Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Smik_4.2073.162ON76576536260.0
YDL028C (MPS1)3.162ON76476532790.0
Suva_4.2213.162ON76576631180.0
Skud_4.2233.162ON76976930800.0
TDEL0D046003.162ON79579216780.0
NCAS0I020803.162ON77481316440.0
ZYRO0B04906g3.162ON84784216230.0
KAFR0F022203.162ON74776615090.0
Kwal_33.141673.162ON83884215150.0
KLTH0F06468g3.162ON83783614970.0
Kpol_1032.103.162ON79142413111e-169
TPHA0M003003.162ON77435613001e-168
ADR317C3.162ON81943712971e-167
Ecym_52363.162ON86439412921e-166
SAKL0C07348g3.162ON86135712461e-159
NDAI0A066203.162ON74736612101e-155
CAGL0K01617g3.162ON77441212061e-154
TBLA0F008603.162ON98045911981e-150
KLLA0C03828g3.162ON79340111701e-148
KNAG0K017403.162ON76535711151e-140
NCAS0C035603.162ON6413688991e-110
KNAG0E008506.31ON7113262815e-25
Kwal_56.224766.31ON6973132806e-25
KLTH0C10912g6.31ON6973132772e-24
Kpol_1037.206.31ON7043052718e-24
NDAI0C026806.31ON7503052711e-23
TPHA0J004206.31ON7073052664e-23
TBLA0B004906.31ON7873052664e-23
ACL006W6.31ON7083102646e-23
KAFR0G026906.31ON7133362647e-23
KNAG0F002901.52ON11252402649e-23
CAGL0K05709g1.52ON11032352649e-23
TDEL0G043806.31ON7223132621e-22
Ecym_30356.31ON7403102621e-22
CAGL0L12474g8.482ON3023122501e-22
YHR102W (KIC1)5.406ON10802992603e-22
YMR001C (CDC5)6.31ON7053602583e-22
TPHA0C017808.482ON3053142473e-22
Smik_8.1805.406ON10732992593e-22
Skud_8.1635.406ON10763002593e-22
TBLA0A071501.52ON13912422594e-22
SAKL0E01584g6.31ON6953102565e-22
Smik_13.1596.31ON7053612557e-22
Skud_13.1546.31ON7053342558e-22
ZYRO0C07480g6.31ON7743132558e-22
NDAI0C017005.406ON10202982568e-22
KLLA0F24618g3.229ON5562352529e-22
YDR507C (GIN4)1.52ON11422422561e-21
Suva_15.2975.406ON10742992551e-21
TDEL0B015408.482ON3043162421e-21
Skud_16.2518.482ON3052412412e-21
KNAG0A023108.482ON3023172412e-21
Suva_13.1636.31ON7053332522e-21
Smik_4.7891.52ON11362422532e-21
Ecym_25318.482ON3013162412e-21
NCAS0C024708.482ON3113192412e-21
Ecym_61454.184ON3653242433e-21
ZYRO0F08074g8.482ON3043162393e-21
Suva_2.6871.52ON11282422513e-21
KAFR0D049505.406ON10082982513e-21
Skud_4.7643.92ON7562602504e-21
SAKL0B04488g4.184ON3683242424e-21
Suva_16.2868.482ON3052412394e-21
KLTH0E11220g8.482ON3023202384e-21
KLLA0D11990g8.482ON3043202384e-21
YPL031C (PHO85)8.482ON3053192385e-21
SAKL0C01716g1.52ON12152422505e-21
NDAI0A006601.52ON10222422495e-21
YDR490C (PKH1)3.92ON7663302485e-21
TBLA0A035705.406ON9752982487e-21
NCAS0D021006.31ON7262272478e-21
Smik_2.1463.229ON5262462448e-21
SAKL0H11638g8.482ON3043192369e-21
Skud_7.3374.184ON3683212399e-21
ZYRO0A12826g4.184ON3662452391e-20
KAFR0H015308.482ON3063182351e-20
Kpol_1007.178.482ON3073112351e-20
Kpol_2002.461.52ON11232422471e-20
TBLA0I018003.229ON6292492441e-20
CAGL0L11550g5.406ON10722992452e-20
TDEL0D026504.184ON3662452372e-20
Kpol_1023.266.31ON7393052442e-20
NCAS0H019405.406ON10152982452e-20
TPHA0H016305.406ON10363502442e-20
NCAS0B086001.52ON11172422452e-20
KNAG0B043205.406ON10272982442e-20
NDAI0G054701.271ON15553752452e-20
SAKL0G01848g5.406ON8853222442e-20
YBR028C (YPK3)3.229ON5252462403e-20
Skud_2.1413.229ON5262442403e-20
Kpol_499.34.184ON3742462353e-20
Smik_3.541.52ON10322352424e-20
Suva_2.6663.92ON7642532414e-20
Smik_4.7673.92ON7582472414e-20
Skud_4.7831.52ON11352422424e-20
KAFR0D041001.52ON11172432424e-20
Kpol_1031.105.406ON11272982424e-20
KLLA0C06138g6.31ON7082272404e-20
Kpol_463.81.271ON14472932424e-20
TDEL0D039503.229ON4934232384e-20
TBLA0C029401.271ON16433542425e-20
KLTH0D03454g1.271ON14333182425e-20
Smik_6.1254.184ON3683212336e-20
Kpol_1028.166.371ON8793062406e-20
TDEL0C064901.52ON11532422407e-20
KAFR0K007007.86ON13812392407e-20
TPHA0E036401.52ON11372432408e-20
NDAI0D040504.184ON3663242318e-20
ABL034W2.479ON14253262408e-20
TBLA0B016303.177ON12952872399e-20
TPHA0H026307.86ON13672392399e-20
Kpol_1037.523.229ON5122412351e-19
Suva_2.1573.229ON5262452351e-19
ACL104C5.406ON9473052381e-19
Kwal_26.73551.271ON14462462381e-19
TPHA0I009201.271ON14343252381e-19
Kwal_55.215455.406ON8653102372e-19
YGR040W (KSS1)4.184ON3683212292e-19
KLTH0G17512g4.184ON3653192292e-19
TDEL0E021805.406ON9872832362e-19
AFR696C1.52ON11422422372e-19
NCAS0A053706.341ON15083232372e-19
Kwal_56.227883.229ON5153472332e-19
TPHA0M018406.341ON16213192372e-19
NDAI0E031708.482ON3232382262e-19
CAGL0C03509g6.371ON8953212352e-19
KAFR0A014201.271ON13983802362e-19
SAKL0C08844g3.229ON5312482322e-19
Smik_3.1896.371ON7193652343e-19
NCAS0C049403.92ON11162842353e-19
NDAI0F045201.24ON4893152313e-19
KNAG0B017801.271ON15803262353e-19
AER264C6.341ON14833162344e-19
YCR091W (KIN82)6.371ON7204012325e-19
Skud_3.1656.371ON7163142325e-19
ACL191C4.184ON3653242255e-19
CAGL0I07513g3.92ON10762942335e-19
KAFR0E010403.229ON5023102295e-19
KLLA0C01650g1.52ON11122422335e-19
TDEL0D014001.271ON14293842335e-19
NCAS0A055706.371ON9183252326e-19
Suva_7.3254.184ON3683212256e-19
NCAS0A102903.229ON5092462287e-19
ZYRO0F17402g1.52ON11892422327e-19
KNAG0K006803.92ON10953492317e-19
KLTH0F16676g5.406ON8782972318e-19
ZYRO0G15290g1.271ON14872772319e-19
KLLA0A02497g4.184ON3623202231e-18
SAKL0D05522g1.271ON14743252311e-18
YAL017W (PSK1)7.86ON13562322301e-18
KLTH0C08932g3.229ON5193672261e-18
NDAI0K023906.371ON8863062291e-18
CAGL0J11638g6.31ON7462902281e-18
TDEL0A078606.371ON8373232291e-18
Ecym_24996.341ON15413582301e-18
Ecym_10581.52ON11642422291e-18
NDAI0A038702.496ON8953002291e-18
NCAS0A094701.271ON15154072291e-18
Kwal_23.63256.341ON15423132292e-18
Ecym_63441.271ON13973112292e-18
Smik_1.507.86ON13572382282e-18
Kwal_14.14164.184ON3653192212e-18
Ecym_35473.229ON5373152252e-18
KLTH0A06776g6.341ON15233132282e-18
Skud_3.391.52ON10172332272e-18
ZYRO0A03894g3.229ON4522332232e-18
NDAI0E021108.676ON9033162272e-18
AGL242C8.482ON3033232172e-18
TBLA0F002406.371ON12483062273e-18
KLLA0F14190g1.271ON13383532273e-18
NDAI0I002506.371ON8973292263e-18
ZYRO0A06446g5.406ON9432972263e-18
TBLA0D022308.141ON11542382263e-18
NDAI0K021002.496ON9092992263e-18
KNAG0C024401.182ON4012562203e-18
TPHA0G032002.479ON15342412273e-18
TPHA0M020806.371ON8893062253e-18
KLLA0F07623g7.86ON12292392263e-18
Skud_1.447.86ON13562322264e-18
KLTH0F01672g1.52ON11642422264e-18
TDEL0A062208.676ON7942992254e-18
CAGL0K08514g2.479ON14892422254e-18
KAFR0C009303.177ON9363292245e-18
TBLA0A084304.184ON3633202175e-18
KLLA0B11946g3.338ON4393942205e-18
CAGL0B04301g3.229ON5422412225e-18
AEL083W3.229ON5362352216e-18
YNR047W (FPK1)6.371ON8933422246e-18
Smik_11.621.182ON3972522186e-18
KLLA0F11143g8.676ON8133072236e-18
KLTH0C09548g3.92ON9933462246e-18
Suva_1.507.86ON13602382246e-18
NDAI0I003406.341ON18363232246e-18
TPHA0A041703.229ON5132322207e-18
Skud_10.1191.271ON14813242247e-18
Smik_16.2963.338ON3883182178e-18
SAKL0H06534g8.676ON8042902228e-18
KLLA0F13552g2.479ON12673442238e-18
KNAG0J012903.229ON5082392198e-18
Kpol_1040.207.86ON12972392239e-18
Kwal_26.77882.479ON12672792229e-18
KLLA0C04191g3.177ON7972872211e-17
TPHA0F024306.31ON7982912211e-17
Ecym_10301.24ON4402862171e-17
TBLA0A016308.482ON3513392151e-17
NDAI0G042903.92ON11133152221e-17
YPR054W (SMK1)3.338ON3883172161e-17
YOL100W (PKH2)3.92ON10812442221e-17
CAGL0K02673g2.496ON9152372211e-17
Kwal_26.78612.496ON9552992211e-17
CAGL0G04609g3.92ON9652922211e-17
CAGL0M08404g1.182ON4622642171e-17
TBLA0B082503.92ON13472992211e-17
Sklu_YGOB_Anc_2.4962.496ON6192972191e-17
KLLA0E21693g5.406ON10163142211e-17
YKL166C (TPK3)1.182ON3982522151e-17
Suva_3.1901.52ON10242302201e-17
YOL113W (SKM1)3.60ON6552342192e-17
Suva_6.1691.271ON14843212212e-17
ADL315C3.338ON4343462162e-17
TDEL0A075606.341ON15753282212e-17
KAFR0A017602.496ON8852512202e-17
Smik_10.1471.271ON14782902202e-17
Ecym_55055.406ON10033062202e-17
KAFR0H010403.338ON4183322152e-17
Skud_15.1127.86ON11012442202e-17
KAFR0E015805.274ON4293202152e-17
KLLA0C12485g3.92ON9252922192e-17
Suva_15.2165.274ON4753692162e-17
Skud_14.3796.371ON8973422192e-17
CAGL0J00539g5.274ON4883222162e-17
Skud_11.581.182ON3952782132e-17
Kpol_1055.242.496ON9373012192e-17
YOL045W (PSK2)7.86ON11012442192e-17
TPHA0H023906.371ON7303112182e-17
Ecym_34883.338ON4373922142e-17
AFR724C1.24ON4402862142e-17
Kpol_1072.168.676ON7952822182e-17
TBLA0I002802.496ON13162992192e-17
NCAS0I028401.182ON4022872133e-17
Ecym_73922.479ON14342812193e-17
Kwal_26.71547.86ON12132392193e-17
YDR466W (PKH3)5.591ON8982562183e-17
YCL024W (KCC4)1.52ON10372352183e-17
KNAG0D039804.184ON3733222123e-17
YHR030C (SLT2)5.274ON4843732143e-17
NDAI0G034508.141ON9482782183e-17
Suva_11.561.182ON3982502123e-17
KAFR0C047806.371ON7863442164e-17
Smik_1.793.177ON9742812174e-17
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Smik_4.207
         (765 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Smik_4.207 Chr4 complement(381159..383456) [2298 bp, 765 aa] {ON...  1401   0.0  
YDL028C Chr4 complement(400997..403291) [2295 bp, 764 aa] {ON}  ...  1267   0.0  
Suva_4.221 Chr4 complement(391492..393789) [2298 bp, 765 aa] {ON...  1205   0.0  
Skud_4.223 Chr4 complement(395836..398145) [2310 bp, 769 aa] {ON...  1191   0.0  
TDEL0D04600 Chr4 (843530..845917) [2388 bp, 795 aa] {ON} Anc_3.1...   650   0.0  
NCAS0I02080 Chr9 (390551..392875) [2325 bp, 774 aa] {ON} Anc_3.162    637   0.0  
ZYRO0B04906g Chr2 (395546..398089) [2544 bp, 847 aa] {ON} simila...   629   0.0  
KAFR0F02220 Chr6 (432967..435210) [2244 bp, 747 aa] {ON} Anc_3.1...   585   0.0  
Kwal_33.14167 s33 (554863..557379) [2517 bp, 838 aa] {ON} YDL028...   588   0.0  
KLTH0F06468g Chr6 (559256..561769) [2514 bp, 837 aa] {ON} simila...   581   0.0  
Kpol_1032.10 s1032 (24479..26854) [2376 bp, 791 aa] {ON} (24479....   509   e-169
TPHA0M00300 Chr13 (59377..61701) [2325 bp, 774 aa] {ON} Anc_3.16...   505   e-168
ADR317C Chr4 complement(1263080..1265539) [2460 bp, 819 aa] {ON}...   504   e-167
Ecym_5236 Chr5 (486270..488864) [2595 bp, 864 aa] {ON} similar t...   502   e-166
SAKL0C07348g Chr3 (677348..679933) [2586 bp, 861 aa] {ON} some s...   484   e-159
NDAI0A06620 Chr1 complement(1510218..1512461) [2244 bp, 747 aa] ...   470   e-155
CAGL0K01617g Chr11 complement(143308..145632) [2325 bp, 774 aa] ...   469   e-154
TBLA0F00860 Chr6 (219628..222570) [2943 bp, 980 aa] {ON} Anc_3.1...   466   e-150
KLLA0C03828g Chr3 (349187..351568) [2382 bp, 793 aa] {ON} simila...   455   e-148
KNAG0K01740 Chr11 (364195..366492) [2298 bp, 765 aa] {ON} Anc_3....   434   e-140
NCAS0C03560 Chr3 complement(710551..712476) [1926 bp, 641 aa] {O...   350   e-110
KNAG0E00850 Chr5 complement(158992..161127) [2136 bp, 711 aa] {O...   112   5e-25
Kwal_56.22476 s56 complement(145039..147132) [2094 bp, 697 aa] {...   112   6e-25
KLTH0C10912g Chr3 (898372..900465) [2094 bp, 697 aa] {ON} highly...   111   2e-24
Kpol_1037.20 s1037 (41658..43772) [2115 bp, 704 aa] {ON} (41658....   108   8e-24
NDAI0C02680 Chr3 complement(621951..624203) [2253 bp, 750 aa] {O...   108   1e-23
TPHA0J00420 Chr10 complement(96445..98568) [2124 bp, 707 aa] {ON...   107   4e-23
