD WTS P+A
Sbjct: 441 LIMKYLDYAVN------------------NIISLDQIRCMIYMTELFLSLSDTWTSAPFA 482

Query: 542 IQYLETIL--DECKLGPCCQIMIWERLSDCYSLRVDPRIKHRVGAMKKGIRDTEDLRGGD 599
           I+YLE IL  +  KLGP C+ +IWER+S  Y LR+DPRI     +      D E+    +
Sbjct: 483 IKYLEVILQKENLKLGPVCRNLIWERISFAYRLRIDPRIHADDDSTSDCDHDLEEELYLN 542

Query: 600 GNSTDHFTDDDILSEGLTRKRKAAFFRLIAARKWAEQKQWRQVSWCLKDIESIYSDIKFL 659
            +         I ++G TR RK A F+L+AA+KW +  Q RQ +W LK    +Y D+ F 
Sbjct: 543 PHK---LHCGKIQNQGFTRYRKEAVFQLLAAKKWLQCGQTRQGAWSLKRCNRVYRDLPFA 599

Query: 660 NGDGLILSKL 669
           N +G +LS+L
Sbjct: 600 NAEGTLLSRL 609

>AGR096C Chr7 complement(917898..919769) [1872 bp, 623 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR108W
           (GSG1)
          Length = 623

 Score =  493 bits (1270), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 280/673 (41%), Positives = 402/673 (59%), Gaps = 74/673 (10%)

Query: 2   VFSYEHYMNLLFHLDNSKETVPPEIAKRIVSNAIAPVITVTSTPLFDKHIQEAYKVDSLY 61
           + SYE YMNL+ + ++  + VP EI++R++ NA++P ++V ST   + H+ E +   SLY
Sbjct: 1   MLSYETYMNLVHYPEHWSQPVPHEISRRVICNALSPCVSVQSTAALEAHLAEEFSEGSLY 60

Query: 62  MLLRFFGGCVSDRDQANEVKVGQDEHQVGDTNASMESFSKSKNLEVPNLPKKGSRSRSNS 121
           MLLR+F   V +R +           +VG  +                    G R R  S
Sbjct: 61  MLLRYFADYVRERGE-----------EVGSVS--------------------GQR-RPGS 88

Query: 122 LFQRDSTQSQYIRFTRPLDDLIETRDTNDMLFNYHSLEVFLDNYLKLVADNTDEMVPHDL 181
           ++QR +  S+Y+RF RPL+++IET +   +  ++  LE  L  +L+ +   T    P +L
Sbjct: 89  VYQRQT--SRYVRFQRPLEEVIETVEQQAV--DFEDLEEALGQHLRDIEARTTNESPSEL 144

Query: 182 LKKSIYHSFFSLAISSTNNLSPYETFNHPILSLIALDISNGEVYEDARDLLVNFKNLNHN 241
           LK SI+H F ++   S+  LSPY T NHPI++L+ALD++ GE Y  AR+LLV FKNL   
Sbjct: 145 LKHSIFHKFITML--SSTALSPYHTVNHPIMALLALDVTQGEEYTLARELLVQFKNLPSK 202

Query: 242 TENFPLFMNTNEMLPVFLLCYNDESQEEFEKCXXXXXXXXXXXFVESVLLSLWKDSFIEA 301
           +  FP ++NTN++LPVF+LC+++ S E++E             FVESV L +    F   
Sbjct: 203 SSKFPSYINTNDVLPVFILCFDESSSEQWETVQALQKAIKKQLFVESVPLPI----FTNY 258

Query: 302 NNSAIQLHQPVMSSLEEILFFLQAPTQTSLSLPLINSIYDMLDYLVYDLMIPFMKRKVSF 361
            +  + LH P+ +SL+E ++    P    L   L++ IY+ ++ +V DLMIPFM RK+SF
Sbjct: 259 ESDPVVLHPPITNSLQEQVYDGSHPPLLRLCPQLVDVIYETINAMVEDLMIPFMNRKISF 318

Query: 362 WEETILQPRKSLFNGAKFFKKFMNKNPSNGNHHHNSLTSDNQGNEYFASSSSEFLMRKLA 421
           W+ETILQPRKS+F+G KF K+FMNK  S+      +L++ + G  YF +SS+EFL+RKLA
Sbjct: 319 WDETILQPRKSIFHGNKFLKRFMNKTNSSAA---GTLSTSSDG--YFLASSNEFLLRKLA 373

