Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Smik_4.2243.190ON1651658131e-112
YDL008W (APC11)3.190ON1651657521e-103
Suva_4.2393.190ON1651657511e-103
Skud_4.2433.190ON1651657451e-102
ZYRO0A04906g3.190ON1601654591e-58
TDEL0H033703.190ON1531654355e-55
Kpol_1045.683.190ON1761764081e-50
KAFR0A012403.190ON1731643837e-47
TPHA0H006403.190ON1801823777e-46
AER016C3.190ON1471633687e-45
KLTH0G16082g3.190ON1351423669e-45
CAGL0I04576g3.190ON1491513671e-44
Ecym_53123.190ON1481633642e-44
SAKL0C10516g3.190ON1441693615e-44
NDAI0A065203.190ON2061423623e-43
KNAG0J012503.190ON2021453571e-42
Kwal_56.231123.190ON1351673493e-42
TBLA0A002603.190ON1841493334e-39
KLLA0E17711g3.190ON1621503002e-34
NCAS0I019203.190ON1281122615e-29
KAFR0C017803.28ON118671047e-06
YOL133W (HRT1)3.28ON121671021e-05
Smik_15.203.28ON121671022e-05
SAKL0C13178g3.28ON138671022e-05
NDAI0G038603.28ON123671012e-05
KLTH0F19228g3.28ON110671002e-05
Suva_15.263.28ON122671002e-05
Skud_15.203.28ON121671003e-05
ZYRO0C03058g3.28ON11667985e-05
TBLA0I019603.279ON184751015e-05
KLLA0C14344g8.799ON1518471036e-05
TPHA0I005908.799ON1591621027e-05
NCAS0C044803.28ON10967968e-05
Kpol_1014.163.28ON10767968e-05
Kwal_55.220543.28ON11167951e-04
Ecym_20293.28ON11467942e-04
NDAI0K007108.799ON159162982e-04
KNAG0A012803.28ON11467932e-04
Kpol_480.258.799ON157162983e-04
ADL181W3.28ON10867914e-04
SAKL0B06226g8.799ON155762964e-04
TDEL0B009808.799ON155962964e-04
TBLA0D006508.799ON156862955e-04
TPHA0P014703.28ON11167905e-04
KAFR0B036208.799ON156062955e-04
CAGL0E01567g3.28ON10267906e-04
TDEL0A004703.28ON11867907e-04
NCAS0C006808.799ON156462947e-04
Suva_13.4328.799ON155962949e-04
YMR247C (RKR1)8.799ON156262949e-04
Skud_13.4198.799ON156462949e-04
Smik_13.4608.799ON156662930.001
KNAG0J005408.799ON156162930.001
TBLA0B087103.28ON12267890.001
KLTH0E13992g8.799ON155062930.001
ZYRO0F12760g8.799ON155562930.001
Kwal_27.123278.799ON157462920.001
KLLA0E07151g3.28ON11067850.003
Ecym_74188.799ON154763880.004
AGL079C2.542ON50647870.005
ABL058C8.799ON154647870.006
NCAS0A082803.279ON11868830.007
CAGL0H10274g3.279ON17560840.007
KNAG0A074303.405ON10234800.011
CAGL0H02651g8.799ON154462850.012
KLTH0F18502gsingletonON26749830.015
Ecym_42508.317ON65753830.017
Ecym_72442.542ON53247810.034
KLLA0F18458g3.279ON14065780.040
Smik_2.1963.279ON18557780.050
TDEL0C027707.416ON20873780.052
KAFR0C004603.279ON15763780.053
TPHA0F018402.157ON52195790.063
AGR034W3.279ON15950770.063
YBR062C3.279ON18057770.069
TBLA0F032803.405ON55532790.069
ZYRO0B02244g2.542ON56362780.072
TBLA0G023102.542ON67464780.074
Ecym_26583.279ON15950760.076
AGL217W8.808ON41466780.080
ZYRO0E06996g3.279ON17251760.080
NDAI0G052001.389ON158632780.084
KLLA0F25740g2.542ON51746780.086
Suva_4.3023.279ON15057750.096
KAFR0A019902.542ON56047770.11
KAFR0I020901.389ON146643770.12
NDAI0A074503.279ON17343750.13
TDEL0A031802.542ON56747760.15
Kpol_1052.193.279ON10350720.16
YDR143C (SAN1)8.317ON61054760.17
YHL010C (ETP1)2.542ON58547760.17
Skud_8.352.542ON58547750.19
Kwal_27.104198.808ON30055750.19
Suva_8.422.542ON58547750.19
Skud_4.4028.317ON61254750.20
TPHA0C042502.542ON55664750.20
Smik_8.322.542ON58547750.21
NDAI0B018202.542ON62547750.22
Kwal_55.21206singletonON27563740.24
SAKL0A09746g2.542ON54856740.24
KLTH0D07150g2.542ON54047740.26
KNAG0A070902.545ON76236740.27
TPHA0A039903.279ON17562720.29
YKL034W (TUL1)2.545ON75836740.32
CAGL0K02563g2.542ON58647730.33
Suva_11.1892.545ON75836730.34
Kpol_1036.668.317ON66828730.36
KAFR0B014602.545ON76136730.36
KNAG0H035102.157ON55141720.44
Smik_4.3878.317ON63454720.45
Suva_1.694.129ON127137730.46
Smik_11.2132.545ON75936720.49
TPHA0B036501.389ON157643720.50
KNAG0C056602.542ON50755720.51
Suva_2.3048.317ON62456720.51
KLLA0E07019g7.416ON27954710.52
SAKL0H15686g8.317ON59936720.55
Kpol_1030.298.761ON101692720.56
Suva_13.4158.761ON102849720.60
Skud_11.1922.545ON75836710.61
Kpol_505.182.157ON58537710.69
Ecym_54453.405ON32127700.69
SAKL0E04488g2.411ON112748710.70
Skud_2.1863.279ON17857690.72
NCAS0A04680singletonON27427700.75
Kpol_1002.82.542ON55847700.77
TBLA0B012602.157ON88532710.79
YMR231W (PEP5)8.761ON102949700.84
KAFR0F007402.157ON51046700.86
ZYRO0B16258g2.157ON57932700.89
YLR247C (IRC20)1.389ON155691700.96
Kwal_55.220763.22ON128653701.0
Kwal_27.105463.279ON10443661.0
TPHA0C042602.545ON75736701.0
Suva_16.4203.405ON29047691.0
ACR267C2.157ON46783691.1
SAKL0D03058g3.279ON15557671.3
KNAG0J008503.279ON16249671.3
KLTH0D07216g2.545ON74736691.3
NDAI0G026308.317ON66129691.3
Kpol_1048.731.389ON154999691.3
YOL138C (RTC1)3.22ON134155691.3
Kwal_26.80902.542ON52047691.4
NCAS0A041202.411ON113776691.4
Smik_1.664.129ON127235691.4
YLR032W (RAD5)2.411ON116941691.4
CAGL0L01947g2.545ON75758691.4
KNAG0A060302.411ON115050691.4
KLLA0C15697g3.405ON30457681.4
TBLA0I014902.545ON75036681.5
NCAS0G025202.157ON51841681.5
Skud_1.604.129ON127534681.6
NCAS0A047602.545ON76136681.6
Kwal_26.80992.545ON75036681.6
Skud_8.1762.157ON41341681.7
Suva_15.3112.157ON26941671.7
ZYRO0E05632g2.545ON76536681.8
SAKL0E10824g2.157ON47541671.8
Kpol_1002.72.545ON75458671.9
TDEL0F044408.317ON55465672.0
NCAS0A125502.542ON57247672.1
KLTH0E09834g2.157ON47941672.2
Ecym_26848.808ON38643672.2
KAFR0B034208.761ON103648672.2
YAL002W (VPS8)4.129ON127435672.3
TDEL0D034603.279ON14441652.4
TPHA0J015708.761ON101848672.4
Skud_12.992.411ON117169672.4
NCAS0C033108.317ON57028662.6
CAGL0G03553g7.416ON21054652.6
Kwal_47.179042.157ON47041662.6
KLLA0F25674g2.545ON75736662.6
SAKL0H17116gsingletonON54436662.7
Kpol_538.53.405ON33546662.8
Kwal_56.235438.247ON96546662.8
Ecym_30056.3ON873114662.8
Skud_15.163.22ON133255662.9
SAKL0D02354g8.808ON33132663.0
TDEL0B063402.545ON76227663.0
CAGL0L03960g2.157ON60346663.1
YHR115C (DMA1)2.157ON41641663.1
TDEL0F02870na 1ON26059653.1
CAGL0E01441g8.317ON71729663.2
Smik_13.4398.761ON103049663.4
Smik_15.163.22ON132655663.4
Ecym_72412.545ON75827653.5
TBLA0A039008.317ON69829653.5
ZYRO0G13376g8.808ON44531653.6
NDAI0K018102.545ON76227654.0
KLLA0E04071g8.317ON70427654.1
NCAS0B069902.157ON52139644.4
Suva_10.1122.411ON116759654.4
KLTH0C05258g3.279ON15243634.8
Suva_15.223.22ON133655644.9
TBLA0C013301.389ON145246644.9
NDAI0F027702.157ON55432645.5
Smik_8.1932.157ON41633645.5
Smik_12.942.411ON117859645.6
Ecym_24906.332ON46567636.0
ABR104W3.405ON32827636.1
Ecym_54282.157ON47438636.3
KLTH0C04664g8.808ON30652627.2
KAFR0H026308.638ON89667637.5
NCAS0B009908.808ON39232627.6
Suva_14.2232.157ON58061628.1
KLTH0F11044g3.405ON29148628.2
TDEL0C054203.405ON9327598.8
ZYRO0C17424g3.405ON27348628.9
CAGL0K08052g3.405ON30554629.1
TDEL0B061701.389ON147045629.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Smik_4.224
         (165 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Smik_4.224 Chr4 (415442..415939) [498 bp, 165 aa] {ON} YDL008W (...   317   e-112
YDL008W Chr4 (433497..433994) [498 bp, 165 aa] {ON}  APC11Cataly...   294   e-103
Suva_4.239 Chr4 (426773..427270) [498 bp, 165 aa] {ON} YDL008W (...   293   e-103
Skud_4.243 Chr4 (428190..428687) [498 bp, 165 aa] {ON} YDL008W (...   291   e-102
ZYRO0A04906g Chr1 complement(395608..396090) [483 bp, 160 aa] {O...   181   1e-58
TDEL0H03370 Chr8 complement(560397..560858) [462 bp, 153 aa] {ON...   172   5e-55
Kpol_1045.68 s1045 complement(160584..161114) [531 bp, 176 aa] {...   161   1e-50
KAFR0A01240 Chr1 (241805..242326) [522 bp, 173 aa] {ON} Anc_3.19...   152   7e-47
TPHA0H00640 Chr8 (126792..127334) [543 bp, 180 aa] {ON} Anc_3.19...   149   7e-46
AER016C Chr5 complement(659572..660015) [444 bp, 147 aa] {ON} Sy...   146   7e-45
KLTH0G16082g Chr7 (1407117..1407524) [408 bp, 135 aa] {ON} some ...   145   9e-45
CAGL0I04576g Chr9 (408872..409321) [450 bp, 149 aa] {ON} similar...   145   1e-44
Ecym_5312 Chr5 complement(632833..633279) [447 bp, 148 aa] {ON} ...   144   2e-44
SAKL0C10516g Chr3 (956666..957100) [435 bp, 144 aa] {ON} similar...   143   5e-44
NDAI0A06520 Chr1 (1482275..1482895) [621 bp, 206 aa] {ON} Anc_3....   144   3e-43
KNAG0J01250 Chr10 complement(225063..225671) [609 bp, 202 aa] {O...   142   1e-42
Kwal_56.23112 s56 complement(406291..406698) [408 bp, 135 aa] {O...   139   3e-42
TBLA0A00260 Chr1 complement(38358..38912) [555 bp, 184 aa] {ON} ...   132   4e-39
KLLA0E17711g Chr5 complement(1571018..1571506) [489 bp, 162 aa] ...   120   2e-34
NCAS0I01920 Chr9 (352307..352693) [387 bp, 128 aa] {ON} Anc_3.19...   105   5e-29
KAFR0C01780 Chr3 complement(363161..363517) [357 bp, 118 aa] {ON...    45   7e-06
YOL133W Chr15 (70325..70690) [366 bp, 121 aa] {ON}  HRT1RING fin...    44   1e-05
Smik_15.20 Chr15 (38383..38748) [366 bp, 121 aa] {ON} YOL133W (R...    44   2e-05
SAKL0C13178g Chr3 complement(1166576..1166992) [417 bp, 138 aa] ...    44   2e-05
NDAI0G03860 Chr7 (925672..926043) [372 bp, 123 aa] {ON} Anc_3.28...    44   2e-05
KLTH0F19228g Chr6 complement(1556655..1556987) [333 bp, 110 aa] ...    43   2e-05
Suva_15.26 Chr15 (48168..48536) [369 bp, 122 aa] {ON} YOL133W (R...    43   2e-05
Skud_15.20 Chr15 (35550..35915) [366 bp, 121 aa] {ON} YOL133W (R...    43   3e-05
ZYRO0C03058g Chr3 complement(236925..237275) [351 bp, 116 aa] {O...    42   5e-05
TBLA0I01960 Chr9 complement(444753..445291,445364..445379) [555 ...    44   5e-05
KLLA0C14344g Chr3 (1245226..1249782) [4557 bp, 1518 aa] {ON} sim...    44   6e-05
TPHA0I00590 Chr9 (117658..122433) [4776 bp, 1591 aa] {ON} Anc_8....    44   7e-05
NCAS0C04480 Chr3 (919123..919452) [330 bp, 109 aa] {ON} Anc_3.28       42   8e-05
Kpol_1014.16 s1014 complement(29615..29938) [324 bp, 107 aa] {ON...    42   8e-05
Kwal_55.22054 s55 complement(1091138..1091473) [336 bp, 111 aa] ...    41   1e-04
Ecym_2029 Chr2 (47083..47427) [345 bp, 114 aa] {ON} similar to A...    41   2e-04
NDAI0K00710 Chr11 (155351..160126) [4776 bp, 1591 aa] {ON} Anc_8...    42   2e-04
KNAG0A01280 Chr1 (27372..27716) [345 bp, 114 aa] {ON} Anc_3.28 Y...    40   2e-04
Kpol_480.25 s480 (57636..62351) [4716 bp, 1571 aa] {ON} (57636.....    42   3e-04
ADL181W Chr4 (379682..380008) [327 bp, 108 aa] {ON} Syntenic hom...    40   4e-04
SAKL0B06226g Chr2 (524855..529528) [4674 bp, 1557 aa] {ON} simil...    42   4e-04
TDEL0B00980 Chr2 (181064..185743) [4680 bp, 1559 aa] {ON} Anc_8....    42   4e-04
TBLA0D00650 Chr4 (172839..177545) [4707 bp, 1568 aa] {ON} Anc_8....    41   5e-04
TPHA0P01470 Chr16 complement(301305..301640) [336 bp, 111 aa] {O...    39   5e-04
KAFR0B03620 Chr2 complement(752307..756989) [4683 bp, 1560 aa] {...    41   5e-04
CAGL0E01567g Chr5 (148425..148733) [309 bp, 102 aa] {ON} similar...    39   6e-04
TDEL0A00470 Chr1 (82852..83208) [357 bp, 118 aa] {ON} Anc_3.28 Y...    39   7e-04
NCAS0C00680 Chr3 (109845..114539) [4695 bp, 1564 aa] {ON} Anc_8....    41   7e-04
Suva_13.432 Chr13 complement(744705..749384) [4680 bp, 1559 aa] ...    41   9e-04
YMR247C Chr13 complement(763351..768039) [4689 bp, 1562 aa] {ON}...    41   9e-04
Skud_13.419 Chr13 complement(738148..742842) [4695 bp, 1564 aa] ...    41   9e-04
Smik_13.460 Chr13 complement(747753..752453) [4701 bp, 1566 aa] ...    40   0.001
KNAG0J00540 Chr10 (86360..91045) [4686 bp, 1561 aa] {ON} Anc_8.7...    40   0.001
TBLA0B08710 Chr2 complement(2075746..2076114) [369 bp, 122 aa] {...    39   0.001
KLTH0E13992g Chr5 (1234550..1239202) [4653 bp, 1550 aa] {ON} sim...    40   0.001
ZYRO0F12760g Chr6 complement(1037460..1042127) [4668 bp, 1555 aa...    40   0.001
Kwal_27.12327 s27 (1178866..1183590) [4725 bp, 1574 aa] {ON} YMR...    40   0.001
KLLA0E07151g Chr5 (651474..651806) [333 bp, 110 aa] {ON} similar...    37   0.003
Ecym_7418 Chr7 (853469..858112) [4644 bp, 1547 aa] {ON} similar ...    39   0.004
AGL079C Chr7 complement(557422..558942) [1521 bp, 506 aa] {ON} S...    38   0.005
ABL058C Chr2 complement(288353..292993) [4641 bp, 1546 aa] {ON} ...    38   0.006
NCAS0A08280 Chr1 (1636423..1636779) [357 bp, 118 aa] {ON} Anc_3....    37   0.007
CAGL0H10274g Chr8 complement(1003801..1004312,1004468..1004483) ...    37   0.007
KNAG0A07430 Chr1 complement(1165740..1166048) [309 bp, 102 aa] {...    35   0.011
CAGL0H02651g Chr8 (238495..243129) [4635 bp, 1544 aa] {ON} simil...    37   0.012
KLTH0F18502g Chr6 (1496235..1497038) [804 bp, 267 aa] {ON} conse...    37   0.015
Ecym_4250 Chr4 complement(517592..519560,519632..519636) [1974 b...    37   0.017
Ecym_7244 Chr7 complement(512748..514346) [1599 bp, 532 aa] {ON}...    36   0.034
KLLA0F18458g Chr6 complement(1697871..1698293) [423 bp, 140 aa] ...    35   0.040
Smik_2.196 Chr2 complement(347806..348363) [558 bp, 185 aa] {ON}...    35   0.050
TDEL0C02770 Chr3 complement(486107..486733) [627 bp, 208 aa] {ON...    35   0.052
KAFR0C00460 Chr3 complement(94989..95446,95522..95537) [474 bp, ...    35   0.053
TPHA0F01840 Chr6 complement(422396..423961) [1566 bp, 521 aa] {O...    35   0.063
AGR034W Chr7 (772766..773245) [480 bp, 159 aa] {ON} Syntenic hom...    34   0.063
YBR062C Chr2 complement(365976..366502,366585..366600) [543 bp, ...    34   0.069
TBLA0F03280 Chr6 complement(805882..807549) [1668 bp, 555 aa] {O...    35   0.069
ZYRO0B02244g Chr2 (186386..188077) [1692 bp, 563 aa] {ON} simila...    35   0.072
TBLA0G02310 Chr7 (598514..600538) [2025 bp, 674 aa] {ON} Anc_2.5...    35   0.074
Ecym_2658 Chr2 (1270952..1271431) [480 bp, 159 aa] {ON} similar ...    34   0.076
AGL217W Chr7 (290043..291287) [1245 bp, 414 aa] {ON} Syntenic ho...    35   0.080
ZYRO0E06996g Chr5 complement(530578..531080,531138..531153) [519...    34   0.080
NDAI0G05200 Chr7 (1261661..1266421) [4761 bp, 1586 aa] {ON} Anc_...    35   0.084
KLLA0F25740g Chr6 complement(2389226..2390779) [1554 bp, 517 aa]...    35   0.086
Suva_4.302 Chr4 complement(532902..533210,533286..533429) [453 b...    33   0.096
KAFR0A01990 Chr1 (418279..419961) [1683 bp, 560 aa] {ON} Anc_2.5...    34   0.11 
KAFR0I02090 Chr9 complement(427023..431423) [4401 bp, 1466 aa] {...    34   0.12 
NDAI0A07450 Chr1 complement(1699546..1700051,1700150..1700165) [...    33   0.13 
TDEL0A03180 Chr1 (569298..571001) [1704 bp, 567 aa] {ON} Anc_2.5...    34   0.15 
Kpol_1052.19 s1052 (60008..60319) [312 bp, 103 aa] {ON} (60008.....    32   0.16 
YDR143C Chr4 complement(742042..743874) [1833 bp, 610 aa] {ON}  ...    34   0.17 
YHL010C Chr8 complement(81964..83721) [1758 bp, 585 aa] {ON}  ET...    34   0.17 
Skud_8.35 Chr8 complement(70011..71768) [1758 bp, 585 aa] {ON} Y...    33   0.19 
Kwal_27.10419 s27 (337699..338601) [903 bp, 300 aa] {ON} YOL054W...    33   0.19 
Suva_8.42 Chr8 complement(84493..86250) [1758 bp, 585 aa] {ON} Y...    33   0.19 
Skud_4.402 Chr4 complement(713711..715549) [1839 bp, 612 aa] {ON...    33   0.20 
TPHA0C04250 Chr3 (915632..917302) [1671 bp, 556 aa] {ON} Anc_2.5...    33   0.20 
Smik_8.32 Chr8 complement(65542..67299) [1758 bp, 585 aa] {ON} Y...    33   0.21 
NDAI0B01820 Chr2 (433938..435815) [1878 bp, 625 aa] {ON} Anc_2.542     33   0.22 
Kwal_55.21206 s55 complement(730534..731361) [828 bp, 275 aa] {O...    33   0.24 
SAKL0A09746g Chr1 (858392..860038) [1647 bp, 548 aa] {ON} simila...    33   0.24 
KLTH0D07150g Chr4 (627115..628737) [1623 bp, 540 aa] {ON} simila...    33   0.26 
KNAG0A07090 Chr1 complement(1110424..1112712) [2289 bp, 762 aa] ...    33   0.27 
TPHA0A03990 Chr1 (887214..887741) [528 bp, 175 aa] {ON} Anc_3.27...    32   0.29 
YKL034W Chr11 (371829..374105) [2277 bp, 758 aa] {ON}  TUL1Golgi...    33   0.32 
CAGL0K02563g Chr11 complement(231812..233572) [1761 bp, 586 aa] ...    33   0.33 
Suva_11.189 Chr11 (354713..356989) [2277 bp, 758 aa] {ON} YKL034...    33   0.34 
Kpol_1036.66 s1036 complement(182540..184546) [2007 bp, 668 aa] ...    33   0.36 
KAFR0B01460 Chr2 (277155..279440) [2286 bp, 761 aa] {ON} Anc_2.5...    33   0.36 
KNAG0H03510 Chr8 complement(654395..656050) [1656 bp, 551 aa] {O...    32   0.44 
Smik_4.387 Chr4 complement(702765..704669) [1905 bp, 634 aa] {ON...    32   0.45 
Suva_1.69 Chr1 (120731..124546) [3816 bp, 1271 aa] {ON} YAL002W ...    33   0.46 
Smik_11.213 Chr11 (358262..360541) [2280 bp, 759 aa] {ON} YKL034...    32   0.49 
TPHA0B03650 Chr2 complement(857083..861813) [4731 bp, 1576 aa] {...    32   0.50 
KNAG0C05660 Chr3 complement(1091851..1093374) [1524 bp, 507 aa] ...    32   0.51 
Suva_2.304 Chr2 complement(537292..539166) [1875 bp, 624 aa] {ON...    32   0.51 
KLLA0E07019g Chr5 (641391..642230) [840 bp, 279 aa] {ON} some si...    32   0.52 
SAKL0H15686g Chr8 (1367935..1367948,1368042..1369827) [1800 bp, ...    32   0.55 
Kpol_1030.29 s1030 complement(56650..59700) [3051 bp, 1016 aa] {...    32   0.56 
Suva_13.415 Chr13 (714887..717973) [3087 bp, 1028 aa] {ON} YMR23...    32   0.60 
Skud_11.192 Chr11 (351379..353655) [2277 bp, 758 aa] {ON} YKL034...    32   0.61 
Kpol_505.18 s505 complement(48530..50287) [1758 bp, 585 aa] {ON}...    32   0.69 
Ecym_5445 Chr5 complement(920562..921527) [966 bp, 321 aa] {ON} ...    32   0.69 
SAKL0E04488g Chr5 (359434..362817) [3384 bp, 1127 aa] {ON} simil...    32   0.70 
Skud_2.186 Chr2 complement(334347..334867,334953..334968) [537 b...    31   0.72 
NCAS0A04680 Chr1 complement(932306..933130) [825 bp, 274 aa] {ON}      32   0.75 
Kpol_1002.8 s1002 complement(21450..23126) [1677 bp, 558 aa] {ON...    32   0.77 
TBLA0B01260 Chr2 (266584..269241) [2658 bp, 885 aa] {ON} Anc_2.1...    32   0.79 
YMR231W Chr13 (733545..736634) [3090 bp, 1029 aa] {ON}  PEP5Comp...    32   0.84 
KAFR0F00740 Chr6 (144375..145907) [1533 bp, 510 aa] {ON} Anc_2.1...    32   0.86 
ZYRO0B16258g Chr2 complement(1317605..1319344) [1740 bp, 579 aa]...    32   0.89 
YLR247C Chr12 complement(628684..633354) [4671 bp, 1556 aa] {ON}...    32   0.96 
Kwal_55.22076 s55 (1098857..1102717) [3861 bp, 1286 aa] {ON} YOL...    32   1.0  
Kwal_27.10546 s27 complement(386744..387058) [315 bp, 104 aa] {O...    30   1.0  
TPHA0C04260 Chr3 complement(917526..919799) [2274 bp, 757 aa] {O...    32   1.0  
Suva_16.420 Chr16 complement(726959..727831) [873 bp, 290 aa] {O...    31   1.0  
ACR267C Chr3 complement(841323..842726) [1404 bp, 467 aa] {ON} S...    31   1.1  
SAKL0D03058g Chr4 complement(252198..252649,252717..252732) [468...    30   1.3  
KNAG0J00850 Chr10 complement(146187..146675) [489 bp, 162 aa] {O...    30   1.3  
KLTH0D07216g Chr4 complement(631219..633462) [2244 bp, 747 aa] {...    31   1.3  
NDAI0G02630 Chr7 (602238..604223) [1986 bp, 661 aa] {ON} Anc_8.317     31   1.3  
Kpol_1048.73 s1048 (207883..212532) [4650 bp, 1549 aa] {ON} (207...    31   1.3  
YOL138C Chr15 complement(61325..65350) [4026 bp, 1341 aa] {ON}  ...    31   1.3  
Kwal_26.8090 s26 complement(641408..642970) [1563 bp, 520 aa] {O...    31   1.4  
NCAS0A04120 Chr1 complement(833424..836837) [3414 bp, 1137 aa] {...    31   1.4  
Smik_1.66 Chr1 (126883..130701) [3819 bp, 1272 aa] {ON} YAL002W ...    31   1.4  
YLR032W Chr12 (204991..208500) [3510 bp, 1169 aa] {ON}  RAD5DNA ...    31   1.4  
CAGL0L01947g Chr12 (227996..230269) [2274 bp, 757 aa] {ON} simil...    31   1.4  
KNAG0A06030 Chr1 complement(909762..913214) [3453 bp, 1150 aa] {...    31   1.4  
KLLA0C15697g Chr3 (1360289..1361203) [915 bp, 304 aa] {ON} simil...    31   1.4  
TBLA0I01490 Chr9 (322980..325232) [2253 bp, 750 aa] {ON} Anc_2.5...    31   1.5  
NCAS0G02520 Chr7 (451683..453239) [1557 bp, 518 aa] {ON} Anc_2.1...    31   1.5  
Skud_1.60 Chr1 (118757..122584) [3828 bp, 1275 aa] {ON} YAL002W ...    31   1.6  
NCAS0A04760 Chr1 (948786..951071) [2286 bp, 761 aa] {ON} Anc_2.5...    31   1.6  
Kwal_26.8099 s26 complement(645436..647688) [2253 bp, 750 aa] {O...    31   1.6  
Skud_8.176 Chr8 complement(313886..315127) [1242 bp, 413 aa] {ON...    31   1.7  
Suva_15.311 Chr15 complement(542475..543284) [810 bp, 269 aa] {O...    30   1.7  
ZYRO0E05632g Chr5 complement(434758..437055) [2298 bp, 765 aa] {...    31   1.8  
SAKL0E10824g Chr5 complement(902623..904050) [1428 bp, 475 aa] {...    30   1.8  
Kpol_1002.7 s1002 (19006..21270) [2265 bp, 754 aa] {ON} (19006.....    30   1.9  
TDEL0F04440 Chr6 complement(833116..834780) [1665 bp, 554 aa] {O...    30   2.0  
NCAS0A12550 Chr1 (2476209..2477927) [1719 bp, 572 aa] {ON} Anc_2...    30   2.1  
KLTH0E09834g Chr5 complement(885503..886942) [1440 bp, 479 aa] {...    30   2.2  
Ecym_2684 Chr2 complement(1321556..1322716) [1161 bp, 386 aa] {O...    30   2.2  
KAFR0B03420 Chr2 (713034..716144) [3111 bp, 1036 aa] {ON} Anc_8....    30   2.2  
YAL002W Chr1 (143707..147531) [3825 bp, 1274 aa] {ON}  VPS8Membr...    30   2.3  
TDEL0D03460 Chr4 (637921..638355) [435 bp, 144 aa] {ON} Anc_3.27...    30   2.4  
TPHA0J01570 Chr10 (360114..363170) [3057 bp, 1018 aa] {ON} Anc_8...    30   2.4  
Skud_12.99 Chr12 (196796..200311) [3516 bp, 1171 aa] {ON} YLR032...    30   2.4  
NCAS0C03310 Chr3 (649744..651456) [1713 bp, 570 aa] {ON} Anc_8.317     30   2.6  
CAGL0G03553g Chr7 complement(345057..345689) [633 bp, 210 aa] {O...    30   2.6  
Kwal_47.17904 s47 complement(602106..603518) [1413 bp, 470 aa] {...    30   2.6  
KLLA0F25674g Chr6 (2384293..2386566) [2274 bp, 757 aa] {ON} simi...    30   2.6  
SAKL0H17116g Chr8 complement(1512627..1514261) [1635 bp, 544 aa]...    30   2.7  
Kpol_538.5 s538 (7029..8036) [1008 bp, 335 aa] {ON} (7029..8036)...    30   2.8  
Kwal_56.23543 s56 complement(591514..594411) [2898 bp, 965 aa] {...    30   2.8  
Ecym_3005 Chr3 complement(9078..11699) [2622 bp, 873 aa] {ON} si...    30   2.8  
Skud_15.16 Chr15 complement(26552..30550) [3999 bp, 1332 aa] {ON...    30   2.9  
SAKL0D02354g Chr4 (188524..189519) [996 bp, 331 aa] {ON} weakly ...    30   3.0  
TDEL0B06340 Chr2 complement(1122797..1125085) [2289 bp, 762 aa] ...    30   3.0  
CAGL0L03960g Chr12 complement(463751..465562) [1812 bp, 603 aa] ...    30   3.1  
YHR115C Chr8 complement(340109..341359) [1251 bp, 416 aa] {ON}  ...    30   3.1  
TDEL0F02870 Chr6 complement(518828..519610) [783 bp, 260 aa] {ON}      30   3.1  
CAGL0E01441g Chr5 (135312..137465) [2154 bp, 717 aa] {ON} some s...    30   3.2  
Smik_13.439 Chr13 (717478..720570) [3093 bp, 1030 aa] {ON} YMR23...    30   3.4  
Smik_15.16 Chr15 complement(29410..33390) [3981 bp, 1326 aa] {ON...    30   3.4  
Ecym_7241 Chr7 (507764..510040) [2277 bp, 758 aa] {ON} similar t...    30   3.5  
TBLA0A03900 Chr1 complement(974843..976939) [2097 bp, 698 aa] {O...    30   3.5  
ZYRO0G13376g Chr7 complement(1066321..1067658) [1338 bp, 445 aa]...    30   3.6  
NDAI0K01810 Chr11 (405118..407406) [2289 bp, 762 aa] {ON} Anc_2....    30   4.0  
KLLA0E04071g Chr5 (369201..371315) [2115 bp, 704 aa] {ON} some s...    30   4.1  
NCAS0B06990 Chr2 complement(1330221..1331786) [1566 bp, 521 aa] ...    29   4.4  
Suva_10.112 Chr10 (211443..214946) [3504 bp, 1167 aa] {ON} YLR03...    30   4.4  
KLTH0C05258g Chr3 complement(455688..456130,456190..456205) [459...    29   4.8  
Suva_15.22 Chr15 complement(39171..43181) [4011 bp, 1336 aa] {ON...    29   4.9  
TBLA0C01330 Chr3 (291659..296017) [4359 bp, 1452 aa] {ON} Anc_1....    29   4.9  
NDAI0F02770 Chr6 complement(677011..678675) [1665 bp, 554 aa] {O...    29   5.5  
Smik_8.193 Chr8 complement(316475..317725) [1251 bp, 416 aa] {ON...    29   5.5  
Smik_12.94 Chr12 (191768..195304) [3537 bp, 1178 aa] {ON} YLR032...    29   5.6  
Ecym_2490 Chr2 (961218..962615) [1398 bp, 465 aa] {ON} similar t...    29   6.0  
ABR104W Chr2 (574068..575054) [987 bp, 328 aa] {ON} Syntenic hom...    29   6.1  
Ecym_5428 Chr5 complement(881972..883396) [1425 bp, 474 aa] {ON}...    29   6.3  
KLTH0C04664g Chr3 (405366..406286) [921 bp, 306 aa] {ON} some si...    28   7.2  
KAFR0H02630 Chr8 (500064..502754) [2691 bp, 896 aa] {ON} Anc_8.6...    29   7.5  
NCAS0B00990 Chr2 complement(154925..156103) [1179 bp, 392 aa] {O...    28   7.6  
Suva_14.223 Chr14 (404941..406683) [1743 bp, 580 aa] {ON} YNL116...    28   8.1  
KLTH0F11044g Chr6 (937668..938543) [876 bp, 291 aa] {ON} weakly ...    28   8.2  
TDEL0C05420 Chr3 complement(972821..973102) [282 bp, 93 aa] {ON}...    27   8.8  
ZYRO0C17424g Chr3 complement(1357940..1358761) [822 bp, 273 aa] ...    28   8.9  
CAGL0K08052g Chr11 complement(800991..801908) [918 bp, 305 aa] {...    28   9.1  
TDEL0B06170 Chr2 (1088912..1093324) [4413 bp, 1470 aa] {ON} Anc_...    28   9.2  