TBLA0B00490 Chr2 complement(94755..97118) [2364 bp, 787 aa] {ON}...   107   4e-23
ACL006W Chr3 (344395..346521) [2127 bp, 708 aa] {ON} Syntenic ho...   106   6e-23
KAFR0G02690 Chr7 complement(555573..557714) [2142 bp, 713 aa] {O...   106   7e-23
KNAG0F00290 Chr6 (31750..35127) [3378 bp, 1125 aa] {ON} Anc_1.52...   106   9e-23
CAGL0K05709g Chr11 complement(556732..560043) [3312 bp, 1103 aa]...   106   9e-23
TDEL0G04380 Chr7 (792278..794446) [2169 bp, 722 aa] {ON} Anc_6.3...   105   1e-22
Ecym_3035 Chr3 complement(70391..72613) [2223 bp, 740 aa] {ON} s...   105   1e-22
CAGL0L12474g Chr12 complement(1347340..1348248) [909 bp, 302 aa]...   100   1e-22
YHR102W Chr8 (316572..319814) [3243 bp, 1080 aa] {ON}  KIC1Prote...   104   3e-22
YMR001C Chr13 complement(269019..271136) [2118 bp, 705 aa] {ON} ...   103   3e-22
TPHA0C01780 Chr3 complement(407048..407965) [918 bp, 305 aa] {ON...   100   3e-22
Smik_8.180 Chr8 (292993..296214) [3222 bp, 1073 aa] {ON} YHR102W...   104   3e-22
Skud_8.163 Chr8 (290415..293645) [3231 bp, 1076 aa] {ON} YHR102W...   104   3e-22
TBLA0A07150 Chr1 (1776160..1780335) [4176 bp, 1391 aa] {ON} Anc_...   104   4e-22
SAKL0E01584g Chr5 complement(121830..123917) [2088 bp, 695 aa] {...   103   5e-22
Smik_13.159 Chr13 complement(260249..262366) [2118 bp, 705 aa] {...   102   7e-22
Skud_13.154 Chr13 complement(255263..257380) [2118 bp, 705 aa] {...   102   8e-22
ZYRO0C07480g Chr3 (565426..567750) [2325 bp, 774 aa] {ON} highly...   102   8e-22
NDAI0C01700 Chr3 complement(367077..370139) [3063 bp, 1020 aa] {...   103   8e-22
KLLA0F24618g Chr6 complement(2288943..2290613) [1671 bp, 556 aa]...   101   9e-22
YDR507C Chr4 complement(1462358..1465786) [3429 bp, 1142 aa] {ON...   103   1e-21
Suva_15.297 Chr15 (518854..520850,520945..522172) [3225 bp, 1074...   102   1e-21
TDEL0B01540 Chr2 complement(272561..273458,273562..273578) [915 ...    98   1e-21
Skud_16.251 Chr16 complement(457106..458006,458108..458124) [918...    97   2e-21
KNAG0A02310 Chr1 complement(216545..217453) [909 bp, 302 aa] {ON...    97   2e-21
Suva_13.163 Chr13 complement(259136..261253) [2118 bp, 705 aa] {...   101   2e-21
Smik_4.789 Chr4 complement(1385209..1388619) [3411 bp, 1136 aa] ...   102   2e-21
Ecym_2531 Chr2 (1034031..1034047,1034135..1035023) [906 bp, 301 ...    97   2e-21
NCAS0C02470 Chr3 complement(460460..461378,461483..461499) [936 ...    97   2e-21
Ecym_6145 Chr6 complement(266766..267863) [1098 bp, 365 aa] {ON}...    98   3e-21
ZYRO0F08074g Chr6 (654009..654025,654107..655004) [915 bp, 304 a...    97   3e-21
Suva_2.687 Chr2 complement(1215095..1218481) [3387 bp, 1128 aa] ...   101   3e-21
KAFR0D04950 Chr4 (971956..974982) [3027 bp, 1008 aa] {ON} Anc_5....   101   3e-21
Skud_4.764 Chr4 complement(1351725..1353995) [2271 bp, 756 aa] {...   100   4e-21
SAKL0B04488g Chr2 (395136..396242) [1107 bp, 368 aa] {ON} highly...    98   4e-21
Suva_16.286 Chr16 complement(495354..496254,496351..496367) [918...    97   4e-21
KLTH0E11220g Chr5 (1005953..1005969,1006040..1006931) [909 bp, 3...    96   4e-21
KLLA0D11990g Chr4 complement(1022895..1023792,1023928..1023944) ...    96   4e-21
YPL031C Chr16 complement(492018..492918,493021..493037) [918 bp,...    96   5e-21
SAKL0C01716g Chr3 (143880..147527) [3648 bp, 1215 aa] {ON} simil...   100   5e-21
NDAI0A00660 Chr1 (121773..124841) [3069 bp, 1022 aa] {ON} Anc_1.52    100   5e-21
YDR490C Chr4 complement(1431968..1434268) [2301 bp, 766 aa] {ON}...   100   5e-21
TBLA0A03570 Chr1 (892930..895857) [2928 bp, 975 aa] {ON} Anc_5.4...   100   7e-21
NCAS0D02100 Chr4 (385878..388058) [2181 bp, 726 aa] {ON} Anc_6.31     100   8e-21
Smik_2.146 Chr2 complement(275270..276850) [1581 bp, 526 aa] {ON...    99   8e-21
SAKL0H11638g Chr8 complement(994049..994946,995016..995032) [915...    96   9e-21
Skud_7.337 Chr7 (562750..563856) [1107 bp, 368 aa] {ON} YGR040W ...    97   9e-21
ZYRO0A12826g Chr1 (1014651..1015751) [1101 bp, 366 aa] {ON} high...    97   1e-20
KAFR0H01530 Chr8 complement(283589..284509) [921 bp, 306 aa] {ON...    95   1e-20
Kpol_1007.17 s1007 (32671..32687,32861..33767) [924 bp, 307 aa] ...    95   1e-20
Kpol_2002.46 s2002 (95107..98478) [3372 bp, 1123 aa] {ON} (95107...   100   1e-20
TBLA0I01800 Chr9 complement(401728..403617) [1890 bp, 629 aa] {O...    99   1e-20
CAGL0L11550g Chr12 (1232015..1235233) [3219 bp, 1072 aa] {ON} si...    99   2e-20
TDEL0D02650 Chr4 complement(505536..506636) [1101 bp, 366 aa] {O...    96   2e-20
Kpol_1023.26 s1023 (51805..54024) [2220 bp, 739 aa] {ON} (51805....    99   2e-20
NCAS0H01940 Chr8 (374913..377960) [3048 bp, 1015 aa] {ON} Anc_5....    99   2e-20
TPHA0H01630 Chr8 (371333..374443) [3111 bp, 1036 aa] {ON} Anc_5....    99   2e-20
NCAS0B08600 Chr2 (1649375..1652728) [3354 bp, 1117 aa] {ON} Anc_...    99   2e-20
KNAG0B04320 Chr2 complement(821265..824348) [3084 bp, 1027 aa] {...    99   2e-20
NDAI0G05470 Chr7 (1340175..1344842) [4668 bp, 1555 aa] {ON} Anc_...    99   2e-20
SAKL0G01848g Chr7 (154547..157204) [2658 bp, 885 aa] {ON} weakly...    99   2e-20
YBR028C Chr2 complement(294425..296002) [1578 bp, 525 aa] {ON}  ...    97   3e-20
Skud_2.141 Chr2 complement(264097..265677) [1581 bp, 526 aa] {ON...    97   3e-20
Kpol_499.3 s499 complement(6075..7199) [1125 bp, 374 aa] {ON} co...    95   3e-20
Smik_3.54 Chr3 (80309..83407) [3099 bp, 1032 aa] {ON} YCL024W (R...    98   4e-20
Suva_2.666 Chr2 complement(1183839..1186133) [2295 bp, 764 aa] {...    97   4e-20
Smik_4.767 Chr4 complement(1353354..1355630) [2277 bp, 758 aa] {...    97   4e-20
Skud_4.783 Chr4 complement(1382552..1385959) [3408 bp, 1135 aa] ...    98   4e-20
KAFR0D04100 Chr4 complement(809681..813034) [3354 bp, 1117 aa] {...    98   4e-20
Kpol_1031.10 s1031 (25064..28447) [3384 bp, 1127 aa] {ON} (25064...    98   4e-20
KLLA0C06138g Chr3 (540409..542535) [2127 bp, 708 aa] {ON} simila...    97   4e-20
Kpol_463.8 s463 complement(18696..23039) [4344 bp, 1447 aa] {ON}...    98   4e-20
TDEL0D03950 Chr4 (720229..721710) [1482 bp, 493 aa] {ON} Anc_3.2...    96   4e-20
TBLA0C02940 Chr3 complement(706091..711022) [4932 bp, 1643 aa] {...    98   5e-20
KLTH0D03454g Chr4 (327039..331340) [4302 bp, 1433 aa] {ON} simil...    98   5e-20
Smik_6.125 Chr6 (201071..202177) [1107 bp, 368 aa] {ON} YGR040W ...    94   6e-20
Kpol_1028.16 s1028 complement(45186..47825) [2640 bp, 879 aa] {O...    97   6e-20
TDEL0C06490 Chr3 complement(1191461..1194922) [3462 bp, 1153 aa]...    97   7e-20
KAFR0K00700 Chr11 complement(153981..158126) [4146 bp, 1381 aa] ...    97   7e-20
TPHA0E03640 Chr5 complement(769962..773375) [3414 bp, 1137 aa] {...    97   8e-20
NDAI0D04050 Chr4 (952438..953538) [1101 bp, 366 aa] {ON} Anc_4.184     94   8e-20
ABL034W Chr2 (333432..337709) [4278 bp, 1425 aa] {ON} Syntenic h...    97   8e-20
TBLA0B01630 Chr2 (360963..364850) [3888 bp, 1295 aa] {ON} Anc_3....    97   9e-20
TPHA0H02630 Chr8 complement(614048..618151) [4104 bp, 1367 aa] {...    97   9e-20
Kpol_1037.52 s1037 complement(128841..130379) [1539 bp, 512 aa] ...    95   1e-19
Suva_2.157 Chr2 complement(275484..277064) [1581 bp, 526 aa] {ON...    95   1e-19
ACL104C Chr3 complement(157357..160200) [2844 bp, 947 aa] {ON} S...    96   1e-19
Kwal_26.7355 s26 (326867..331207) [4341 bp, 1446 aa] {ON} YJL095...    96   1e-19
TPHA0I00920 Chr9 (204753..209057) [4305 bp, 1434 aa] {ON} Anc_1....    96   1e-19
Kwal_55.21545 s55 complement(882294..884891) [2598 bp, 865 aa] {...    96   2e-19
YGR040W Chr7 (575398..576504) [1107 bp, 368 aa] {ON}  KSS1Mitoge...    93   2e-19
KLTH0G17512g Chr7 complement(1518329..1519426) [1098 bp, 365 aa]...    93   2e-19
TDEL0E02180 Chr5 complement(408232..411195) [2964 bp, 987 aa] {O...    96   2e-19
AFR696C Chr6 complement(1722130..1725558) [3429 bp, 1142 aa] {ON...    96   2e-19
NCAS0A05370 Chr1 complement(1061671..1066197) [4527 bp, 1508 aa]...    96   2e-19
Kwal_56.22788 s56 complement(281404..282951) [1548 bp, 515 aa] {...    94   2e-19
TPHA0M01840 Chr13 complement(380953..385818) [4866 bp, 1621 aa] ...    96   2e-19
NDAI0E03170 Chr5 complement(677441..678392,678524..678543) [972 ...    92   2e-19
CAGL0C03509g Chr3 complement(350846..353533) [2688 bp, 895 aa] {...    95   2e-19
KAFR0A01420 Chr1 (276454..280650) [4197 bp, 1398 aa] {ON} Anc_1....    96   2e-19
SAKL0C08844g Chr3 (811712..813307) [1596 bp, 531 aa] {ON} simila...    94   2e-19
Smik_3.189 Chr3 (273885..276044) [2160 bp, 719 aa] {ON} YCR091W ...    95   3e-19
NCAS0C04940 Chr3 (1006185..1009535) [3351 bp, 1116 aa] {ON} Anc_...    95   3e-19
NDAI0F04520 Chr6 complement(1098426..1099895) [1470 bp, 489 aa] ...    94   3e-19
KNAG0B01780 Chr2 (326438..331180) [4743 bp, 1580 aa] {ON} Anc_1....    95   3e-19
AER264C Chr5 complement(1120017..1124468) [4452 bp, 1483 aa] {ON...    95   4e-19
YCR091W Chr3 (274404..276566) [2163 bp, 720 aa] {ON}  KIN82Putat...    94   5e-19
Skud_3.165 Chr3 (258916..261066) [2151 bp, 716 aa] {ON} YCR091W ...    94   5e-19
ACL191C Chr3 complement(26475..27572) [1098 bp, 365 aa] {ON} Syn...    91   5e-19
CAGL0I07513g Chr9 (722045..725275) [3231 bp, 1076 aa] {ON} simil...    94   5e-19
KAFR0E01040 Chr5 complement(214744..216252) [1509 bp, 502 aa] {O...    93   5e-19
KLLA0C01650g Chr3 (128119..131457) [3339 bp, 1112 aa] {ON} simil...    94   5e-19
TDEL0D01400 Chr4 (269367..273656) [4290 bp, 1429 aa] {ON} Anc_1....    94   5e-19
NCAS0A05570 Chr1 (1093653..1096409) [2757 bp, 918 aa] {ON} Anc_6...    94   6e-19
Suva_7.325 Chr7 (550760..551866) [1107 bp, 368 aa] {ON} YGR040W ...    91   6e-19
NCAS0A10290 Chr1 complement(2051582..2053111) [1530 bp, 509 aa] ...    92   7e-19
ZYRO0F17402g Chr6 complement(1445685..1449254) [3570 bp, 1189 aa...    94   7e-19
KNAG0K00680 Chr11 (120919..124206) [3288 bp, 1095 aa] {ON} Anc_3...    94   7e-19
KLTH0F16676g Chr6 complement(1351362..1353998) [2637 bp, 878 aa]...    94   8e-19
ZYRO0G15290g Chr7 complement(1237119..1241582) [4464 bp, 1487 aa...    94   9e-19
KLLA0A02497g Chr1 (218592..219680) [1089 bp, 362 aa] {ON} highly...    91   1e-18
SAKL0D05522g Chr4 (437018..441442) [4425 bp, 1474 aa] {ON} simil...    94   1e-18
YAL017W Chr1 (120225..124295) [4071 bp, 1356 aa] {ON}  PSK1One o...    93   1e-18
KLTH0C08932g Chr3 (749308..750867) [1560 bp, 519 aa] {ON} simila...    92   1e-18
NDAI0K02390 Chr11 (537260..539920) [2661 bp, 886 aa] {ON} Anc_6....    93   1e-18
CAGL0J11638g Chr10 complement(1130744..1132984) [2241 bp, 746 aa...    92   1e-18
TDEL0A07860 Chr1 (1365985..1368498) [2514 bp, 837 aa] {ON} Anc_6...    93   1e-18
Ecym_2499 Chr2 complement(976395..981020) [4626 bp, 1541 aa] {ON...    93   1e-18
Ecym_1058 Chr1 (105835..109329) [3495 bp, 1164 aa] {ON} similar ...    93   1e-18
NDAI0A03870 Chr1 (867910..870597) [2688 bp, 895 aa] {ON} Anc_2.496     93   1e-18