Query: 422 DWSMMLSDFKTAYSTYESLMDDLDAFPKYLASCIEWCAVSLLMGAQRIVTVKMIKNDINP 481
           DWS MLSD+KTAYS Y  L+ D + +P+YL+SC E+ A+SLLMGA  IVT KMIKNDI+P
Sbjct: 374 DWSFMLSDYKTAYSIYYILLRDFELYPQYLSSCQEFSALSLLMGAHSIVTTKMIKNDIDP 433

Query: 482 LIEKALATYENCXXXXXXXXXXXXXXNTVEPVRSY-ETRCMILASELFLSLSDKWTSTPY 540
           LI K +                    +TV  +    + RC++  +ELFLSLSD WTS P+
Sbjct: 434 LIMKYM-------------------DSTVASLNYLGKFRCLVYMAELFLSLSDTWTSAPF 474

Query: 541 AIQYLETIL--DECKLGPCCQIMIWERLSDCYSLRVDPRIKHRVGAMKKGIRD--TEDLR 596
           AI+YLE IL  ++ KLGP  + M+WER+S  Y LR+DPRI      +     +  TED  
Sbjct: 475 AIKYLELILQNEQLKLGPLSRTMLWERISYAYQLRIDPRIHTDDEYLSDNFMELTTEDDF 534

Query: 597 GGDGNSTDHFTDDDILSEGLTRKRKAAFFRLIAARKWAEQKQWRQVSWCLKDIESIYSDI 656
             + N   H+    I S GLTR RK A FRL+AA+KW E    RQ +W LK    +Y ++
Sbjct: 535 CMNPNKLHHWR---IHSLGLTRHRKEAVFRLLAAKKWLEYGHIRQGAWSLKGCNKVYRNL 591

Query: 657 KFLNGDGLILSKL 669
            F N DG +LS+L
Sbjct: 592 GFANADGTLLSRL 604

>KLLA0F18953g Chr6 (1737522..1739465) [1944 bp, 647 aa] {ON} similar
           to uniprot|P46944 Saccharomyces cerevisiae YDR108W GSG1
           Subunit of TRAPP (transport protein particle) a
           multi-subunit complex involved in targeting and/or
           fusion of ER-to-Golgi transport vesicles with their
           acceptor compartment protein has late meiotic role
           following DNA replication
          Length = 647

 Score =  441 bits (1134), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 252/681 (37%), Positives = 380/681 (55%), Gaps = 66/681 (9%)

Query: 3   FSYEHYMNLLFHLDNSKETVPPEIAKRIVSNAIAPVITVTSTPLFDKHIQEAYKVDSLYM 62
           FSYE YMNL+ + ++    +P EI+K+++ N ++P I V S    D H+++ Y +DS+ M
Sbjct: 5   FSYEKYMNLIQYPEHWSNPIPHEISKKVIYNTLSPCICVQSNLELDNHLKDMYNIDSISM 64

Query: 63  LLRFFGGCVSDRDQANEVKVGQDEHQVGDTNASMESFSKSKNLEVPNLPKKGSRSRSNSL 122
           L R+FG  + DRDQ                         + +L+ P     G R RS+SL
Sbjct: 65  LFRYFGDYIQDRDQ----------------------IPSTTDLKDPGSVSSG-RHRSDSL 101

Query: 123 FQRDSTQSQYIRFTRPLDDLIETRDTNDMLFNYHSLEVFLDNYLKLVADNTDE-MVPHDL 181
           FQR +  S+ +RFTR L+DLI   D+ D +     ++ FL  YL+ +    +E   P  L
Sbjct: 102 FQRQA--SECVRFTRSLEDLISI-DSEDHILQSTDIDSFLSQYLQNLEPIMNENGTPSKL 158

Query: 182 LKKSIYHSFFSLAISSTNNLSPYETFNHPILSLIALDISNGEVYEDARDLLVNFKNLNHN 241
           LK SIYH FF + +SS N LS Y +F+HP+++L+ LDI+ G+ YE+AR++L++FKNLN+ 
Sbjct: 159 LKHSIYHRFF-ITLSSIN-LSRYHSFHHPVVALLPLDITKGQGYENAREILIHFKNLNNT 216

Query: 242 TENFPLFMNTNEMLPVFLLCYNDESQEEFEKCXXXXXXXXXXXFVESVLLSLWKDSFIEA 301
            ENFP F+N N++LPVF+LCY++ S+E++E             FVESV +SL+       
Sbjct: 217 LENFPEFININDILPVFVLCYDENSREQWESVQALTKSLKKQLFVESVSISLFTP---HD 273