>Smik_4.224 Chr4 (415442..415939) [498 bp, 165 aa] {ON} YDL008W
           (REAL)
          Length = 165

 Score =  317 bits (813), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 153/165 (92%), Positives = 153/165 (92%)

Query: 1   MKVKINEVHSVFAWTWQIPSISDEKVTXXXXXXXXXXXXVCGICRASYNGTCPSCKFPGD 60
           MKVKINEVHSVFAWTWQIPSISDEKVT            VCGICRASYNGTCPSCKFPGD
Sbjct: 1   MKVKINEVHSVFAWTWQIPSISDEKVTNDKLNDNDENEDVCGICRASYNGTCPSCKFPGD 60

Query: 61  QCPLVIGVCHHNFHDHCIYRWLDTPTSKGLCPMCRQRFQLQKGLAINDAHIQKFVEIVSR 120
           QCPLVIGVCHHNFHDHCIYRWLDTPTSKGLCPMCRQRFQLQKGLAINDAHIQKFVEIVSR
Sbjct: 61  QCPLVIGVCHHNFHDHCIYRWLDTPTSKGLCPMCRQRFQLQKGLAINDAHIQKFVEIVSR 120

Query: 121 RREEMIEEGVAEDFVDFDEPIRQNTDNAIDRSQVDTVLDEDFLLR 165
           RREEMIEEGVAEDFVDFDEPIRQNTDNAIDRSQVDTVLDEDFLLR
Sbjct: 121 RREEMIEEGVAEDFVDFDEPIRQNTDNAIDRSQVDTVLDEDFLLR 165

>YDL008W Chr4 (433497..433994) [498 bp, 165 aa] {ON}  APC11Catalytic
           core subunit of the Anaphase-Promoting Complex/Cyclosome
           (APC/C), which is a ubiquitin-protein ligase required
           for degradation of anaphase inhibitors, including
           mitotic cyclins, during the metaphase/anaphase
           transition; contains a RING-H2 domain that is required
           for activity
          Length = 165

 Score =  294 bits (752), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 139/165 (84%), Positives = 144/165 (87%)

Query: 1   MKVKINEVHSVFAWTWQIPSISDEKVTXXXXXXXXXXXXVCGICRASYNGTCPSCKFPGD 60
           MKVKINEVHSVFAW+W IPS SDE               VCGICRASYNGTCPSCKFPGD
Sbjct: 1   MKVKINEVHSVFAWSWHIPSTSDEDAANNDPIGNDEDEDVCGICRASYNGTCPSCKFPGD 60

Query: 61  QCPLVIGVCHHNFHDHCIYRWLDTPTSKGLCPMCRQRFQLQKGLAINDAHIQKFVEIVSR 120
           QCPLVIG+CHHNFHDHCIYRWLDTPTSKGLCPMCRQ FQLQKGLAINDAH+QKFVEIVSR
Sbjct: 61  QCPLVIGLCHHNFHDHCIYRWLDTPTSKGLCPMCRQTFQLQKGLAINDAHVQKFVEIVSR 120

Query: 121 RREEMIEEGVAEDFVDFDEPIRQNTDNAIDRSQVDTVLDEDFLLR 165
           RREEMIEEGVAE+FVDFDEPIRQNTDN I R QVDT+LDEDFLLR
Sbjct: 121 RREEMIEEGVAEEFVDFDEPIRQNTDNPIGRQQVDTILDEDFLLR 165

>Suva_4.239 Chr4 (426773..427270) [498 bp, 165 aa] {ON} YDL008W
           (REAL)
          Length = 165

 Score =  293 bits (751), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 140/165 (84%), Positives = 145/165 (87%)

Query: 1   MKVKINEVHSVFAWTWQIPSISDEKVTXXXXXXXXXXXXVCGICRASYNGTCPSCKFPGD 60
           MKVKIN+VHSVFAW+W IP ISDE  T            VCGICRASYNGTCPSCKFPGD
Sbjct: 1   MKVKINQVHSVFAWSWHIPRISDENETNEVTNENDDDEDVCGICRASYNGTCPSCKFPGD 60

Query: 61  QCPLVIGVCHHNFHDHCIYRWLDTPTSKGLCPMCRQRFQLQKGLAINDAHIQKFVEIVSR 120
           QCPLVIGVCHHNFHDHCIYRWLDT  SKGLCPMCRQ FQLQKGLAINDAHI+KFVE+VSR
Sbjct: 61  QCPLVIGVCHHNFHDHCIYRWLDTSNSKGLCPMCRQVFQLQKGLAINDAHIRKFVEVVSR 120

Query: 121 RREEMIEEGVAEDFVDFDEPIRQNTDNAIDRSQVDTVLDEDFLLR 165
           RREEMIEEGVAEDFVDFDEPIRQNTD+AIDR QVDTVLDEDFLLR
Sbjct: 121 RREEMIEEGVAEDFVDFDEPIRQNTDSAIDRQQVDTVLDEDFLLR 165

>Skud_4.243 Chr4 (428190..428687) [498 bp, 165 aa] {ON} YDL008W
           (REAL)
          Length = 165

 Score =  291 bits (745), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 137/165 (83%), Positives = 146/165 (88%)

Query: 1   MKVKINEVHSVFAWTWQIPSISDEKVTXXXXXXXXXXXXVCGICRASYNGTCPSCKFPGD 60
           MKVKINEVHSVFAW+W IPSISDE +             VCGICRASYNGTCPSCK+PGD
Sbjct: 1   MKVKINEVHSVFAWSWHIPSISDEVIGNEVPNENDEDEDVCGICRASYNGTCPSCKYPGD 60

Query: 61  QCPLVIGVCHHNFHDHCIYRWLDTPTSKGLCPMCRQRFQLQKGLAINDAHIQKFVEIVSR 120
           QCPLVIGVCHHNFHDHCIYRWLDT  SKGLCPMCRQ FQLQKGLAINDAHIQKFV+IVSR
Sbjct: 61  QCPLVIGVCHHNFHDHCIYRWLDTSNSKGLCPMCRQTFQLQKGLAINDAHIQKFVDIVSR 120

Query: 121 RREEMIEEGVAEDFVDFDEPIRQNTDNAIDRSQVDTVLDEDFLLR 165
           RREEMIEEGVAEDFV+FDEP+RQNTD+AI+R Q+DTVLDEDFLLR
Sbjct: 121 RREEMIEEGVAEDFVNFDEPMRQNTDSAIERQQIDTVLDEDFLLR 165

>ZYRO0A04906g Chr1 complement(395608..396090) [483 bp, 160 aa] {ON}
           similar to uniprot|Q12157 Saccharomyces cerevisiae
           YDL008W APC11 Catalytic core subunit of the Anaphase-
           Promoting Complex/Cyclosome (APC/C) which is a
           ubiquitin- protein ligase required for degradation of
           anaphase inhibitors including mitotic cyclins during the
           metaphase/anaphase transition
          Length = 160

 Score =  181 bits (459), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 89/165 (53%), Positives = 106/165 (64%), Gaps = 5/165 (3%)

Query: 1   MKVKINEVHSVFAWTWQIPSISDEKVTXXXXXXXXXXXXVCGICRASYNGTCPSCKFPGD 60
           MKV I EVHSVFAWTW IP     K              VCGICRASYN TCPSCK+PGD
Sbjct: 1   MKVDIEEVHSVFAWTWHIP-----KDNKDGSLEADDDDDVCGICRASYNATCPSCKYPGD 55

Query: 61  QCPLVIGVCHHNFHDHCIYRWLDTPTSKGLCPMCRQRFQLQKGLAINDAHIQKFVEIVSR 120
           +C LV+G C+HNFH HCIYRWLDT TSKGLCPMCRQ FQL++GLAIND+ ++KF E+  R
Sbjct: 56  ECSLVVGECNHNFHVHCIYRWLDTTTSKGLCPMCRQLFQLKRGLAINDSQLEKFKELQLR 115

Query: 121 RREEMIEEGVAEDFVDFDEPIRQNTDNAIDRSQVDTVLDEDFLLR 165
           +R     E   ED  +  E      D A    Q D ++D+  ++R
Sbjct: 116 KRTNTAGEFADEDDEEAIERAMAQQDQAEVDDQGDVIMDQGLVVR 160

>TDEL0H03370 Chr8 complement(560397..560858) [462 bp, 153 aa] {ON}
           Anc_3.190 YDL008W
          Length = 153

 Score =  172 bits (435), Expect = 5e-55,   Method: Compositional matrix adjust.
 Identities = 87/165 (52%), Positives = 108/165 (65%), Gaps = 12/165 (7%)

Query: 1   MKVKINEVHSVFAWTWQIPSISDEKVTXXXXXXXXXXXXVCGICRASYNGTCPSCKFPGD 60
           MKVK+ EVHSVFAWTW IP  S +               VCGICRASYN TCP CKFPGD
Sbjct: 1   MKVKLREVHSVFAWTWHIPKESQD--AHAETIDDNDGDDVCGICRASYNATCPGCKFPGD 58

Query: 61  QCPLVIGVCHHNFHDHCIYRWLDTPTSKGLCPMCRQRFQLQKGLAINDAHIQKFVEIVSR 120
            CPLV+G C+HNFH HCIYRWLDT TS+GLCPMCRQ FQL+KGLAIND+ I KF E+ ++
Sbjct: 59  GCPLVVGECNHNFHVHCIYRWLDTATSRGLCPMCRQTFQLKKGLAINDSQISKFQELRNK 118

Query: 121 RREEMIEEGVAEDFVDFDEPIRQNTDNAIDRSQVDTVLDEDFLLR 165
           + +   +E     F D  +P     ++     Q D ++D+  ++R
Sbjct: 119 QWQTRQQE-----FGDQQDPETNPLED-----QDDPMMDQGLIVR 153

>Kpol_1045.68 s1045 complement(160584..161114) [531 bp, 176 aa] {ON}
           complement(160586..161116) [531 nt, 177 aa]
          Length = 176

 Score =  161 bits (408), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 81/176 (46%), Positives = 108/176 (61%), Gaps = 11/176 (6%)

Query: 1   MKVKINEVHSVFAWTWQIPSIS---------DEKVTXXXXXXXXXXXXVCGICRASYNGT 51
           MKV++ +VH VF+W+W IP  +         D                VCGICRAS+N T
Sbjct: 1   MKVEVKKVHCVFSWSWHIPKNAGTIESGLGEDAIGDIHGMVHEDDEEDVCGICRASFNRT 60

Query: 52  CPSCKFPGDQCPLVIGVCHHNFHDHCIYRWLDTPTSKGLCPMCRQRFQLQKGLAINDAHI 111
           CP+CKFPGD CPLVIG C HNFH HCIY WLDT TS+GLCPMCRQ FQL+KG++IND+HI
Sbjct: 61  CPNCKFPGDGCPLVIGECQHNFHVHCIYEWLDTSTSRGLCPMCRQLFQLKKGVSINDSHI 120

Query: 112 QKFVEIVSRRREEM--IEEGVAEDFVDFDEPIRQNTDNAIDRSQVDTVLDEDFLLR 165
           ++F E+  +R++E    E  + +D         Q        +Q D ++D+D ++R
Sbjct: 121 ERFRELAIKRQQEQNEFESNLDDDAAIARAIAEQEDTGRNVDNQGDIIMDQDLVVR 176

>KAFR0A01240 Chr1 (241805..242326) [522 bp, 173 aa] {ON} Anc_3.190
           YDL008W
          Length = 173

 Score =  152 bits (383), Expect = 7e-47,   Method: Compositional matrix adjust.
 Identities = 76/164 (46%), Positives = 98/164 (59%), Gaps = 16/164 (9%)

Query: 1   MKVKINEVHSVFAWTWQIPSISDEK---VTXXXXXXXXXXXXVCGICRASYNGTCPSCKF 57
           MKV + +++ V+AW+W I +   E+   V             VCGICRASYNGTCPSCK 
Sbjct: 1   MKVTVKKIYPVYAWSWDIVTRKGEQKSDVYSVLDKYRSEKDDVCGICRASYNGTCPSCKI 60

Query: 58  PGDQCPLVIGVCHHNFHDHCIYRWLDTPTSKGLCPMCRQRFQLQKGLAINDAHIQKFVEI 117
           PG  CPL++G C+HNFH HCI+RWL+T  SKGLCPMCRQ F+L K L IN  ++QKF E+
Sbjct: 61  PGTMCPLIVGSCNHNFHYHCIFRWLNTLNSKGLCPMCRQEFKLDKKLVINSDYLQKF-EV 119

Query: 118 VSRRREEMIEEGVAEDFVDFDEPIRQNTDNAIDRSQVDTVLDED 161
           ++R+  E     V E+            DN ID   +D    ED
Sbjct: 120 LARKNRERRALNVDEE------------DNGIDNMIIDAAGIED 151

>TPHA0H00640 Chr8 (126792..127334) [543 bp, 180 aa] {ON} Anc_3.190
           YDL008W
          Length = 180

 Score =  149 bits (377), Expect = 7e-46,   Method: Compositional matrix adjust.
 Identities = 82/182 (45%), Positives = 103/182 (56%), Gaps = 19/182 (10%)

Query: 1   MKVKINEVHSVFAWTWQIPSISDEKVTXXXXXXXXXXXXV----------------CGIC 44
           MKV+I  V+ VFAW WQIP   D+KV             V                CGIC
Sbjct: 1   MKVQIKNVNGVFAWGWQIPK-HDQKVKKDHNNSIVSGSDVDHQEQNSDDEDDEEDFCGIC 59

Query: 45  RASYNGTCPSCKFPGDQCPLVIGVCHHNFHDHCIYRWLDTPTSKGLCPMCRQRFQLQKGL 104
           RAS+   CP+CKFP D CP+VIG C HNFH HCI+ WL+T  S+GLCPMCRQ F+L+KG+
Sbjct: 60  RASFIRACPNCKFPSDGCPIVIGKCKHNFHVHCIFEWLETEASRGLCPMCRQVFELRKGV 119

Query: 105 AINDAHIQKFVEIVSRRREEMIE-EGVAEDFVDFDEPIRQNTDNAIDRSQVDTVLDEDFL 163
            IND H   F E++ +R++E  E E  AED       I     N  D   VD +LD+D +
Sbjct: 120 VINDLHYVTFKELILKRQKEQNEFEATAEDDEALARMIAAQEGNNGD-VPVDDILDQDMV 178

Query: 164 LR 165
           +R
Sbjct: 179 VR 180

>AER016C Chr5 complement(659572..660015) [444 bp, 147 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDL008W
           (APC11)
          Length = 147

 Score =  146 bits (368), Expect = 7e-45,   Method: Compositional matrix adjust.
 Identities = 67/163 (41%), Positives = 97/163 (59%), Gaps = 17/163 (10%)

Query: 1   MKVKINEVHSVFAWTWQIPSISDEKVTXXXXXXXXXXXXVCGICRASYNGTCPSCKFPGD 60
           M+++IN +  V +W W +P    E               VCGICR SYNGTCP+CK PG+
Sbjct: 1   MQLQINNIQCVASWYWDVPK---ELKRDSPVYEDEDEEDVCGICRGSYNGTCPNCKLPGE 57

Query: 61  QCPLVIGVCHHNFHDHCIYRWLDTPTSKGLCPMCRQRFQLQKGLAINDAHIQKFVEIVSR 120
            CPL++G CHHNFH HCIY+WL+T TSKGLCPMCRQ F L++G+ IN+ H  KF +++ +
Sbjct: 58  TCPLIVGSCHHNFHVHCIYQWLNTSTSKGLCPMCRQAFSLREGIRINEPHRDKFEKVLMK 117

Query: 121 RREEMIEEGVAEDFVDFDEPIRQNTDNAIDRSQVDTVLDEDFL 163
            R++ +              +     N +   Q D ++D++F+
Sbjct: 118 ARQQSV--------------VSVAGANPVGPDQDDVIIDQEFI 146

>KLTH0G16082g Chr7 (1407117..1407524) [408 bp, 135 aa] {ON} some
           similarities with uniprot|Q12157 Saccharomyces
           cerevisiae YDL008W APC11 Catalytic core subunit of the
           Anaphase-Promoting Complex/Cyclosome (APC/C) which is a
           ubiquitin-protein ligase required for degradation of
           anaphase inhibitors including mitotic cyclins during the
           metaphase/anaphase transition
          Length = 135

 Score =  145 bits (366), Expect = 9e-45,   Method: Compositional matrix adjust.
 Identities = 64/142 (45%), Positives = 91/142 (64%), Gaps = 7/142 (4%)

Query: 1   MKVKINEVHSVFAWTWQIPSISDEKVTXXXXXXXXXXXXVCGICRASYNGTCPSCKFPGD 60
           M+++  +V+ VF+W+W IP   D                +CGICR SYNGTCP CK+PGD
Sbjct: 1   MQLEFKKVYPVFSWSWDIPGDDDAD-------REIGDEDLCGICRVSYNGTCPGCKYPGD 53

Query: 61  QCPLVIGVCHHNFHDHCIYRWLDTPTSKGLCPMCRQRFQLQKGLAINDAHIQKFVEIVSR 120
            CPLVIG C+HNFH HCI +WL TPT+KGLCPMCRQ+F L++G+AIN+  ++K   ++ +
Sbjct: 54  NCPLVIGECNHNFHVHCIQQWLATPTAKGLCPMCRQQFSLKRGVAINEGQVEKLANLLLQ 113

