Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Smik_4.2223.187ON63633297e-42
Skud_4.2413.187ON106631434e-13
YDL012C3.187ON107631305e-11
Suva_4.2373.187ON103611081e-07
NCAS0I019003.187ON9320700.039
Kwal_YGOB_Anc_3.1873.187ON11221640.37
Skud_8.1982.102ON51730630.56
Ecym_82918.608ON40115592.0
YGR136W (LSB1)3.501ON24157582.6
Suva_7.4243.501ON24918582.7
CAGL0I04510g3.187ON11621573.7
TDEL0A055308.608ON41811565.3
ZYRO0F10802g8.608ON41629565.5
ADL266C8.608ON45219557.1
Smik_6.2323.501ON24162557.8
NOTE: 17 genes in the same pillar as Smik_4.222 were not hit in these BLAST results
LIST: Kpol_1036.51 ZYRO0A04972g CAGL0K01903g TBLA0B01680 TBLA0F00730 KAFR0C00880 YBR016W KNAG0K01285 KLTH0E15840g AER212W TDEL0D04340 Smik_2.135 Suva_2.144 Ecym_5263 Klac_YGOB_Anc_3.187 Skud_2.128 SAKL0C08008g

BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Smik_4.222
         (63 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Smik_4.222 Chr4 complement(413282..413401,413405..413416,413420....   131   7e-42
Skud_4.241 Chr4 complement(425844..426119,426211..426255) [321 b...    60   4e-13
YDL012C Chr4 complement(431108..431386,431473..431517) [324 bp, ...    55   5e-11
Suva_4.237 Chr4 complement(424387..424653,424741..424785) [312 b...    46   1e-07
NCAS0I01900 Chr9 (349882..350163) [282 bp, 93 aa] {ON} Anc_3.187...    32   0.039
Kwal_YGOB_Anc_3.187 s27 complement(77867..78157,78226..78273) [3...    29   0.37 
Skud_8.198 Chr8 (349159..350712) [1554 bp, 517 aa] {ON} YHR137W ...    29   0.56 
Ecym_8291 Chr8 (592981..594186) [1206 bp, 401 aa] {ON} similar t...    27   2.0  
YGR136W Chr7 (762428..763153) [726 bp, 241 aa] {ON}  LSB1Protein...    27   2.6  
Suva_7.424 Chr7 (732619..733368) [750 bp, 249 aa] {ON} YGR136W (...    27   2.7  
CAGL0I04510g Chr9 complement(403225..403527,403675..403722) [351...    27   3.7  
TDEL0A05530 Chr1 (972948..974204) [1257 bp, 418 aa] {ON} Anc_8.6...    26   5.3  
ZYRO0F10802g Chr6 (882144..883394) [1251 bp, 416 aa] {ON} simila...    26   5.5  
ADL266C Chr4 complement(235644..237002) [1359 bp, 452 aa] {ON} S...    26   7.1  
Smik_6.232 Chr6 (380319..381044) [726 bp, 241 aa] {ON} YGR136W (...    26   7.8  

>Smik_4.222 Chr4
          complement(413282..413401,413405..413416,
          413420..413476) [189 bp, 63 aa] {ON} YDL012C (REAL)
          Length = 63

 Score =  131 bits (329), Expect = 7e-42,   Method: Compositional matrix adjust.
 Identities = 63/63 (100%), Positives = 63/63 (100%)

Query: 1  MSAQDYYGNSTSKQSVGLFEFYFTDHVLLTNPCILTASRSFQYSRPTAPPPGYETGSRGY 60
          MSAQDYYGNSTSKQSVGLFEFYFTDHVLLTNPCILTASRSFQYSRPTAPPPGYETGSRGY
Sbjct: 1  MSAQDYYGNSTSKQSVGLFEFYFTDHVLLTNPCILTASRSFQYSRPTAPPPGYETGSRGY 60

Query: 61 APA 63
          APA
Sbjct: 61 APA 63

>Skud_4.241 Chr4 complement(425844..426119,426211..426255) [321
          bp, 106 aa] {ON} YDL012C (REAL)
          Length = 106

 Score = 59.7 bits (143), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 35/63 (55%), Positives = 36/63 (57%), Gaps = 27/63 (42%)

Query: 1  MSAQDYYGNSTSKQSVGLFEFYFTDHVLLTNPCILTASRSFQYSRPTAPPPGYETGSRGY 60
          MSAQDYYGNSTSKQS                           YSRPTAPPPGYETG+RGY
Sbjct: 1  MSAQDYYGNSTSKQS---------------------------YSRPTAPPPGYETGARGY 33