NCAS0A09470 Chr1 complement(1883183..1887730) [4548 bp, 1515 aa]...    93   1e-18
Kwal_23.6325 s23 complement(1533223..1537851) [4629 bp, 1542 aa]...    93   2e-18
Ecym_6344 Chr6 complement(664647..668840) [4194 bp, 1397 aa] {ON...    93   2e-18
Smik_1.50 Chr1 (103132..107205) [4074 bp, 1357 aa] {ON} YAL017W ...    92   2e-18
Kwal_14.1416 s14 (315842..316939) [1098 bp, 365 aa] {ON} YGR040W...    90   2e-18
Ecym_3547 Chr3 complement(1034494..1036107) [1614 bp, 537 aa] {O...    91   2e-18
KLTH0A06776g Chr1 complement(562932..567503) [4572 bp, 1523 aa] ...    92   2e-18
Skud_3.39 Chr3 (66201..69254) [3054 bp, 1017 aa] {ON} YCL024W (R...    92   2e-18
ZYRO0A03894g Chr1 (307915..309273) [1359 bp, 452 aa] {ON} simila...    91   2e-18
NDAI0E02110 Chr5 complement(430989..433700) [2712 bp, 903 aa] {O...    92   2e-18
AGL242C Chr7 complement(246896..247790,247838..247854) [912 bp, ...    88   2e-18
TBLA0F00240 Chr6 complement(45510..49256) [3747 bp, 1248 aa] {ON...    92   3e-18
KLLA0F14190g Chr6 (1311121..1315137) [4017 bp, 1338 aa] {ON} uni...    92   3e-18
NDAI0I00250 Chr9 (42174..44867) [2694 bp, 897 aa] {ON} Anc_3.177...    92   3e-18
ZYRO0A06446g Chr1 complement(513126..515957) [2832 bp, 943 aa] {...    92   3e-18
TBLA0D02230 Chr4 (557816..561280) [3465 bp, 1154 aa] {ON} Anc_8....    92   3e-18
NDAI0K02100 Chr11 complement(469575..472304) [2730 bp, 909 aa] {...    92   3e-18
KNAG0C02440 Chr3 complement(475652..476857) [1206 bp, 401 aa] {O...    89   3e-18
TPHA0G03200 Chr7 (683296..687900) [4605 bp, 1534 aa] {ON} Anc_2....    92   3e-18
TPHA0M02080 Chr13 (426966..429635) [2670 bp, 889 aa] {ON} Anc_6....    91   3e-18
KLLA0F07623g Chr6 (720246..723935) [3690 bp, 1229 aa] {ON} simil...    92   3e-18
Skud_1.44 Chr1 (95573..99643) [4071 bp, 1356 aa] {ON} YAL017W (R...    92   4e-18
KLTH0F01672g Chr6 (127277..130771) [3495 bp, 1164 aa] {ON} simil...    92   4e-18
TDEL0A06220 Chr1 (1088622..1091006) [2385 bp, 794 aa] {ON} Anc_8...    91   4e-18
CAGL0K08514g Chr11 complement(854143..858612) [4470 bp, 1489 aa]...    91   4e-18
KAFR0C00930 Chr3 complement(186877..189687) [2811 bp, 936 aa] {O...    91   5e-18
TBLA0A08430 Chr1 complement(2075682..2076773) [1092 bp, 363 aa] ...    88   5e-18
KLLA0B11946g Chr2 complement(1048033..1049352) [1320 bp, 439 aa]...    89   5e-18
CAGL0B04301g Chr2 (420544..422172) [1629 bp, 542 aa] {ON} simila...    90   5e-18
AEL083W Chr5 (470964..472574) [1611 bp, 536 aa] {ON} Syntenic ho...    90   6e-18
YNR047W Chr14 (708523..711204) [2682 bp, 893 aa] {ON}  FPK1Ser/T...    91   6e-18
Smik_11.62 Chr11 complement(120153..121346) [1194 bp, 397 aa] {O...    89   6e-18
KLLA0F11143g Chr6 complement(1026129..1028570) [2442 bp, 813 aa]...    91   6e-18
KLTH0C09548g Chr3 (792218..795199) [2982 bp, 993 aa] {ON} simila...    91   6e-18
Suva_1.50 Chr1 (96474..100556) [4083 bp, 1360 aa] {ON} YAL017W (...    91   6e-18
NDAI0I00340 Chr9 (65047..70557) [5511 bp, 1836 aa] {ON} Anc_6.341      91   6e-18
TPHA0A04170 Chr1 (937692..939233) [1542 bp, 513 aa] {ON} Anc_3.2...    89   7e-18
Skud_10.119 Chr10 (215299..219744) [4446 bp, 1481 aa] {ON} YJL09...    91   7e-18
Smik_16.296 Chr16 (542962..544128) [1167 bp, 388 aa] {ON} YPR054...    88   8e-18
SAKL0H06534g Chr8 complement(575439..577853) [2415 bp, 804 aa] {...    90   8e-18
KLLA0F13552g Chr6 complement(1252906..1256709) [3804 bp, 1267 aa...    91   8e-18
KNAG0J01290 Chr10 complement(230493..232019) [1527 bp, 508 aa] {...    89   8e-18
Kpol_1040.20 s1040 (57057..60950) [3894 bp, 1297 aa] {ON} (57057...    91   9e-18
Kwal_26.7788 s26 (511530..515333) [3804 bp, 1267 aa] {ON} YKL101...    90   9e-18
KLLA0C04191g Chr3 (384198..386591) [2394 bp, 797 aa] {ON} weakly...    90   1e-17
TPHA0F02430 Chr6 complement(535865..538261) [2397 bp, 798 aa] {O...    90   1e-17
Ecym_1030 Chr1 (56043..57365) [1323 bp, 440 aa] {ON} similar to ...    88   1e-17
TBLA0A01630 Chr1 complement(385348..386386,386496..386512) [1056...    87   1e-17
NDAI0G04290 Chr7 complement(1030530..1033871) [3342 bp, 1113 aa]...    90   1e-17
YPR054W Chr16 (666280..667446) [1167 bp, 388 aa] {ON}  SMK1Middl...    88   1e-17
YOL100W Chr15 (129237..132482) [3246 bp, 1081 aa] {ON}  PKH2Seri...    90   1e-17
CAGL0K02673g Chr11 complement(241338..244085) [2748 bp, 915 aa] ...    90   1e-17
Kwal_26.7861 s26 complement(544126..546993) [2868 bp, 955 aa] {O...    90   1e-17
CAGL0G04609g Chr7 complement(437162..440059) [2898 bp, 965 aa] {...    90   1e-17
CAGL0M08404g Chr13 complement(836791..838179) [1389 bp, 462 aa] ...    88   1e-17
TBLA0B08250 Chr2 complement(1968879..1972922) [4044 bp, 1347 aa]...    90   1e-17
Sklu_YGOB_Anc_2.496 Chr5 (185447..187306) [1860 bp, 619 aa] {ON}...    89   1e-17
KLLA0E21693g Chr5 complement(1936438..1939488) [3051 bp, 1016 aa...    90   1e-17
YKL166C Chr11 complement(134509..135705) [1197 bp, 398 aa] {ON} ...    87   1e-17
Suva_3.190 Chr3 (288639..288813,288870..291766) [3072 bp, 1024 a...    89   1e-17
YOL113W Chr15 (104326..106293) [1968 bp, 655 aa] {ON}  SKM1Membe...    89   2e-17
Suva_6.169 Chr6 complement(300200..304654) [4455 bp, 1484 aa] {O...    90   2e-17
ADL315C Chr4 complement(146096..147400) [1305 bp, 434 aa] {ON} S...    88   2e-17
TDEL0A07560 Chr1 complement(1316498..1321225) [4728 bp, 1575 aa]...    90   2e-17
KAFR0A01760 Chr1 complement(363462..366119) [2658 bp, 885 aa] {O...    89   2e-17
Smik_10.147 Chr10 (239101..243537) [4437 bp, 1478 aa] {ON} YJL09...    89   2e-17
Ecym_5505 Chr5 (1027605..1030616) [3012 bp, 1003 aa] {ON} simila...    89   2e-17
KAFR0H01040 Chr8 complement(189604..190860) [1257 bp, 418 aa] {O...    87   2e-17
Skud_15.112 Chr15 (202308..205613) [3306 bp, 1101 aa] {ON} YOL04...    89   2e-17
KAFR0E01580 Chr5 (318991..320280) [1290 bp, 429 aa] {ON} Anc_5.2...    87   2e-17
KLLA0C12485g Chr3 (1060167..1062944) [2778 bp, 925 aa] {ON} simi...    89   2e-17
Suva_15.216 Chr15 complement(376197..377624) [1428 bp, 475 aa] {...    88   2e-17
Skud_14.379 Chr14 (677081..679774) [2694 bp, 897 aa] {ON} YNR047...    89   2e-17
CAGL0J00539g Chr10 (47095..48561) [1467 bp, 488 aa] {ON} highly ...    88   2e-17
Skud_11.58 Chr11 complement(120855..122042) [1188 bp, 395 aa] {O...    87   2e-17
Kpol_1055.24 s1055 complement(57430..60243) [2814 bp, 937 aa] {O...    89   2e-17
YOL045W Chr15 (243497..246802) [3306 bp, 1101 aa] {ON}  PSK2One ...    89   2e-17
TPHA0H02390 Chr8 (561244..563436) [2193 bp, 730 aa] {ON} Anc_6.3...    89   2e-17
Ecym_3488 Chr3 complement(915087..916400) [1314 bp, 437 aa] {ON}...    87   2e-17
AFR724C Chr6 complement(1770338..1771660) [1323 bp, 440 aa] {ON}...    87   2e-17
Kpol_1072.16 s1072 complement(37585..39972) [2388 bp, 795 aa] {O...    89   2e-17
TBLA0I00280 Chr9 (42870..46820) [3951 bp, 1316 aa] {ON} Anc_2.49...    89   2e-17
NCAS0I02840 Chr9 (528136..529344) [1209 bp, 402 aa] {ON} Anc_1.2...    87   3e-17
Ecym_7392 Chr7 complement(803240..807544) [4305 bp, 1434 aa] {ON...    89   3e-17
Kwal_26.7154 s26 (237387..241028) [3642 bp, 1213 aa] {ON} YOL045...    89   3e-17
YDR466W Chr4 (1395121..1397817) [2697 bp, 898 aa] {ON}  PKH3Prot...    89   3e-17
YCL024W Chr3 (79162..82275) [3114 bp, 1037 aa] {ON}  KCC4Protein...    89   3e-17
KNAG0D03980 Chr4 (721049..722170) [1122 bp, 373 aa] {ON} Anc_4.1...    86   3e-17
YHR030C Chr8 complement(168890..170344) [1455 bp, 484 aa] {ON}  ...    87   3e-17
NDAI0G03450 Chr7 (822716..825562) [2847 bp, 948 aa] {ON} Anc_8.141     89   3e-17
Suva_11.56 Chr11 complement(119479..120675) [1197 bp, 398 aa] {O...    86   3e-17
KAFR0C04780 Chr3 (948771..951131) [2361 bp, 786 aa] {ON} Anc_6.3...    88   4e-17
Smik_1.79 Chr1 complement(149839..152763) [2925 bp, 974 aa] {ON}...    88   4e-17
NDAI0A07190 Chr1 (1636773..1638380) [1608 bp, 535 aa] {ON} Anc_3...    87   4e-17
SAKL0C09174g Chr3 complement(833618..836833) [3216 bp, 1071 aa] ...    88   4e-17
ZYRO0B06512g Chr2 complement(521075..524410) [3336 bp, 1111 aa] ...    88   4e-17
Suva_15.124 Chr15 (215781..219101) [3321 bp, 1106 aa] {ON} YOL04...    88   4e-17
NCAS0A02120 Chr1 (401097..402230) [1134 bp, 377 aa] {ON} Anc_4.184     86   4e-17
Smik_3.173 Chr3 complement(242285..246307) [4023 bp, 1340 aa] {O...    88   4e-17
AFR092W Chr6 (595092..599363) [4272 bp, 1423 aa] {ON} Syntenic h...    88   4e-17
Skud_4.742 Chr4 (1315170..1317881) [2712 bp, 903 aa] {ON} YDR466...    88   4e-17
Kpol_431.9 s431 complement(22310..26968) [4659 bp, 1552 aa] {ON}...    88   4e-17
NCAS0D04710 Chr4 complement(901442..903856) [2415 bp, 804 aa] {O...    88   4e-17
KLTH0D06006g Chr4 complement(532589..535453) [2865 bp, 954 aa] {...    88   4e-17
Skud_1.72 Chr1 (141337..144261) [2925 bp, 974 aa] {ON} YAR019C (...    88   4e-17
Smik_14.377 Chr14 (666338..669025) [2688 bp, 895 aa] {ON} YNR047...    88   5e-17
NCAS0F01580 Chr6 complement(313801..317949) [4149 bp, 1382 aa] {...    88   5e-17
KNAG0I02670 Chr9 complement(524008..526734) [2727 bp, 908 aa] {O...    88   5e-17
Smik_8.97 Chr8 complement(148421..149857) [1437 bp, 478 aa] {ON}...    87   5e-17
CAGL0L03520g Chr12 complement(403100..407443) [4344 bp, 1447 aa]...    88   5e-17
TDEL0C03710 Chr3 (653934..655169) [1236 bp, 411 aa] {ON} Anc_1.1...    86   5e-17
Skud_3.146 Chr3 complement(227229..231233) [4005 bp, 1334 aa] {O...    88   5e-17
ZYRO0D17468g Chr4 (1439376..1441958) [2583 bp, 860 aa] {ON} weak...    87   5e-17
KNAG0D00390 Chr4 (53459..58429) [4971 bp, 1656 aa] {ON} Anc_6.34...    88   5e-17
KLLA0B07205g Chr2 complement(624606..625973) [1368 bp, 455 aa] {...    86   5e-17
Smik_6.350 Chr6 (559997..562465) [2469 bp, 822 aa] {ON} YPL153C ...    87   5e-17
YJL095W Chr10 (247255..251691) [4437 bp, 1478 aa] {ON}  BCK1Mito...    88   6e-17
Skud_10.50 Chr10 complement(84697..85890) [1194 bp, 397 aa] {ON}...    86   6e-17
TDEL0A02550 Chr1 (457841..461950) [4110 bp, 1369 aa] {ON} Anc_2....    88   6e-17
KAFR0C03010 Chr3 (598970..601342) [2373 bp, 790 aa] {ON} Anc_8.1...    87   6e-17
Skud_8.86 Chr8 complement(149508..150953) [1446 bp, 481 aa] {ON}...    86   7e-17
Suva_2.642 Chr2 (1147428..1148865,1149541..1150805) [2703 bp, 90...    87   7e-17
NDAI0H02470 Chr8 complement(597707..601942) [4236 bp, 1411 aa] {...    87   7e-17
NCAS0A05770 Chr1 (1132854..1137239) [4386 bp, 1461 aa] {ON} Anc_...    87   7e-17
TPHA0M01500 Chr13 (317999..319291) [1293 bp, 430 aa] {ON} Anc_3....    86   7e-17
CAGL0K02167g Chr11 complement(192297..195785) [3489 bp, 1162 aa]...    87   7e-17
Skud_16.340 Chr16 (631100..632266) [1167 bp, 388 aa] {ON} YPR054...    85   8e-17
YJL164C Chr10 complement(109966..111159) [1194 bp, 397 aa] {ON} ...    85   8e-17
SAKL0B09856g Chr2 complement(830531..834355) [3825 bp, 1274 aa] ...    87   9e-17
NCAS0A00280 Chr1 (40406..42013) [1608 bp, 535 aa] {ON} Anc_1.24        86   9e-17