Query: 121 RREEMIEEGVAEDFVDFDEPIR 142
            R   +     +  +D +  +R
Sbjct: 114 PRPAALAADDQDMMMDQEFAVR 135

>CAGL0I04576g Chr9 (408872..409321) [450 bp, 149 aa] {ON} similar to
           uniprot|Q12157 Saccharomyces cerevisiae YDL008w APC11
           subunit of the anaphase promoting complex
          Length = 149

 Score =  145 bits (367), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 70/151 (46%), Positives = 94/151 (62%), Gaps = 7/151 (4%)

Query: 1   MKVKINEVHSVFAWTWQIPSISDEKVTXXXXXXXXXXXXVCGICRASYNGTCPSCKFPGD 60
           M++++ EVH VF W W IP   D                VCGICRASY+  CP+C++PG+
Sbjct: 1   MRIELTEVHGVFNWVWDIPKNEDR----LDESMADEDEDVCGICRASYHAPCPNCRYPGE 56

Query: 61  QCPLVIGVCHHNFHDHCIYRWLDTPTSKGLCPMCRQRFQLQKGLAINDAHIQKFVEIVSR 120
            C +V+G C HNFH HCI RW+DTPTSKGLCPMCRQ+FQL +   IN+ HI  F EI  +
Sbjct: 57  SCAIVLGRCGHNFHVHCISRWVDTPTSKGLCPMCRQKFQLLQRTKINEPHIPLFKEIEIK 116

Query: 121 RREEMIEEGVAEDFVDFDE---PIRQNTDNA 148
           R  ++ EE  A ++   +E   P R++ + A
Sbjct: 117 RYRQLQEEIEAGNYDALEEANIPPREDVEMA 147

>Ecym_5312 Chr5 complement(632833..633279) [447 bp, 148 aa] {ON}
           similar to Ashbya gossypii AER016C
          Length = 148

 Score =  144 bits (364), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 71/163 (43%), Positives = 100/163 (61%), Gaps = 16/163 (9%)

Query: 1   MKVKINEVHSVFAWTWQIPSISDEKVTXXXXXXXXXXXXVCGICRASYNGTCPSCKFPGD 60
           M+++I  V  V +W W +P    E               VCGICRASYNGTCP+CK PG+
Sbjct: 1   MQLQIKNVQCVASWYWDVPK---ELKRDLHEGEDEDDEDVCGICRASYNGTCPNCKLPGE 57

Query: 61  QCPLVIGVCHHNFHDHCIYRWLDTPTSKGLCPMCRQRFQLQKGLAINDAHIQKFVEIVSR 120
            CPL++G CHHNFH HCIY+WL+T TSKGLCPMCRQ F L+ G+ IN+ H +KF +++ +
Sbjct: 58  TCPLIVGSCHHNFHVHCIYQWLNTSTSKGLCPMCRQAFSLRDGIRINEPHKEKFEKVLMK 117

Query: 121 RREEMIEEGVAEDFVDFDEPIRQNTDNAIDRSQVDTVLDEDFL 163
            R++ +   V+   V        N    +D  Q D ++D++F+
Sbjct: 118 ARQQNV---VSVSGV--------NAAGGVD--QEDVMIDQEFI 147

>SAKL0C10516g Chr3 (956666..957100) [435 bp, 144 aa] {ON} similar to
           uniprot|Q12157 Saccharomyces cerevisiae YDL008W APC11
           Catalytic core subunit of the Anaphase- Promoting
           Complex/Cyclosome (APC/C) which is a ubiquitin- protein
           ligase required for degradation of anaphase inhibitors
           including mitotic cyclins during the metaphase/anaphase
           transition
          Length = 144

 Score =  143 bits (361), Expect = 5e-44,   Method: Compositional matrix adjust.
 Identities = 73/169 (43%), Positives = 103/169 (60%), Gaps = 29/169 (17%)

Query: 1   MKVKINEVHSVFAWTWQIPSISDEKVTXXXXXXXXXXXXVCGICRASYNGTCPSCKFPGD 60
           MKV + +VH+V +W+W IP     +              VCGICR SYNGTCPSCK+PGD
Sbjct: 1   MKVVVKKVHAVCSWSWHIPRDGTHQ-----HEAADTEEDVCGICRVSYNGTCPSCKYPGD 55

Query: 61  QCPLVIGVCHHNFHDHCIYRWLDTPTSKGLCPMCRQRFQLQKGLAINDAHIQKFVEIVSR 120
           +CPLV+G C+HNFH HCI +WLDT TS+GLCPMCRQ F L++G+AIND+ +  F +++++
Sbjct: 56  ECPLVVGECNHNFHVHCIVQWLDTATSRGLCPMCRQLFSLKRGVAINDSQLDHFAKLLNK 115

Query: 121 RRE----EMIEEGVAEDFVDFDEPIRQNTDNAIDRSQVDTVLDEDFLLR 165
                  E+   G+AE                    + D ++++DFL+R
Sbjct: 116 VNRAGATELANAGLAE--------------------EQDLMMEQDFLVR 144

>NDAI0A06520 Chr1 (1482275..1482895) [621 bp, 206 aa] {ON} Anc_3.190
           YDL008W
          Length = 206

 Score =  144 bits (362), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 64/142 (45%), Positives = 86/142 (60%), Gaps = 12/142 (8%)

Query: 1   MKVKINEVHSVFAWTWQIP------------SISDEKVTXXXXXXXXXXXXVCGICRASY 48
           MK+++  ++ + AW+W +P            + +D                VCGICRASY
Sbjct: 1   MKIEVQNIYPLVAWSWDMPKNLDDPDSDEPDNANDSYGIRRRAPNKNAVDDVCGICRASY 60

Query: 49  NGTCPSCKFPGDQCPLVIGVCHHNFHDHCIYRWLDTPTSKGLCPMCRQRFQLQKGLAIND 108
           NGTCP+CKFPG  CPLV+G C+HNFH HCIY+WL T TSKGLCPMCRQ+F+L+    +N 
Sbjct: 61  NGTCPNCKFPGTDCPLVLGRCNHNFHFHCIYQWLKTLTSKGLCPMCRQKFRLKPNATVNT 120

Query: 109 AHIQKFVEIVSRRREEMIEEGV 130
            H+  F E+    R  +I EG+
Sbjct: 121 DHLGAFKELAITTRARLISEGL 142

>KNAG0J01250 Chr10 complement(225063..225671) [609 bp, 202 aa] {ON}
           Anc_3.190 YDL008W
          Length = 202

 Score =  142 bits (357), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 70/145 (48%), Positives = 83/145 (57%), Gaps = 19/145 (13%)

Query: 1   MKVKINEVHSVFAWTW-----------QIP--------SISDEKVTXXXXXXXXXXXXVC 41
           MK+ I  V+ VF W+W           Q P         +    +             VC
Sbjct: 1   MKLDIKRVNPVFTWSWDTRDPAAAKDRQYPFLYNYYPVDVEKAHLENGNAVDGDEDEDVC 60

Query: 42  GICRASYNGTCPSCKFPGDQCPLVIGVCHHNFHDHCIYRWLDTPTSKGLCPMCRQRFQLQ 101
           GICRASYNGTCPSCK PGD CPLV G+CHH+FH HCI+RWLDT TSKGLCPMCRQ+FQL 
Sbjct: 61  GICRASYNGTCPSCKIPGDSCPLVAGLCHHHFHYHCIFRWLDTNTSKGLCPMCRQQFQLN 120

Query: 102 KGLAINDAHIQKFVEIVSRRREEMI 126
             L IN  +++KF  I    RE + 
Sbjct: 121 SKLPINRPYLEKFESITKAIRERVF 145

>Kwal_56.23112 s56 complement(406291..406698) [408 bp, 135 aa] {ON}
           YDL008W (APC11) - subunit of the anaphase promoting
           complex (APC) [contig 183] FULL
          Length = 135

 Score =  139 bits (349), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 66/167 (39%), Positives = 99/167 (59%), Gaps = 34/167 (20%)

Query: 1   MKVKINEVHSVFAWTWQIPS--ISDEKVTXXXXXXXXXXXXVCGICRASYNGTCPSCKFP 58
           MK++  +V+ VF+W+W IP    +D+++             +CGICR SYNGTCP C+FP
Sbjct: 1   MKIEFKKVYPVFSWSWDIPGDDNADKEIGDED---------LCGICRVSYNGTCPGCRFP 51

Query: 59  GDQCPLVIGVCHHNFHDHCIYRWLDTPTSKGLCPMCRQRFQLQKGLAINDAHIQKFVEIV 118
           GD CPLVIG C+HNFH HCI +WL+T T+KGLCPMCRQ+F L++G+AIN+  +    ++ 
Sbjct: 52  GDNCPLVIGECNHNFHVHCIQQWLETATAKGLCPMCRQQFSLKRGVAINECQMDSLAKL- 110

Query: 119 SRRREEMIEEGVAEDFVDFDEPIRQNTDNAIDRSQVDTVLDEDFLLR 165
                                 + Q+   A+     D ++D++F++R
Sbjct: 111 ----------------------LLQSQPAALTTEDQDMMMDQEFIVR 135

>TBLA0A00260 Chr1 complement(38358..38912) [555 bp, 184 aa] {ON}
           Anc_3.190 YDL008W
          Length = 184

 Score =  132 bits (333), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 66/149 (44%), Positives = 90/149 (60%), Gaps = 12/149 (8%)

Query: 1   MKVKINEVHSVFAWTWQIPS----ISDEKVTXXXXXXXXXXXX-----VCGICRASYNGT 51
           MK+++  ++ VFAW W IP+    I +++                   VCGICR +YN T
Sbjct: 1   MKIEVKGIYPVFAWKWDIPNDNHFIQNKERELGIDYSSGHNMVDEDEDVCGICRFNYNRT 60

Query: 52  CPSCKFPGDQCPLVIGVCHHNFHDHCIYRWLDTPTSKGLCPMCRQRFQLQKGLAINDAHI 111
           CP+CK PG +CPLV+G C HNFH HCIY+WLDT TSKGLCPMCRQ F+L++G+A+N +  
Sbjct: 61  CPNCKVPGKRCPLVVGNCFHNFHVHCIYKWLDTTTSKGLCPMCRQEFKLKEGVALNKSQE 120

Query: 112 QKFVEI---VSRRREEMIEEGVAEDFVDF 137
             F  +    +R+R    +E V  D   F
Sbjct: 121 DVFKSLELKQARQRFGAFDEDVDVDLSGF 149

>KLLA0E17711g Chr5 complement(1571018..1571506) [489 bp, 162 aa]
           {ON} similar to uniprot|Q12157 Saccharomyces cerevisiae
           YDL008W APC11 Catalytic core subunit of the Anaphase-
           Promoting Complex/Cyclosome (APC/C) which is a
           ubiquitin- protein ligase required for degradation of
           anaphase inhibitors including mitotic cyclins during the
           metaphase/anaphase transition
          Length = 162

 Score =  120 bits (300), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 59/150 (39%), Positives = 82/150 (54%), Gaps = 18/150 (12%)

Query: 1   MKVKINEVHSVFAWTWQIP--------SISDEKV----------TXXXXXXXXXXXXVCG 42
           M++++ +V  V  W W IP         ++D+ V                       VCG
Sbjct: 1   MRIEVTDVSLVSTWAWDIPKDLSKGKHGVADQTVHMEKWEDIQNEDEDAENDEEEYEVCG 60

Query: 43  ICRASYNGTCPSCKFPGDQCPLVIGVCHHNFHDHCIYRWLDTPTSKGLCPMCRQRFQLQK 102
           ICR  Y+ TCPSC +PG  CP+V+G+C+HNFH HCI +WL T TSKGLCP+CRQ FQL+ 
Sbjct: 61  ICRNRYDATCPSCDYPGSGCPIVLGLCNHNFHVHCIKQWLSTETSKGLCPLCRQGFQLRP 120

Query: 103 GLAINDAHIQKFVEIVSRRREEMIEEGVAE 132
            + IN  H  +F +++   R+  I  G  E
Sbjct: 121 NVLINKMHHDEFQKLLMSVRQHNIPMGGGE 150

>NCAS0I01920 Chr9 (352307..352693) [387 bp, 128 aa] {ON} Anc_3.190
           YDL008W
          Length = 128

 Score =  105 bits (261), Expect = 5e-29,   Method: Compositional matrix adjust.
 Identities = 48/112 (42%), Positives = 63/112 (56%), Gaps = 5/112 (4%)

Query: 1   MKVKINEVHSVFAWTWQIPSISDEK-----VTXXXXXXXXXXXXVCGICRASYNGTCPSC 55
           MK+++ EV+ VF W+W I S ++++                   VCGICRA YN  CPSC
Sbjct: 1   MKLEVREVYPVFEWSWDITSETEQQQNHEPEEQPEDDDDDDDDEVCGICRAGYNAVCPSC 60

Query: 56  KFPGDQCPLVIGVCHHNFHDHCIYRWLDTPTSKGLCPMCRQRFQLQKGLAIN 107
             PG  CP+V+G C H FH HC+  WL T  ++G CPMCRQ F L     +N
Sbjct: 61  SHPGVTCPVVVGTCQHAFHVHCVVPWLATAAARGACPMCRQPFALDPLRRVN 112

>KAFR0C01780 Chr3 complement(363161..363517) [357 bp, 118 aa] {ON}
           Anc_3.28 YOL133W
          Length = 118

 Score = 44.7 bits (104), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 24/67 (35%), Positives = 34/67 (50%), Gaps = 8/67 (11%)

Query: 41  CGICRASYNGTCPSCKF-----PGDQCPLVIGVCHHNFHDHCIYRWLDTPTSKGLCPMCR 95
           C ICR      C  C+      P ++C    GVC+H FH HCI +W+ T   +  CP+  
Sbjct: 52  CAICRNHIMEPCIECQPKAMTDPDNECVAAWGVCNHAFHLHCINKWIKT---RDACPLDN 108

Query: 96  QRFQLQK 102
           Q +QL +
Sbjct: 109 QPWQLAR 115

>YOL133W Chr15 (70325..70690) [366 bp, 121 aa] {ON}  HRT1RING finger
           containing subunit of Skp1-Cullin-F-box ubiquitin
           protein ligases (SCF); required for Gic2p, Far1p, Sic1p
           and Cln2p degradation; may tether Cdc34p (a ubiquitin
           conjugating enzyme or E2) and Cdc53p (a cullin) subunits
           of SCF
          Length = 121

 Score = 43.9 bits (102), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 23/67 (34%), Positives = 33/67 (49%), Gaps = 8/67 (11%)

Query: 41  CGICRASYNGTCPSCKFPG-----DQCPLVIGVCHHNFHDHCIYRWLDTPTSKGLCPMCR 95
           C ICR      C  C+        ++C    GVC+H FH HCI +W+ T   +  CP+  
Sbjct: 55  CAICRNHIMEPCIECQPKAMTDTDNECVAAWGVCNHAFHLHCINKWIKT---RDACPLDN 111

Query: 96  QRFQLQK 102
           Q +QL +
Sbjct: 112 QPWQLAR 118

>Smik_15.20 Chr15 (38383..38748) [366 bp, 121 aa] {ON} YOL133W
           (REAL)
          Length = 121

 Score = 43.9 bits (102), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 23/67 (34%), Positives = 33/67 (49%), Gaps = 8/67 (11%)

Query: 41  CGICRASYNGTCPSCKFPG-----DQCPLVIGVCHHNFHDHCIYRWLDTPTSKGLCPMCR 95
           C ICR      C  C+        ++C    GVC+H FH HCI +W+ T   +  CP+  
Sbjct: 55  CAICRNHIMEPCIECQPKAMTDTDNECVAAWGVCNHAFHLHCINKWIKT---RDACPLDN 111

Query: 96  QRFQLQK 102
           Q +QL +
Sbjct: 112 QPWQLAR 118

>SAKL0C13178g Chr3 complement(1166576..1166992) [417 bp, 138 aa]
           {ON} similar to uniprot|Q08273 Saccharomyces cerevisiae
           YOL133W HRT1 RING finger containing subunit of
           Skp1-Cullin- F-box ubiquitin protein ligases (SCF)
           required for Gic2p Far1p Sic1p and Cln2p degradation may
           tether Cdc34p (a ubiquitin conjugating enzyme or E2) and
           Cdc53p (a cullin) subunits of SCF
          Length = 138

 Score = 43.9 bits (102), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 23/67 (34%), Positives = 31/67 (46%), Gaps = 8/67 (11%)

Query: 41  CGICRASYNGTCPSCKFPG-----DQCPLVIGVCHHNFHDHCIYRWLDTPTSKGLCPMCR 95
           C ICR      C  C+        ++C    G C+H FH HCI +WL T   +  CP+  
Sbjct: 72  CAICRNHIMEPCIQCQPTAMTDTDNECVAAWGTCNHAFHLHCINKWLQT---RNACPLDN 128

Query: 96  QRFQLQK 102
           Q +Q  K
Sbjct: 129 QPWQFAK 135

>NDAI0G03860 Chr7 (925672..926043) [372 bp, 123 aa] {ON} Anc_3.28
           YOL133W
          Length = 123

 Score = 43.5 bits (101), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 23/67 (34%), Positives = 33/67 (49%), Gaps = 8/67 (11%)

Query: 41  CGICRASYNGTCPSCKFPG-----DQCPLVIGVCHHNFHDHCIYRWLDTPTSKGLCPMCR 95
           C ICR      C  C+        ++C    GVC+H FH HCI +W+ T   +  CP+  
Sbjct: 57  CAICRNHIMEPCIECQPKAMTDTDNECVAAWGVCNHAFHLHCINKWIQT---RDACPLDN 113

Query: 96  QRFQLQK 102
           Q +QL +
Sbjct: 114 QPWQLAR 120

>KLTH0F19228g Chr6 complement(1556655..1556987) [333 bp, 110 aa]
           {ON} similar to uniprot|Q08273 Saccharomyces cerevisiae
           YOL133W HRT1 RING finger containing subunit of
           Skp1-Cullin- F-box ubiquitin protein ligases (SCF)
           required for Gic2p Far1p Sic1p and Cln2p degradation may
           tether Cdc34p (a ubiquitin conjugating enzyme or E2) and
           Cdc53p (a cullin) subunits of SCF
          Length = 110

 Score = 43.1 bits (100), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 23/67 (34%), Positives = 31/67 (46%), Gaps = 8/67 (11%)

Query: 41  CGICRASYNGTCPSCKFPG-----DQCPLVIGVCHHNFHDHCIYRWLDTPTSKGLCPMCR 95
           C ICR      C  C+        ++C    G C+H FH HCI +WL T   +  CP+  
Sbjct: 44  CAICRNHIMEPCIQCQPTAMTDTDNECVAAWGACNHAFHLHCINKWLQT---RNACPLDN 100

Query: 96  QRFQLQK 102
           Q +Q  K
Sbjct: 101 QTWQFAK 107

>Suva_15.26 Chr15 (48168..48536) [369 bp, 122 aa] {ON} YOL133W
           (REAL)
          Length = 122

 Score = 43.1 bits (100), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 23/67 (34%), Positives = 33/67 (49%), Gaps = 8/67 (11%)

Query: 41  CGICRASYNGTCPSCKFPG-----DQCPLVIGVCHHNFHDHCIYRWLDTPTSKGLCPMCR 95
           C ICR      C  C+        ++C    GVC+H FH HCI +W+ T   +  CP+  
Sbjct: 56  CAICRNHIMEPCIECQPKAMTDTDNECVAAWGVCNHAFHLHCINKWIKT---RDACPLDN 112

Query: 96  QRFQLQK 102
           Q +QL +
Sbjct: 113 QPWQLAR 119

>Skud_15.20 Chr15 (35550..35915) [366 bp, 121 aa] {ON} YOL133W
           (REAL)
          Length = 121

 Score = 43.1 bits (100), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 23/67 (34%), Positives = 33/67 (49%), Gaps = 8/67 (11%)

Query: 41  CGICRASYNGTCPSCKFPG-----DQCPLVIGVCHHNFHDHCIYRWLDTPTSKGLCPMCR 95
           C ICR      C  C+        ++C    GVC+H FH HCI +W+ T   +  CP+  
Sbjct: 55  CAICRNHIMEPCIECQPKAMTDTDNECVAAWGVCNHAFHLHCINKWIKT---RDACPLDN 111

Query: 96  QRFQLQK 102
           Q +QL +
Sbjct: 112 QPWQLAR 118

>ZYRO0C03058g Chr3 complement(236925..237275) [351 bp, 116 aa] {ON}
           highly similar to uniprot|Q08273 Saccharomyces
           cerevisiae YOL133W HRT1 RING finger containing subunit
           of Skp1-Cullin-F-box ubiquitin protein ligases (SCF)
           required for Gic2p Far1p Sic1p and Cln2p degradation may
           tether Cdc34p (a ubiquitin conjugating enzyme or E2) and
           Cdc53p (a cullin) subunits of SCF
          Length = 116

 Score = 42.4 bits (98), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 23/67 (34%), Positives = 33/67 (49%), Gaps = 8/67 (11%)

Query: 41  CGICRASYNGTCPSCKFPG-----DQCPLVIGVCHHNFHDHCIYRWLDTPTSKGLCPMCR 95
           C ICR      C  C+        ++C    GVC+H FH HCI +W+ T   +  CP+  
Sbjct: 50  CAICRNHIMEPCIECQPMAMTDTDNECVAAWGVCNHAFHLHCINKWIKT---RDACPLDN 106

Query: 96  QRFQLQK 102
           Q +QL +
Sbjct: 107 QPWQLAR 113

>TBLA0I01960 Chr9 complement(444753..445291,445364..445379) [555 bp,
           184 aa] {ON} Anc_3.279 YBR062C
          Length = 184

 Score = 43.5 bits (101), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 27/75 (36%), Positives = 37/75 (49%), Gaps = 15/75 (20%)

Query: 40  VCGICRASYNGTCPSCKFPGDQCPLVIGV--CHHNFHDHCIYRWLDTPTSKGLCPMCRQR 97
           +C ICR         CKF  D  PL+I +  C H F   CI  WL   +S   CP+CR  
Sbjct: 114 ICSICR---------CKFFDDDYPLIIELPNCKHYFDLECITLWLQKNSS---CPICRND 161

Query: 98  FQLQKGLAINDAHIQ 112
             L+K   I+D+ ++
Sbjct: 162 V-LEKKFKIDDSQVE 175

>KLLA0C14344g Chr3 (1245226..1249782) [4557 bp, 1518 aa] {ON} similar
            to uniprot|Q04781 Saccharomyces cerevisiae YMR247C
            Hypothetical ORF
          Length = 1518

 Score = 44.3 bits (103), Expect = 6e-05,   Method: Composition-based stats.
 Identities = 17/47 (36%), Positives = 25/47 (53%), Gaps = 5/47 (10%)

Query: 56   KFPGDQCPLVIGVCHHNFHDHCIYRWLDTPTSKGLCPMCRQRFQLQK 102
            K P   CP     C++ FH  C+Y+W  + +    CP+CR  F L+K
Sbjct: 1477 KLPTKVCP----TCNNRFHGACLYKWFKS-SGNNTCPLCRGEFNLRK 1518

>TPHA0I00590 Chr9 (117658..122433) [4776 bp, 1591 aa] {ON} Anc_8.799
            YMR247C
          Length = 1591

 Score = 43.9 bits (102), Expect = 7e-05,   Method: Composition-based stats.
 Identities = 18/62 (29%), Positives = 31/62 (50%), Gaps = 7/62 (11%)

Query: 41   CGICRASYNGTCPSCKFPGDQCPLVIGVCHHNFHDHCIYRWLDTPTSKGLCPMCRQRFQL 100
            C IC ++ +      K P   CP     C++ FH  C+Y+W  + ++   CP+CR    L
Sbjct: 1537 CAICYSTLHAV--DRKLPTKVCP----TCNNKFHGSCLYKWFRS-SNNNTCPLCRSEIAL 1589

Query: 101  QK 102
            ++
Sbjct: 1590 RR 1591

>NCAS0C04480 Chr3 (919123..919452) [330 bp, 109 aa] {ON} Anc_3.28
          Length = 109

 Score = 41.6 bits (96), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 22/67 (32%), Positives = 32/67 (47%), Gaps = 8/67 (11%)

Query: 41  CGICRASYNGTCPSCKFPG-----DQCPLVIGVCHHNFHDHCIYRWLDTPTSKGLCPMCR 95
           C ICR      C  C+        ++C    G C+H FH HCI +W+ T   +  CP+  
Sbjct: 43  CAICRNHIMEPCIECQPKAMTDTDNECVAAWGTCNHAFHLHCINKWIKT---RDACPLDN 99

Query: 96  QRFQLQK 102
           Q +QL +
Sbjct: 100 QPWQLAR 106

>Kpol_1014.16 s1014 complement(29615..29938) [324 bp, 107 aa] {ON}
           complement(29615..29938) [324 nt, 108 aa]
          Length = 107

 Score = 41.6 bits (96), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 22/67 (32%), Positives = 32/67 (47%), Gaps = 8/67 (11%)

Query: 41  CGICRASYNGTCPSCKFPG-----DQCPLVIGVCHHNFHDHCIYRWLDTPTSKGLCPMCR 95
           C ICR      C  C+        ++C    G C+H FH HCI +W+ T   +  CP+  
Sbjct: 41  CAICRNHIMEPCIECQPNAMTETDNECVAAWGTCNHAFHLHCINKWIKT---RDACPLDN 97