Query: 61 APA 63
          APA
Sbjct: 34 APA 36

>YDL012C Chr4 complement(431108..431386,431473..431517) [324 bp,
          107 aa] {ON} Tail-anchored plasma membrane protein
          containing a conserved CYSTM module, possibly involved
          in response to stress; may contribute to non-homologous
          end-joining (NHEJ) based on ydl012c htz1 double null
          phenotype
          Length = 107

 Score = 54.7 bits (130), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 32/63 (50%), Positives = 34/63 (53%), Gaps = 27/63 (42%)

Query: 1  MSAQDYYGNSTSKQSVGLFEFYFTDHVLLTNPCILTASRSFQYSRPTAPPPGYETGSRGY 60
          MSAQDYYGNS SKQS                           YSRP+APPPGYET SRGY
Sbjct: 1  MSAQDYYGNSASKQS---------------------------YSRPSAPPPGYETASRGY 33

Query: 61 APA 63
          AP+
Sbjct: 34 APS 36

>Suva_4.237 Chr4 complement(424387..424653,424741..424785) [312
          bp, 103 aa] {ON} YDL012C (REAL)
          Length = 103

 Score = 46.2 bits (108), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 28/61 (45%), Positives = 30/61 (49%), Gaps = 27/61 (44%)

Query: 1  MSAQDYYGNSTSKQSVGLFEFYFTDHVLLTNPCILTASRSFQYSRPTAPPPGYETGSRGY 60
          MSAQDYYGNS  KQS                           YS PTAPPPGYE+G RG+
Sbjct: 1  MSAQDYYGNSAYKQS---------------------------YSHPTAPPPGYESGPRGF 33

Query: 61 A 61
          A
Sbjct: 34 A 34

>NCAS0I01900 Chr9 (349882..350163) [282 bp, 93 aa] {ON} Anc_3.187
          YBR016W
          Length = 93

 Score = 31.6 bits (70), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 13/20 (65%), Positives = 17/20 (85%), Gaps = 1/20 (5%)

Query: 41 FQYSRPTAPPPGYET-GSRG 59
           QYSRP+ PPPG+E+ G+RG
Sbjct: 1  MQYSRPSVPPPGHESQGTRG 20

>Kwal_YGOB_Anc_3.187 s27 complement(77867..78157,78226..78273)
          [339 bp, 112 aa] {ON} ANNOTATED BY YGOB -
          Length = 112

 Score = 29.3 bits (64), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 11/21 (52%), Positives = 15/21 (71%)

Query: 42 QYSRPTAPPPGYETGSRGYAP 62
          QY+ P+ PPPG++  SRG  P
Sbjct: 16 QYTSPSGPPPGHQQDSRGILP 36

>Skud_8.198 Chr8 (349159..350712) [1554 bp, 517 aa] {ON} YHR137W
           (REAL)
          Length = 517

 Score = 28.9 bits (63), Expect = 0.56,   Method: Composition-based stats.
 Identities = 13/30 (43%), Positives = 17/30 (56%)

Query: 22  YFTDHVLLTNPCILTASRSFQYSRPTAPPP 51
           + T H+ L +P  L  SRSFQY+     PP
Sbjct: 81  FTTAHLDLDSPSELPMSRSFQYAESKGTPP 110

>Ecym_8291 Chr8 (592981..594186) [1206 bp, 401 aa] {ON} similar to
          Ashbya gossypii ADL266C
          Length = 401

 Score = 27.3 bits (59), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 10/15 (66%), Positives = 12/15 (80%)

Query: 42 QYSRPTAPPPGYETG 56
          +YSRP  PPPGY+ G
Sbjct: 43 EYSRPPVPPPGYDGG 57

>YGR136W Chr7 (762428..763153) [726 bp, 241 aa] {ON}  LSB1Protein
           containing an N-terminal SH3 domain; binds Las17p, which
           is a homolog of human Wiskott-Aldrich Syndrome protein
           involved in actin patch assembly and actin
           polymerization
          Length = 241

 Score = 26.9 bits (58), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 18/57 (31%), Positives = 26/57 (45%), Gaps = 4/57 (7%)

Query: 6   YYGNSTSKQSVGLFEFYFTDHVLL--TNPCILTASRSFQYSRPTAPPPGYETGSRGY 60
           Y G S +K  +G+F   +         +P    A+ S   SRP+ PPP YE  +  Y
Sbjct: 91  YRGKSNNK--IGIFPANYVKPAFTRSASPKSAEAASSSTVSRPSVPPPSYEPAASQY 145