ACR142W Chr3 (597519..600032) [2514 bp, 837 aa] {ON} Syntenic ho...    87   9e-17
KAFR0D01220 Chr4 (246927..250094) [3168 bp, 1055 aa] {ON} Anc_7....    87   9e-17
TBLA0H01330 Chr8 complement(297718..299163) [1446 bp, 481 aa] {O...    86   9e-17
Smik_15.122 Chr15 (209665..212970) [3306 bp, 1101 aa] {ON} YOL04...    87   9e-17
CAGL0D01694g Chr4 complement(176981..178279) [1299 bp, 432 aa] {...    85   9e-17
Smik_10.66 Chr10 complement(108043..109236) [1194 bp, 397 aa] {O...    85   1e-16
YAR019C Chr1 complement(172211..175135) [2925 bp, 974 aa] {ON}  ...    87   1e-16
TBLA0C05830 Chr3 complement(1408930..1410210) [1281 bp, 426 aa] ...    85   1e-16
TPHA0G03290 Chr7 (702953..705874) [2922 bp, 973 aa] {ON} Anc_2.4...    87   1e-16
KNAG0A06540 Chr1 (1002435..1006733) [4299 bp, 1432 aa] {ON} Anc_...    87   1e-16
Kpol_541.49 s541 complement(156530..159514) [2985 bp, 994 aa] {O...    87   1e-16
TBLA0I01150 Chr9 complement(235187..240424) [5238 bp, 1745 aa] {...    87   1e-16
NCAS0B08280 Chr2 (1579804..1581033) [1230 bp, 409 aa] {ON} Anc_1...    85   1e-16
KLLA0B11902g Chr2 (1041657..1043144) [1488 bp, 495 aa] {ON} unip...    86   1e-16
Kwal_56.22693 s56 complement(239982..242936) [2955 bp, 984 aa] {...    87   1e-16
KNAG0B05350 Chr2 complement(1034166..1036676) [2511 bp, 836 aa] ...    86   1e-16
TDEL0D05320 Chr4 complement(965082..968255) [3174 bp, 1057 aa] {...    87   1e-16
Kwal_56.23841 s56 (732202..733500) [1299 bp, 432 aa] {ON} YLR113...    85   1e-16
KAFR0D03390 Chr4 (667896..670292) [2397 bp, 798 aa] {ON} Anc_2.4...    86   1e-16
KAFR0F01800 Chr6 complement(350480..351754) [1275 bp, 424 aa] {O...    85   1e-16
AEL115C Chr5 complement(405062..406222) [1161 bp, 386 aa] {ON} S...    84   1e-16
KLLA0B12716g Chr2 (1109939..1112089) [2151 bp, 716 aa] {ON} simi...    86   1e-16
NDAI0D01620 Chr4 (386654..388132) [1479 bp, 492 aa] {ON} Anc_5.274     85   2e-16
CAGL0H07535g Chr8 (736241..737137) [897 bp, 298 aa] {ON} highly ...    83   2e-16
TBLA0H01660 Chr8 complement(377521..380511) [2991 bp, 996 aa] {O...    86   2e-16
NCAS0D04600 Chr4 (875553..880604) [5052 bp, 1683 aa] {ON} Anc_6....    86   2e-16
Ecym_7361 Chr7 complement(753862..755313) [1452 bp, 483 aa] {ON}...    85   2e-16
Suva_6.245 Chr6 (438131..439315) [1185 bp, 394 aa] {ON} YJL164C ...    84   2e-16
KLLA0C08525g Chr3 (744554..749209) [4656 bp, 1551 aa] {ON} simil...    86   2e-16
NCAS0A05050 Chr1 complement(1002107..1004788) [2682 bp, 893 aa] ...    86   2e-16
YPL153C Chr16 complement(261727..264192) [2466 bp, 821 aa] {ON} ...    86   2e-16
Skud_16.129 Chr16 complement(233341..235824) [2484 bp, 827 aa] {...    86   2e-16
KNAG0K01240 Chr11 (243154..246096) [2943 bp, 980 aa] {ON} Anc_3....    86   2e-16
KLTH0G12738g Chr7 complement(1085500..1086804) [1305 bp, 434 aa]...    84   2e-16
KAFR0C01440 Chr3 complement(295468..298755) [3288 bp, 1095 aa] {...    86   2e-16
Kpol_2002.75 s2002 complement(168123..169394) [1272 bp, 423 aa] ...    84   2e-16
YNR031C Chr14 complement(680694..685433) [4740 bp, 1579 aa] {ON}...    86   2e-16
Kwal_33.13112 s33 (76807..78324) [1518 bp, 505 aa] {ON} YDR523C ...    85   2e-16
TDEL0A02720 Chr1 complement(491618..494365) [2748 bp, 915 aa] {O...    86   2e-16
Suva_16.382 Chr16 (673009..674205) [1197 bp, 398 aa] {ON} YPR054...    84   2e-16
KLTH0A07458g Chr1 (620459..623080) [2622 bp, 873 aa] {ON} simila...    86   2e-16
ZYRO0B01166g Chr2 complement(97168..100059) [2892 bp, 963 aa] {O...    86   3e-16
NDAI0C03900 Chr3 complement(883841..885310) [1470 bp, 489 aa] {O...    84   3e-16
KAFR0F03900 Chr6 (763094..764203) [1110 bp, 369 aa] {ON} Anc_4.1...    83   3e-16
Ecym_3586 Chr3 complement(1112070..1115303) [3234 bp, 1077 aa] {...    86   3e-16
Skud_8.39 Chr8 complement(76730..79501) [2772 bp, 923 aa] {ON} Y...    85   3e-16
Smik_15.57 Chr15 (92331..95576) [3246 bp, 1081 aa] {ON} YOL100W ...    86   3e-16
ZYRO0D08184g Chr4 (706856..711601) [4746 bp, 1581 aa] {ON} simil...    86   3e-16
TPHA0B02440 Chr2 (560189..561592) [1404 bp, 467 aa] {ON} Anc_5.2...    84   3e-16
TDEL0C06780 Chr3 complement(1236767..1238173) [1407 bp, 468 aa] ...    84   3e-16
TBLA0A06670 Chr1 complement(1630701..1632023) [1323 bp, 440 aa] ...    84   3e-16
KAFR0G01200 Chr7 (273238..274761) [1524 bp, 507 aa] {ON} Anc_1.2...    84   3e-16
Skud_15.54 Chr15 (88576..91824) [3249 bp, 1082 aa] {ON} YOL100W ...    85   3e-16
Kpol_2002.24 s2002 (48405..49868) [1464 bp, 487 aa] {ON} (48405....    84   3e-16
KNAG0A06750 Chr1 (1053919..1056294) [2376 bp, 791 aa] {ON} Anc_2...    85   3e-16
Ecym_5251 Chr5 (522785..525466) [2682 bp, 893 aa] {ON} similar t...    85   3e-16
Kpol_1054.2 s1054 complement(4365..7655) [3291 bp, 1096 aa] {ON}...    85   4e-16
NCAS0A08080 Chr1 complement(1594221..1596092) [1872 bp, 623 aa] ...    84   4e-16
Smik_8.42 Chr8 complement(74075..76894) [2820 bp, 939 aa] {ON} Y...    85   4e-16
Suva_16.157 Chr16 complement(270891..273389) [2499 bp, 832 aa] {...    85   4e-16
SAKL0A01254g Chr1 (119884..124560) [4677 bp, 1558 aa] {ON} simil...    85   4e-16
Suva_14.402 Chr14 (690198..692915) [2718 bp, 905 aa] {ON} YNR047...    85   4e-16
ZYRO0G18502g Chr7 (1528075..1529265) [1191 bp, 396 aa] {ON} simi...    83   4e-16
Kwal_26.8796 s26 (946406..948796) [2391 bp, 796 aa] {ON} YPL153C...    84   4e-16
YHL007C Chr8 complement(95118..97937) [2820 bp, 939 aa] {ON}  ST...    85   5e-16
Smik_16.204 Chr16 complement(369272..370021) [750 bp, 249 aa] {O...    80   5e-16
Suva_15.46 Chr15 (81948..83909) [1962 bp, 653 aa] {ON} YOL113W (...    84   5e-16
CAGL0K07458g Chr11 complement(737165..739279) [2115 bp, 704 aa] ...    84   5e-16
ZYRO0C15862g Chr3 (1239992..1241305) [1314 bp, 437 aa] {ON} simi...    83   5e-16
KLTH0F00946g Chr6 (73412..74950) [1539 bp, 512 aa] {ON} similar ...    84   5e-16
KLLA0C18568g Chr3 (1639958..1642282) [2325 bp, 774 aa] {ON} simi...    84   5e-16
Kwal_33.13846 s33 complement(419630..420757) [1128 bp, 375 aa] {...    82   5e-16
KLLA0B09790g Chr2 complement(855327..856214) [888 bp, 295 aa] {O...    81   5e-16
KNAG0F00170 Chr6 (13778..15409) [1632 bp, 543 aa] {ON} Anc_1.24 ...    84   6e-16
NCAS0I02680 Chr9 (498371..500752) [2382 bp, 793 aa] {ON}               84   6e-16
Skud_11.67 Chr11 complement(135815..137341) [1527 bp, 508 aa] {O...    84   6e-16
Smik_7.92 Chr7 (155049..157742) [2694 bp, 897 aa] {ON} YGL180W (...    84   6e-16
AER223C Chr5 complement(1044971..1047679) [2709 bp, 902 aa] {ON}...    84   6e-16
KLTH0D11242g Chr4 (918232..920619) [2388 bp, 795 aa] {ON} simila...    84   6e-16
Kwal_23.6458 s23 (1592349..1594955) [2607 bp, 868 aa] {ON} YNR04...    84   6e-16
Suva_8.47 Chr8 complement(91615..94557) [2943 bp, 980 aa] {ON} Y...    84   6e-16
Kpol_376.5 s376 (6334..7767) [1434 bp, 477 aa] {ON} (6334..7767)...    83   6e-16
Skud_11.126 Chr11 (235011..239567) [4557 bp, 1518 aa] {ON} YKL10...    84   6e-16
NDAI0A00960 Chr1 complement(197205..198431) [1227 bp, 408 aa] {O...    82   6e-16
Smik_4.745 Chr4 (1316457..1319201) [2745 bp, 914 aa] {ON} YDR466...    84   6e-16
Kpol_1018.65 s1018 (189779..191584) [1806 bp, 601 aa] {ON} (1897...    84   7e-16
NCAS0A12350 Chr1 complement(2446237..2447236,2447319..2448559) [...    84   7e-16
Kwal_23.5576 s23 complement(1223517..1225031) [1515 bp, 504 aa] ...    83   7e-16
KLTH0D05566g Chr4 (498055..501441) [3387 bp, 1128 aa] {ON} weakl...    84   7e-16
TBLA0B03840 Chr2 complement(881914..884490) [2577 bp, 858 aa] {O...    84   7e-16
Kwal_27.11803 s27 (952938..953678) [741 bp, 246 aa] {ON} YPL031C...    80   7e-16
KLLA0F20053g Chr6 (1867209..1868543) [1335 bp, 444 aa] {ON} high...    82   7e-16
TPHA0A01630 Chr1 complement(328040..329347) [1308 bp, 435 aa] {O...    82   8e-16
NCAS0A06680 Chr1 (1320265..1321704) [1440 bp, 479 aa] {ON} Anc_5...    83   8e-16
KLLA0F11319g Chr6 (1042436..1044967) [2532 bp, 843 aa] {ON} simi...    84   8e-16
Ecym_2640 Chr2 complement(1232617..1236594) [3978 bp, 1325 aa] {...    84   8e-16
KLTH0E16126g Chr5 complement(1427208..1429814) [2607 bp, 868 aa]...    84   8e-16
SAKL0H16038g Chr8 complement(1401627..1402931) [1305 bp, 434 aa]...    82   8e-16
KAFR0A07370 Chr1 complement(1487868..1490012) [2145 bp, 714 aa] ...    84   9e-16
NDAI0G02700 Chr7 complement(618268..619611) [1344 bp, 447 aa] {O...    82   9e-16
KLLA0C17160g Chr3 (1498959..1501454) [2496 bp, 831 aa] {ON} simi...    83   1e-15
Ecym_8095 Chr8 (205952..207106) [1155 bp, 384 aa] {ON} similar t...    82   1e-15
Smik_2.300 Chr2 (546211..547107) [897 bp, 298 aa] {ON} YBR160W (...    80   1e-15
Suva_7.82 Chr7 (156049..158751) [2703 bp, 900 aa] {ON} YGL180W (...    83   1e-15
CAGL0M11748g Chr13 (1168856..1170199) [1344 bp, 447 aa] {ON} hig...    82   1e-15
KLTH0E15004g Chr5 (1328930..1330165) [1236 bp, 411 aa] {ON} simi...    82   1e-15
TBLA0A10420 Chr1 (2562614..2564092) [1479 bp, 492 aa] {ON} Anc_5...    82   1e-15
KNAG0G01250 Chr7 complement(280791..283364) [2574 bp, 857 aa] {O...    83   1e-15
NCAS0F01460 Chr6 complement(290441..292465) [2025 bp, 674 aa] {O...    83   1e-15
Kpol_543.55 s543 (126256..127533) [1278 bp, 425 aa] {ON} (126256...    82   1e-15
KLTH0F04840g Chr6 complement(427194..428339) [1146 bp, 381 aa] {...    81   1e-15
Kpol_1060.53 s1060 complement(126120..128330) [2211 bp, 736 aa] ...    83   1e-15
SAKL0C05368g Chr3 complement(510576..511832) [1257 bp, 418 aa] {...    82   1e-15
SAKL0E03608g Chr5 complement(291806..294007) [2202 bp, 733 aa] {...    83   1e-15
YGL180W Chr7 (160065..162758) [2694 bp, 897 aa] {ON}  ATG1Protei...    83   1e-15
Suva_4.411 Chr4 (729465..730361) [897 bp, 298 aa] {ON} YBR160W (...    80   1e-15
KLTH0D04818g Chr4 (439491..441566) [2076 bp, 691 aa] {ON} simila...    83   1e-15
KLTH0G06974g Chr7 (556626..558125) [1500 bp, 499 aa] {ON} highly...    82   1e-15
ZYRO0A05214g Chr1 complement(418443..421268) [2826 bp, 941 aa] {...    83   2e-15
TDEL0E03520 Chr5 (657779..659251) [1473 bp, 490 aa] {ON} Anc_5.2...    82   2e-15
TDEL0B04700 Chr2 (834336..836996) [2661 bp, 886 aa] {ON} Anc_8.1...    83   2e-15
Kwal_47.18233 s47 complement(743846..745642) [1797 bp, 598 aa] {...    82   2e-15
KAFR0J02620 Chr10 complement(502187..504265) [2079 bp, 692 aa] {...    82   2e-15
ZYRO0G16082g Chr7 complement(1320266..1321714) [1449 bp, 482 aa]...    82   2e-15
KNAG0A06140 Chr1 (931737..933437) [1701 bp, 566 aa] {ON} Anc_2.4...    82   2e-15
KNAG0M01450 Chr13 (254622..256061) [1440 bp, 479 aa] {ON}              82   2e-15
KAFR0G00480 Chr7 complement(131066..132268) [1203 bp, 400 aa] {O...    81   2e-15
Skud_14.362 Chr14 complement(648801..653540) [4740 bp, 1579 aa] ...    83   2e-15
KLLA0B13607g Chr2 (1191592..1194561) [2970 bp, 989 aa] {ON} simi...    83   2e-15
SAKL0G06402g Chr7 (535632..537986) [2355 bp, 784 aa] {ON} simila...    82   2e-15
TBLA0I02400 Chr9 complement(548975..554167) [5193 bp, 1730 aa] {...    83   2e-15