Query: 96  QRFQLQK 102
           Q +QL +
Sbjct: 98  QPWQLAR 104

>Kwal_55.22054 s55 complement(1091138..1091473) [336 bp, 111 aa]
           {ON} YOL133W (HRT1) - subunit of Skp1-Cullin-F-box
           ubiquitin protein ligase (SCF) [contig 124] FULL
          Length = 111

 Score = 41.2 bits (95), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 22/67 (32%), Positives = 30/67 (44%), Gaps = 8/67 (11%)

Query: 41  CGICRASYNGTCPSCKFPG-----DQCPLVIGVCHHNFHDHCIYRWLDTPTSKGLCPMCR 95
           C ICR      C  C+        ++C    G C+H FH HCI +WL T   +  CP+  
Sbjct: 45  CAICRNHIMEPCIQCQPTAMTDTDNECVAAWGTCNHAFHLHCINKWLQT---RNACPLDN 101

Query: 96  QRFQLQK 102
           Q +   K
Sbjct: 102 QPWSFAK 108

>Ecym_2029 Chr2 (47083..47427) [345 bp, 114 aa] {ON} similar to
           Ashbya gossypii ADL181W
          Length = 114

 Score = 40.8 bits (94), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 22/67 (32%), Positives = 31/67 (46%), Gaps = 8/67 (11%)

Query: 41  CGICRASYNGTCPSCKFPG-----DQCPLVIGVCHHNFHDHCIYRWLDTPTSKGLCPMCR 95
           C ICR      C  C+        ++C    G C+H FH HCI +WL T   +  CP+  
Sbjct: 48  CAICRNHIMEPCIQCQPNAMTDTDNECVAAWGTCNHAFHLHCINKWLLT---RNACPLDN 104

Query: 96  QRFQLQK 102
           + +Q  K
Sbjct: 105 KTWQFAK 111

>NDAI0K00710 Chr11 (155351..160126) [4776 bp, 1591 aa] {ON} Anc_8.799
            YMR247C
          Length = 1591

 Score = 42.4 bits (98), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 18/62 (29%), Positives = 28/62 (45%), Gaps = 7/62 (11%)

Query: 41   CGICRASYNGTCPSCKFPGDQCPLVIGVCHHNFHDHCIYRWLDTPTSKGLCPMCRQRFQL 100
            C IC +  +      K P   CP     C + FH  C+Y+W  + +    CP+CR    L
Sbjct: 1537 CAICYSVLHAV--DRKLPTKTCP----TCKNKFHGACLYKWFKS-SGNNTCPLCRSEIAL 1589

Query: 101  QK 102
            ++
Sbjct: 1590 RR 1591

>KNAG0A01280 Chr1 (27372..27716) [345 bp, 114 aa] {ON} Anc_3.28
           YOL133W
          Length = 114

 Score = 40.4 bits (93), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 22/67 (32%), Positives = 31/67 (46%), Gaps = 8/67 (11%)

Query: 41  CGICRASYNGTCPSCKFPG-----DQCPLVIGVCHHNFHDHCIYRWLDTPTSKGLCPMCR 95
           C ICR      C  C+        ++C    G C H FH HCI +W+ T   +  CP+  
Sbjct: 48  CAICRNHIMEPCIECQPKAMTDTDNECVAAWGACGHAFHLHCINKWIKT---RDACPLDN 104

Query: 96  QRFQLQK 102
           Q +QL +
Sbjct: 105 QPWQLAR 111

>Kpol_480.25 s480 (57636..62351) [4716 bp, 1571 aa] {ON}
            (57636..62351) [4716 nt, 1572 aa]
          Length = 1571

 Score = 42.4 bits (98), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 18/62 (29%), Positives = 28/62 (45%), Gaps = 7/62 (11%)

Query: 41   CGICRASYNGTCPSCKFPGDQCPLVIGVCHHNFHDHCIYRWLDTPTSKGLCPMCRQRFQL 100
            C IC +  +      K P   CP     C + FH  C+Y+W  + +    CPMCR    +
Sbjct: 1517 CAICYSILHAV--DRKLPTKTCP----TCRNKFHGACLYKWFRS-SGNNTCPMCRSEIAI 1569

Query: 101  QK 102
            ++
Sbjct: 1570 RR 1571

>ADL181W Chr4 (379682..380008) [327 bp, 108 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOL133W (HRT1)
          Length = 108

 Score = 39.7 bits (91), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 22/67 (32%), Positives = 31/67 (46%), Gaps = 8/67 (11%)

Query: 41  CGICRASYNGTCPSCKFPG-----DQCPLVIGVCHHNFHDHCIYRWLDTPTSKGLCPMCR 95
           C ICR      C  C+        ++C    G C+H FH HCI +WL T   +  CP+  
Sbjct: 42  CAICRNHIMEPCIQCQPNAMTDTENECVAAWGTCNHAFHLHCINKWLLT---RNACPLDN 98

Query: 96  QRFQLQK 102
           + +Q  K
Sbjct: 99  KTWQFAK 105

>SAKL0B06226g Chr2 (524855..529528) [4674 bp, 1557 aa] {ON} similar to
            uniprot|Q04781 Saccharomyces cerevisiae YMR247C
            Hypothetical ORF
          Length = 1557

 Score = 41.6 bits (96), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 18/62 (29%), Positives = 27/62 (43%), Gaps = 7/62 (11%)

Query: 41   CGICRASYNGTCPSCKFPGDQCPLVIGVCHHNFHDHCIYRWLDTPTSKGLCPMCRQRFQL 100
            C IC +  +      K P   CP     C++ FH  C+Y+W  + +    CPMCR     
Sbjct: 1503 CAICYSILHAV--DRKLPTKTCP----TCNNKFHGACLYKWFRS-SGNNTCPMCRSEIPF 1555

Query: 101  QK 102
             +
Sbjct: 1556 NR 1557

>TDEL0B00980 Chr2 (181064..185743) [4680 bp, 1559 aa] {ON} Anc_8.799
            YMR247C
          Length = 1559

 Score = 41.6 bits (96), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 18/62 (29%), Positives = 28/62 (45%), Gaps = 7/62 (11%)

Query: 41   CGICRASYNGTCPSCKFPGDQCPLVIGVCHHNFHDHCIYRWLDTPTSKGLCPMCRQRFQL 100
            C IC +  +      K P   CP     C++ FH  C+Y+W  + +    CP+CR     
Sbjct: 1505 CAICYSILHAV--DRKLPTKTCP----TCNNKFHGACLYKWFRS-SGNNTCPLCRSEIPF 1557

Query: 101  QK 102
            +K
Sbjct: 1558 RK 1559

>TBLA0D00650 Chr4 (172839..177545) [4707 bp, 1568 aa] {ON} Anc_8.799
            YMR247C
          Length = 1568

 Score = 41.2 bits (95), Expect = 5e-04,   Method: Composition-based stats.
 Identities = 17/62 (27%), Positives = 28/62 (45%), Gaps = 7/62 (11%)

Query: 41   CGICRASYNGTCPSCKFPGDQCPLVIGVCHHNFHDHCIYRWLDTPTSKGLCPMCRQRFQL 100
            C IC +  +      K P   CP     C++ +H  C+Y+W  + +    CPMCR     
Sbjct: 1514 CAICYSILHAV--DRKLPSKTCP----TCNNKYHGACLYKWFRS-SGNNTCPMCRSEIPF 1566

Query: 101  QK 102
            ++
Sbjct: 1567 RR 1568

>TPHA0P01470 Chr16 complement(301305..301640) [336 bp, 111 aa] {ON}
           Anc_3.28 YOL133W
          Length = 111

 Score = 39.3 bits (90), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 21/67 (31%), Positives = 32/67 (47%), Gaps = 8/67 (11%)

Query: 41  CGICRASYNGTCPSCKFPG-----DQCPLVIGVCHHNFHDHCIYRWLDTPTSKGLCPMCR 95
           C ICR      C  C+        ++C +    C+H FH HCI +W+ T   +  CP+  
Sbjct: 45  CAICRNHIMEPCIECQPMAMTETDNECVVAWAACNHAFHLHCINKWIKT---RDACPLDN 101

Query: 96  QRFQLQK 102
           Q +QL +
Sbjct: 102 QPWQLAR 108

>KAFR0B03620 Chr2 complement(752307..756989) [4683 bp, 1560 aa] {ON}
            Anc_8.799 YMR247C
          Length = 1560

 Score = 41.2 bits (95), Expect = 5e-04,   Method: Composition-based stats.
 Identities = 18/62 (29%), Positives = 27/62 (43%), Gaps = 7/62 (11%)

Query: 41   CGICRASYNGTCPSCKFPGDQCPLVIGVCHHNFHDHCIYRWLDTPTSKGLCPMCRQRFQL 100
            C IC +  +      K P   CP     C + FH  C+Y+W  + +    CP+CR     
Sbjct: 1506 CAICYSILHAI--DRKLPSKTCP----TCKNRFHGACLYKWFRS-SGNNTCPLCRSEIPF 1558

Query: 101  QK 102
            +K
Sbjct: 1559 RK 1560

>CAGL0E01567g Chr5 (148425..148733) [309 bp, 102 aa] {ON} similar to
           uniprot|Q08273 Saccharomyces cerevisiae YOL133w HRT1
           RING-box protein
          Length = 102

 Score = 39.3 bits (90), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 21/67 (31%), Positives = 31/67 (46%), Gaps = 8/67 (11%)

Query: 41  CGICRASYNGTCPSCKFPG-----DQCPLVIGVCHHNFHDHCIYRWLDTPTSKGLCPMCR 95
           C ICR      C  C+        ++C    G C+H FH HCI +W+ T   +  CP+  
Sbjct: 36  CAICRNHIMEPCIECQPKAMTDTDNECVAAWGTCNHAFHLHCINKWIKT---RDACPLDN 92

Query: 96  QRFQLQK 102
           Q + L +
Sbjct: 93  QPWHLAR 99

>TDEL0A00470 Chr1 (82852..83208) [357 bp, 118 aa] {ON} Anc_3.28
           YOL133W
          Length = 118

 Score = 39.3 bits (90), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 21/67 (31%), Positives = 31/67 (46%), Gaps = 8/67 (11%)

Query: 41  CGICRASYNGTCPSCKFPG-----DQCPLVIGVCHHNFHDHCIYRWLDTPTSKGLCPMCR 95
           C ICR      C  C+        ++C    G C+H FH HCI +W+ T   +  CP+  
Sbjct: 52  CAICRNHIMEPCIECQPLAMTDTDNECVAAWGTCNHAFHLHCINKWIKT---RDACPLDN 108

Query: 96  QRFQLQK 102
           Q + L +
Sbjct: 109 QPWHLAR 115

>NCAS0C00680 Chr3 (109845..114539) [4695 bp, 1564 aa] {ON} Anc_8.799
            YMR247C
          Length = 1564

 Score = 40.8 bits (94), Expect = 7e-04,   Method: Composition-based stats.
 Identities = 18/62 (29%), Positives = 27/62 (43%), Gaps = 7/62 (11%)

Query: 41   CGICRASYNGTCPSCKFPGDQCPLVIGVCHHNFHDHCIYRWLDTPTSKGLCPMCRQRFQL 100
            C IC +  +      K P   CP     C + FH  C+Y+W  + +    CP+CR    L
Sbjct: 1510 CAICYSILHAV--DRKLPTKTCP----TCKNKFHGACLYKWFRS-SGNNTCPLCRSEIPL 1562

Query: 101  QK 102
             +
Sbjct: 1563 HR 1564

>Suva_13.432 Chr13 complement(744705..749384) [4680 bp, 1559 aa] {ON}
            YMR247C (REAL)
          Length = 1559

 Score = 40.8 bits (94), Expect = 9e-04,   Method: Composition-based stats.
 Identities = 17/62 (27%), Positives = 27/62 (43%), Gaps = 7/62 (11%)

Query: 41   CGICRASYNGTCPSCKFPGDQCPLVIGVCHHNFHDHCIYRWLDTPTSKGLCPMCRQRFQL 100
            C IC +  +      K P   CP     C + FH  C+Y+W  + +    CP+CR     
Sbjct: 1505 CAICYSILHAV--DRKLPSKTCP----TCKNKFHGACLYKWFRS-SGNNTCPLCRSEIPF 1557

Query: 101  QK 102
            ++
Sbjct: 1558 RR 1559

>YMR247C Chr13 complement(763351..768039) [4689 bp, 1562 aa] {ON}
            RKR1RING domain E3 ubiquitin ligase; involved in the
            ubiquitin-mediated degradation of non-stop proteins;
            functional connections to chromatin modification; nuclear
            protein that also co-localizes with ribosomes; homolog of
            mouse Listerin, whose mutation has been reported to cause
            neurodegeneration in mice
          Length = 1562

 Score = 40.8 bits (94), Expect = 9e-04,   Method: Composition-based stats.
 Identities = 17/62 (27%), Positives = 27/62 (43%), Gaps = 7/62 (11%)

Query: 41   CGICRASYNGTCPSCKFPGDQCPLVIGVCHHNFHDHCIYRWLDTPTSKGLCPMCRQRFQL 100
            C IC +  +      K P   CP     C + FH  C+Y+W  + +    CP+CR     
Sbjct: 1508 CAICYSILHAV--DRKLPSKTCP----TCKNKFHGACLYKWFRS-SGNNTCPLCRSEIPF 1560

Query: 101  QK 102
            ++
Sbjct: 1561 RR 1562

>Skud_13.419 Chr13 complement(738148..742842) [4695 bp, 1564 aa] {ON}
            YMR247C (REAL)
          Length = 1564

 Score = 40.8 bits (94), Expect = 9e-04,   Method: Composition-based stats.
 Identities = 17/62 (27%), Positives = 27/62 (43%), Gaps = 7/62 (11%)

Query: 41   CGICRASYNGTCPSCKFPGDQCPLVIGVCHHNFHDHCIYRWLDTPTSKGLCPMCRQRFQL 100
            C IC +  +      K P   CP     C + FH  C+Y+W  + +    CP+CR     
Sbjct: 1510 CAICYSILHAV--DRKLPSKTCP----TCKNKFHGACLYKWFRS-SGNNTCPLCRSEIPF 1562

Query: 101  QK 102
            ++
Sbjct: 1563 RR 1564

>Smik_13.460 Chr13 complement(747753..752453) [4701 bp, 1566 aa] {ON}
            YMR247C (REAL)
          Length = 1566

 Score = 40.4 bits (93), Expect = 0.001,   Method: Composition-based stats.
 Identities = 17/62 (27%), Positives = 27/62 (43%), Gaps = 7/62 (11%)

Query: 41   CGICRASYNGTCPSCKFPGDQCPLVIGVCHHNFHDHCIYRWLDTPTSKGLCPMCRQRFQL 100
            C IC +  +      K P   CP     C + FH  C+Y+W  + +    CP+CR     
Sbjct: 1512 CAICYSILHAV--DRKLPSKTCP----TCKNRFHGACLYKWFRS-SGNNTCPLCRSEIPF 1564

Query: 101  QK 102
            ++
Sbjct: 1565 RR 1566

>KNAG0J00540 Chr10 (86360..91045) [4686 bp, 1561 aa] {ON} Anc_8.799
            YMR247C
          Length = 1561

 Score = 40.4 bits (93), Expect = 0.001,   Method: Composition-based stats.
 Identities = 17/62 (27%), Positives = 27/62 (43%), Gaps = 7/62 (11%)

Query: 41   CGICRASYNGTCPSCKFPGDQCPLVIGVCHHNFHDHCIYRWLDTPTSKGLCPMCRQRFQL 100
            C IC +  +      K P   CP     C + FH  C+Y+W  + +    CP+CR     
Sbjct: 1507 CAICYSILHAV--DRKLPNKTCP----TCKNRFHGACLYKWFRS-SGNNTCPLCRNEIPF 1559

Query: 101  QK 102
            ++
Sbjct: 1560 RR 1561

>TBLA0B08710 Chr2 complement(2075746..2076114) [369 bp, 122 aa] {ON}
           Anc_3.28 YOL133W
          Length = 122

 Score = 38.9 bits (89), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 22/67 (32%), Positives = 30/67 (44%), Gaps = 8/67 (11%)

Query: 41  CGICRASYNGTCPSCKFPG-----DQCPLVIGVCHHNFHDHCIYRWLDTPTSKGLCPMCR 95
           C ICR      C  C+          C    G C+H FH HCI +W+ T   +  CP+  
Sbjct: 56  CAICRNHIMEPCIECQPKAMTDTDTDCVAAWGTCNHAFHLHCINKWIKT---REACPLDN 112

Query: 96  QRFQLQK 102
           Q +QL +
Sbjct: 113 QPWQLAR 119

>KLTH0E13992g Chr5 (1234550..1239202) [4653 bp, 1550 aa] {ON} similar
            to uniprot|Q04781 Saccharomyces cerevisiae YMR247C
            Hypothetical ORF
          Length = 1550

 Score = 40.4 bits (93), Expect = 0.001,   Method: Composition-based stats.
 Identities = 17/62 (27%), Positives = 28/62 (45%), Gaps = 7/62 (11%)

Query: 41   CGICRASYNGTCPSCKFPGDQCPLVIGVCHHNFHDHCIYRWLDTPTSKGLCPMCRQRFQL 100
            C IC +  +      K P   CP     C++ FH  C+Y+W  + +    CP+CR     
Sbjct: 1496 CAICYSILHAV--DRKLPSKVCP----TCNNRFHGACLYKWFRS-SGNNTCPLCRSEIPF 1548

Query: 101  QK 102
            ++
Sbjct: 1549 RR 1550

>ZYRO0F12760g Chr6 complement(1037460..1042127) [4668 bp, 1555 aa]
            {ON} similar to uniprot|Q04781 Saccharomyces cerevisiae
            YMR247C Hypothetical ORF
          Length = 1555

 Score = 40.4 bits (93), Expect = 0.001,   Method: Composition-based stats.
 Identities = 17/62 (27%), Positives = 28/62 (45%), Gaps = 7/62 (11%)

Query: 41   CGICRASYNGTCPSCKFPGDQCPLVIGVCHHNFHDHCIYRWLDTPTSKGLCPMCRQRFQL 100
            C IC +  +      K P   CP     C++ FH  C+Y+W  + +    CP+CR     
Sbjct: 1501 CAICYSILHAV--DRKLPTKTCP----TCNNKFHGSCLYKWFRS-SGNNTCPLCRGEIPF 1553

Query: 101  QK 102
            ++
Sbjct: 1554 RR 1555

>Kwal_27.12327 s27 (1178866..1183590) [4725 bp, 1574 aa] {ON} YMR247C
            - Hypothetical ORF [contig 20] FULL
          Length = 1574

 Score = 40.0 bits (92), Expect = 0.001,   Method: Composition-based stats.
 Identities = 17/62 (27%), Positives = 28/62 (45%), Gaps = 7/62 (11%)

Query: 41   CGICRASYNGTCPSCKFPGDQCPLVIGVCHHNFHDHCIYRWLDTPTSKGLCPMCRQRFQL 100
            C IC +  +      K P   CP     C++ FH  C+Y+W  + +    CP+CR     
Sbjct: 1520 CAICYSILHAV--DRKLPSKVCP----TCNNRFHGACLYKWFRS-SGNNTCPLCRSEIPF 1572

Query: 101  QK 102
            ++
Sbjct: 1573 RR 1574

>KLLA0E07151g Chr5 (651474..651806) [333 bp, 110 aa] {ON} similar to
           uniprot|Q08273 Saccharomyces cerevisiae YOL133W HRT1
           RING finger containing subunit of Skp1-Cullin- F-box
           ubiquitin protein ligases (SCF) required for Gic2p Far1p
           Sic1p and Cln2p degradation may tether Cdc34p (a
           ubiquitin conjugating enzyme or E2) and Cdc53p (a
           cullin) subunits of SCF
          Length = 110

 Score = 37.4 bits (85), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 20/67 (29%), Positives = 33/67 (49%), Gaps = 8/67 (11%)

Query: 41  CGICRASYNGTCPSCKFPGD-----QCPLVIGVCHHNFHDHCIYRWLDTPTSKGLCPMCR 95
           C ICR      C +C+         +C    G C+H FH HCI +W+    S+ +CP+  
Sbjct: 44  CAICRNHIMEPCVNCQQEATFNSEHECVAAWGECNHAFHLHCITQWIK---SRNVCPLDN 100

Query: 96  QRFQLQK 102
           + ++L +
Sbjct: 101 KPWKLAR 107

>Ecym_7418 Chr7 (853469..858112) [4644 bp, 1547 aa] {ON} similar to
            Ashbya gossypii ABL058C
          Length = 1547

 Score = 38.5 bits (88), Expect = 0.004,   Method: Composition-based stats.
 Identities = 19/63 (30%), Positives = 29/63 (46%), Gaps = 9/63 (14%)

Query: 41   CGICRASYNGTCP-SCKFPGDQCPLVIGVCHHNFHDHCIYRWLDTPTSKGLCPMCRQRFQ 99
            C IC   Y+   P   K P   CP     C++ FH  C+Y+W  + +    CP+CR    
Sbjct: 1493 CAIC---YSILHPVDRKLPTKVCP----TCNNRFHGACLYKWFRS-SGNNSCPLCRSEIP 1544

Query: 100  LQK 102
             ++
Sbjct: 1545 FRR 1547

>AGL079C Chr7 complement(557422..558942) [1521 bp, 506 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YHL010C
          Length = 506

 Score = 38.1 bits (87), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 23/47 (48%), Gaps = 7/47 (14%)

Query: 51  TCPSC--KFPGDQCPLVIGVCHHNFHDHCIYRWLDTPTSKGLCPMCR 95
           TCP C  +   D   L+   C H FH  C+ +W D     G CP+CR
Sbjct: 211 TCPVCLERMDSDTTGLITTACQHTFHCQCLDKWKD-----GRCPVCR 252

>ABL058C Chr2 complement(288353..292993) [4641 bp, 1546 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YMR247C
          Length = 1546

 Score = 38.1 bits (87), Expect = 0.006,   Method: Composition-based stats.
 Identities = 14/47 (29%), Positives = 22/47 (46%), Gaps = 5/47 (10%)

Query: 56   KFPGDQCPLVIGVCHHNFHDHCIYRWLDTPTSKGLCPMCRQRFQLQK 102
            K P   CP     C + FH  C+Y+W  + +    CP+CR     ++
Sbjct: 1505 KLPSKVCP----TCSNRFHGACLYKWFKS-SGNNTCPLCRGEIPFRR 1546

>NCAS0A08280 Chr1 (1636423..1636779) [357 bp, 118 aa] {ON} Anc_3.279
           YBR062C
          Length = 118

 Score = 36.6 bits (83), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 23/68 (33%), Positives = 34/68 (50%), Gaps = 8/68 (11%)

Query: 49  NGTCP--SCKFPGDQCPLVIGV--CHHNFHDHCIYRWLDTPTSKGLCPMCRQRFQLQKGL 104
           N  CP   CKF  D+ PL++ +  C+H F   CI  WL    +   CP+CR    L+  L
Sbjct: 46  NDECPICCCKFSEDKYPLIVELPRCNHRFDLECISVWLSKSVT---CPLCRDNV-LEHKL 101

Query: 105 AINDAHIQ 112
            I+ +  +
Sbjct: 102 NIDTSKTE 109

>CAGL0H10274g Chr8 complement(1003801..1004312,1004468..1004483)
           [528 bp, 175 aa] {ON} similar to uniprot|P38239
           Saccharomyces cerevisiae YBR062c
          Length = 175

 Score = 37.0 bits (84), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 23/60 (38%), Positives = 29/60 (48%), Gaps = 7/60 (11%)

Query: 49  NGTCPSC--KFPGDQCPLVIGV--CHHNFHDHCIYRWLDTPTSKGLCPMCRQRFQLQKGL 104
           + TCP C   F  D+ PLV+ +  C H F   C+  WL   T    CPMCR     +K L
Sbjct: 101 DDTCPICCSNFIADEYPLVVELPHCGHKFDFECVSMWL---TKNTTCPMCRDDVTHKKEL 157

>KNAG0A07430 Chr1 complement(1165740..1166048) [309 bp, 102 aa]
          {ON} Anc_3.405 YPR093C
          Length = 102

 Score = 35.4 bits (80), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 15/34 (44%), Positives = 20/34 (58%), Gaps = 3/34 (8%)

Query: 69 CHHNFHDHCIYRWLDTPTS---KGLCPMCRQRFQ 99
          CHH FH  CI +W  T T    + LCP CR++ +
Sbjct: 29 CHHKFHSDCIRKWHTTTTGEIRRPLCPFCREQSE 62

>CAGL0H02651g Chr8 (238495..243129) [4635 bp, 1544 aa] {ON} similar to
            uniprot|Q04781 Saccharomyces cerevisiae YMR247c
          Length = 1544

 Score = 37.4 bits (85), Expect = 0.012,   Method: Composition-based stats.
 Identities = 16/62 (25%), Positives = 26/62 (41%), Gaps = 7/62 (11%)

Query: 41   CGICRASYNGTCPSCKFPGDQCPLVIGVCHHNFHDHCIYRWLDTPTSKGLCPMCRQRFQL 100
            C IC +  +      K P   C      C + FH  C+Y+W  + +    CP+CR     
Sbjct: 1490 CAICYSILHAV--DRKLPTKTC----STCKNKFHGACLYKWFRS-SGNNTCPLCRSEINF 1542

Query: 101  QK 102
            ++
Sbjct: 1543 RR 1544

>KLTH0F18502g Chr6 (1496235..1497038) [804 bp, 267 aa] {ON}
           conserved hypothetical protein
          Length = 267

 Score = 36.6 bits (83), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 19/49 (38%), Positives = 28/49 (57%), Gaps = 3/49 (6%)

Query: 65  VIGVCHHNFHDHCIYRWLDTPTSKGLCPMCRQRFQLQKGLAINDAHIQK 113
           V+G C H FH HCI RW+    +   CP+C++ + L  G     A+I+K
Sbjct: 125 VLG-CSHIFHSHCIDRWI--CRNSACCPLCKRSYSLPVGSCHVIAYIEK 170