>Suva_7.424 Chr7 (732619..733368) [750 bp, 249 aa] {ON} YGR136W
           (REAL)
          Length = 249

 Score = 26.9 bits (58), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 12/18 (66%), Positives = 14/18 (77%)

Query: 37  ASRSFQYSRPTAPPPGYE 54
           AS S + SRP+APPP YE
Sbjct: 122 ASLSSKVSRPSAPPPSYE 139

>CAGL0I04510g Chr9 complement(403225..403527,403675..403722) [351
          bp, 116 aa] {ON} similar to uniprot|P38216
          Saccharomyces cerevisiae YBR016w and similar to
          uniprot|Q12489 Saccharomyces cerevisiae YDL012c
          Length = 116

 Score = 26.6 bits (57), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 14/21 (66%), Positives = 14/21 (66%), Gaps = 3/21 (14%)

Query: 42 QYSRPTAPPPGYETG---SRG 59
          QYSRPTAPPP    G   SRG
Sbjct: 16 QYSRPTAPPPSQGQGKDSSRG 36

>TDEL0A05530 Chr1 (972948..974204) [1257 bp, 418 aa] {ON}
          Anc_8.608 YOR197W
          Length = 418

 Score = 26.2 bits (56), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 10/11 (90%), Positives = 10/11 (90%)

Query: 42 QYSRPTAPPPG 52
          QYSRP APPPG
Sbjct: 52 QYSRPAAPPPG 62

 Score = 25.8 bits (55), Expect = 9.1,   Method: Compositional matrix adjust.
 Identities = 14/24 (58%), Positives = 15/24 (62%), Gaps = 4/24 (16%)

Query: 43 YSRPTAPPPGY----ETGSRGYAP 62
          YSRP APPPG+    E  SR  AP
Sbjct: 36 YSRPAAPPPGFYEQQEQYSRPAAP 59

>ZYRO0F10802g Chr6 (882144..883394) [1251 bp, 416 aa] {ON} similar
          to uniprot|Q08601 Saccharomyces cerevisiae YOR197W MCA1
          Putative cysteine protease similar to mammalian
          caspases
          Length = 416

 Score = 26.2 bits (56), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 11/29 (37%), Positives = 15/29 (51%)

Query: 30 TNPCILTASRSFQYSRPTAPPPGYETGSR 58
          + P +     +  YSRP  PPPG   G+R
Sbjct: 25 SRPPVPPPQETNHYSRPAVPPPGRTAGNR 53

>ADL266C Chr4 complement(235644..237002) [1359 bp, 452 aa] {ON}
          Syntenic homolog of Saccharomyces cerevisiae YOR197W
          (MCA1)
          Length = 452

 Score = 25.8 bits (55), Expect = 7.1,   Method: Compositional matrix adjust.
 Identities = 10/19 (52%), Positives = 12/19 (63%)

Query: 42 QYSRPTAPPPGYETGSRGY 60
          QY RP+ PPPGY     G+
Sbjct: 66 QYERPSCPPPGYAPHQGGF 84

>Smik_6.232 Chr6 (380319..381044) [726 bp, 241 aa] {ON} YGR136W
           (REAL)
          Length = 241

 Score = 25.8 bits (55), Expect = 7.8,   Method: Compositional matrix adjust.
 Identities = 19/62 (30%), Positives = 27/62 (43%), Gaps = 7/62 (11%)

Query: 5   DYYGNSTSKQSVGLFEFYFTD----HVLLTNPCILTASRSFQYSRPTAPPPGYETGSRGY 60
           D+Y    + + VG+F   +        +LT P       S + SRP+ PPP YE     Y
Sbjct: 89  DWYKGKANNR-VGIFPANYVKPAFTRSVLTKPE--EGDLSSKVSRPSVPPPSYEPAVSQY 145

Query: 61  AP 62
            P
Sbjct: 146 PP 147

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.132    0.403 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 7,127,503
Number of extensions: 218503
Number of successful extensions: 552
Number of sequences better than 10.0: 24
Number of HSP's gapped: 544
Number of HSP's successfully gapped: 25
Length of query: 63
Length of database: 53,481,399
Length adjustment: 36
Effective length of query: 27
Effective length of database: 49,353,423
Effective search space: 1332542421
Effective search space used: 1332542421
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 59 (27.3 bits)