TBLA0B02310 Chr2 (539362..541821) [2460 bp, 819 aa] {ON} Anc_3.9...    82   2e-15
SAKL0E02860g Chr5 complement(228726..232859) [4134 bp, 1377 aa] ...    83   2e-15
TBLA0E02790 Chr5 complement(693136..695562) [2427 bp, 808 aa] {O...    82   2e-15
SAKL0G10978g Chr7 (929164..930729) [1566 bp, 521 aa] {ON} highly...    82   2e-15
KNAG0C01060 Chr3 complement(205965..207374) [1410 bp, 469 aa] {O...    82   2e-15
Kwal_27.9763 s27 (54483..57089) [2607 bp, 868 aa] {ON} YAR019C (...    82   2e-15
ZYRO0G03366g Chr7 (261014..265864) [4851 bp, 1616 aa] {ON} simil...    83   2e-15
TPHA0E02840 Chr5 (594381..595589) [1209 bp, 402 aa] {ON} Anc_6.2...    81   2e-15
YBR160W Chr2 (560078..560974) [897 bp, 298 aa] {ON}  CDC28Cataly...    79   2e-15
Kwal_26.7635 s26 (451306..453381) [2076 bp, 691 aa] {ON} YKL126W...    82   2e-15
Skud_7.91 Chr7 (165681..168374) [2694 bp, 897 aa] {ON} YGL180W (...    82   2e-15
TPHA0E03300 Chr5 (703575..704912) [1338 bp, 445 aa] {ON} Anc_1.1...    81   2e-15
Kwal_33.13831 s33 complement(413256..415358) [2103 bp, 700 aa] {...    82   2e-15
YKL101W Chr11 (248920..253476) [4557 bp, 1518 aa] {ON}  HSL1Nim1...    83   2e-15
NDAI0C05340 Chr3 (1236394..1237296) [903 bp, 300 aa] {ON}              79   2e-15
Suva_11.123 Chr11 (235064..239644) [4581 bp, 1526 aa] {ON} YKL10...    82   2e-15
CAGL0J06072g Chr10 complement(574501..576822) [2322 bp, 773 aa] ...    82   3e-15
SAKL0B07304g Chr2 (625541..627007) [1467 bp, 488 aa] {ON} simila...    81   3e-15
Kwal_56.24059 s56 complement(829673..830734) [1062 bp, 353 aa] {...    80   3e-15
KLTH0H04180g Chr8 (381111..382172) [1062 bp, 353 aa] {ON} highly...    80   3e-15
NCAS0A04360 Chr1 (880768..882822) [2055 bp, 684 aa] {ON} Anc_2.446     82   3e-15
KAFR0F04340 Chr6 (848844..853628) [4785 bp, 1594 aa] {ON} Anc_6....    82   3e-15
KLTH0E11924g Chr5 (1059134..1060030) [897 bp, 298 aa] {ON} highl...    79   3e-15
Suva_10.202 Chr10 (380079..381386) [1308 bp, 435 aa] {ON} YLR113...    81   3e-15
KAFR0B02980 Chr2 (623470..624804) [1335 bp, 444 aa] {ON} Anc_8.3...    81   3e-15
Suva_15.65 Chr15 (102271..105513) [3243 bp, 1080 aa] {ON} YOL100...    82   3e-15
Smik_14.360 Chr14 complement(638655..643406) [4752 bp, 1583 aa] ...    82   3e-15
Kwal_27.12559 s27 (1273349..1274593) [1245 bp, 414 aa] {ON} YPR0...    80   3e-15
Skud_12.181 Chr12 (354407..355702) [1296 bp, 431 aa] {ON} YLR113...    80   3e-15
KAFR0D03200 Chr4 (628993..633339) [4347 bp, 1448 aa] {ON} Anc_2....    82   4e-15
NCAS0C04100 Chr3 (834997..837714) [2718 bp, 905 aa] {ON} Anc_8.141     82   4e-15
SAKL0C00946g Chr3 (84995..86689) [1695 bp, 564 aa] {ON} similar ...    81   4e-15
Ecym_6040 Chr6 complement(77854..80544) [2691 bp, 896 aa] {ON} s...    82   4e-15
Ecym_2397 Chr2 complement(771343..773961) [2619 bp, 872 aa] {ON}...    82   4e-15
CAGL0L06006g Chr12 complement(672704..675532) [2829 bp, 942 aa] ...    82   4e-15
KAFR0C04590 Chr3 complement(917915..922321) [4407 bp, 1468 aa] {...    82   4e-15
Ecym_4266 Chr4 complement(564935..566329) [1395 bp, 464 aa] {ON}...    80   4e-15
Smik_12.173 Chr12 (351727..353034) [1308 bp, 435 aa] {ON} YLR113...    80   4e-15
Kpol_1028.40 s1028 (95617..100392) [4776 bp, 1591 aa] {ON} (9561...    82   4e-15
Suva_3.110 Chr3 complement(160016..164146) [4131 bp, 1376 aa] {O...    82   4e-15
CAGL0F00913g Chr6 (97023..100643) [3621 bp, 1206 aa] {ON} simila...    82   4e-15
TDEL0C04800 Chr3 (866157..867467) [1311 bp, 436 aa] {ON} Anc_3.3...    80   4e-15
AGR048C Chr7 complement(807464..808825) [1362 bp, 453 aa] {ON} S...    80   4e-15
CAGL0K06479g Chr11 (637125..640100) [2976 bp, 991 aa] {ON} some ...    82   4e-15
ZYRO0G02530g Chr7 (194463..196577) [2115 bp, 704 aa] {ON} highly...    81   4e-15
NCAS0C03690 Chr3 (741930..744881) [2952 bp, 983 aa] {ON}               81   5e-15
KAFR0D03020 Chr4 (596365..598398) [2034 bp, 677 aa] {ON} Anc_2.4...    81   5e-15
NDAI0A05280 Chr1 complement(1191032..1192342) [1311 bp, 436 aa] ...    80   5e-15
NDAI0H02340 Chr8 complement(568767..570887) [2121 bp, 706 aa] {O...    81   5e-15
TPHA0C00470 Chr3 (81482..83377) [1896 bp, 631 aa] {ON} Anc_5.611...    81   5e-15
KNAG0J01700 Chr10 (309962..312424) [2463 bp, 820 aa] {ON}              81   5e-15
TPHA0D02840 Chr4 (591733..593637) [1905 bp, 634 aa] {ON}               81   5e-15
Ecym_8400 Chr8 complement(825315..828515) [3201 bp, 1066 aa] {ON...    81   5e-15
KAFR0K00330 Chr11 (74162..75283) [1122 bp, 373 aa] {ON} Anc_6.21...    79   6e-15
Smik_11.139 Chr11 (235511..240115) [4605 bp, 1534 aa] {ON} YKL10...    81   6e-15
Suva_14.385 Chr14 complement(661987..666732) [4746 bp, 1581 aa] ...    81   6e-15
KAFR0E01810 Chr5 complement(372094..373524) [1431 bp, 476 aa] {O...    80   6e-15
TPHA0P01050 Chr16 complement(212259..215624) [3366 bp, 1121 aa] ...    81   6e-15
TPHA0J00630 Chr10 (139476..140600) [1125 bp, 374 aa] {ON} Anc_4....    79   6e-15
Kwal_47.18307 s47 complement(776521..778386) [1866 bp, 621 aa] {...    80   6e-15
TPHA0G02480 Chr7 (509815..511860) [2046 bp, 681 aa] {ON} Anc_2.4...    80   6e-15
YCR073C Chr3 complement(242588..246583) [3996 bp, 1331 aa] {ON} ...    81   6e-15
KNAG0H00790 Chr8 complement(124926..126131) [1206 bp, 401 aa] {O...    79   6e-15
CAGL0K04169g Chr11 (384567..385763) [1197 bp, 398 aa] {ON} simil...    79   6e-15
KLLA0E03587g Chr5 complement(323764..325707) [1944 bp, 647 aa] {...    80   7e-15
Suva_4.145 Chr4 complement(268826..270370) [1545 bp, 514 aa] {ON...    80   7e-15
Smik_15.39 Chr15 (72332..74314) [1983 bp, 660 aa] {ON} YOL113W (...    80   7e-15
ACR191C Chr3 complement(680398..683847) [3450 bp, 1149 aa] {ON} ...    81   7e-15
TDEL0H03640 Chr8 complement(600211..603924) [3714 bp, 1237 aa] {...    81   7e-15
TPHA0G02800 Chr7 (597211..598722) [1512 bp, 503 aa] {ON} Anc_2.4...    80   8e-15
ACL054W Chr3 (269703..272621) [2919 bp, 972 aa] {ON} Syntenic ho...    80   8e-15
TBLA0I01370 Chr9 complement(294202..296526) [2325 bp, 774 aa] {O...    80   8e-15
NDAI0B00210 Chr2 (27983..29185) [1203 bp, 400 aa] {ON} Anc_1.182       79   9e-15
TPHA0H00760 Chr8 complement(152442..155384) [2943 bp, 980 aa] {O...    80   9e-15
KLTH0D02486g Chr4 (247566..251237) [3672 bp, 1223 aa] {ON} simil...    80   9e-15
SAKL0H10758g Chr8 complement(930403..931302) [900 bp, 299 aa] {O...    77   9e-15
CAGL0H06259g Chr8 (615045..619055) [4011 bp, 1336 aa] {ON} simil...    80   9e-15
Kwal_26.7552 s26 (416444..417829) [1386 bp, 461 aa] {ON} YKL139W...    79   9e-15
CAGL0I09504g Chr9 (909589..911175) [1587 bp, 528 aa] {ON} simila...    80   9e-15
TDEL0H00890 Chr8 complement(146908..149088) [2181 bp, 726 aa] {O...    80   1e-14
KNAG0G02300 Chr7 (528489..529748) [1260 bp, 419 aa] {ON} Anc_8.3...    79   1e-14
TDEL0A04580 Chr1 (816247..818331) [2085 bp, 694 aa] {ON} Anc_5.5...    80   1e-14
Kpol_513.7 s513 (14160..15050) [891 bp, 296 aa] {ON} (14160..150...    77   1e-14
NCAS0C01370 Chr3 complement(250693..253092) [2400 bp, 799 aa] {O...    80   1e-14
Kpol_1033.55 s1033 (138831..140555,140557..140895) [2064 bp, 687...    80   1e-14
YDL101C Chr4 complement(280307..281848) [1542 bp, 513 aa] {ON}  ...    79   1e-14
KAFR0C05860 Chr3 (1160586..1162520) [1935 bp, 644 aa] {ON} Anc_5...    80   1e-14
ZYRO0D06182g Chr4 complement(529121..530416) [1296 bp, 431 aa] {...    79   1e-14
Skud_5.249 Chr5 complement(400867..404310) [3444 bp, 1147 aa] {O...    80   1e-14
Kwal_YGOB_27.11919 s27 (1003201..1003830,1004866..1005135) [900 ...    77   1e-14
ABL028W Chr2 (345953..348121) [2169 bp, 722 aa] {ON} Syntenic ho...    80   1e-14
TDEL0F00840 Chr6 (144884..146875) [1992 bp, 663 aa] {ON} Anc_2.9...    80   1e-14
TBLA0D00220 Chr4 (52218..54500) [2283 bp, 760 aa] {ON} Anc_2.96 ...    80   1e-14
TPHA0G02910 Chr7 (624676..626727) [2052 bp, 683 aa] {ON} Anc_2.4...    80   1e-14
NCAS0C03380 Chr3 complement(664012..665310) [1299 bp, 432 aa] {O...    79   1e-14
YLR113W Chr12 (371620..372927) [1308 bp, 435 aa] {ON}  HOG1Mitog...    79   1e-14
TBLA0A07460 Chr1 (1848207..1849757) [1551 bp, 516 aa] {ON} Anc_1...    79   1e-14
TBLA0A04720 Chr1 (1168895..1172683) [3789 bp, 1262 aa] {ON} Anc_...    80   1e-14
TPHA0E03850 Chr5 complement(810694..812142) [1449 bp, 482 aa] {O...    79   2e-14
Kpol_1033.50 s1033 complement(126043..127197) [1155 bp, 384 aa] ...    78   2e-14
KAFR0K02490 Chr11 (515669..518356) [2688 bp, 895 aa] {ON} Anc_5....    79   2e-14
KNAG0D01140 Chr4 (192308..193495) [1188 bp, 395 aa] {ON}               78   2e-14
YDR523C Chr4 complement(1485566..1487038) [1473 bp, 490 aa] {ON}...    79   2e-14
SAKL0C06248g Chr3 complement(577990..580185) [2196 bp, 731 aa] {...    79   2e-14
KAFR0E03030 Chr5 (606567..607457) [891 bp, 296 aa] {ON} Anc_8.51...    77   2e-14
NCAS0C04120 Chr3 complement(840008..842755) [2748 bp, 915 aa] {O...    79   2e-14
YKL126W Chr11 (205707..207749) [2043 bp, 680 aa] {ON}  YPK1Serin...    79   2e-14
AFR335C Chr6 complement(1046756..1049857) [3102 bp, 1033 aa] {ON...    79   2e-14
Skud_2.287 Chr2 (527443..528339) [897 bp, 298 aa] {ON} YBR160W (...    77   2e-14
Smik_11.113 Chr11 (191688..193730) [2043 bp, 680 aa] {ON} YMR104...    79   2e-14
KAFR0H02430 Chr8 complement(464446..466800) [2355 bp, 784 aa] {O...    79   2e-14
NCAS0E01150 Chr5 complement(217594..219315) [1722 bp, 573 aa] {O...    79   2e-14
SAKL0E04092g Chr5 complement(326532..327901,327970..327982) [138...    78   2e-14
ZYRO0D05500g Chr4 (473262..477050) [3789 bp, 1262 aa] {ON} weakl...    79   2e-14
Smik_4.803 Chr4 complement(1408345..1409817) [1473 bp, 490 aa] {...    78   2e-14
Suva_2.651 Chr2 (1164264..1166165) [1902 bp, 633 aa] {ON} YDR477...    79   2e-14
KNAG0A03900 Chr1 complement(520500..521390) [891 bp, 296 aa] {ON...    76   2e-14
KAFR0A05090 Chr1 (1011918..1013924) [2007 bp, 668 aa] {ON}             79   2e-14
TBLA0A02030 Chr1 complement(491365..492576) [1212 bp, 403 aa] {O...    77   2e-14
Kpol_183.1 s183 (158..2257) [2100 bp, 699 aa] {ON} (158..2257) [...    79   2e-14
AER232C Chr5 complement(1066272..1067981) [1710 bp, 569 aa] {ON}...    79   2e-14
SAKL0G06952g Chr7 (570584..572383) [1800 bp, 599 aa] {ON} simila...    79   2e-14
ZYRO0C06776g Chr3 complement(508813..511485) [2673 bp, 890 aa] {...    79   2e-14
CAGL0C05005g Chr3 complement(467626..470856) [3231 bp, 1076 aa] ...    79   2e-14
ZYRO0F07370g Chr6 (595931..598219) [2289 bp, 762 aa] {ON} simila...    79   3e-14
Kpol_1037.6 s1037 (12601..15534) [2934 bp, 977 aa] {ON} (12601.....    79   3e-14
SAKL0A00484g Chr1 complement(57938..60544) [2607 bp, 868 aa] {ON...    79   3e-14
KLTH0F04730g Chr6 complement(417013..419133) [2121 bp, 706 aa] {...    79   3e-14
TPHA0G01600 Chr7 complement(329313..331850) [2538 bp, 845 aa] {O...    79   3e-14
KLLA0A03806g Chr1 complement(338807..340615) [1809 bp, 602 aa] {...    78   3e-14