>Ecym_4250 Chr4 complement(517592..519560,519632..519636) [1974 bp,
           657 aa] {ON} similar to Ashbya gossypii AGL191W 1-intron
          Length = 657

 Score = 36.6 bits (83), Expect = 0.017,   Method: Composition-based stats.
 Identities = 20/53 (37%), Positives = 27/53 (50%), Gaps = 6/53 (11%)

Query: 61  QCPLVIGVCHHNFHDHCIYRWLDTPTSKGLCPMCRQRFQLQKGL--AINDAHI 111
            CP  +  C H F   CI++W     S   CP+CR R    +GL  AIND+ +
Sbjct: 274 HCPTELP-CGHIFGRDCIFKWTKEHNS---CPICRSRIVEDEGLNHAINDSPV 322

>Ecym_7244 Chr7 complement(512748..514346) [1599 bp, 532 aa] {ON}
           similar to Ashbya gossypii AGL079C
          Length = 532

 Score = 35.8 bits (81), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 22/47 (46%), Gaps = 7/47 (14%)

Query: 51  TCPSC--KFPGDQCPLVIGVCHHNFHDHCIYRWLDTPTSKGLCPMCR 95
           TCP C  +   D   L+   C H FH  C+ +W       G CP+CR
Sbjct: 234 TCPVCLERMDSDTTGLITTACQHTFHCQCLDQW-----KGGRCPVCR 275

>KLLA0F18458g Chr6 complement(1697871..1698293) [423 bp, 140 aa]
           {ON} similar to uniprot|P38239 Saccharomyces cerevisiae
           YBR062C Hypothetical ORF
          Length = 140

 Score = 34.7 bits (78), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 22/65 (33%), Positives = 28/65 (43%), Gaps = 14/65 (21%)

Query: 40  VCGICRASYNGTCPSCKFPGDQCPLVIGV--CHHNFHDHCIYRWLDTPTSKGLCPMCRQR 97
            C IC+         C F  D  PLV  V  C+H F   C+  WL    +   CPMCR  
Sbjct: 70  TCAICQ---------CNFLDDPYPLVAKVPRCNHKFDLECLSIWL---QNNHTCPMCRDD 117

Query: 98  FQLQK 102
            + +K
Sbjct: 118 LRSKK 122

>Smik_2.196 Chr2 complement(347806..348363) [558 bp, 185 aa] {ON}
           YBR062C (REAL)
          Length = 185

 Score = 34.7 bits (78), Expect = 0.050,   Method: Compositional matrix adjust.
 Identities = 20/57 (35%), Positives = 27/57 (47%), Gaps = 14/57 (24%)

Query: 41  CGICRASYNGTCPSCKFPGDQCPLVIGV--CHHNFHDHCIYRWLDTPTSKGLCPMCR 95
           C IC  +Y           D+ PLV+ +  CHH F   C+  WL   T+   CP+CR
Sbjct: 114 CSICYTNY---------LEDEYPLVVELPHCHHKFDLECLSVWLSRSTT---CPLCR 158

>TDEL0C02770 Chr3 complement(486107..486733) [627 bp, 208 aa] {ON}
           Anc_7.416 YER116C
          Length = 208

 Score = 34.7 bits (78), Expect = 0.052,   Method: Compositional matrix adjust.
 Identities = 23/73 (31%), Positives = 34/73 (46%), Gaps = 11/73 (15%)

Query: 45  RASYNGTCPSCKFPGDQCPLVIGVCHHNFHDHCIYRWLDT---PTSKGLCPMCRQRFQLQ 101
           +A  +  CP C  P +    VI  C H F   C+++ L++   P   GLC +CR      
Sbjct: 132 KAVRDYQCPICFDPPENS--VITPCGHTFCVSCLFQMLNSSRGPKKNGLCALCR------ 183

Query: 102 KGLAINDAHIQKF 114
           K +AI D  + K 
Sbjct: 184 KSVAIRDIKMIKL 196

>KAFR0C00460 Chr3 complement(94989..95446,95522..95537) [474 bp, 157
           aa] {ON} Anc_3.279 YBR062C
          Length = 157

 Score = 34.7 bits (78), Expect = 0.053,   Method: Compositional matrix adjust.
 Identities = 23/63 (36%), Positives = 29/63 (46%), Gaps = 7/63 (11%)

Query: 49  NGTCPSC--KFPGDQCPLVIGV--CHHNFHDHCIYRWLDTPTSKGLCPMCRQRFQLQKGL 104
           N  C  C   F  D+ PLVI +  C H F   CI  WL   +S   CP+CR +      L
Sbjct: 84  NDLCSICFENFREDEYPLVIELPHCSHKFDLQCISVWL---SSNSTCPVCRDKVNHNAKL 140

Query: 105 AIN 107
            I+
Sbjct: 141 DID 143

>TPHA0F01840 Chr6 complement(422396..423961) [1566 bp, 521 aa] {ON}
           Anc_2.157 YHR115C
          Length = 521

 Score = 35.0 bits (79), Expect = 0.063,   Method: Composition-based stats.
 Identities = 26/95 (27%), Positives = 44/95 (46%), Gaps = 14/95 (14%)

Query: 64  LVIGVCHHNFHDHCIYRWLDTPTSKGLCPMCRQRFQLQKGLAINDAHIQKFVEIVSRRRE 123
           + I  C H++H HCI R +     + +CP CR    L+  L           E  S    
Sbjct: 426 IFISPCSHSWHFHCIRRLVMMSYPQFVCPNCRSSCDLEASL-----------ESSSEDEG 474

Query: 124 EMIEEGVAEDFVDFDEPIRQNTDNA-IDRSQVDTV 157
           +M+ +   E+ VD D P   + +NA ++ +QV ++
Sbjct: 475 DMLIDD--ENNVDDDLPNHASNENAEVNEAQVTSM 507

>AGR034W Chr7 (772766..773245) [480 bp, 159 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YBR062C
          Length = 159

 Score = 34.3 bits (77), Expect = 0.063,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 26/50 (52%), Gaps = 5/50 (10%)

Query: 55  CKFPGDQCPLVIGV--CHHNFHDHCIYRWLDTPTSKGLCPMCRQRFQLQK 102
           C +  D+ PLV+ +  C H F   C+  WL   T+   CPMCR    ++K
Sbjct: 95  CGYLEDEYPLVVELPNCGHTFDLQCVSVWLSRSTT---CPMCRSDVLVRK 141

>YBR062C Chr2 complement(365976..366502,366585..366600) [543 bp, 180
           aa] {ON} Protein of unknown function that interacts with
           Msb2p; may play a role in activation of the filamentous
           growth pathway.
          Length = 180

 Score = 34.3 bits (77), Expect = 0.069,   Method: Compositional matrix adjust.
 Identities = 20/57 (35%), Positives = 27/57 (47%), Gaps = 14/57 (24%)

Query: 41  CGICRASYNGTCPSCKFPGDQCPLVIGV--CHHNFHDHCIYRWLDTPTSKGLCPMCR 95
           C IC  +Y           D+ PLV+ +  CHH F   C+  WL   T+   CP+CR
Sbjct: 109 CSICYTNY---------LEDEYPLVVELPHCHHKFDLECLSVWLSRSTT---CPLCR 153

>TBLA0F03280 Chr6 complement(805882..807549) [1668 bp, 555 aa]
          {ON} Anc_3.405 YPR093C
          Length = 555

 Score = 35.0 bits (79), Expect = 0.069,   Method: Compositional matrix adjust.
 Identities = 17/32 (53%), Positives = 22/32 (68%), Gaps = 3/32 (9%)

Query: 66 IGVCHHNFHDHCIYRWLDTPTSKGL-CPMCRQ 96
          + VC HNFH +CI +W    TSK L CP+CR+
Sbjct: 19 LKVCQHNFHFNCIRQW--HLTSKSLECPVCRR 48

>ZYRO0B02244g Chr2 (186386..188077) [1692 bp, 563 aa] {ON} similar
           to uniprot|P38748 YHL010C Saccharomyces cerevisiae
           Hypothetical ORF
          Length = 563

 Score = 34.7 bits (78), Expect = 0.072,   Method: Compositional matrix adjust.
 Identities = 19/62 (30%), Positives = 29/62 (46%), Gaps = 8/62 (12%)

Query: 51  TCPSC--KFPGDQCPLVIGVCHHNFHDHCIYRWLDTPTSKGLCPMCR-QRFQLQKGLAIN 107
           TCP C  +   D   L+   C H FH  C+ +W ++      CP+CR    +L +   + 
Sbjct: 233 TCPVCLERMDSDTTGLITIPCQHTFHCQCLDKWKNSK-----CPVCRYSSLRLSRDSLLR 287

Query: 108 DA 109
           DA
Sbjct: 288 DA 289

>TBLA0G02310 Chr7 (598514..600538) [2025 bp, 674 aa] {ON} Anc_2.542
           YHL010C
          Length = 674

 Score = 34.7 bits (78), Expect = 0.074,   Method: Composition-based stats.
 Identities = 17/64 (26%), Positives = 29/64 (45%), Gaps = 8/64 (12%)

Query: 51  TCPSC--KFPGDQCPLVIGVCHHNFHDHCIYRWLDTPTSKGLCPMCR-QRFQLQKGLAIN 107
           +CP C  +       L+   C H FH  C+ +W ++      CP+CR    ++ + L IN
Sbjct: 282 SCPVCLERMDSSITGLITIPCQHTFHCQCLNKWKNSK-----CPICRFSTLRISRDLVIN 336

Query: 108 DAHI 111
              +
Sbjct: 337 KKQV 340

>Ecym_2658 Chr2 (1270952..1271431) [480 bp, 159 aa] {ON} similar to
           Ashbya gossypii AGR034W
          Length = 159

 Score = 33.9 bits (76), Expect = 0.076,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 24/50 (48%), Gaps = 5/50 (10%)

Query: 55  CKFPGDQCPLVIGV--CHHNFHDHCIYRWLDTPTSKGLCPMCRQRFQLQK 102
           C +  D  PLV+ +  C+H F   CI  WL   ++   CPMCR      K
Sbjct: 95  CVYLEDSYPLVVKLPNCNHKFDLQCITLWLSKSST---CPMCRNDVMSSK 141

>AGL217W Chr7 (290043..291287) [1245 bp, 414 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOL054W (PSH1)
          Length = 414

 Score = 34.7 bits (78), Expect = 0.080,   Method: Compositional matrix adjust.
 Identities = 19/66 (28%), Positives = 32/66 (48%), Gaps = 3/66 (4%)

Query: 63  PLVIGVCHHNFHDHCIYRWLDTPTSKGL-CPMCRQRFQLQKGLAIN-DAHIQKFVEIVSR 120
           P++ G C HN+   CI  WL+  +S  L CP CR        L +    ++   +E++ +
Sbjct: 48  PVMTG-CGHNYCYFCISNWLNNTSSTELNCPQCRSSITSMPSLNVTLQQNLDALIEVLDK 106

Query: 121 RREEMI 126
              E+I
Sbjct: 107 AEPEVI 112

>ZYRO0E06996g Chr5 complement(530578..531080,531138..531153) [519
           bp, 172 aa] {ON} similar to uniprot|P38239 Saccharomyces
           cerevisiae YBR062C Hypothetical ORF
          Length = 172

 Score = 33.9 bits (76), Expect = 0.080,   Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 26/51 (50%), Gaps = 7/51 (13%)

Query: 49  NGTCP--SCKFPGDQCPLVIGV--CHHNFHDHCIYRWLDTPTSKGLCPMCR 95
           + +CP   C +  D  PLV  +  C+H F   CI  WL   TS   CP+CR
Sbjct: 100 DDSCPICCCTYKEDDHPLVAELPHCNHKFDLECISVWLSKSTS---CPLCR 147

>NDAI0G05200 Chr7 (1261661..1266421) [4761 bp, 1586 aa] {ON} Anc_1.389
          Length = 1586

 Score = 34.7 bits (78), Expect = 0.084,   Method: Composition-based stats.
 Identities = 14/32 (43%), Positives = 19/32 (59%), Gaps = 3/32 (9%)

Query: 69   CHHNFHDHCIYRWLDTPTSKGLCPMCRQRFQL 100
            C H F + CIY WL T T   +CP+C+ +  L
Sbjct: 1282 CGHFFCEDCIYDWLQTRT---ICPICKHKASL 1310

>KLLA0F25740g Chr6 complement(2389226..2390779) [1554 bp, 517 aa]
           {ON} similar to uniprot|P38748 YHL010C Saccharomyces
           cerevisiae Hypothetical ORF
          Length = 517

 Score = 34.7 bits (78), Expect = 0.086,   Method: Composition-based stats.
 Identities = 17/46 (36%), Positives = 21/46 (45%), Gaps = 7/46 (15%)

Query: 52  CPSC--KFPGDQCPLVIGVCHHNFHDHCIYRWLDTPTSKGLCPMCR 95
           CP C  K   +   LV   C H FH  C+ +W       G CP+CR
Sbjct: 215 CPVCLEKLDSEVTGLVTTPCQHTFHCKCLDQW-----KNGNCPVCR 255

>Suva_4.302 Chr4 complement(532902..533210,533286..533429) [453 bp,
           150 aa] {ON} YBR062C (REAL)
          Length = 150

 Score = 33.5 bits (75), Expect = 0.096,   Method: Compositional matrix adjust.
 Identities = 20/57 (35%), Positives = 27/57 (47%), Gaps = 14/57 (24%)

Query: 41  CGICRASYNGTCPSCKFPGDQCPLVIGV--CHHNFHDHCIYRWLDTPTSKGLCPMCR 95
           C IC  +Y           D+ PLV+ +  CHH F   C+  WL   T+   CP+CR
Sbjct: 79  CSICYTNY---------LEDKYPLVVELPHCHHKFDLECLSVWLSRSTT---CPLCR 123

>KAFR0A01990 Chr1 (418279..419961) [1683 bp, 560 aa] {ON} Anc_2.542
           YHL010C
          Length = 560

 Score = 34.3 bits (77), Expect = 0.11,   Method: Composition-based stats.
 Identities = 15/47 (31%), Positives = 23/47 (48%), Gaps = 7/47 (14%)

Query: 51  TCPSC--KFPGDQCPLVIGVCHHNFHDHCIYRWLDTPTSKGLCPMCR 95
           TCP C  +   +   L+   C H FH  C+ +W ++      CP+CR
Sbjct: 240 TCPVCLERMDSETTGLITIPCQHTFHCQCLDKWKNSQ-----CPVCR 281

>KAFR0I02090 Chr9 complement(427023..431423) [4401 bp, 1466 aa] {ON}
            Anc_1.389 YLR247C
          Length = 1466

 Score = 34.3 bits (77), Expect = 0.12,   Method: Composition-based stats.
 Identities = 14/43 (32%), Positives = 22/43 (51%), Gaps = 11/43 (25%)

Query: 62   CPLVIGV--------CHHNFHDHCIYRWLDTPTSKGLCPMCRQ 96
            CP+ +          C H F  HCI+ WL    +K +CP+C++
Sbjct: 1151 CPICLNTIYMGSIIKCGHFFCKHCIFSWL---KNKSVCPICKK 1190

>NDAI0A07450 Chr1 complement(1699546..1700051,1700150..1700165) [522
           bp, 173 aa] {ON} Anc_3.279 YBR062C
          Length = 173

 Score = 33.5 bits (75), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 18/43 (41%), Positives = 22/43 (51%), Gaps = 5/43 (11%)

Query: 55  CKFPGDQCPLVIGV--CHHNFHDHCIYRWLDTPTSKGLCPMCR 95
           CKF  D+ PLV  +  C H F   CI  WL   +    CP+CR
Sbjct: 109 CKFLEDKYPLVAELPHCGHRFDLECISVWL---SKSDTCPLCR 148

>TDEL0A03180 Chr1 (569298..571001) [1704 bp, 567 aa] {ON} Anc_2.542
           YHL010C
          Length = 567

 Score = 33.9 bits (76), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 16/47 (34%), Positives = 23/47 (48%), Gaps = 7/47 (14%)

Query: 51  TCPSC--KFPGDQCPLVIGVCHHNFHDHCIYRWLDTPTSKGLCPMCR 95
           TCP C  +   D   L+   C H FH  C+ +W ++      CP+CR
Sbjct: 233 TCPVCLERMDSDTTGLITIPCQHTFHCQCLDKWKNSR-----CPVCR 274

>Kpol_1052.19 s1052 (60008..60319) [312 bp, 103 aa] {ON}
           (60008..60319) [312 nt, 104 aa]
          Length = 103

 Score = 32.3 bits (72), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 23/50 (46%), Gaps = 5/50 (10%)

Query: 55  CKFPGDQCPLVIGV--CHHNFHDHCIYRWLDTPTSKGLCPMCRQRFQLQK 102
           C +  D+ PL+  +  C HNF   C+  WL   +    CPMCR      K
Sbjct: 39  CTYADDKYPLISKLPHCGHNFDYECLSIWL---SKNKTCPMCRDDITSHK 85

>YDR143C Chr4 complement(742042..743874) [1833 bp, 610 aa] {ON}
           SAN1Ubiquitin-protein ligase; involved in the
           proteasome-dependent degradation of aberrant nuclear
           proteins; targets substrates with regions of exposed
           hydrophobicity containing 5 or more contiguous
           hydrophobic residues; contains intrinsically disordered
           regions that contribute to substrate recognition
          Length = 610

 Score = 33.9 bits (76), Expect = 0.17,   Method: Composition-based stats.
 Identities = 19/54 (35%), Positives = 24/54 (44%), Gaps = 8/54 (14%)

Query: 51  TCPSCKFPGDQCPLVIGVCHHNFHDHCIYRWLDTPTSKGLCPMCRQRFQLQKGL 104
           T PS K    + P     C H F   CIY+W     S   CP+CRQ+     G+
Sbjct: 244 TNPSYKHSPIKLP-----CGHIFGRECIYKWSRLENS---CPLCRQKISESVGV 289

>YHL010C Chr8 complement(81964..83721) [1758 bp, 585 aa] {ON}
           ETP1Putative protein of unknown function that is
           required for growth on ethanol; contains a zinc finger
           region and has homology to human BRAP2, which is a
           cytoplasmic protein that binds nuclear localization
           sequences
          Length = 585

 Score = 33.9 bits (76), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 16/47 (34%), Positives = 23/47 (48%), Gaps = 7/47 (14%)

Query: 51  TCPSC--KFPGDQCPLVIGVCHHNFHDHCIYRWLDTPTSKGLCPMCR 95
           TCP C  +   +   LV   C H FH  C+ +W ++      CP+CR
Sbjct: 239 TCPVCLERMDSETTGLVTIPCQHTFHCQCLNKWKNSR-----CPVCR 280

>Skud_8.35 Chr8 complement(70011..71768) [1758 bp, 585 aa] {ON}
           YHL010C (REAL)
          Length = 585

 Score = 33.5 bits (75), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 16/47 (34%), Positives = 23/47 (48%), Gaps = 7/47 (14%)

Query: 51  TCPSC--KFPGDQCPLVIGVCHHNFHDHCIYRWLDTPTSKGLCPMCR 95
           TCP C  +   +   LV   C H FH  C+ +W ++      CP+CR
Sbjct: 239 TCPVCLERMDSETTGLVTIPCQHTFHCQCLNKWKNSR-----CPVCR 280

>Kwal_27.10419 s27 (337699..338601) [903 bp, 300 aa] {ON} YOL054W -
           Hypothetical ORF [contig 36] FULL
          Length = 300

 Score = 33.5 bits (75), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 18/55 (32%), Positives = 27/55 (49%), Gaps = 4/55 (7%)

Query: 65  VIGVCHHNFHDHCIYRWLDTPTSKGL-CPMCRQRFQLQKGLAINDAHIQKFVEIV 118
           V+  C HN+   CI  WL +  +  L CP CR   + Q  L   ++ +Q  +E V
Sbjct: 5   VMTTCGHNYCYDCISNWLVSNNANELTCPQCRSPLKEQPSL---NSALQNLLEFV 56

>Suva_8.42 Chr8 complement(84493..86250) [1758 bp, 585 aa] {ON}
           YHL010C (REAL)
          Length = 585

 Score = 33.5 bits (75), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 16/47 (34%), Positives = 23/47 (48%), Gaps = 7/47 (14%)

Query: 51  TCPSC--KFPGDQCPLVIGVCHHNFHDHCIYRWLDTPTSKGLCPMCR 95
           TCP C  +   +   LV   C H FH  C+ +W ++      CP+CR
Sbjct: 239 TCPVCLERMDSETSGLVTIPCQHTFHCQCLNKWKNSR-----CPVCR 280

>Skud_4.402 Chr4 complement(713711..715549) [1839 bp, 612 aa] {ON}
           YDR143C (REAL)
          Length = 612

 Score = 33.5 bits (75), Expect = 0.20,   Method: Composition-based stats.
 Identities = 18/54 (33%), Positives = 23/54 (42%), Gaps = 8/54 (14%)

Query: 51  TCPSCKFPGDQCPLVIGVCHHNFHDHCIYRWLDTPTSKGLCPMCRQRFQLQKGL 104
           T PS K    + P     C H F   CIY+W     S   CP+CR +     G+
Sbjct: 243 TNPSYKHSPIKLP-----CGHIFGRECIYKWSKLENS---CPLCRHKISESAGI 288

>TPHA0C04250 Chr3 (915632..917302) [1671 bp, 556 aa] {ON} Anc_2.542
           YHL010C
          Length = 556

 Score = 33.5 bits (75), Expect = 0.20,   Method: Composition-based stats.
 Identities = 21/64 (32%), Positives = 29/64 (45%), Gaps = 12/64 (18%)

Query: 51  TCPSCKFPGDQCPLVIGV----CHHNFHDHCIYRWLDTPTSKGLCPMCRQ-RFQLQKGLA 105
           TCP C    D   LV G+    C H FH  C+ +W ++      CP+CR     + + L 
Sbjct: 240 TCPVCLEKMDS--LVTGLITIPCSHTFHCQCLDKWKNSK-----CPVCRHTNLNISRKLL 292

Query: 106 INDA 109
           I  A
Sbjct: 293 IEQA 296

>Smik_8.32 Chr8 complement(65542..67299) [1758 bp, 585 aa] {ON}
           YHL010C (REAL)
          Length = 585

 Score = 33.5 bits (75), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 16/47 (34%), Positives = 23/47 (48%), Gaps = 7/47 (14%)

Query: 51  TCPSC--KFPGDQCPLVIGVCHHNFHDHCIYRWLDTPTSKGLCPMCR 95
           TCP C  +   +   LV   C H FH  C+ +W ++      CP+CR
Sbjct: 239 TCPVCLERMDSETTGLVTIPCQHTFHCQCLNKWKNSR-----CPVCR 280

>NDAI0B01820 Chr2 (433938..435815) [1878 bp, 625 aa] {ON} Anc_2.542
          Length = 625

 Score = 33.5 bits (75), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 16/47 (34%), Positives = 23/47 (48%), Gaps = 7/47 (14%)

Query: 51  TCPSC--KFPGDQCPLVIGVCHHNFHDHCIYRWLDTPTSKGLCPMCR 95
           TCP C  +   +   L+   C H FH  C+ +W D+      CP+CR
Sbjct: 267 TCPVCLERMDSETTGLITIPCQHTFHCSCLDKWNDSR-----CPVCR 308

>Kwal_55.21206 s55 complement(730534..731361) [828 bp, 275 aa] {ON}
           [contig 295] FULL
          Length = 275

 Score = 33.1 bits (74), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 17/63 (26%), Positives = 31/63 (49%), Gaps = 12/63 (19%)

Query: 40  VCGICRASYNGTCPSCKFPGDQCPLVIGVCHHNFHDHCIYRWLDTPTSKGLCPMCRQRFQ 99
            C IC+  +N     C         ++G C+H FH +CI +W+    +   CP+C++ + 
Sbjct: 119 TCAICQEDFNKLNNVC---------LLG-CNHVFHTYCIDQWI--CRNSACCPLCKRSYS 166

Query: 100 LQK 102
           L +
Sbjct: 167 LPR 169

>SAKL0A09746g Chr1 (858392..860038) [1647 bp, 548 aa] {ON} similar
           to uniprot|P38748 Saccharomyces cerevisiae YHL010C
           Hypothetical ORF
          Length = 548

 Score = 33.1 bits (74), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 18/56 (32%), Positives = 27/56 (48%), Gaps = 8/56 (14%)

Query: 51  TCPSC--KFPGDQCPLVIGVCHHNFHDHCIYRWLDTPTSKGLCPMCR-QRFQLQKG 103
           +CP C  +   D   L+   C H FH  C+ +W D+      CP+CR    +L +G
Sbjct: 236 SCPVCLERMDSDITGLITIPCQHTFHCQCLDKWKDSR-----CPVCRYSNLKLTRG 286

>KLTH0D07150g Chr4 (627115..628737) [1623 bp, 540 aa] {ON} similar
           to uniprot|P38748 Saccharomyces cerevisiae YHL010C
           Hypothetical ORF
          Length = 540

 Score = 33.1 bits (74), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 16/47 (34%), Positives = 22/47 (46%), Gaps = 7/47 (14%)

Query: 51  TCPSC--KFPGDQCPLVIGVCHHNFHDHCIYRWLDTPTSKGLCPMCR 95
           TCP C  +   +   L    C H FH  C+ +W D+      CP+CR
Sbjct: 246 TCPVCLERLDSEVTGLATIPCQHTFHCQCLNKWKDSR-----CPVCR 287

>KNAG0A07090 Chr1 complement(1110424..1112712) [2289 bp, 762 aa]
           {ON} Anc_2.545 YKL034W
          Length = 762