Query: 302 NNSAIQLHQPVMSSLEEILFFLQAPTQTSLSLPLINSIYDMLDYLVYDLMIPFMKRKVSF 361
           N  +  LH P+  SL E +F +  PT  ++   L+  IYD + ++V ++MIPFM RK+ F
Sbjct: 274 NQKSTTLHSPITVSLHEQVFNMSHPTSINIPSRLLTHIYDTISFIVEEMMIPFMHRKLVF 333

Query: 362 WEETILQPRKSLFNGAKFFKKFMNKNPSNG-NHHHNSLTSDNQGNEYFASSSSEFLMRKL 420
           W+ET+LQPRKS+F   KFF++F++   ++   H  N      +G+  F +SS EFL+RKL
Sbjct: 334 WDETVLQPRKSIFQSNKFFRRFISPKSNHPIAHKVNDPQDPAEGDIMFPASSPEFLLRKL 393

Query: 421 ADWSMMLSDFKTAYSTYESLMDDLDAFPKYLASCIEWCAVSLLMGAQRIVTVKMIKNDIN 480
           ADWS MLSDFK AYS Y+ L  D +++P+YLA C+E+  +SLLMGAQ I+T K IK +++
Sbjct: 394 ADWSFMLSDFKKAYSIYDLLTKDFESYPQYLAPCLEYKTISLLMGAQNIITAKTIKTEVD 453

Query: 481 PLIEKALATYENCXXXXXXXXXXXXXXNTVEPVRSYETRCMILASELFLSLSDKWTSTPY 540
           PL+ +A+  Y+                            C++  S+L LSLSD W S+P 
Sbjct: 454 PLMTRAIEQYKKQDEKHSLRV----------------IHCILTFSDLLLSLSDTWVSSPL 497

Query: 541 AIQYLETILDECKLGPCCQIMIWERLSDCYSLRVDPRI----------------KHRVGA 584
           A+ YL  I     LGP   ++I ER++  Y + +D R+                      
Sbjct: 498 AVNYLTYIQKSHLLGPYATVIILERIAYAYEICIDLRVNDHFLPKPDEENKADESEAAEN 557

Query: 585 MKKGIRDTEDLRGGDGNSTDHFTDDDILSEGLTRKRKAAFFRLIAARKWAEQKQWRQVSW 644
            KKG    E     +  + +    +++ SEGLTR RK + ++L+AA+KW E  +  Q  W
Sbjct: 558 SKKGENGLEVDDMHEWRNENKLIQNNLRSEGLTRFRKYSLYQLVAAKKWVELHKRNQAKW 617

Query: 645 CLKDIESIYSDIKF-LNGDGL 664
           C+      Y  +      DGL
Sbjct: 618 CIYHAAPAYEKLSLSKRPDGL 638

>NDAI0D02560 Chr4 (589972..593856) [3885 bp, 1294 aa] {ON} Anc_5.94
           YHR154W
          Length = 1294

 Score = 33.9 bits (76), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 34/104 (32%), Positives = 46/104 (44%), Gaps = 28/104 (26%)

Query: 294 WKDSFIEANNSAIQLHQPVMSSLEEILFFLQAPTQTSLSLPLINSIYDMLDYLVYDLMIP 353
           WK  F+E  N     HQ      EEI   +      +++LP     Y M+    YDLMIP
Sbjct: 71  WKKWFLEKFNH----HQ------EEIHIIVS----NTINLPF----YKMV---TYDLMIP 109

Query: 354 FMKRKVSFWEETILQPRKSL----FNGAKFFKKFMNKNPSNGNH 393
            +     +W E +L    +L     N  K F KF N +PS+GN 
Sbjct: 110 VVS---IYWLEQVLARSSALDNANTNNTKLFLKFNNFSPSDGNQ 150

>CAGL0D02464g Chr4 (250405..253020) [2616 bp, 871 aa] {ON} similar
           to uniprot|P42837 Saccharomyces cerevisiae YNL325c FIG4
          Length = 871

 Score = 33.1 bits (74), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 50/213 (23%), Positives = 83/213 (38%), Gaps = 41/213 (19%)