TBLA0C03140 Chr3 (759258..760763) [1506 bp, 501 aa] {ON} Anc_5.2...    78   3e-14
ZYRO0G19074g Chr7 complement(1580648..1583413) [2766 bp, 921 aa]...    79   3e-14
Suva_6.221 Chr6 (399862..400920,400924..402096) [2232 bp, 743 aa...    78   3e-14
Suva_16.104 Chr16 (176201..177352) [1152 bp, 383 aa] {ON} YPL203...    77   4e-14
KAFR0F01940 Chr6 complement(379908..382283) [2376 bp, 791 aa] {O...    78   4e-14
TPHA0A04570 Chr1 (1038551..1040674) [2124 bp, 707 aa] {ON} Anc_1...    78   4e-14
SAKL0C07722g Chr3 (717419..720157) [2739 bp, 912 aa] {ON} simila...    79   4e-14
CAGL0D02002g Chr4 (207419..209080) [1662 bp, 553 aa] {ON} simila...    78   4e-14
KNAG0I02830 Chr9 (549811..554358) [4548 bp, 1515 aa] {ON} Anc_1....    79   4e-14
NDAI0G06240 Chr7 (1546580..1549282) [2703 bp, 900 aa] {ON} Anc_1...    78   4e-14
KLTH0G05698g Chr7 (453530..455323) [1794 bp, 597 aa] {ON} simila...    78   4e-14
NCAS0A07990 Chr1 complement(1578473..1581346) [2874 bp, 957 aa] ...    79   4e-14
TDEL0A02010 Chr1 (365325..366782) [1458 bp, 485 aa] {ON} Anc_2.4...    77   4e-14
Ecym_2566 Chr2 (1105239..1106126) [888 bp, 295 aa] {ON} similar ...    75   4e-14
KNAG0D00210 Chr4 complement(22721..25222) [2502 bp, 833 aa] {ON}...    78   4e-14
Suva_2.11 Chr2 complement(17473..18858) [1386 bp, 461 aa] {ON} Y...    77   4e-14
Kpol_495.14 s495 (33810..35684) [1875 bp, 624 aa] {ON} (33810..3...    78   4e-14
YPL203W Chr16 (166256..167398) [1143 bp, 380 aa] {ON}  TPK2cAMP-...    77   4e-14
NDAI0A08560 Chr1 complement(1969778..1973731) [3954 bp, 1317 aa]...    79   4e-14
NCAS0E03010 Chr5 (599358..602810) [3453 bp, 1150 aa] {ON} Anc_7....    78   5e-14
ZYRO0C13156g Chr3 complement(1041022..1042068) [1047 bp, 348 aa]...    76   5e-14
KNAG0A06290 Chr1 (958438..960516) [2079 bp, 692 aa] {ON} Anc_2.4...    78   5e-14
CAGL0M08910g Chr13 complement(887703..889541) [1839 bp, 612 aa] ...    78   5e-14
SAKL0H06754g Chr8 (594995..597649) [2655 bp, 884 aa] {ON} simila...    78   5e-14
TDEL0D04460 Chr4 complement(813075..815816) [2742 bp, 913 aa] {O...    78   5e-14
Ecym_2434 Chr2 complement(843308..846676) [3369 bp, 1122 aa] {ON...    78   5e-14
Smik_4.135 Chr4 complement(256861..258402) [1542 bp, 513 aa] {ON...    77   5e-14
TPHA0G01630 Chr7 (336511..339126) [2616 bp, 871 aa] {ON} Anc_8.6...    78   5e-14
NDAI0G03030 Chr7 (704910..708269) [3360 bp, 1119 aa] {ON}              78   5e-14
Kwal_27.11919 s27 (1003201..1003827) [627 bp, 209 aa] {OFF} YBR1...    73   5e-14
KNAG0B03230 Chr2 complement(625072..626997) [1926 bp, 641 aa] {O...    77   5e-14
KNAG0A05670 Chr1 complement(847460..849016) [1557 bp, 518 aa] {O...    77   6e-14
TBLA0E02290 Chr5 complement(563483..567385) [3903 bp, 1300 aa] {...    78   6e-14
NDAI0H01020 Chr8 complement(225366..228566) [3201 bp, 1066 aa] {...    78   6e-14
Suva_11.86 Chr11 (169096..170685) [1590 bp, 529 aa] {ON} YKL139W...    77   6e-14
CAGL0I05896g Chr9 (560169..562505) [2337 bp, 778 aa] {ON} some s...    77   6e-14
TDEL0F04290 Chr6 (801456..802739) [1284 bp, 427 aa] {ON} Anc_8.3...    76   6e-14
Kpol_265.1 s265 (4826..7099) [2274 bp, 757 aa] {ON} (4826..7099)...    77   7e-14
TBLA0A02050 Chr1 (495735..497039) [1305 bp, 434 aa] {ON}               76   7e-14
SAKL0F13618g Chr6 (1085967..1089494) [3528 bp, 1175 aa] {ON} sim...    78   7e-14
KNAG0L00520 Chr12 (79786..80892) [1107 bp, 368 aa] {ON} Anc_7.86...    76   7e-14
KNAG0D04810 Chr4 (867817..872139) [4323 bp, 1440 aa] {ON} Anc_7....    78   7e-14
Smik_2.13 Chr2 complement(14021..17473) [3453 bp, 1150 aa] {ON} ...    78   7e-14
Smik_2.14 Chr2 complement(14021..17473) [3453 bp, 1150 aa] {ON} ...    78   7e-14
CAGL0K03399g Chr11 complement(311316..313427) [2112 bp, 703 aa] ...    77   7e-14
Suva_11.99 Chr11 (192143..194197) [2055 bp, 684 aa] {ON} YMR104C...    77   7e-14
Skud_2.4 Chr2 complement(4805..8260) [3456 bp, 1151 aa] {ON} YBL...    77   8e-14
Kwal_55.20326 s55 complement(351010..353262) [2253 bp, 750 aa] {...    77   8e-14
TPHA0L02180 Chr12 (453556..455538) [1983 bp, 660 aa] {ON} Anc_5....    77   8e-14
Suva_11.65 Chr11 complement(134606..136120) [1515 bp, 504 aa] {O...    77   8e-14
TPHA0H00420 Chr8 complement(82575..85691) [3117 bp, 1038 aa] {ON...    77   8e-14
NDAI0K01370 Chr11 (313672..315714) [2043 bp, 680 aa] {ON}              77   8e-14
YBL105C Chr2 complement(14241..17696) [3456 bp, 1151 aa] {ON}  P...    77   8e-14
AEL230W Chr5 (198401..200227) [1827 bp, 608 aa] {ON} Syntenic ho...    77   9e-14
Ecym_4652 Chr4 (1272725..1276156) [3432 bp, 1143 aa] {ON} simila...    77   9e-14
KNAG0C02600 Chr3 complement(504486..507134) [2649 bp, 882 aa] {O...    77   9e-14
TBLA0E03360 Chr5 complement(838512..840476) [1965 bp, 654 aa] {O...    77   9e-14
CAGL0G09020g Chr7 (860266..861351) [1086 bp, 361 aa] {ON} highly...    75   9e-14
CAGL0L07326g Chr12 (810529..812049) [1521 bp, 506 aa] {ON} simil...    76   1e-13
ZYRO0F07194g Chr6 complement(581438..584254) [2817 bp, 938 aa] {...    77   1e-13
NCAS0B02350 Chr2 complement(394128..395018) [891 bp, 296 aa] {ON...    74   1e-13
ADR058C Chr4 complement(810939..811826) [888 bp, 295 aa] {ON} Sy...    74   1e-13
YDR477W Chr4 (1412373..1414274) [1902 bp, 633 aa] {ON}  SNF1AMP-...    77   1e-13
TDEL0E05220 Chr5 complement(957515..958597) [1083 bp, 360 aa] {O...    75   1e-13
ACR281C Chr3 complement(864528..868307) [3780 bp, 1259 aa] {ON} ...    77   1e-13
Smik_6.408 Chr6 complement(657018..658163) [1146 bp, 381 aa] {ON...    75   1e-13
KLTH0D10714g Chr4 (880389..883007) [2619 bp, 872 aa] {ON} simila...    77   1e-13
Skud_11.103 Chr11 (192587..194629) [2043 bp, 680 aa] {ON} YMR104...    77   1e-13
Skud_16.76 Chr16 (139571..140719) [1149 bp, 382 aa] {ON} YPL203W...    75   1e-13
TPHA0F02150 Chr6 complement(475516..477768) [2253 bp, 750 aa] {O...    77   1e-13
AFR377C Chr6 complement(1116589..1118769) [2181 bp, 726 aa] {ON}...    77   1e-13
NDAI0B02900 Chr2 complement(737651..738709) [1059 bp, 352 aa] {O...    75   1e-13
ACR249C Chr3 complement(797020..798951) [1932 bp, 643 aa] {ON} S...    77   1e-13
Kpol_513.17 s513 (49097..50824) [1728 bp, 575 aa] {ON} (49097..5...    76   1e-13
NCAS0D00400 Chr4 complement(61545..63716) [2172 bp, 723 aa] {ON}...    77   1e-13
NDAI0F01650 Chr6 (403635..404738) [1104 bp, 367 aa] {ON} Anc_6.214     75   1e-13
Skud_2.90 Chr2 (176138..177199) [1062 bp, 353 aa] {ON} YBL016W (...    75   1e-13
NDAI0G03470 Chr7 complement(829975..832455) [2481 bp, 826 aa] {O...    77   1e-13
Ecym_7473 Chr7 (963826..966045) [2220 bp, 739 aa] {ON} similar t...    77   1e-13
KNAG0C06060 Chr3 (1183766..1186654) [2889 bp, 962 aa] {ON} Anc_5...    77   1e-13
Kwal_47.17252 s47 (318148..320766) [2619 bp, 872 aa] {ON} YGL180...    77   1e-13
Smik_4.754 Chr4 (1333667..1335565) [1899 bp, 632 aa] {ON} YDR477...    76   1e-13
CAGL0J03872g Chr10 (368472..370457) [1986 bp, 661 aa] {ON} simil...    76   1e-13
TDEL0A02220 Chr1 (402496..404565) [2070 bp, 689 aa] {ON} Anc_2.4...    76   1e-13
Suva_2.703 Chr2 complement(1238496..1239953) [1458 bp, 485 aa] {...    75   2e-13
ADR167W Chr4 (994581..997202) [2622 bp, 873 aa] {ON} Syntenic ho...    76   2e-13
Kwal_26.8709 s26 (907885..910374) [2490 bp, 829 aa] {ON} YPL141C...    76   2e-13
Kpol_1072.29 s1072 complement(61987..64668) [2682 bp, 893 aa] {O...    76   2e-13
Ecym_2405 Chr2 (788655..791222) [2568 bp, 855 aa] {ON} similar t...    76   2e-13
KLTH0E09658g Chr5 (869857..870957) [1101 bp, 366 aa] {ON} highly...    74   2e-13
TBLA0J00990 Chr10 (224999..227335) [2337 bp, 778 aa] {ON} Anc_1....    76   2e-13
AFR205C Chr6 complement(805580..806953) [1374 bp, 457 aa] {ON} S...    75   2e-13
NDAI0H00940 Chr8 complement(209645..211702) [2058 bp, 685 aa] {O...    76   2e-13
Ecym_2457 Chr2 (888054..890165) [2112 bp, 703 aa] {ON} similar t...    76   2e-13
KNAG0M00190 Chr13 complement(25224..27602) [2379 bp, 792 aa] {ON...    76   2e-13
SAKL0D06534g Chr4 complement(538606..540091,540155..540237) [156...    75   2e-13
Ecym_5588 Chr5 complement(1205102..1206943) [1842 bp, 613 aa] {O...    75   2e-13
KLTH0C05478g Chr3 complement(471760..475254) [3495 bp, 1164 aa] ...    76   2e-13
Smik_6.339 Chr6 (538177..540774) [2598 bp, 865 aa] {ON} YPL141C ...    76   2e-13
NDAI0E02320 Chr5 (480203..483001) [2799 bp, 932 aa] {ON}               76   2e-13
KLLA0A05819g Chr1 (541545..543659) [2115 bp, 704 aa] {ON} simila...    75   2e-13
YPL141C Chr16 complement(283464..286061) [2598 bp, 865 aa] {ON} ...    76   2e-13
KLTH0E06754g Chr5 (619163..621784) [2622 bp, 873 aa] {ON} simila...    76   2e-13
SAKL0A04246g Chr1 complement(396019..397221) [1203 bp, 400 aa] {...    74   2e-13
Kwal_27.10581 s27 complement(403249..406713) [3465 bp, 1154 aa] ...    76   3e-13
Skud_4.751 Chr4 (1332135..1334039) [1905 bp, 634 aa] {ON} YDR477...    75   3e-13
NDAI0E04610 Chr5 (1042690..1046154) [3465 bp, 1154 aa] {ON} Anc_...    76   3e-13
KNAG0F02900 Chr6 (549477..551426) [1950 bp, 649 aa] {ON}               75   3e-13
YBL016W Chr2 (192451..193512) [1062 bp, 353 aa] {ON}  FUS3Mitoge...    74   3e-13
CAGL0M13541g Chr13 (1333846..1335714) [1869 bp, 622 aa] {ON} sim...    75   3e-13
CAGL0I06248g Chr9 (600351..602792) [2442 bp, 813 aa] {ON} simila...    75   3e-13
Ecym_2203 Chr2 (401590..402648) [1059 bp, 352 aa] {ON} similar t...    74   3e-13
Suva_1.86 Chr1 complement(150761..153685) [2925 bp, 974 aa] {ON}...    75   3e-13
Suva_14.178 Chr14 (328862..331195) [2334 bp, 777 aa] {ON} YNL161...    75   3e-13
CAGL0M09361g Chr13 complement(928484..931918) [3435 bp, 1144 aa]...    75   3e-13
Kpol_2001.30 s2001 (87817..90093) [2277 bp, 758 aa] {ON} (87817....    75   3e-13
Kpol_520.17 s520 complement(37953..41447) [3495 bp, 1164 aa] {ON...    75   3e-13
NCAS0A11020 Chr1 (2193556..2194869) [1314 bp, 437 aa] {ON} Anc_3...    74   3e-13
Smik_10.91 Chr10 complement(145745..148153) [2409 bp, 802 aa] {O...    75   4e-13
Kwal_26.8751 s26 complement(928853..931399) [2547 bp, 848 aa] {O...    75   4e-13
Skud_15.399 Chr15 (714789..717212) [2424 bp, 807 aa] {ON} YOR233...    75   4e-13
Suva_15.411 Chr15 (716095..718542) [2448 bp, 815 aa] {ON} YHR205...    75   4e-13
ABR014W Chr2 (417708..420623) [2916 bp, 971 aa] {ON} Syntenic ho...    75   4e-13
Smik_2.101 Chr2 (186008..187069) [1062 bp, 353 aa] {ON} YBL016W ...    74   4e-13
Skud_11.88 Chr11 (169115..170659) [1545 bp, 514 aa] {ON} YKL139W...    74   4e-13
YJL141C Chr10 complement(147967..150390) [2424 bp, 807 aa] {ON} ...    75   4e-13
TPHA0O01400 Chr15 complement(277678..279258) [1581 bp, 526 aa] {...    74   4e-13
ZYRO0F13310g Chr6 (1092612..1096322) [3711 bp, 1236 aa] {ON} som...    75   4e-13
KLTH0B06424g Chr2 complement(518184..520328) [2145 bp, 714 aa] {...    75   4e-13
CAGL0H01639g Chr8 (158967..160532) [1566 bp, 521 aa] {ON} simila...    74   4e-13