 Score = 33.1 bits (74), Expect = 0.27,   Method: Composition-based stats.
 Identities = 13/36 (36%), Positives = 20/36 (55%), Gaps = 3/36 (8%)

Query: 60  DQCPLVIGVCHHNFHDHCIYRWLDTPTSKGLCPMCR 95
           DQ   ++  C+H FH  C+  W+   + K  CP+CR
Sbjct: 724 DQYSYMVTPCNHIFHTECLENWM---SYKLQCPVCR 756

>TPHA0A03990 Chr1 (887214..887741) [528 bp, 175 aa] {ON} Anc_3.279
           YBR062C
          Length = 175

 Score = 32.3 bits (72), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 27/62 (43%), Gaps = 5/62 (8%)

Query: 43  ICRASYNGTCPSCKFPGDQCPLVIGV--CHHNFHDHCIYRWLDTPTSKGLCPMCRQRFQL 100
           I  A  N +   CK+  D  PL+  +  C H+F   CI  WL   +    CP+CR     
Sbjct: 99  IKAAHLNCSICYCKYTDDDYPLIAQLPHCGHHFDFECISIWL---SKNETCPICRDNLTS 155

Query: 101 QK 102
            K
Sbjct: 156 HK 157

>YKL034W Chr11 (371829..374105) [2277 bp, 758 aa] {ON}
           TUL1Golgi-localized RING-finger ubiquitin ligase (E3),
           involved in ubiquitinating and sorting membrane proteins
           that contain polar transmembrane domains to
           multivesicular bodies for delivery to the vacuole for
           quality control purposes
          Length = 758

 Score = 33.1 bits (74), Expect = 0.32,   Method: Composition-based stats.
 Identities = 13/36 (36%), Positives = 20/36 (55%), Gaps = 3/36 (8%)

Query: 60  DQCPLVIGVCHHNFHDHCIYRWLDTPTSKGLCPMCR 95
           DQ   ++  C+H FH  C+  W++    K  CP+CR
Sbjct: 720 DQHSYMVTPCNHVFHTSCLENWMNY---KLQCPVCR 752

>CAGL0K02563g Chr11 complement(231812..233572) [1761 bp, 586 aa]
           {ON} similar to uniprot|P38748 Saccharomyces cerevisiae
           YHL010c
          Length = 586

 Score = 32.7 bits (73), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 15/47 (31%), Positives = 23/47 (48%), Gaps = 7/47 (14%)

Query: 51  TCPSC--KFPGDQCPLVIGVCHHNFHDHCIYRWLDTPTSKGLCPMCR 95
           TCP C  +   +   L+   C H FH  C+ +W ++      CP+CR
Sbjct: 246 TCPVCLERMDSETTGLITIPCQHTFHCQCLDKWKNSK-----CPVCR 287

>Suva_11.189 Chr11 (354713..356989) [2277 bp, 758 aa] {ON} YKL034W
           (REAL)
          Length = 758

 Score = 32.7 bits (73), Expect = 0.34,   Method: Composition-based stats.
 Identities = 13/36 (36%), Positives = 20/36 (55%), Gaps = 3/36 (8%)

Query: 60  DQCPLVIGVCHHNFHDHCIYRWLDTPTSKGLCPMCR 95
           DQ   ++  C+H FH  C+  W+   + K  CP+CR
Sbjct: 720 DQHSYMVTPCNHVFHTSCLENWM---SYKLQCPVCR 752

>Kpol_1036.66 s1036 complement(182540..184546) [2007 bp, 668 aa]
           {ON} complement(182540..184546) [2007 nt, 669 aa]
          Length = 668

 Score = 32.7 bits (73), Expect = 0.36,   Method: Composition-based stats.
 Identities = 11/28 (39%), Positives = 15/28 (53%), Gaps = 3/28 (10%)

Query: 69  CHHNFHDHCIYRWLDTPTSKGLCPMCRQ 96
           CHH F   C+Y+W      +  CP+CR 
Sbjct: 264 CHHIFGRECLYKW---TRHENTCPLCRH 288

>KAFR0B01460 Chr2 (277155..279440) [2286 bp, 761 aa] {ON} Anc_2.545
           YKL034W
          Length = 761

 Score = 32.7 bits (73), Expect = 0.36,   Method: Composition-based stats.
 Identities = 13/36 (36%), Positives = 20/36 (55%), Gaps = 3/36 (8%)

Query: 60  DQCPLVIGVCHHNFHDHCIYRWLDTPTSKGLCPMCR 95
           DQ   ++  C+H FH  C+  W+   + K  CP+CR
Sbjct: 723 DQHSYMVTPCNHIFHTSCLENWM---SYKLQCPVCR 755

>KNAG0H03510 Chr8 complement(654395..656050) [1656 bp, 551 aa] {ON}
           Anc_2.157 YHR115C
          Length = 551

 Score = 32.3 bits (72), Expect = 0.44,   Method: Composition-based stats.
 Identities = 13/41 (31%), Positives = 21/41 (51%)

Query: 64  LVIGVCHHNFHDHCIYRWLDTPTSKGLCPMCRQRFQLQKGL 104
           + I  C H++H HC+ R +     + +CP CR    L+  L
Sbjct: 464 IFISPCSHSWHFHCVRRLVMLSYPQFVCPNCRSACDLEATL 504

>Smik_4.387 Chr4 complement(702765..704669) [1905 bp, 634 aa] {ON}
           YDR143C (REAL)
          Length = 634

 Score = 32.3 bits (72), Expect = 0.45,   Method: Composition-based stats.
 Identities = 18/54 (33%), Positives = 23/54 (42%), Gaps = 8/54 (14%)

Query: 51  TCPSCKFPGDQCPLVIGVCHHNFHDHCIYRWLDTPTSKGLCPMCRQRFQLQKGL 104
           T PS K    + P     C H F   CIY+W     S   CP+CR +     G+
Sbjct: 254 TNPSYKHSPIKLP-----CGHIFGRECIYKWSRLENS---CPLCRHKISENAGV 299

>Suva_1.69 Chr1 (120731..124546) [3816 bp, 1271 aa] {ON} YAL002W
            (REAL)
          Length = 1271

 Score = 32.7 bits (73), Expect = 0.46,   Method: Composition-based stats.
 Identities = 14/37 (37%), Positives = 19/37 (51%), Gaps = 1/37 (2%)

Query: 61   QCPLVIGVCHHNFHDHCIYRWLDTPTSKGLCPMCRQR 97
            + PLVI  CHH FH  C+      P +K  C +C  +
Sbjct: 1232 ETPLVIFKCHHGFHQTCLENLAQKP-NKYTCLICETK 1267

>Smik_11.213 Chr11 (358262..360541) [2280 bp, 759 aa] {ON} YKL034W
           (REAL)
          Length = 759

 Score = 32.3 bits (72), Expect = 0.49,   Method: Composition-based stats.
 Identities = 13/36 (36%), Positives = 20/36 (55%), Gaps = 3/36 (8%)

Query: 60  DQCPLVIGVCHHNFHDHCIYRWLDTPTSKGLCPMCR 95
           DQ   ++  C+H FH  C+  W+   + K  CP+CR
Sbjct: 721 DQHSYMVTPCNHVFHTPCLENWM---SYKLQCPVCR 753

>TPHA0B03650 Chr2 complement(857083..861813) [4731 bp, 1576 aa] {ON}
            Anc_1.389 YLR247C
          Length = 1576

 Score = 32.3 bits (72), Expect = 0.50,   Method: Composition-based stats.
 Identities = 13/43 (30%), Positives = 24/43 (55%), Gaps = 11/43 (25%)

Query: 62   CPLVIGV--------CHHNFHDHCIYRWLDTPTSKGLCPMCRQ 96
            CP+ +G+        C H F ++CI+ WL   ++   CP+C++
Sbjct: 1271 CPICLGLIHTGSMISCGHFFCNNCIFSWLKLNSN---CPLCKR 1310

>KNAG0C05660 Chr3 complement(1091851..1093374) [1524 bp, 507 aa]
           {ON} Anc_2.542 YHL010C
          Length = 507

 Score = 32.3 bits (72), Expect = 0.51,   Method: Compositional matrix adjust.
 Identities = 17/55 (30%), Positives = 26/55 (47%), Gaps = 8/55 (14%)

Query: 51  TCPSC--KFPGDQCPLVIGVCHHNFHDHCIYRWLDTPTSKGLCPMCR-QRFQLQK 102
            CP C  +   +   L+   C H FH  C+ RW ++      CP+CR   F+L +
Sbjct: 170 ACPVCLERMDSETTGLITIPCQHTFHCQCLNRWKNSK-----CPVCRYSSFRLSR 219

>Suva_2.304 Chr2 complement(537292..539166) [1875 bp, 624 aa] {ON}
           YDR143C (REAL)
          Length = 624

 Score = 32.3 bits (72), Expect = 0.51,   Method: Composition-based stats.
 Identities = 17/56 (30%), Positives = 24/56 (42%), Gaps = 8/56 (14%)

Query: 51  TCPSCKFPGDQCPLVIGVCHHNFHDHCIYRWLDTPTSKGLCPMCRQRFQLQKGLAI 106
           T PS K    + P     C H F   C+Y+W     S   CP+CR +     G+ +
Sbjct: 262 TNPSYKHSPIRLP-----CGHVFGRECLYKWSRLENS---CPLCRHKISESAGVPV 309

>KLLA0E07019g Chr5 (641391..642230) [840 bp, 279 aa] {ON} some
           similarities with uniprot|P40072 Saccharomyces
           cerevisiae YER116C SLX8 Protein containing a RING finger
           domain that forms a complex with Hex3p mutant phenotypes
           and genetic interactions suggest a possible role in
           resolving recombination intermediates during DNA
           replication or repair
          Length = 279

 Score = 32.0 bits (71), Expect = 0.52,   Method: Compositional matrix adjust.
 Identities = 16/54 (29%), Positives = 26/54 (48%), Gaps = 6/54 (11%)

Query: 52  CPSCKFPGDQCPLVIGVCHHNFHDHCIYRWLDTPTSKG----LCPMCRQRFQLQ 101
           CP C  P +    ++  C H F   C+Y  +++    G    LC +CR+  +LQ
Sbjct: 212 CPICMEPPEAA--LVTKCGHVFCTTCLYGMVNSSKGNGRRNGLCALCRENVKLQ 263

>SAKL0H15686g Chr8 (1367935..1367948,1368042..1369827) [1800 bp, 599
           aa] {ON} some similarities with uniprot|P22470
           Saccharomyces cerevisiae YDR143C SAN1 Ubiquitin-protein
           ligase controls turnover of a specific class of unstable
           nuclear proteins including Sir4p but not Sir2p or Sir3p
           san1 mutations suppress sir4 spt16 and cdc68 mutations
           suggesting a role in chromatin silencing
          Length = 599

 Score = 32.3 bits (72), Expect = 0.55,   Method: Composition-based stats.
 Identities = 14/36 (38%), Positives = 18/36 (50%), Gaps = 3/36 (8%)

Query: 69  CHHNFHDHCIYRWLDTPTSKGLCPMCRQRFQLQKGL 104
           C H F   CIY+W     S   CP+CR     ++GL
Sbjct: 247 CGHRFGRMCIYQWTKEHNS---CPICRAEIVGREGL 279

>Kpol_1030.29 s1030 complement(56650..59700) [3051 bp, 1016 aa] {ON}
            complement(56650..59700) [3051 nt, 1017 aa]
          Length = 1016

 Score = 32.3 bits (72), Expect = 0.56,   Method: Composition-based stats.
 Identities = 23/92 (25%), Positives = 41/92 (44%), Gaps = 7/92 (7%)

Query: 49   NGTCPSCKFPGDQCPLVIGVCHHNFHDHCIYRWLDTPTSKGL---CPMCRQRFQLQKGLA 105
            N  C  C+  G + P+V+  C HN+H  C+    D  T   +   CP C    +  + LA
Sbjct: 914  NVNCCMCE-AGLELPIVVFKCTHNYHQRCLNEE-DKKTDGSIVYKCPKCIVDLESSERLA 971

Query: 106  INDAHIQKFVEIVSRRREEMIEEG--VAEDFV 135
             +   ++  +++V     +  E+   V  DF+
Sbjct: 972  KSQQEVKNNIKLVKMALNQGQEDSFKVVTDFI 1003

>Suva_13.415 Chr13 (714887..717973) [3087 bp, 1028 aa] {ON} YMR231W
           (REAL)
          Length = 1028

 Score = 32.3 bits (72), Expect = 0.60,   Method: Composition-based stats.
 Identities = 18/49 (36%), Positives = 22/49 (44%), Gaps = 4/49 (8%)

Query: 49  NGTCPSCKFPGDQCPLVIGVCHHNFHDHCIYRWLDTPTSKG---LCPMC 94
           N TC  C    D  P+V   C H +H HC+    DT  S+     CP C
Sbjct: 923 NQTCFMCNLTLD-IPVVFFKCGHTYHQHCLNEEEDTLESERKLFKCPKC 970

>Skud_11.192 Chr11 (351379..353655) [2277 bp, 758 aa] {ON} YKL034W
           (REAL)
          Length = 758

 Score = 32.0 bits (71), Expect = 0.61,   Method: Composition-based stats.
 Identities = 13/36 (36%), Positives = 19/36 (52%), Gaps = 3/36 (8%)

Query: 60  DQCPLVIGVCHHNFHDHCIYRWLDTPTSKGLCPMCR 95
           DQ   ++  C H FH  C+  W+   + K  CP+CR
Sbjct: 720 DQHSYMVTPCDHVFHTSCLENWM---SYKLQCPVCR 752

>Kpol_505.18 s505 complement(48530..50287) [1758 bp, 585 aa] {ON}
           complement(48530..50287) [1758 nt, 586 aa]
          Length = 585

 Score = 32.0 bits (71), Expect = 0.69,   Method: Composition-based stats.
 Identities = 13/37 (35%), Positives = 19/37 (51%)

Query: 64  LVIGVCHHNFHDHCIYRWLDTPTSKGLCPMCRQRFQL 100
           + I  C H++H HCI R +     + +CP CR    L
Sbjct: 515 IFISPCSHSWHFHCIRRLVMMSYPQFVCPNCRSSCDL 551

>Ecym_5445 Chr5 complement(920562..921527) [966 bp, 321 aa] {ON}
          similar to Ashbya gossypii ABR104W
          Length = 321

 Score = 31.6 bits (70), Expect = 0.69,   Method: Compositional matrix adjust.
 Identities = 12/27 (44%), Positives = 14/27 (51%)

Query: 69 CHHNFHDHCIYRWLDTPTSKGLCPMCR 95
          C H FH  CI +W  +  S   CP CR
Sbjct: 26 CQHEFHLSCIRKWYHSRISDRTCPNCR 52

>SAKL0E04488g Chr5 (359434..362817) [3384 bp, 1127 aa] {ON} similar
           to uniprot|P32849 Saccharomyces cerevisiae YLR032W RAD5
           Single-stranded DNA-dependent ATPase involved in
           postreplication repair contains RING finger domain
          Length = 1127

 Score = 32.0 bits (71), Expect = 0.70,   Method: Compositional matrix adjust.
 Identities = 14/48 (29%), Positives = 25/48 (52%), Gaps = 3/48 (6%)

Query: 64  LVIGVCHHNFHDHCIYRWLDTPTSKGL---CPMCRQRFQLQKGLAIND 108
           ++   C H F +HC+  ++D  T K L   CP CR+    ++ L + +
Sbjct: 888 VIFTECAHAFCEHCLLEYIDFQTQKKLELKCPNCRESIDPKRLLTLKE 935

>Skud_2.186 Chr2 complement(334347..334867,334953..334968) [537 bp,
           178 aa] {ON} YBR062C (REAL)
          Length = 178

 Score = 31.2 bits (69), Expect = 0.72,   Method: Compositional matrix adjust.
 Identities = 19/57 (33%), Positives = 27/57 (47%), Gaps = 14/57 (24%)

Query: 41  CGICRASYNGTCPSCKFPGDQCPLVIGV--CHHNFHDHCIYRWLDTPTSKGLCPMCR 95
           C IC  +Y           D+ PLV+ +  C+H F   C+  WL   T+   CP+CR
Sbjct: 107 CSICYTNY---------LEDEYPLVVELPHCNHRFDLECLSVWLSRSTT---CPLCR 151

>NCAS0A04680 Chr1 complement(932306..933130) [825 bp, 274 aa] {ON} 
          Length = 274

 Score = 31.6 bits (70), Expect = 0.75,   Method: Compositional matrix adjust.
 Identities = 13/27 (48%), Positives = 15/27 (55%), Gaps = 3/27 (11%)

Query: 69  CHHNFHDHCIYRWLDTPTSKGLCPMCR 95
           C H+FH  CI  WL       LCP+CR
Sbjct: 231 CSHHFHFECIKLWLQ---KNSLCPLCR 254

>Kpol_1002.8 s1002 complement(21450..23126) [1677 bp, 558 aa] {ON}
           complement(21450..23126) [1677 nt, 559 aa]
          Length = 558

 Score = 31.6 bits (70), Expect = 0.77,   Method: Compositional matrix adjust.
 Identities = 15/47 (31%), Positives = 22/47 (46%), Gaps = 7/47 (14%)

Query: 51  TCPSC--KFPGDQCPLVIGVCHHNFHDHCIYRWLDTPTSKGLCPMCR 95
           TCP C  +       L+   C H FH  C+ +W ++      CP+CR
Sbjct: 234 TCPVCLERLDDGTTGLITIPCQHTFHCQCLDKWKNSK-----CPVCR 275

>TBLA0B01260 Chr2 (266584..269241) [2658 bp, 885 aa] {ON} Anc_2.157
           YHR115C
          Length = 885

 Score = 32.0 bits (71), Expect = 0.79,   Method: Composition-based stats.
 Identities = 12/32 (37%), Positives = 18/32 (56%)

Query: 64  LVIGVCHHNFHDHCIYRWLDTPTSKGLCPMCR 95
           + I  C H++H HCI R +     + +CP CR
Sbjct: 782 IFISPCSHSWHFHCIRRLVMLQYPQFVCPNCR 813

>YMR231W Chr13 (733545..736634) [3090 bp, 1029 aa] {ON}
           PEP5Component of CORVET tethering complex; peripheral
           vacuolar membrane protein required for protein
           trafficking and vacuole biogenesis; interacts with Pep7p
          Length = 1029

 Score = 31.6 bits (70), Expect = 0.84,   Method: Composition-based stats.
 Identities = 18/49 (36%), Positives = 23/49 (46%), Gaps = 4/49 (8%)

Query: 49  NGTCPSCKFPGDQCPLVIGVCHHNFHDHCIYRWLDTPTSKG---LCPMC 94
           N TC  C+   D  P+V   C H +H HC+    DT  S+     CP C
Sbjct: 925 NQTCFMCRLTLD-IPVVFFKCGHIYHQHCLNEEEDTLESERKLFKCPKC 972

>KAFR0F00740 Chr6 (144375..145907) [1533 bp, 510 aa] {ON} Anc_2.157
           YHR115C
          Length = 510

 Score = 31.6 bits (70), Expect = 0.86,   Method: Compositional matrix adjust.
 Identities = 15/46 (32%), Positives = 22/46 (47%)

Query: 64  LVIGVCHHNFHDHCIYRWLDTPTSKGLCPMCRQRFQLQKGLAINDA 109
           + I  C H++H HCI R +     + +CP CR    L+  L   D 
Sbjct: 416 IFISPCSHSWHFHCIRRLVMVSYPQFVCPNCRASCDLEATLESEDG 461

>ZYRO0B16258g Chr2 complement(1317605..1319344) [1740 bp, 579 aa]
           {ON} similar to uniprot|P53924 Saccharomyces cerevisiae
           YNL116W DMA2 Protein involved in regulating spindle
           position and orientation functionally redundant with
           Dma1p homolog of S. pombe Dma1 and H. sapiens Chfr
          Length = 579

 Score = 31.6 bits (70), Expect = 0.89,   Method: Composition-based stats.
 Identities = 12/32 (37%), Positives = 18/32 (56%)

Query: 64  LVIGVCHHNFHDHCIYRWLDTPTSKGLCPMCR 95
           + I  C H++H  CI R + T   + +CP CR
Sbjct: 506 MFISPCSHSWHFQCIRRLVMTSYPQFVCPNCR 537

>YLR247C Chr12 complement(628684..633354) [4671 bp, 1556 aa] {ON}
            IRC20Putative helicase; localizes to the mitochondrion
            and the nucleus; YLR247C is not an essential gene; null
            mutant displays increased levels of spontaneous Rad52p
            foci
          Length = 1556

 Score = 31.6 bits (70), Expect = 0.96,   Method: Composition-based stats.
 Identities = 23/91 (25%), Positives = 39/91 (42%), Gaps = 23/91 (25%)

Query: 69   CHHNFHDHCIYRWLDTPTSKGLCPMCRQRFQLQKGL-AINDAHIQKFVEIVSRRREEMIE 127
            C H F   CI  WL   +    CP+C       KG  +I++ +  KF     +R +E+  
Sbjct: 1254 CGHYFCKSCILTWLRAHSK---CPIC-------KGFCSISEVYNFKFKNSTEKREKEI-- 1301

Query: 128  EGVAEDFVDFDEPIRQNTDNAIDRSQVDTVL 158
                       EP R+  D++ D S  ++++
Sbjct: 1302 ----------QEPRREGADSSQDNSNENSII 1322

>Kwal_55.22076 s55 (1098857..1102717) [3861 bp, 1286 aa] {ON} YOL138C
            - Hypothetical ORF [contig 124] FULL
          Length = 1286

 Score = 31.6 bits (70), Expect = 1.0,   Method: Composition-based stats.
 Identities = 17/53 (32%), Positives = 24/53 (45%), Gaps = 4/53 (7%)

Query: 41   CGICRASYNGTCPSCKFPGDQCPLVIGVCHHNFHDHCIYRW-LDTPTSKGLCP 92
            C +C +  N  C  C+ P  +  + I  C H  H  C  RW +D   S+  CP
Sbjct: 1228 CDLC-SRMNTLCALCERPLKKLTMCILSCGHEGHPECFQRWFMDEEMSE--CP 1277

>Kwal_27.10546 s27 complement(386744..387058) [315 bp, 104 aa]
          {ON} YBR062C - Hypothetical ORF [contig 35] FULL
          Length = 104

 Score = 30.0 bits (66), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 15/43 (34%), Positives = 23/43 (53%), Gaps = 5/43 (11%)

Query: 55 CKFPGDQCPLVIGV--CHHNFHDHCIYRWLDTPTSKGLCPMCR 95
          C +  D+ PLV+ +  C+H F   C+  WL   +    CP+CR
Sbjct: 40 CNYRDDKYPLVVELPHCNHRFDLECVAVWL---SKSRTCPLCR 79

>TPHA0C04260 Chr3 complement(917526..919799) [2274 bp, 757 aa] {ON}
           Anc_2.545 YKL034W
          Length = 757

 Score = 31.6 bits (70), Expect = 1.0,   Method: Composition-based stats.
 Identities = 13/36 (36%), Positives = 19/36 (52%), Gaps = 3/36 (8%)

Query: 60  DQCPLVIGVCHHNFHDHCIYRWLDTPTSKGLCPMCR 95
           DQ   ++  C+H FH  C+  W+     K  CP+CR
Sbjct: 719 DQQSYMVTPCNHIFHTACLENWMGY---KLQCPVCR 751

>Suva_16.420 Chr16 complement(726959..727831) [873 bp, 290 aa]
          {ON} YPR093C (REAL)
          Length = 290

 Score = 31.2 bits (69), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 20/47 (42%), Positives = 22/47 (46%), Gaps = 5/47 (10%)

Query: 52 CPSCKFPGDQCPLVIG---VCHHNFHDHCIYRWLDTPTSKGLCPMCR 95
          CP C F GDQ     G   VC H FH +CI  W         CP+CR
Sbjct: 4  CPIC-FEGDQDGEQFGCLEVCRHEFHLNCIREWHKYSIDLK-CPICR 48

>ACR267C Chr3 complement(841323..842726) [1404 bp, 467 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YNL116W and
           YHR115C
          Length = 467

 Score = 31.2 bits (69), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 23/83 (27%), Positives = 35/83 (42%), Gaps = 12/83 (14%)

Query: 64  LVIGVCHHNFHDHCIYRWLDTPTSKGLCPMCRQRFQLQKGL---------AINDAHIQKF 114
           + I  C H++H  CI R + T   + +CP CR    L+  L            + H ++ 
Sbjct: 381 IFISPCSHSWHYQCIRRLVMTQYPQFICPNCRSSCDLEASLDSEDEEEDEVGKEGHYKEE 440

Query: 115 VEIVSRRREEM---IEEGVAEDF 134
             I SR R  +   I+E   ED 
Sbjct: 441 AAIESRTRSPLAAAIQEENEEDI 463

>SAKL0D03058g Chr4 complement(252198..252649,252717..252732) [468
           bp, 155 aa] {ON} similar to uniprot|P38239 Saccharomyces
           cerevisiae YBR062C Hypothetical ORF
          Length = 155

 Score = 30.4 bits (67), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 19/57 (33%), Positives = 24/57 (42%), Gaps = 14/57 (24%)

Query: 41  CGICRASYNGTCPSCKFPGDQCPLVIGV--CHHNFHDHCIYRWLDTPTSKGLCPMCR 95
           C IC + YN          D  PLV+ +  C H F   C+  WL        CP+CR
Sbjct: 86  CSICCSKYNE---------DDYPLVVELPHCSHRFDLECLTPWL---LKNSTCPLCR 130

>KNAG0J00850 Chr10 complement(146187..146675) [489 bp, 162 aa] {ON}
           Anc_3.279 YBR062C
          Length = 162

 Score = 30.4 bits (67), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 19/49 (38%), Positives = 25/49 (51%), Gaps = 7/49 (14%)