Query: 294 WKDSFIEANNSAIQLHQPVMSSLEEILFFLQAPTQTSLSLPLINSIYDMLDYLVYDLMIP 353
           + D F+  NN    L +PV+S LE +  + Q         P+I+   D ++       + 
Sbjct: 228 YNDMFMWNNN----LLEPVLSCLESVYDWFQ---------PIIHGFIDQVN-------VS 267

Query: 354 FMKRKVSFWEETILQPRKSLFNGAKFFKKFMNKNPSNGNH-HHNSLTSD-------NQGN 405
            + + V     T++  R   F GA+F K+ +N N    N      + +D         G 
Sbjct: 268 VLGKSVYI---TLIARRSRFFAGARFLKRGVNNNGYVANEVETEQIVADMVLTAFHKSGM 324

Query: 406 EYFASSSSEFLMRKLAD----WSMMLSDFKTAYSTYESLMDDLDAFPKYLASCIEWCAVS 461
            YF S+     ++        W+   S+  TA    E  + D    P + A+ I +  + 
Sbjct: 325 GYFDSNRYTSFVQHRGSIPLFWTQEASNL-TAKPPIEITVRD----PFFSAAAIHFDNLF 379

Query: 462 LLMGAQRIVTVKMIKN-DINPLIEKALATYENC 493
              G  RI  + +IK  +  P   K L  YE C
Sbjct: 380 QRYGGGRIDVLNLIKTKEKVPRETKLLKEYEEC 412

>Suva_13.217 Chr13 (351568..352542) [975 bp, 324 aa] {ON} YMR048W
           (REAL)
          Length = 324

 Score = 32.3 bits (72), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 20/71 (28%), Positives = 34/71 (47%), Gaps = 5/71 (7%)

Query: 380 FKKFMNKNPSNGNHHHNSLTS----DNQGNEYFASSSSEF-LMRKLADWSMMLSDFKTAY 434
            +KF  + P+  N     L S    +++G E    +  +  L+RKL DW M  ++ +  Y
Sbjct: 240 LEKFKEQGPAELNTDEKKLLSRWLDEHRGTEKVLMTEEDIQLLRKLEDWEMNDAEVEMTY 299

Query: 435 STYESLMDDLD 445
           + + S  DD D
Sbjct: 300 NDFASREDDFD 310

>YAL029C Chr1 complement(87855..92270) [4416 bp, 1471 aa] {ON}
           MYO4One of two type V myosin motors (along with MYO2)
           involved in actin-based transport of cargos; required
           for mRNA transport, including ASH1 mRNA, and
           facilitating the growth and movement of ER tubules into
           the growing bud along with She3p
          Length = 1471

 Score = 32.0 bits (71), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 18/61 (29%), Positives = 29/61 (47%)

Query: 54  AYKVDSLYMLLRFFGGCVSDRDQANEVKVGQDEHQVGDTNASMESFSKSKNLEVPNLPKK 113
           A K  S   ++R+F       ++  EV++ Q E Q+  TN  ME+F  +K     N  + 
Sbjct: 169 AGKTVSAKYIMRYFASVQESNNREGEVEMSQIESQILATNPIMEAFGNAKTTRNDNSSRF 228

Query: 114 G 114
           G
Sbjct: 229 G 229

>KAFR0A06380 Chr1 complement(1288673..1294306) [5634 bp, 1877 aa] {ON}
            Anc_4.173 YLR342W
          Length = 1877

 Score = 31.6 bits (70), Expect = 9.6,   Method: Compositional matrix adjust.
 Identities = 21/61 (34%), Positives = 30/61 (49%), Gaps = 5/61 (8%)

Query: 156  HSLEVFLDNYLKLVADNTDEMVPHDLLKKSIYHSFFSLAISSTNNLSP---YE--TFNHP 210
            H+L  +   YL+L+  N D  +   L  +SI   F  L +  TN  +P   YE  T NHP
Sbjct: 1089 HALIFYRGEYLQLIDANQDNYLEECLKIRSILAEFEELNVEQTNPYAPELKYEEQTANHP 1148

Query: 211  I 211
            +
Sbjct: 1149 V 1149

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.134    0.395 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 76,770,193
Number of extensions: 3498336
Number of successful extensions: 14951
Number of sequences better than 10.0: 54
Number of HSP's gapped: 15303
Number of HSP's successfully gapped: 61
Length of query: 698
Length of database: 53,481,399
Length adjustment: 117
Effective length of query: 581
Effective length of database: 40,065,477
Effective search space: 23278042137
Effective search space used: 23278042137
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 69 (31.2 bits)