ZYRO0G00506g Chr7 complement(38488..40854) [2367 bp, 788 aa] {ON...    75   4e-13
KLLA0D03190g Chr4 (267933..269051) [1119 bp, 372 aa] {ON} highly...    73   5e-13
KLLA0D09328g Chr4 complement(788565..791705) [3141 bp, 1046 aa] ...    75   5e-13
YNL161W Chr14 (332597..334867) [2271 bp, 756 aa] {ON}  CBK1Serin...    75   5e-13
NCAS0I00470 Chr9 (74336..77584) [3249 bp, 1082 aa] {ON} Anc_7.86       75   5e-13
YKL161C Chr11 complement(149386..150687) [1302 bp, 433 aa] {ON} ...    74   5e-13
ZYRO0G20306g Chr7 complement(1675578..1677227) [1650 bp, 549 aa]...    74   5e-13
Smik_13.290 Chr13 complement(457921..459951) [2031 bp, 676 aa] {...    74   5e-13
KLTH0D04356g Chr4 (405904..405987,406076..407401) [1410 bp, 469 ...    74   5e-13
TPHA0C00160 Chr3 complement(17339..19603) [2265 bp, 754 aa] {ON}...    75   5e-13
NDAI0B03310 Chr2 complement(844616..845557) [942 bp, 313 aa] {ON...    72   5e-13
SAKL0A04466g Chr1 (413816..414937) [1122 bp, 373 aa] {ON} highly...    73   5e-13
Skud_10.73 Chr10 complement(123049..125436) [2388 bp, 795 aa] {O...    74   6e-13
Kpol_1002.111 s1002 (277615..278664) [1050 bp, 349 aa] {ON} (277...    73   6e-13
Skud_4.154 Chr4 complement(275783..277324) [1542 bp, 513 aa] {ON...    74   6e-13
NDAI0D02750 Chr4 (639802..644349) [4548 bp, 1515 aa] {ON} Anc_2....    75   6e-13
TBLA0A10690 Chr1 (2642723..2645632) [2910 bp, 969 aa] {ON} Anc_4...    74   7e-13
TBLA0H03440 Chr8 (840759..841643) [885 bp, 294 aa] {ON} Anc_8.51...    72   7e-13
KAFR0G01080 Chr7 complement(243965..247417) [3453 bp, 1150 aa] {...    74   7e-13
TBLA0D05770 Chr4 (1424960..1427671) [2712 bp, 903 aa] {ON} Anc_1...    74   7e-13
KLTH0E16104g Chr5 complement(1425822..1427042) [1221 bp, 406 aa]...    73   7e-13
Skud_4.797 Chr4 complement(1405618..1407075) [1458 bp, 485 aa] {...    74   7e-13
AFL090W Chr6 (274336..275376) [1041 bp, 346 aa] {ON} Syntenic ho...    72   7e-13
Kpol_1018.162 s1018 (414868..416904) [2037 bp, 678 aa] {ON} (414...    74   8e-13
KLLA0B13112g Chr2 complement(1146006..1148198) [2193 bp, 730 aa]...    74   8e-13
Kpol_2001.10 s2001 (30724..33018) [2295 bp, 764 aa] {ON} (30724....    74   8e-13
TDEL0H01070 Chr8 complement(192834..194624) [1791 bp, 596 aa] {O...    74   8e-13
Skud_14.172 Chr14 (323327..325564) [2238 bp, 745 aa] {ON} YNL161...    74   9e-13
Suva_7.375 Chr7 (643870..645591) [1722 bp, 573 aa] {ON} YGR092W ...    74   9e-13
KAFR0B06980 Chr2 (1452754..1455081) [2328 bp, 775 aa] {ON} Anc_4...    74   9e-13
NDAI0B04700 Chr2 complement(1164332..1165918) [1587 bp, 528 aa] ...    73   9e-13
ZYRO0F08778g Chr6 (702733..703626) [894 bp, 297 aa] {ON} highly ...    71   1e-12
NCAS0I02850 Chr9 (529637..532042) [2406 bp, 801 aa] {ON} Anc_1.180     74   1e-12
SAKL0E12342g Chr5 complement(1021369..1023795) [2427 bp, 808 aa]...    74   1e-12
Smik_14.167 Chr14 (311655..312284,312591..314228) [2268 bp, 755 ...    74   1e-12
TDEL0C03050 Chr3 (545862..549299) [3438 bp, 1145 aa] {ON} Anc_7....    74   1e-12
Skud_15.39 Chr15 (69445..71412) [1968 bp, 655 aa] {ON} YOL113W (...    74   1e-12
Ecym_6092 Chr6 (178965..180299) [1335 bp, 444 aa] {ON} similar t...    73   1e-12
Skud_7.391 Chr7 (652479..654200) [1722 bp, 573 aa] {ON} YGR092W ...    73   1e-12
KAFR0B02140 Chr2 (417972..420662) [2691 bp, 896 aa] {ON} Anc_8.1...    74   1e-12
KLTH0H10318g Chr8 complement(888661..890128,890228..890316) [155...    73   1e-12
Kwal_14.2497 s14 complement(784224..785480) [1257 bp, 418 aa] {O...    72   1e-12
Smik_6.178 Chr6 (291601..293322) [1722 bp, 573 aa] {ON} YGR092W ...    73   1e-12
Ecym_5624 Chr5 (1256658..1258022) [1365 bp, 454 aa] {ON} similar...    72   1e-12
KAFR0K02450 Chr11 (504087..504131,504190..505680) [1536 bp, 511 ...    73   1e-12
Ecym_6400 Chr6 complement(779716..781983) [2268 bp, 755 aa] {ON}...    73   1e-12
Smik_8.295 Chr8 (484074..486548) [2475 bp, 824 aa] {ON} YHR205W ...    73   1e-12
TPHA0B03850 Chr2 (909219..910841) [1623 bp, 540 aa] {ON} Anc_1.4...    73   1e-12
ZYRO0D02970g Chr4 complement(231363..233669) [2307 bp, 768 aa] {...    73   1e-12
KLTH0E04334g Chr5 complement(391495..393723) [2229 bp, 742 aa] {...    73   1e-12
Skud_13.262 Chr13 complement(448758..450791) [2034 bp, 677 aa] {...    73   1e-12
YBR274W Chr2 (749594..751177) [1584 bp, 527 aa] {ON}  CHK1Serine...    73   1e-12
Smik_11.97 Chr11 (168854..170491) [1638 bp, 545 aa] {ON} YKL139W...    73   2e-12
TPHA0F03520 Chr6 (755480..757756) [2277 bp, 758 aa] {ON} Anc_1.5...    73   2e-12
ZYRO0E07018g Chr5 (531316..532419) [1104 bp, 367 aa] {ON} simila...    72   2e-12
NDAI0G06150 Chr7 (1519393..1521780) [2388 bp, 795 aa] {ON} Anc_1...    73   2e-12
TPHA0B00240 Chr2 complement(44468..46525) [2058 bp, 685 aa] {ON}...    73   2e-12
SAKL0H24750g Chr8 complement(2152673..2155420) [2748 bp, 915 aa]...    73   2e-12
ZYRO0G08844g Chr7 complement(711678..712766) [1089 bp, 362 aa] {...    72   2e-12
NDAI0F03200 Chr6 complement(770618..772924) [2307 bp, 768 aa] {O...    73   2e-12
TDEL0A04780 Chr1 (842715..844580) [1866 bp, 621 aa] {ON} Anc_5.6...    73   2e-12
KAFR0C02840 Chr3 (559821..560873) [1053 bp, 350 aa] {ON} Anc_8.1...    71   2e-12
KLTH0F05522g Chr6 complement(477035..478975) [1941 bp, 646 aa] {...    73   2e-12
KLLA0B02332g Chr2 complement(206863..207948) [1086 bp, 361 aa] {...    71   2e-12
Skud_8.272 Chr8 (478199..480706) [2508 bp, 835 aa] {ON} YHR205W ...    73   2e-12
TPHA0D02740 Chr4 (566279..568819) [2541 bp, 846 aa] {ON} Anc_5.5...    73   2e-12
YMR104C Chr13 complement(473420..475453) [2034 bp, 677 aa] {ON} ...    73   2e-12
CAGL0M10153g Chr13 complement(1010688..1013291) [2604 bp, 867 aa...    73   2e-12
Suva_5.250 Chr5 (392904..396323) [3420 bp, 1139 aa] {ON} YER129W...    73   2e-12
YKL139W Chr11 (182958..184544) [1587 bp, 528 aa] {ON}  CTK1Catal...    72   2e-12
Kpol_1018.54 s1018 (163688..166192) [2505 bp, 834 aa] {ON} (1636...    73   2e-12
SAKL0B12364g Chr2 (1060853..1063021) [2169 bp, 722 aa] {ON} high...    73   2e-12
Kwal_47.16761 s47 (100315..102549) [2235 bp, 744 aa] {ON} YHR205...    73   2e-12
KLLA0C03938g Chr3 complement(358851..360632) [1782 bp, 593 aa] {...    72   2e-12
YHR205W Chr8 (509363..511837) [2475 bp, 824 aa] {ON}  SCH9AGC fa...    73   2e-12
KLLA0E06447g Chr5 complement(577669..581154) [3486 bp, 1161 aa] ...    73   2e-12
KAFR0D02900 Chr4 (575853..577313) [1461 bp, 486 aa] {ON} Anc_7.5...    72   2e-12
TPHA0L01470 Chr12 (303604..304497) [894 bp, 297 aa] {ON} Anc_8.5...    70   2e-12
ADL389W Chr4 (27641..29776) [2136 bp, 711 aa] {ON} Syntenic homo...    72   2e-12
YGR092W Chr7 (668189..669907) [1719 bp, 572 aa] {ON}  DBF2Ser/Th...    72   2e-12
NCAS0A06440 Chr1 (1270771..1273020) [2250 bp, 749 aa] {ON} Anc_4...    72   2e-12
Ecym_2042 Chr2 complement(67312..68397) [1086 bp, 361 aa] {ON} s...    71   2e-12
TBLA0D05640 Chr4 (1380616..1383066) [2451 bp, 816 aa] {ON} Anc_1...    72   2e-12
TPHA0D01140 Chr4 (238656..240524) [1869 bp, 622 aa] {ON} Anc_8.6...    72   2e-12
SAKL0B05082g Chr2 (436707..438896) [2190 bp, 729 aa] {ON} simila...    72   2e-12
TBLA0B06510 Chr2 (1536156..1538489) [2334 bp, 777 aa] {ON} Anc_1...    72   3e-12
CAGL0M02233g Chr13 complement(267332..269635) [2304 bp, 767 aa] ...    72   3e-12
Suva_6.222 Chr6 (400975..402096) [1122 bp, 373 aa] {ON} YJL141C ...    71   3e-12
AAR009W Chr1 (358947..360308) [1362 bp, 453 aa] {ON} Syntenic ho...    72   3e-12
TPHA0H00410 Chr8 (79426..82197) [2772 bp, 923 aa] {ON} Anc_8.141...    72   3e-12
TDEL0D00330 Chr4 complement(55638..57872) [2235 bp, 744 aa] {ON}...    72   3e-12
ADL168C Chr4 complement(398517..399605) [1089 bp, 362 aa] {ON} S...    71   3e-12
KNAG0F01440 Chr6 (261403..263685) [2283 bp, 760 aa] {ON}               72   3e-12
Kpol_1033.1 s1033 complement(1..828) [828 bp, 276 aa] {ON} compl...    70   3e-12
NCAS0B07380 Chr2 complement(1396315..1397898) [1584 bp, 527 aa] ...    72   3e-12
NDAI0D03420 Chr4 (806856..809261) [2406 bp, 801 aa] {ON} Anc_4.384     72   3e-12
NDAI0B00220 Chr2 (29825..32470) [2646 bp, 881 aa] {ON} Anc_1.180       72   3e-12
Kwal_27.10004 s27 complement(156153..158360) [2208 bp, 735 aa] {...    72   3e-12
Suva_13.281 Chr13 complement(455094..457136) [2043 bp, 680 aa] {...    72   3e-12
Skud_16.140 Chr16 complement(255090..257687) [2598 bp, 865 aa] {...    72   3e-12
NCAS0A09750 Chr1 (1940202..1942370) [2169 bp, 722 aa] {ON}             72   3e-12
Ecym_4448 Chr4 complement(917136..918872) [1737 bp, 578 aa] {ON}...    72   4e-12
SAKL0C05280g Chr3 complement(502205..504490) [2286 bp, 761 aa] {...    72   4e-12
TDEL0F03120 Chr6 (570471..572192) [1722 bp, 573 aa] {ON} Anc_3.4...    72   4e-12
NCAS0B04490 Chr2 (814474..815523) [1050 bp, 349 aa] {ON} Anc_8.141     70   4e-12
Skud_16.132 Chr16 (239797..242571) [2775 bp, 924 aa] {ON} YPL150...    72   4e-12
KLLA0E12145g Chr5 (1080245..1081612) [1368 bp, 455 aa] {ON} simi...    71   4e-12
TBLA0I00910 Chr9 complement(170526..173945) [3420 bp, 1139 aa] {...    72   4e-12
CAGL0B02739g Chr2 complement(262590..264620) [2031 bp, 676 aa] {...    72   4e-12
Skud_2.406 Chr2 (718522..720105) [1584 bp, 527 aa] {ON} YBR274W ...    71   4e-12
CAGL0F09075g Chr6 (894761..897001) [2241 bp, 746 aa] {ON} simila...    72   4e-12
KLLA0E01585g Chr5 (149305..149370,149488..150960) [1539 bp, 512 ...    71   4e-12
SAKL0C06666g Chr3 complement(628448..630367) [1920 bp, 639 aa] {...    71   4e-12
KLLA0B03586g Chr2 complement(326871..329075) [2205 bp, 734 aa] {...    72   5e-12
Suva_4.535 Chr4 (921278..922861) [1584 bp, 527 aa] {ON} YBR274W ...    71   5e-12
KNAG0C04310 Chr3 complement(842994..846503) [3510 bp, 1169 aa] {...    72   5e-12
Skud_7.92 Chr7 complement(169006..170697) [1692 bp, 563 aa] {ON}...    71   5e-12
TBLA0A08810 Chr1 (2161249..2162304) [1056 bp, 351 aa] {ON} Anc_8...    70   5e-12
NCAS0A01100 Chr1 (218400..219464) [1065 bp, 354 aa] {ON}               70   5e-12
NCAS0J00960 Chr10 (157010..159121) [2112 bp, 703 aa] {ON}              71   5e-12
KLTH0D17204g Chr4 complement(1426818..1429085) [2268 bp, 755 aa]...    71   5e-12
NCAS0C01670 Chr3 complement(306682..309372) [2691 bp, 896 aa] {O...    71   5e-12
Suva_16.160 Chr16 (277393..280149) [2757 bp, 918 aa] {ON} YPL150...    71   5e-12
Kwal_33.13984 s33 complement(471429..473378) [1950 bp, 649 aa] {...    71   6e-12
TPHA0E02820 Chr5 complement(589816..590970) [1155 bp, 384 aa] {O...    70   6e-12
Suva_2.105 Chr2 (186428..187489) [1062 bp, 353 aa] {ON} YBL016W ...    70   6e-12
SAKL0D06666g Chr4 (551260..552522) [1263 bp, 420 aa] {ON} some s...    70   6e-12
KAFR0A03730 Chr1 (761946..764312) [2367 bp, 788 aa] {ON} Anc_8.6...    71   6e-12
SAKL0C07744g Chr3 (720519..721799) [1281 bp, 426 aa] {ON} simila...    70   6e-12
CAGL0G05720g Chr7 complement(547617..549833) [2217 bp, 738 aa] {...    71   6e-12
KLTH0H08316g Chr8 (730027..731094) [1068 bp, 355 aa] {ON} simila...    70   6e-12