Query: 51  TCPSC--KFPGDQCPLVIGV--CHHNFHDHCIYRWLDTPTSKGLCPMCR 95
           TC  C  +F  D  PL+  +  C H F   CI  WL   +++  CPMCR
Sbjct: 91  TCSICFERFGNDNYPLLAQLPHCGHIFDLQCISMWL---SNQVTCPMCR 136

>KLTH0D07216g Chr4 complement(631219..633462) [2244 bp, 747 aa] {ON}
           similar to uniprot|P36096 Saccharomyces cerevisiae
           YKL034W TUL1 Transmembrane Ubiquitin Ligase
          Length = 747

 Score = 31.2 bits (69), Expect = 1.3,   Method: Composition-based stats.
 Identities = 13/36 (36%), Positives = 19/36 (52%), Gaps = 3/36 (8%)

Query: 60  DQCPLVIGVCHHNFHDHCIYRWLDTPTSKGLCPMCR 95
           D+   +I  C H FH  C+  W+   + K  CP+CR
Sbjct: 709 DKESYMITPCSHIFHTQCLESWM---SYKLQCPVCR 741

>NDAI0G02630 Chr7 (602238..604223) [1986 bp, 661 aa] {ON} Anc_8.317
          Length = 661

 Score = 31.2 bits (69), Expect = 1.3,   Method: Composition-based stats.
 Identities = 11/29 (37%), Positives = 15/29 (51%), Gaps = 3/29 (10%)

Query: 69  CHHNFHDHCIYRWLDTPTSKGLCPMCRQR 97
           C H F   C+Y+W     S   CP+CR +
Sbjct: 246 CDHIFGRECLYKWSKLENS---CPLCRHK 271

>Kpol_1048.73 s1048 (207883..212532) [4650 bp, 1549 aa] {ON}
            (207883..212532) [4650 nt, 1550 aa]
          Length = 1549

 Score = 31.2 bits (69), Expect = 1.3,   Method: Composition-based stats.
 Identities = 24/99 (24%), Positives = 43/99 (43%), Gaps = 10/99 (10%)

Query: 69   CHHNFHDHCIYRWLDTPTSKGLCPMCRQRFQLQKGLAINDAHIQKFVEIVSR----RREE 124
            C H F   CI  WL    S   CP+C+    L +    N    ++  E  S     + +E
Sbjct: 1241 CGHFFCKKCIQSWLKNKNS---CPLCKTETGLSE--IYNFKFKEEDTEYSSYGSQPKSKE 1295

Query: 125  MIEEGVAEDFVDFDEPIRQNTDNAIDRSQVDTVLDEDFL 163
            + +E    D +  DE +++  D  ++    D++ +E F+
Sbjct: 1296 ISDECYENDRITDDEMVKKE-DELMNSRDSDSIFNEKFV 1333

>YOL138C Chr15 complement(61325..65350) [4026 bp, 1341 aa] {ON}
            RTC1Subunit of the SEA (Seh1-associated) complex, a
            coatomer-related complex that associates dynamically with
            the vacuole; null mutation suppresses cdc13-1 temperature
            sensitivity; has N-terminal WD-40 repeats and a
            C-terminal RING motif
          Length = 1341

 Score = 31.2 bits (69), Expect = 1.3,   Method: Composition-based stats.
 Identities = 17/55 (30%), Positives = 23/55 (41%), Gaps = 4/55 (7%)

Query: 41   CGICRASYNGTCPSCKFPGDQCPLVIGVCHHNFHDHCIYRWL---DTPTSKGLCP 92
            C  C+   N +C  C+ P  +  +VI  C H  H  CI  W    +     G CP
Sbjct: 1283 CDSCKKK-NTSCVLCERPLKKLTMVILPCGHEGHFQCIQEWFLDENEQECPGGCP 1336

>Kwal_26.8090 s26 complement(641408..642970) [1563 bp, 520 aa] {ON}
           YHL010C - Hypothetical ORF [contig 55] FULL
          Length = 520

 Score = 31.2 bits (69), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 16/47 (34%), Positives = 21/47 (44%), Gaps = 7/47 (14%)

Query: 51  TCPSC--KFPGDQCPLVIGVCHHNFHDHCIYRWLDTPTSKGLCPMCR 95
           TCP C  +   +   L    C H FH  C+ +W D       CP+CR
Sbjct: 226 TCPVCLERLDSEVTGLATIPCQHTFHCVCLNKWGDNR-----CPVCR 267

>NCAS0A04120 Chr1 complement(833424..836837) [3414 bp, 1137 aa] {ON}
           Anc_2.411
          Length = 1137

 Score = 31.2 bits (69), Expect = 1.4,   Method: Composition-based stats.
 Identities = 20/76 (26%), Positives = 29/76 (38%), Gaps = 14/76 (18%)

Query: 53  PSCKFPGDQC--------PL---VIGVCHHNFHDHCIYRWLDTPTSKGL---CPMCRQRF 98
           P   FP  +C        PL   V   C H F + CI  + +    K L   CP CR++ 
Sbjct: 875 PQIDFPALECSICTTDPIPLDKIVFTECGHPFCESCIEEYFEFQAGKNLELKCPNCREQI 934

Query: 99  QLQKGLAINDAHIQKF 114
              + L +     + F
Sbjct: 935 NSNRLLTVEKIEAETF 950

>Smik_1.66 Chr1 (126883..130701) [3819 bp, 1272 aa] {ON} YAL002W
            (REAL)
          Length = 1272

 Score = 31.2 bits (69), Expect = 1.4,   Method: Composition-based stats.
 Identities = 13/35 (37%), Positives = 19/35 (54%), Gaps = 1/35 (2%)

Query: 61   QCPLVIGVCHHNFHDHCIYRWLDTPTSKGLCPMCR 95
            + PLVI  CHH FH  C+      P ++  C +C+
Sbjct: 1233 KTPLVIFKCHHGFHQTCLENLAQRP-NEYFCLICQ 1266

>YLR032W Chr12 (204991..208500) [3510 bp, 1169 aa] {ON}  RAD5DNA
           helicase proposed to promote replication fork regression
           during postreplication repair by template switching;
           RING finger containing ubiquitin ligase; stimulates the
           synthesis of free and PCNA-bound polyubiquitin chains by
           Ubc13p-Mms2p
          Length = 1169

 Score = 31.2 bits (69), Expect = 1.4,   Method: Composition-based stats.
 Identities = 13/41 (31%), Positives = 23/41 (56%), Gaps = 3/41 (7%)

Query: 69  CHHNFHDHCIYRWLDTPTSKGL---CPMCRQRFQLQKGLAI 106
           C H+F + C++ +++   SK L   CP CR +    + LA+
Sbjct: 932 CGHSFCEKCLFEYIEFQNSKNLGLKCPNCRNQIDACRLLAL 972

>CAGL0L01947g Chr12 (227996..230269) [2274 bp, 757 aa] {ON} similar
           to uniprot|P36096 Saccharomyces cerevisiae YKL034w
          Length = 757

 Score = 31.2 bits (69), Expect = 1.4,   Method: Composition-based stats.
 Identities = 19/58 (32%), Positives = 25/58 (43%), Gaps = 7/58 (12%)

Query: 41  CGICRAS---YNGTCPSCKFPGDQCPLVIGVCHHNFHDHCIYRWLDTPTSKGLCPMCR 95
           C IC A    Y    P      D+   +I  C H FH  C+  W+   + K  CP+CR
Sbjct: 698 CAICMAEFPVYVEELPETH-QVDKDSYMITPCDHMFHTSCLESWM---SYKLQCPVCR 751

>KNAG0A06030 Chr1 complement(909762..913214) [3453 bp, 1150 aa] {ON}
           Anc_2.411 YLR032W
          Length = 1150

 Score = 31.2 bits (69), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 16/50 (32%), Positives = 23/50 (46%), Gaps = 3/50 (6%)

Query: 58  PGDQCPLVIGVCHHNFHDHCIYRWLDTPTSKGL---CPMCRQRFQLQKGL 104
           P D   L++  C H F D CI  ++     K L   CP+CR+      G+
Sbjct: 901 PIDPHKLILTDCGHPFCDKCILEYITYQKEKKLDVKCPICREMLDDTSGM 950

>KLLA0C15697g Chr3 (1360289..1361203) [915 bp, 304 aa] {ON}
          similar to uniprot|Q06834 Saccharomyces cerevisiae
          YPR093C ASR1 Protein involved in a putative alcohol-
          responsive signaling pathway accumulates in the nucleus
          under alcohol stress contains a Ring/PHD finger domain
          Length = 304

 Score = 30.8 bits (68), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 20/57 (35%), Positives = 27/57 (47%), Gaps = 11/57 (19%)

Query: 40 VCGICRASYNGTCPSCKFPGDQCPLVIGVCHHNFHDHCIYRWLDTPTSKGLCPMCRQ 96
          +CGIC  S N T        DQ  L+   C H +H  CI +W    ++   CP CR+
Sbjct: 4  ICGICLESMNET--------DQGELL--PCEHRYHVSCIRKW-HLYSNDFKCPTCRK 49

>TBLA0I01490 Chr9 (322980..325232) [2253 bp, 750 aa] {ON} Anc_2.545
           YKL034W
          Length = 750

 Score = 30.8 bits (68), Expect = 1.5,   Method: Composition-based stats.
 Identities = 13/36 (36%), Positives = 20/36 (55%), Gaps = 3/36 (8%)

Query: 60  DQCPLVIGVCHHNFHDHCIYRWLDTPTSKGLCPMCR 95
           D+   +I  C+H FH  C+  W+   + K  CP+CR
Sbjct: 712 DKDTYMITPCNHIFHTTCLENWM---SYKLQCPVCR 744

>NCAS0G02520 Chr7 (451683..453239) [1557 bp, 518 aa] {ON} Anc_2.157
           YHR115C
          Length = 518

 Score = 30.8 bits (68), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 14/41 (34%), Positives = 21/41 (51%)

Query: 64  LVIGVCHHNFHDHCIYRWLDTPTSKGLCPMCRQRFQLQKGL 104
           + I  C H++H HCI R +     + +CP CR    L+  L
Sbjct: 442 IFISPCAHSWHFHCIRRLVMLSYPQFVCPNCRSACDLEAAL 482

>Skud_1.60 Chr1 (118757..122584) [3828 bp, 1275 aa] {ON} YAL002W
            (REAL)
          Length = 1275

 Score = 30.8 bits (68), Expect = 1.6,   Method: Composition-based stats.
 Identities = 13/34 (38%), Positives = 16/34 (47%), Gaps = 2/34 (5%)

Query: 61   QCPLVIGVCHHNFHDHCIYRWLDTPTSKG--LCP 92
            + PLVI  CHH FH  C+      P      +CP
Sbjct: 1233 EMPLVIFKCHHGFHQTCLENLAQKPNEYSCLICP 1266

>NCAS0A04760 Chr1 (948786..951071) [2286 bp, 761 aa] {ON} Anc_2.545
           YKL034W
          Length = 761

 Score = 30.8 bits (68), Expect = 1.6,   Method: Composition-based stats.
 Identities = 13/36 (36%), Positives = 18/36 (50%), Gaps = 3/36 (8%)

Query: 60  DQCPLVIGVCHHNFHDHCIYRWLDTPTSKGLCPMCR 95
           DQ   ++  C H FH  C+  W+     K  CP+CR
Sbjct: 723 DQHSYMVTPCDHIFHTDCLENWMGY---KLQCPVCR 755

>Kwal_26.8099 s26 complement(645436..647688) [2253 bp, 750 aa] {ON}
           YKL034W (TUL1) -  [contig 55] FULL
          Length = 750

 Score = 30.8 bits (68), Expect = 1.6,   Method: Composition-based stats.
 Identities = 13/36 (36%), Positives = 19/36 (52%), Gaps = 3/36 (8%)

Query: 60  DQCPLVIGVCHHNFHDHCIYRWLDTPTSKGLCPMCR 95
           D+   +I  C H FH  C+  W+   + K  CP+CR
Sbjct: 712 DKDDYMITPCSHIFHTQCLESWM---SYKLQCPVCR 744

>Skud_8.176 Chr8 complement(313886..315127) [1242 bp, 413 aa] {ON}
           YHR115C (REAL)
          Length = 413

 Score = 30.8 bits (68), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 13/41 (31%), Positives = 21/41 (51%)

Query: 64  LVIGVCHHNFHDHCIYRWLDTPTSKGLCPMCRQRFQLQKGL 104
           + I  C H++H HC+ R +     + +CP CR    L+  L
Sbjct: 335 IFISPCAHSWHFHCVRRLVIMSYPQFMCPNCRSNCDLETTL 375

>Suva_15.311 Chr15 complement(542475..543284) [810 bp, 269 aa] {ON}
           YHR115C (REAL)
          Length = 269

 Score = 30.4 bits (67), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 13/41 (31%), Positives = 21/41 (51%)

Query: 64  LVIGVCHHNFHDHCIYRWLDTPTSKGLCPMCRQRFQLQKGL 104
           + I  C H++H HC+ R +     + +CP CR    L+  L
Sbjct: 193 IFISPCAHSWHFHCVRRLVILSYPQFMCPNCRSNCDLEATL 233

>ZYRO0E05632g Chr5 complement(434758..437055) [2298 bp, 765 aa] {ON}
           similar to uniprot|P36096 Saccharomyces cerevisiae
           YKL034W TUL1 Transmembrane Ubiquitin Ligase
          Length = 765

 Score = 30.8 bits (68), Expect = 1.8,   Method: Composition-based stats.
 Identities = 12/36 (33%), Positives = 19/36 (52%), Gaps = 3/36 (8%)

Query: 60  DQCPLVIGVCHHNFHDHCIYRWLDTPTSKGLCPMCR 95
           D+   ++  C H FH  C+  W+   + K  CP+CR
Sbjct: 727 DEQTYMVTPCAHIFHTQCLENWM---SYKLQCPVCR 759

>SAKL0E10824g Chr5 complement(902623..904050) [1428 bp, 475 aa] {ON}
           similar to uniprot|Q75BK4 Ashbya gossypii ACR267C
           ACR267Cp and some similarites with YNL116W
           uniprot|P53924 Saccharomyces cerevisiae YNL116W DMA2
           Protein involved in regulating spindle position and
           orientation functionally redundant with Dma1p homolog of
           S. pombe Dma1 and H. sapiens Chfr
          Length = 475

 Score = 30.4 bits (67), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 13/41 (31%), Positives = 21/41 (51%)

Query: 64  LVIGVCHHNFHDHCIYRWLDTPTSKGLCPMCRQRFQLQKGL 104
           + I  C H++H  C+ R + T   + +CP CR    L+  L
Sbjct: 402 IFISPCSHSWHYQCVRRLVMTSYPQFVCPNCRSSCDLEASL 442

>Kpol_1002.7 s1002 (19006..21270) [2265 bp, 754 aa] {ON}
           (19006..21270) [2265 nt, 755 aa]
          Length = 754

 Score = 30.4 bits (67), Expect = 1.9,   Method: Composition-based stats.
 Identities = 18/58 (31%), Positives = 25/58 (43%), Gaps = 7/58 (12%)

Query: 41  CGICRAS---YNGTCPSCKFPGDQCPLVIGVCHHNFHDHCIYRWLDTPTSKGLCPMCR 95
           C IC +    Y    P+     D    +I  C+H FH  C+  W+     K  CP+CR
Sbjct: 695 CAICMSEVPVYVDDVPTTH-KVDLDSFMITPCNHVFHTQCLENWMGY---KLQCPVCR 748

>TDEL0F04440 Chr6 complement(833116..834780) [1665 bp, 554 aa] {ON}
           Anc_8.317 YDR143C
          Length = 554

 Score = 30.4 bits (67), Expect = 2.0,   Method: Composition-based stats.
 Identities = 18/65 (27%), Positives = 28/65 (43%), Gaps = 7/65 (10%)

Query: 65  VIGVCHHNFHDHCIYRWLDTPTSKGLCPMCRQRF----QLQKGLAINDAHIQKFVEIVSR 120
           V+  C+H F   C+++W     S   CP+CR +       Q G   N A   +  E   R
Sbjct: 214 VVLPCNHVFGRECLFKWSQLENS---CPLCRHKIVEAAAGQSGEDSNGAVANQNAEAFER 270

Query: 121 RREEM 125
            R+ +
Sbjct: 271 IRQAL 275

>NCAS0A12550 Chr1 (2476209..2477927) [1719 bp, 572 aa] {ON}
           Anc_2.542
          Length = 572

 Score = 30.4 bits (67), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 15/47 (31%), Positives = 23/47 (48%), Gaps = 7/47 (14%)

Query: 51  TCPSC--KFPGDQCPLVIGVCHHNFHDHCIYRWLDTPTSKGLCPMCR 95
           TCP C  +   +   L+   C H FH  C+ +W ++      CP+CR
Sbjct: 237 TCPVCLEQLDCETTGLITIPCQHTFHCQCLDKWKNSR-----CPVCR 278

>KLTH0E09834g Chr5 complement(885503..886942) [1440 bp, 479 aa] {ON}
           some similarities with uniprot|P53924 Saccharomyces
           cerevisiae YNL116W DMA2 Protein involved in regulating
           spindle position and orientation functionally redundant
           with Dma1p homolog of S. pombe Dma1 and H. sapiens Chfr
          Length = 479

 Score = 30.4 bits (67), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 13/41 (31%), Positives = 21/41 (51%)

Query: 64  LVIGVCHHNFHDHCIYRWLDTPTSKGLCPMCRQRFQLQKGL 104
           + I  C H++H  C+ R + T   + +CP CR    L+  L
Sbjct: 411 IFISPCSHSWHYQCVRRLVMTTYPQFVCPNCRSSCDLEASL 451

>Ecym_2684 Chr2 complement(1321556..1322716) [1161 bp, 386 aa] {ON}
           similar to Ashbya gossypii AGL217W
          Length = 386

 Score = 30.4 bits (67), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 14/43 (32%), Positives = 20/43 (46%), Gaps = 1/43 (2%)

Query: 65  VIGVCHHNFHDHCIYRWLDTPTSKGL-CPMCRQRFQLQKGLAI 106
           V+  C HN+  +CI  WL+   +  L CP CR        L +
Sbjct: 5   VMTSCGHNYCYYCISNWLNNNNATELNCPQCRTTIGAMPALNV 47

>KAFR0B03420 Chr2 (713034..716144) [3111 bp, 1036 aa] {ON} Anc_8.761
           YMR231W
          Length = 1036

 Score = 30.4 bits (67), Expect = 2.2,   Method: Composition-based stats.
 Identities = 16/48 (33%), Positives = 23/48 (47%), Gaps = 3/48 (6%)

Query: 49  NGTCPSCKFPGDQCPLVIGVCHHNFHDHCIYRWLDTPTSKGL--CPMC 94
           N TC  CK P    P+V   C H +H +C+     T  ++ +  CP C
Sbjct: 933 NQTCFMCKLPM-HLPMVYFKCGHIYHQNCMDEEYSTEENELIFKCPKC 979

>YAL002W Chr1 (143707..147531) [3825 bp, 1274 aa] {ON}
            VPS8Membrane-binding component of the CORVET complex;
            involved in endosomal vesicle tethering and fusion in the
            endosome to vacuole protein targeting pathway; interacts
            with Vps21p; contains RING finger motif
          Length = 1274

 Score = 30.4 bits (67), Expect = 2.3,   Method: Composition-based stats.
 Identities = 13/35 (37%), Positives = 17/35 (48%), Gaps = 1/35 (2%)

Query: 61   QCPLVIGVCHHNFHDHCIYRWLDTPTSKGLCPMCR 95
            + PLVI  CHH FH  C+      P     C +C+
Sbjct: 1233 KTPLVIFKCHHGFHQTCLENLAQKPDEYS-CLICQ 1266

>TDEL0D03460 Chr4 (637921..638355) [435 bp, 144 aa] {ON} Anc_3.279
           YBR062C
          Length = 144

 Score = 29.6 bits (65), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 15/41 (36%), Positives = 21/41 (51%), Gaps = 5/41 (12%)

Query: 57  FPGDQCPLVIGV--CHHNFHDHCIYRWLDTPTSKGLCPMCR 95
           +  D  PLV+ +  C H+F   C+  W    TS   CP+CR
Sbjct: 82  YLNDGYPLVVRLPHCGHDFDLECLSVWFSKSTS---CPLCR 119

>TPHA0J01570 Chr10 (360114..363170) [3057 bp, 1018 aa] {ON}
           Anc_8.761 YMR231W
          Length = 1018

 Score = 30.4 bits (67), Expect = 2.4,   Method: Composition-based stats.
 Identities = 14/48 (29%), Positives = 23/48 (47%), Gaps = 3/48 (6%)

Query: 49  NGTCPSCKFPGDQCPLVIGVCHHNFHDHCIYRWLDTPTSKG--LCPMC 94
           N  C  CK    + P++   C H +H+ C+ + LD  +     +CP C
Sbjct: 915 NEKCDYCK-ANLEIPIIYFQCGHTYHERCLNKELDQNSGDEVYVCPKC 961

>Skud_12.99 Chr12 (196796..200311) [3516 bp, 1171 aa] {ON} YLR032W
           (REAL)
          Length = 1171

 Score = 30.4 bits (67), Expect = 2.4,   Method: Composition-based stats.
 Identities = 19/69 (27%), Positives = 28/69 (40%), Gaps = 13/69 (18%)

Query: 41  CGICRASYNGTCPSCKFPGDQCPLVIGVCHHNFHDHCIYRWLDTPTSKGL---CPMCRQR 97
           C IC A           P D    +   C H+F + C++ ++D    K L   CP CR  
Sbjct: 916 CSICTAE----------PIDLNKALFTECGHSFCEKCLFEYIDFQNGKKLCLKCPNCRDS 965

Query: 98  FQLQKGLAI 106
               + LA+
Sbjct: 966 IDGGRLLAL 974

>NCAS0C03310 Chr3 (649744..651456) [1713 bp, 570 aa] {ON} Anc_8.317
          Length = 570

 Score = 30.0 bits (66), Expect = 2.6,   Method: Composition-based stats.
 Identities = 11/28 (39%), Positives = 14/28 (50%), Gaps = 3/28 (10%)

Query: 69  CHHNFHDHCIYRWLDTPTSKGLCPMCRQ 96
           C H F   C+YRW     +   CP+CR 
Sbjct: 235 CGHIFGRECLYRWCKLENT---CPLCRH 259

>CAGL0G03553g Chr7 complement(345057..345689) [633 bp, 210 aa] {ON}
           weakly similar to uniprot|P40072 Saccharomyces
           cerevisiae YER116c YEU6
          Length = 210

 Score = 29.6 bits (65), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 15/54 (27%), Positives = 28/54 (51%), Gaps = 5/54 (9%)

Query: 52  CPSCKFPGDQCPLVIGVCHHNFHDHCIYRWLD---TPTSKGLCPMCRQRFQLQK 102
           CP C  P D    ++  C H F   C+++ ++   TP   G+C +CR+   +++
Sbjct: 146 CPICFEPPDVA--IMTPCGHVFCCECLFQMVNNSRTPRKGGVCALCRKTINMKQ 197

>Kwal_47.17904 s47 complement(602106..603518) [1413 bp, 470 aa] {ON}
           YNL116W - Hypothetical ORF [contig 204] FULL
          Length = 470

 Score = 30.0 bits (66), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 13/41 (31%), Positives = 21/41 (51%)

Query: 64  LVIGVCHHNFHDHCIYRWLDTPTSKGLCPMCRQRFQLQKGL 104
           + I  C H++H  C+ R + T   + +CP CR    L+  L
Sbjct: 402 IFISPCSHSWHYQCVRRLVMTTYPQFVCPNCRSSCDLEASL 442

>KLLA0F25674g Chr6 (2384293..2386566) [2274 bp, 757 aa] {ON} similar
           to uniprot|P36096 Saccharomyces cerevisiae YKL034W TUL1
           Transmembrane Ubiquitin Ligase
          Length = 757

 Score = 30.0 bits (66), Expect = 2.6,   Method: Composition-based stats.
 Identities = 13/36 (36%), Positives = 18/36 (50%), Gaps = 3/36 (8%)

Query: 60  DQCPLVIGVCHHNFHDHCIYRWLDTPTSKGLCPMCR 95
           D    +I  C H FH  C+  W+   + K  CP+CR
Sbjct: 719 DAQSYMITPCSHIFHTECLENWM---SYKLQCPVCR 751

>SAKL0H17116g Chr8 complement(1512627..1514261) [1635 bp, 544 aa]
           {ON} weakly similar to uniprot|P22470 Saccharomyces
           cerevisiae YDR143C SAN1 Ubiquitin-protein ligase
           controls turnover of a specific class of unstable
           nuclear proteins including Sir4p but not Sir2p or Sir3p
           san1 mutations suppress sir4 spt16 and cdc68 mutations
           suggesting a role in chromatin silencing
          Length = 544

 Score = 30.0 bits (66), Expect = 2.7,   Method: Composition-based stats.
 Identities = 14/36 (38%), Positives = 18/36 (50%), Gaps = 3/36 (8%)

Query: 69  CHHNFHDHCIYRWLDTPTSKGLCPMCRQRFQLQKGL 104
           C H F   CIY+W     S   CP+CR     ++GL
Sbjct: 231 CGHVFGRVCIYQWTKENNS---CPICRANIVGREGL 263

>Kpol_538.5 s538 (7029..8036) [1008 bp, 335 aa] {ON} (7029..8036)
          [1008 nt, 336 aa]
          Length = 335

 Score = 30.0 bits (66), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 18/46 (39%), Positives = 21/46 (45%), Gaps = 5/46 (10%)

Query: 52 CPSC--KFPGDQCPLVIGVCHHNFHDHCIYRWLDTPTSKGLCPMCR 95
          C  C  +F  D+C L    CHH FH  CI  W  +      CP CR
Sbjct: 6  CAICFEEFKEDRCAL--NPCHHTFHLECIRIW-HSYADDLKCPTCR 48

>Kwal_56.23543 s56 complement(591514..594411) [2898 bp, 965 aa] {ON}
           YDR103W (STE5) - scaffold protein for MAP kinase cascade
           [contig 176] FULL
          Length = 965

 Score = 30.0 bits (66), Expect = 2.8,   Method: Composition-based stats.
 Identities = 16/46 (34%), Positives = 24/46 (52%), Gaps = 5/46 (10%)

Query: 54  SCKFPGDQCPLVIGVCHHNFHDHCIYRWLDTPTS---KGLCPMCRQ 96
           SC+  G++  +V   C H  H+ C+  + + PTS     L P CRQ
Sbjct: 170 SCRTVGEK--VVSLECGHLVHEECLMTYFENPTSCHIDELFPFCRQ 213

>Ecym_3005 Chr3 complement(9078..11699) [2622 bp, 873 aa] {ON}
           similar to Ashbya gossypii ACR024W
          Length = 873

 Score = 30.0 bits (66), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 26/114 (22%), Positives = 47/114 (41%), Gaps = 32/114 (28%)

Query: 71  HNFHDHCIYRWLDTPTSKGLCPMCRQRF----QLQKGLAINDAHIQKFVEIVSRRRE--- 123
           H FH +C              P   +RF     + +   +N    Q F+++++RR +   
Sbjct: 276 HKFHIYC-------------SPTYLERFFKLADINRNGLLNLKEFQLFIKLLTRRNDITE 322

Query: 124 ---EMIEEGVAEDFVDF--------DEPI-RQNTDNAIDRSQVDTVLDEDFLLR 165
              ++ + G   DF  F         E I R  T+   ++  +D ++DED LL+
Sbjct: 323 IWRDISKPGSVLDFEKFYNFLIDIQGESISRHLTEKIFEKYSIDGIMDEDLLLK 376

>Skud_15.16 Chr15 complement(26552..30550) [3999 bp, 1332 aa] {ON}
            YOL138C (REAL)
          Length = 1332

 Score = 30.0 bits (66), Expect = 2.9,   Method: Composition-based stats.
 Identities = 19/55 (34%), Positives = 24/55 (43%), Gaps = 4/55 (7%)

Query: 41   CGICRASYNGTCPSCKFPGDQCPLVIGVCHHNFHDHCIYRW-LDTPTSK--GLCP 92
            C  C+   N  C  C+ P  +  +VI  C H  H  CI  W LD    +  G CP
Sbjct: 1274 CDSCKKK-NTPCILCERPLKKLTMVILPCGHEGHFQCIQEWFLDEKEHECPGGCP 1327

>SAKL0D02354g Chr4 (188524..189519) [996 bp, 331 aa] {ON} weakly
          similar to uniprot|Q12161 Saccharomyces cerevisiae
          YOL054W PSH1 Nuclear protein putative RNA polymerase II
          elongation factor isolated as Pob3p/Spt16p- binding
          protein
          Length = 331

 Score = 30.0 bits (66), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 13/32 (40%), Positives = 17/32 (53%), Gaps = 1/32 (3%)

Query: 65 VIGVCHHNFHDHCIYRWLDTPTSKGL-CPMCR 95
          V+  C HN+   CI  WL+   +  L CP CR
Sbjct: 5  VMTSCGHNYCYDCISNWLNNNNATELTCPQCR 36

>TDEL0B06340 Chr2 complement(1122797..1125085) [2289 bp, 762 aa]
           {ON} Anc_2.545 YKL034W
          Length = 762

 Score = 30.0 bits (66), Expect = 3.0,   Method: Composition-based stats.
 Identities = 11/27 (40%), Positives = 15/27 (55%), Gaps = 3/27 (11%)

Query: 69  CHHNFHDHCIYRWLDTPTSKGLCPMCR 95
           C H FH  C+  W+   + K  CP+CR
Sbjct: 733 CGHVFHTQCLENWM---SYKLQCPVCR 756

>CAGL0L03960g Chr12 complement(463751..465562) [1812 bp, 603 aa]
           {ON} similar to uniprot|P53924 Saccharomyces cerevisiae
           YNL116w
          Length = 603

 Score = 30.0 bits (66), Expect = 3.1,   Method: Composition-based stats.
 Identities = 13/46 (28%), Positives = 22/46 (47%)

Query: 64  LVIGVCHHNFHDHCIYRWLDTPTSKGLCPMCRQRFQLQKGLAINDA 109
           + I  C H +H  C+ R +     + +CP CR    L+  L  +D+
Sbjct: 528 IFISPCAHTWHFRCVRRLVMLAYPQFVCPNCRSTCDLEASLDNSDS 573

>YHR115C Chr8 complement(340109..341359) [1251 bp, 416 aa] {ON}
           DMA1Ubiquitin-protein ligase (E3); controls septin
           dynamics and the spindle position checkpoint (SPOC)
           along with functionally redundant ligase Dma2p by
           regulating the recruitment of Elm1p to the bud neck;
           regulates levels of the translation initiation factor
           eIF2 subunit Gcd11p, as well as abundance, localization,
           and ubiquitination of Cdk inhibitory kinase Swe1p;
           ortholog of human RNF8 protein, with sequence similarity
           to human Chfr; contains FHA and RING finger domains
          Length = 416

 Score = 30.0 bits (66), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 13/41 (31%), Positives = 21/41 (51%)

Query: 64  LVIGVCHHNFHDHCIYRWLDTPTSKGLCPMCRQRFQLQKGL 104
           + I  C H++H HC+ R +     + +CP CR    L+  L
Sbjct: 340 IFISPCAHSWHFHCVRRLVIMNYPQFMCPNCRTNCDLETTL 380

>TDEL0F02870 Chr6 complement(518828..519610) [783 bp, 260 aa] {ON} 
          Length = 260

 Score = 29.6 bits (65), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 16/59 (27%), Positives = 30/59 (50%), Gaps = 12/59 (20%)

Query: 64  LVIGVCHHNFHDHCIYRWLDTPTSKG-----LCPMCR------QRFQLQKGLAINDAHI 111
           +V+  C H FH  C+  W  +P  +G     +CP+CR      + F ++ GL +++  +
Sbjct: 180 IVMIPCQHYFHAGCLKEWF-SPQRRGKRRPLVCPLCRMDIVKCKAFCMRLGLLMSELKV 237

>CAGL0E01441g Chr5 (135312..137465) [2154 bp, 717 aa] {ON} some
           similarities with uniprot|P22470 Saccharomyces
           cerevisiae YDR143c SAN1 mating-type regulation protein
          Length = 717

 Score = 30.0 bits (66), Expect = 3.2,   Method: Composition-based stats.
 Identities = 11/29 (37%), Positives = 15/29 (51%), Gaps = 3/29 (10%)

Query: 69  CHHNFHDHCIYRWLDTPTSKGLCPMCRQR 97
           C H F   C+Y W     S   CP+CR++
Sbjct: 295 CGHIFGRSCLYEWTRLENS---CPLCRKK 320

>Smik_13.439 Chr13 (717478..720570) [3093 bp, 1030 aa] {ON} YMR231W
           (REAL)
          Length = 1030

 Score = 30.0 bits (66), Expect = 3.4,   Method: Composition-based stats.
 Identities = 17/49 (34%), Positives = 22/49 (44%), Gaps = 4/49 (8%)

Query: 49  NGTCPSCKFPGDQCPLVIGVCHHNFHDHCIYRWLDTPTSKG---LCPMC 94
           N TC  C    D  P+V   C H +H HC+    DT  ++     CP C
Sbjct: 926 NQTCFMCNLTLD-VPVVFFKCGHIYHQHCLNEEEDTLKNERKLFKCPKC 973

>Smik_15.16 Chr15 complement(29410..33390) [3981 bp, 1326 aa] {ON}
            YOL138C (REAL)
          Length = 1326

 Score = 30.0 bits (66), Expect = 3.4,   Method: Composition-based stats.
 Identities = 17/55 (30%), Positives = 22/55 (40%), Gaps = 4/55 (7%)

Query: 41   CGICRASYNGTCPSCKFPGDQCPLVIGVCHHNFHDHCIYRWL---DTPTSKGLCP 92
            C  C+   N  C  C+ P  +  +VI  C H  H  CI  W    +     G CP
Sbjct: 1268 CDSCKKK-NTLCVLCERPLKKLTMVILPCGHEGHFQCIQEWFLNENEHECPGGCP 1321

>Ecym_7241 Chr7 (507764..510040) [2277 bp, 758 aa] {ON} similar to
           Ashbya gossypii AFR275W
          Length = 758

 Score = 29.6 bits (65), Expect = 3.5,   Method: Composition-based stats.
 Identities = 11/27 (40%), Positives = 15/27 (55%), Gaps = 3/27 (11%)

Query: 69  CHHNFHDHCIYRWLDTPTSKGLCPMCR 95
           C H FH  C+  W+   + K  CP+CR
Sbjct: 729 CAHVFHTECLENWM---SYKLQCPVCR 752

>TBLA0A03900 Chr1 complement(974843..976939) [2097 bp, 698 aa] {ON}
           Anc_8.317 YDR143C
          Length = 698

 Score = 29.6 bits (65), Expect = 3.5,   Method: Composition-based stats.
 Identities = 11/29 (37%), Positives = 15/29 (51%), Gaps = 3/29 (10%)

Query: 69  CHHNFHDHCIYRWLDTPTSKGLCPMCRQR 97
           C H F   C+Y W     S   CP+CR++
Sbjct: 337 CKHIFCRSCLYEWSKLKNS---CPLCRKK 362

>ZYRO0G13376g Chr7 complement(1066321..1067658) [1338 bp, 445 aa]
          {ON} some similarities with uniprot|Q12161
          Saccharomyces cerevisiae YOL054W PSH1 Nuclear protein
          putative RNA polymerase II elongation factor isolated
          as Pob3p/Spt16p- binding protein
          Length = 445

 Score = 29.6 bits (65), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 11/31 (35%), Positives = 18/31 (58%)

Query: 65 VIGVCHHNFHDHCIYRWLDTPTSKGLCPMCR 95
          V+  C HN+   C+  W D+ +++  CP CR
Sbjct: 41 VMTQCGHNYCYDCLSSWFDSNSNELSCPQCR 71

>NDAI0K01810 Chr11 (405118..407406) [2289 bp, 762 aa] {ON} Anc_2.545
           YKL034W
          Length = 762

 Score = 29.6 bits (65), Expect = 4.0,   Method: Composition-based stats.
 Identities = 11/27 (40%), Positives = 15/27 (55%), Gaps = 3/27 (11%)

Query: 69  CHHNFHDHCIYRWLDTPTSKGLCPMCR 95
           C+H FH  C+  W+     K  CP+CR
Sbjct: 733 CNHIFHTECLENWMGY---KLQCPVCR 756

>KLLA0E04071g Chr5 (369201..371315) [2115 bp, 704 aa] {ON} some
           similarities with uniprot|P22470 Saccharomyces
           cerevisiae YDR143C SAN1 Ubiquitin-protein ligase
           controls turnover of a specific class of unstable
           nuclear proteins including Sir4p but not Sir2p or Sir3p
           san1 mutations suppress sir4 spt16 and cdc68 mutations
           suggesting a role in chromatin silencing
          Length = 704

 Score = 29.6 bits (65), Expect = 4.1,   Method: Composition-based stats.
 Identities = 11/27 (40%), Positives = 14/27 (51%), Gaps = 3/27 (11%)

Query: 69  CHHNFHDHCIYRWLDTPTSKGLCPMCR 95
           C H F   C+Y+W    T    CP+CR
Sbjct: 219 CGHVFGRECLYKW---TTEHNSCPICR 242

>NCAS0B06990 Chr2 complement(1330221..1331786) [1566 bp, 521 aa]
           {ON} Anc_2.157 YHR115C
          Length = 521

 Score = 29.3 bits (64), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 11/39 (28%), Positives = 19/39 (48%)

Query: 63  PLVIGVCHHNFHDHCIYRWLDTPTSKGLCPMCRQRFQLQ 101
           P+ I  C H++H  C+   +        CP C+ +F L+
Sbjct: 357 PIFISPCSHHWHYKCVKDLITVEYPFFFCPTCKNQFDLE 395

>Suva_10.112 Chr10 (211443..214946) [3504 bp, 1167 aa] {ON} YLR032W
           (REAL)
          Length = 1167

 Score = 29.6 bits (65), Expect = 4.4,   Method: Composition-based stats.
 Identities = 17/59 (28%), Positives = 25/59 (42%), Gaps = 13/59 (22%)

Query: 41  CGICRASYNGTCPSCKFPGDQCPLVIGVCHHNFHDHCIYRWLDTPTSKGL---CPMCRQ 96
           C IC A           P D    V   C H+F + C++ +++    K L   CP CR+
Sbjct: 914 CSICTAE----------PIDLDNAVFTECGHSFCEKCLFEYIEFQNGKQLSLKCPNCRE 962

>KLTH0C05258g Chr3 complement(455688..456130,456190..456205) [459
           bp, 152 aa] {ON} similar to uniprot|P38239 Saccharomyces
           cerevisiae YBR062C Hypothetical ORF
          Length = 152

 Score = 28.9 bits (63), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 15/43 (34%), Positives = 21/43 (48%), Gaps = 5/43 (11%)

Query: 55  CKFPGDQCPLVIGV--CHHNFHDHCIYRWLDTPTSKGLCPMCR 95
           C +  D  PLV+ +  C H F   C+  WL   +    CP+CR
Sbjct: 88  CGYLDDTHPLVVKLPHCSHRFDLECVAVWL---SKSRTCPLCR 127

>Suva_15.22 Chr15 complement(39171..43181) [4011 bp, 1336 aa] {ON}
            YOL138C (REAL)
          Length = 1336

 Score = 29.3 bits (64), Expect = 4.9,   Method: Composition-based stats.
 Identities = 16/55 (29%), Positives = 22/55 (40%), Gaps = 4/55 (7%)

Query: 41   CGICRASYNGTCPSCKFPGDQCPLVIGVCHHNFHDHCIYRWLDTPTSK---GLCP 92
            C  C+   N  C  C+ P  +  +V+  C H  H  CI  W      +   G CP
Sbjct: 1278 CDSCKKR-NSLCVLCERPLKKLTMVLLPCGHEGHFQCIQEWFLNEKERECPGGCP 1331

>TBLA0C01330 Chr3 (291659..296017) [4359 bp, 1452 aa] {ON} Anc_1.389
            YLR247C
          Length = 1452

 Score = 29.3 bits (64), Expect = 4.9,   Method: Composition-based stats.
 Identities = 15/46 (32%), Positives = 21/46 (45%), Gaps = 7/46 (15%)

Query: 69   CHHNFHDHCIYRWLDTPTSKGLCPMCRQRFQLQKGLAINDAHIQKF 114
            C H +   CI+ WL+    K  CP+C+          IND +  KF
Sbjct: 1152 CGHYYCQDCIWNWLEKSKKKN-CPICKIETN------INDTYNFKF 1190

>NDAI0F02770 Chr6 complement(677011..678675) [1665 bp, 554 aa] {ON}
           Anc_2.157 YHR115C
          Length = 554

 Score = 29.3 bits (64), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 12/32 (37%), Positives = 18/32 (56%)

Query: 64  LVIGVCHHNFHDHCIYRWLDTPTSKGLCPMCR 95
           + I  C H++H HCI R +     + +CP CR
Sbjct: 484 IFISPCAHSWHFHCIRRLVMLTYPQFVCPNCR 515

>Smik_8.193 Chr8 complement(316475..317725) [1251 bp, 416 aa] {ON}
           YHR115C (REAL)
          Length = 416

 Score = 29.3 bits (64), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 11/33 (33%), Positives = 18/33 (54%)

Query: 64  LVIGVCHHNFHDHCIYRWLDTPTSKGLCPMCRQ 96
           + I  C H++H HC+ R +     + +CP CR 
Sbjct: 340 IFISPCAHSWHFHCVRRLVIMSYPQFMCPNCRS 372

>Smik_12.94 Chr12 (191768..195304) [3537 bp, 1178 aa] {ON} YLR032W
           (REAL)
          Length = 1178

 Score = 29.3 bits (64), Expect = 5.6,   Method: Composition-based stats.
 Identities = 16/59 (27%), Positives = 26/59 (44%), Gaps = 13/59 (22%)

Query: 41  CGICRASYNGTCPSCKFPGDQCPLVIGVCHHNFHDHCIYRWLDTPTSKGL---CPMCRQ 96
           C IC A           P D   ++   C H+F + C++ +++    K L   CP CR+
Sbjct: 923 CSICTAE----------PIDIDKVLFTECGHSFCEKCLFEYIEFQKGKNLCLKCPNCRK 971

>Ecym_2490 Chr2 (961218..962615) [1398 bp, 465 aa] {ON} similar to
           Ashbya gossypii AAR049C
          Length = 465

 Score = 28.9 bits (63), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 20/67 (29%), Positives = 33/67 (49%), Gaps = 6/67 (8%)

Query: 61  QCPLVIGVCHHNFHDHCIYRWLDTPTSKGLCPMCRQRFQLQKGLAINDAHIQKFVEIVSR 120
           Q P V+G C H F   CI  +L+    +  CP+C    +L++ +   +  + + V   SR
Sbjct: 41  QTP-VLGHCGHTFCSLCIRTYLN---KEARCPLC--LVELRQNMLQKEFLLGEIVASYSR 94

Query: 121 RREEMIE 127
            R  M+E
Sbjct: 95  IRGRMLE 101

>ABR104W Chr2 (574068..575054) [987 bp, 328 aa] {ON} Syntenic
          homolog of Saccharomyces cerevisiae YPR093C
          Length = 328

 Score = 28.9 bits (63), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 10/27 (37%), Positives = 14/27 (51%)

Query: 69 CHHNFHDHCIYRWLDTPTSKGLCPMCR 95
          C H +H  CI +W    +    CP+CR
Sbjct: 35 CGHEYHLACIRKWFHLHSGNRSCPVCR 61

>Ecym_5428 Chr5 complement(881972..883396) [1425 bp, 474 aa] {ON}
           similar to Ashbya gossypii ACR267C
          Length = 474

 Score = 28.9 bits (63), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 13/38 (34%), Positives = 20/38 (52%)

Query: 64  LVIGVCHHNFHDHCIYRWLDTPTSKGLCPMCRQRFQLQ 101
           + I  C H++H  CI R + T   + +CP CR    L+
Sbjct: 390 IFISPCSHSWHYQCIRRLVMTQYPQFVCPNCRSSCDLE 427

>KLTH0C04664g Chr3 (405366..406286) [921 bp, 306 aa] {ON} some
           similarities with uniprot|Q12161 Saccharomyces
           cerevisiae YOL054W PSH1 Nuclear protein putative RNA
           polymerase II elongation factor isolated as
           Pob3p/Spt16p- binding protein
          Length = 306

 Score = 28.5 bits (62), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 15/52 (28%), Positives = 24/52 (46%), Gaps = 1/52 (1%)

Query: 65  VIGVCHHNFHDHCIYRWLDTPTSKGL-CPMCRQRFQLQKGLAINDAHIQKFV 115
           V+  C HN+   CI  WL +  +  L CP CR   +    L +   ++  +V
Sbjct: 5   VMTSCGHNYCYECISNWLVSNNANELTCPQCRSPLKEPPALNVALQNLLNYV 56

>KAFR0H02630 Chr8 (500064..502754) [2691 bp, 896 aa] {ON} Anc_8.638
           YOR219C
          Length = 896

 Score = 28.9 bits (63), Expect = 7.5,   Method: Composition-based stats.
 Identities = 20/67 (29%), Positives = 28/67 (41%)

Query: 96  QRFQLQKGLAINDAHIQKFVEIVSRRREEMIEEGVAEDFVDFDEPIRQNTDNAIDRSQVD 155
           +RF L  G A ++ HIQ   E V +     +       F D D  IR +    I   ++ 
Sbjct: 821 KRFMLIHGTADDNVHIQNTYEFVDKLNLNKLRNYDMHIFPDSDHSIRYHGAQRIIYEKIY 880

Query: 156 TVLDEDF 162
             LDE F
Sbjct: 881 YWLDEAF 887

>NCAS0B00990 Chr2 complement(154925..156103) [1179 bp, 392 aa]
          {ON} Anc_8.808 YOL054W
          Length = 392

 Score = 28.5 bits (62), Expect = 7.6,   Method: Compositional matrix adjust.
 Identities = 12/32 (37%), Positives = 18/32 (56%), Gaps = 1/32 (3%)

Query: 65 VIGVCHHNFHDHCIYRWLDTPTSKGL-CPMCR 95
          ++  C HN+   C+  W+ T + K L CP CR
Sbjct: 41 MMTSCGHNYCYGCLKSWISTNSKKELACPQCR 72

>Suva_14.223 Chr14 (404941..406683) [1743 bp, 580 aa] {ON} YNL116W
           (REAL)
          Length = 580

 Score = 28.5 bits (62), Expect = 8.1,   Method: Composition-based stats.
 Identities = 17/61 (27%), Positives = 25/61 (40%), Gaps = 10/61 (16%)

Query: 41  CGICRASYNGTCPSCKFPGDQCPLVIGVCHHNFHDHCIYRWLDTPTSKGLCPMCRQRFQL 100
           C IC          CK    Q  + I  C H++H  C+ R +     + +CP CR    L
Sbjct: 491 CSICL---------CKIKPCQA-IFISPCAHSWHFRCVRRLVMLSYPQFICPNCRSSCDL 540

Query: 101 Q 101
           +
Sbjct: 541 E 541

>KLTH0F11044g Chr6 (937668..938543) [876 bp, 291 aa] {ON} weakly
          similar to uniprot|Q06834 Saccharomyces cerevisiae
          YPR093C ASR1 Protein involved in a putative
          alcohol-responsive signaling pathway accumulates in the
          nucleus under alcohol stress contains a Ring/PHD finger
          domain
          Length = 291

 Score = 28.5 bits (62), Expect = 8.2,   Method: Compositional matrix adjust.
 Identities = 20/48 (41%), Positives = 23/48 (47%), Gaps = 7/48 (14%)

Query: 51 TCPSC--KFPGDQCPLVIGVCHHNFHDHCIYRWLDTPTSKGL-CPMCR 95
          +CP C        C LV   C H +H +CI RW     SK L CP CR
Sbjct: 3  SCPICFESLSKGACRLV--ECGHKYHFNCIRRW--HYHSKNLQCPTCR 46

>TDEL0C05420 Chr3 complement(972821..973102) [282 bp, 93 aa] {ON}
          Anc_3.405 YPR093C
          Length = 93

 Score = 27.3 bits (59), Expect = 8.8,   Method: Compositional matrix adjust.
 Identities = 13/27 (48%), Positives = 13/27 (48%), Gaps = 1/27 (3%)

Query: 69 CHHNFHDHCIYRWLDTPTSKGLCPMCR 95
          C H FH  CI RW  T      CP CR
Sbjct: 26 CRHKFHKECIRRW-HTGAIDLKCPTCR 51

>ZYRO0C17424g Chr3 complement(1357940..1358761) [822 bp, 273 aa]
          {ON} weakly similar to uniprot|Q06834 Saccharomyces
          cerevisiae YPR093C ASR1 Protein involved in a putative
          alcohol-responsive signaling pathway accumulates in the
          nucleus under alcohol stress contains a Ring/PHD finger
          domain
          Length = 273

 Score = 28.5 bits (62), Expect = 8.9,   Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 21/48 (43%), Gaps = 4/48 (8%)

Query: 51 TCPSCKFPGDQCPLVIGV---CHHNFHDHCIYRWLDTPTSKGLCPMCR 95
          TCP C          IG    C+H FH  C+ RW        +CP+CR
Sbjct: 4  TCPICLDDDRTNIESIGTLQPCNHKFHRDCLRRW-HLYAHDLVCPICR 50

>CAGL0K08052g Chr11 complement(800991..801908) [918 bp, 305 aa] {ON}
           weakly similar to uniprot|Q06834 Saccharomyces
           cerevisiae YPR093c
          Length = 305

 Score = 28.5 bits (62), Expect = 9.1,   Method: Compositional matrix adjust.
 Identities = 17/54 (31%), Positives = 21/54 (38%), Gaps = 16/54 (29%)

Query: 69  CHHNFHDHCIYRWLDTPTSKGLCPMCR---------------QRFQLQKGLAIN 107
           C H +H  CI +W         CPMCR               +   LQKG A+N
Sbjct: 25  CGHEYHSDCIRKWHGHAEDLK-CPMCRIDAEELVVKLYGCAEKIIDLQKGFAVN 77

>TDEL0B06170 Chr2 (1088912..1093324) [4413 bp, 1470 aa] {ON} Anc_1.389
            YLR247C
          Length = 1470

 Score = 28.5 bits (62), Expect = 9.2,   Method: Compositional matrix adjust.
 Identities = 17/45 (37%), Positives = 20/45 (44%), Gaps = 5/45 (11%)

Query: 51   TCPSCKFPGDQCPLVIGVCHHNFHDHCIYRWLDTPTSKGLCPMCR 95
            +CP C   G      I  C H F   CI+ WL    S   CPMC+
Sbjct: 1153 SCPIC--LGKITMGAIIKCGHFFCRSCIHSWLKNHNS---CPMCK 1192

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.325    0.139    0.458 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 16,964,579
Number of extensions: 624272
Number of successful extensions: 2449
Number of sequences better than 10.0: 242
Number of HSP's gapped: 2464
Number of HSP's successfully gapped: 243
Length of query: 165
Length of database: 53,481,399
Length adjustment: 101
Effective length of query: 64
Effective length of database: 41,900,133
Effective search space: 2681608512
Effective search space used: 2681608512
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 61 (28.1 bits)