CAGL0H10318g Chr8 complement(1006299..1007222) [924 bp, 307 aa] ...    69   6e-12
Kpol_1065.3 s1065 complement(4445..5575) [1131 bp, 376 aa] {ON} ...    70   6e-12
Suva_16.169 Chr16 complement(292738..295314) [2577 bp, 858 aa] {...    71   6e-12
YPL150W Chr16 (268188..270893) [2706 bp, 901 aa] {ON} Protein ki...    71   6e-12
KAFR0A06790 Chr1 complement(1371892..1372806) [915 bp, 304 aa] {...    69   7e-12
Smik_5.275 Chr5 (426176..429601) [3426 bp, 1141 aa] {ON} YER129W...    71   7e-12
ZYRO0B07854g Chr2 complement(613992..616007) [2016 bp, 671 aa] {...    71   7e-12
ACR133C Chr3 complement(581468..584023) [2556 bp, 851 aa] {ON} S...    71   7e-12
TPHA0B01150 Chr2 complement(259998..262070) [2073 bp, 690 aa] {O...    71   7e-12
NCAS0A04220 Chr1 (855791..857353) [1563 bp, 520 aa] {ON} Anc_2.425     70   7e-12
TDEL0G02820 Chr7 complement(543911..545377,545450..545476) [1494...    70   7e-12
SAKL0E05984g Chr5 complement(485895..487391,487462..487482) [151...    70   7e-12
KLLA0F01276g Chr6 complement(120001..121560) [1560 bp, 519 aa] {...    70   7e-12
NCAS0B05560 Chr2 complement(1050313..1051371) [1059 bp, 352 aa] ...    69   8e-12
TBLA0B03990 Chr2 complement(910314..912455) [2142 bp, 713 aa] {O...    71   8e-12
ZYRO0F18062g Chr6 complement(1494752..1496167) [1416 bp, 471 aa]...    70   9e-12
TPHA0P01270 Chr16 complement(254480..257137) [2658 bp, 885 aa] {...    70   9e-12
AFL101C Chr6 complement(249144..250247) [1104 bp, 367 aa] {ON} S...    69   9e-12
TPHA0B01520 Chr2 complement(336164..339616) [3453 bp, 1150 aa] {...    71   9e-12
SAKL0H07084g Chr8 complement(619288..622047) [2760 bp, 919 aa] {...    70   9e-12
KAFR0C00920 Chr3 complement(185475..186674) [1200 bp, 399 aa] {O...    69   9e-12
CAGL0L05632g Chr12 (612478..614511) [2034 bp, 677 aa] {ON} simil...    70   1e-11
NDAI0F01600 Chr6 complement(392424..393662) [1239 bp, 412 aa] {O...    70   1e-11
ZYRO0A05544g Chr1 (450809..452704) [1896 bp, 631 aa] {ON} highly...    70   1e-11
TBLA0F00820 Chr6 (209607..211844) [2238 bp, 745 aa] {ON} Anc_3.1...    70   1e-11
ABL011C Chr2 complement(378257..380362) [2106 bp, 701 aa] {ON} S...    70   1e-11
Kwal_33.14554 s33 (717776..719920) [2145 bp, 714 aa] {ON} YNL161...    70   1e-11
TDEL0F00930 Chr6 complement(160181..163573) [3393 bp, 1130 aa] {...    70   1e-11
KLLA0D07810g Chr4 complement(669095..671251) [2157 bp, 718 aa] {...    70   1e-11
YER129W Chr5 (417281..420709) [3429 bp, 1142 aa] {ON}  SAK1Upstr...    70   1e-11
YLR362W Chr12 (849866..852019) [2154 bp, 717 aa] {ON}  STE11Sign...    70   1e-11
TBLA0C02310 Chr3 complement(546887..548596) [1710 bp, 569 aa] {O...    70   1e-11
Kpol_463.19 s463 complement(53246..55561) [2316 bp, 771 aa] {ON}...    70   1e-11
Skud_14.32 Chr14 complement(49930..51057) [1128 bp, 375 aa] {ON}...    69   1e-11
Kpol_1000.14 s1000 complement(36018..38015) [1998 bp, 665 aa] {O...    70   1e-11
TDEL0B01250 Chr2 complement(228145..229038) [894 bp, 297 aa] {ON...    68   1e-11
Ecym_8098 Chr8 (210698..212857) [2160 bp, 719 aa] {ON} similar t...    70   1e-11
Ecym_1275 Chr1 complement(560481..561836) [1356 bp, 451 aa] {ON}...    69   1e-11
KNAG0A03040 Chr1 complement(372150..374084) [1935 bp, 644 aa] {O...    70   2e-11
TDEL0A06000 Chr1 (1053427..1055799) [2373 bp, 790 aa] {ON} Anc_8...    70   2e-11
ADR033W Chr4 (764716..766449) [1734 bp, 577 aa] {ON} Syntenic ho...    69   2e-11
Kpol_1018.137 s1018 complement(366178..367914) [1737 bp, 578 aa]...    69   2e-11
Ecym_6307 Chr6 (578677..580227) [1551 bp, 516 aa] {ON} similar t...    69   2e-11
Kwal_27.9773 s27 (57252..58472) [1221 bp, 406 aa] {ON} YAR018C (...    69   2e-11
Ecym_5209 Chr5 complement(445530..448133) [2604 bp, 867 aa] {ON}...    70   2e-11
CAGL0E01683g Chr5 complement(166821..167948) [1128 bp, 375 aa] {...    69   2e-11
TDEL0A06140 Chr1 complement(1074016..1076601) [2586 bp, 861 aa] ...    70   2e-11
KAFR0H02540 Chr8 complement(483399..485852) [2454 bp, 817 aa] {O...    70   2e-11
TBLA0D05010 Chr4 complement(1234934..1236238) [1305 bp, 434 aa] ...    69   2e-11
NDAI0A06630 Chr1 complement(1514165..1515943) [1779 bp, 592 aa] ...    69   2e-11
NCAS0I02060 Chr9 (386630..388573) [1944 bp, 647 aa] {ON} Anc_3.1...    69   2e-11
Suva_10.464 Chr10 (809505..811721) [2217 bp, 738 aa] {ON} YLR362...    69   2e-11
NCAS0B06000 Chr2 complement(1134919..1135808,1135909..1135957) [...    68   2e-11
NCAS0B01470 Chr2 (241003..243186) [2184 bp, 727 aa] {ON} Anc_8.654     69   2e-11
KNAG0J02660 Chr10 (495011..497425) [2415 bp, 804 aa] {ON} Anc_1....    69   2e-11
Smik_2.417 Chr2 (735214..736797) [1584 bp, 527 aa] {ON} YBR274W ...    69   2e-11
NCAS0B03740 Chr2 complement(668231..671380) [3150 bp, 1049 aa] {...    70   2e-11
Smik_12.450 Chr12 (788896..791106) [2211 bp, 736 aa] {ON} YLR362...    69   2e-11
ZYRO0F06842g Chr6 (561269..563800) [2532 bp, 843 aa] {ON} simila...    69   2e-11
TDEL0E01710 Chr5 complement(330667..332706) [2040 bp, 679 aa] {O...    69   2e-11
Suva_8.284 Chr8 (514891..517317) [2427 bp, 808 aa] {ON} YOR233W ...    69   2e-11
YOR233W Chr15 (775846..778248) [2403 bp, 800 aa] {ON}  KIN4Serin...    69   2e-11
TBLA0B08650 Chr2 (2065061..2066308) [1248 bp, 415 aa] {ON} Anc_3...    69   2e-11
Ecym_5241 Chr5 complement(495748..497586) [1839 bp, 612 aa] {ON}...    69   2e-11
KAFR0G01810 Chr7 (386620..389130) [2511 bp, 836 aa] {ON} Anc_1.2...    69   2e-11
CAGL0B03509g Chr2 complement(349638..351431) [1794 bp, 597 aa] {...    69   2e-11
Kpol_1066.45 s1066 complement(76786..79428) [2643 bp, 880 aa] {O...    69   3e-11
Skud_13.465 Chr13 (826172..827929) [1758 bp, 585 aa] {ON} YMR291...    69   3e-11
Smik_6.347 Chr6 complement(553316..556069) [2754 bp, 917 aa] {ON...    69   3e-11
KLLA0D07348g Chr4 (626999..629728) [2730 bp, 909 aa] {ON} simila...    69   3e-11
Suva_6.78 Chr6 (135988..137325) [1338 bp, 445 aa] {ON} YFR014C (...    68   3e-11
AFR019W Chr6 (471481..472560) [1080 bp, 359 aa] {ON} Syntenic ho...    68   3e-11
KAFR0C01720 Chr3 (351078..352208) [1131 bp, 376 aa] {ON} Anc_3.4...    68   3e-11
TPHA0D03940 Chr4 (825250..826989) [1740 bp, 579 aa] {ON} Anc_3.4...    69   3e-11
ZYRO0F11418g Chr6 complement(936573..938117) [1545 bp, 514 aa] {...    69   3e-11
KLLA0F23155g Chr6 (2157146..2158429) [1284 bp, 427 aa] {ON} simi...    68   3e-11
Ecym_2194 Chr2 complement(381633..382733) [1101 bp, 366 aa] {ON}...    68   3e-11
YMR291W Chr13 (852630..854390) [1761 bp, 586 aa] {ON}  TDA1Prote...    69   3e-11
KLLA0D14905g Chr4 (1256065..1257768) [1704 bp, 567 aa] {ON} simi...    69   3e-11
TPHA0P00640 Chr16 (132185..133963) [1779 bp, 592 aa] {ON} Anc_3....    69   3e-11
TBLA0A08290 Chr1 complement(2039328..2041376) [2049 bp, 682 aa] ...    69   3e-11
Skud_11.56 Chr11 complement(117617..119776) [2160 bp, 719 aa] {O...    69   3e-11
AFL188C Chr6 complement(88793..90211) [1419 bp, 472 aa] {ON} Syn...    68   3e-11
KNAG0C01820 Chr3 (355604..357376) [1773 bp, 590 aa] {ON}               69   3e-11
KLLA0E14785g Chr5 complement(1323743..1324675) [933 bp, 310 aa] ...    67   3e-11
NDAI0B03190 Chr2 complement(815759..817309) [1551 bp, 516 aa] {O...    68   3e-11
ZYRO0G05214g Chr7 (420482..422980) [2499 bp, 832 aa] {ON} some s...    69   3e-11
Kwal_55.22001 s55 (1069907..1070998) [1092 bp, 363 aa] {ON} YNL3...    67   4e-11
TDEL0D04560 Chr4 (835822..837885) [2064 bp, 687 aa] {ON} Anc_3.1...    69   4e-11
TPHA0C02880 Chr3 (623723..624778) [1056 bp, 351 aa] {ON} Anc_8.1...    67   4e-11
KLLA0E07437g Chr5 complement(672690..673787) [1098 bp, 365 aa] {...    67   4e-11
NCAS0F02190 Chr6 complement(435844..437706) [1863 bp, 620 aa] {O...    68   4e-11
KLTH0F18942g Chr6 (1535941..1537032) [1092 bp, 363 aa] {ON} high...    67   4e-11
NCAS0B05910 Chr2 (1120092..1121645) [1554 bp, 517 aa] {ON} Anc_2...    68   4e-11
TPHA0O00670 Chr15 (125331..127088) [1758 bp, 585 aa] {ON} Anc_1....    68   4e-11
Kpol_1042.20 s1042 (45090..47261) [2172 bp, 723 aa] {ON} (45090....    69   4e-11
Kwal_23.3992 s23 complement(515493..517208) [1716 bp, 571 aa] {O...    68   4e-11
Kpol_541.48 s541 (152877..153692,153695..156046) [3168 bp, 1055 ...    69   4e-11
SAKL0C12870g Chr3 (1145051..1146142) [1092 bp, 363 aa] {ON} high...    67   4e-11
KLTH0E06776g Chr5 complement(622147..625575) [3429 bp, 1142 aa] ...    69   5e-11
KAFR0F02190 Chr6 (428623..430095) [1473 bp, 490 aa] {ON} Anc_3.1...    68   5e-11
KAFR0C04280 Chr3 (848308..849912) [1605 bp, 534 aa] {ON} Anc_1.3...    68   5e-11
NCAS0G02070 Chr7 (372747..374960) [2214 bp, 737 aa] {ON} Anc_2.96      68   5e-11
TBLA0C01750 Chr3 (412762..415707) [2946 bp, 981 aa] {ON} Anc_8.6...    68   5e-11
SAKL0D12628g Chr4 (1048973..1051429) [2457 bp, 818 aa] {ON} weak...    68   5e-11
TBLA0E04970 Chr5 (1272310..1273944) [1635 bp, 544 aa] {ON} Anc_4...    68   5e-11
Suva_13.481 Chr13 (834531..836279) [1749 bp, 582 aa] {ON} YMR291...    68   5e-11
Kpol_161.2 s161 complement(3125..4246) [1122 bp, 373 aa] {ON} co...    67   5e-11
Skud_12.447 Chr12 (790003..792210) [2208 bp, 735 aa] {ON} YLR362...    68   6e-11
Smik_14.34 Chr14 (53272..55788) [2517 bp, 838 aa] {ON} YNL298W (...    68   6e-11
TPHA0E02270 Chr5 (471696..472916) [1221 bp, 406 aa] {ON} Anc_5.2...    67   6e-11
ZYRO0B09196g Chr2 complement(721019..722569) [1551 bp, 516 aa] {...    67   6e-11
TDEL0C03740 Chr3 (658468..660702) [2235 bp, 744 aa] {ON} Anc_1.1...    68   6e-11
KLTH0G05214g Chr7 (423793..425754) [1962 bp, 653 aa] {ON} weakly...    68   6e-11
TDEL0D02040 Chr4 (395555..397138) [1584 bp, 527 aa] {ON} Anc_1.3...    67   6e-11
ZYRO0G19052g Chr7 (1576638..1580033) [3396 bp, 1131 aa] {ON} sim...    68   6e-11
NDAI0B02500 Chr2 (625206..629036) [3831 bp, 1276 aa] {ON} Anc_8....    68   6e-11
Ecym_6196 Chr6 (364576..365652) [1077 bp, 358 aa] {ON} similar t...    67   6e-11
AEL284C Chr5 complement(106480..107919) [1440 bp, 479 aa] {ON} S...    67   6e-11
Kwal_56.24091 s56 (845680..846825) [1146 bp, 381 aa] {ON} YPL209...    67   6e-11
ZYRO0G18546g Chr7 (1530693..1533050) [2358 bp, 785 aa] {ON} simi...    68   7e-11
KLLA0C00979g Chr3 (73295..74746) [1452 bp, 483 aa] {ON} similar ...    67   7e-11
Smik_14.24 Chr14 complement(40883..42010) [1128 bp, 375 aa] {ON}...    67   7e-11
KLLA0E10539g Chr5 (929989..931104) [1116 bp, 371 aa] {ON} highly...    67   7e-11
Skud_14.40 Chr14 (62496..65006) [2511 bp, 836 aa] {ON} YNL298W (...    68   7e-11
KNAG0A05580 Chr1 (830643..831560) [918 bp, 305 aa] {ON} Anc_2.33...    66   7e-11
KLTH0F12012g Chr6 complement(1013169..1014881) [1713 bp, 570 aa]...    67   7e-11
YGL179C Chr7 complement(163409..165091) [1683 bp, 560 aa] {ON}  ...    67   7e-11
NDAI0A06130 Chr1 complement(1391744..1394203) [2460 bp, 819 aa] ...    68   7e-11
KAFR0F03970 Chr6 (777047..778201) [1155 bp, 384 aa] {ON} Anc_4.1...    67   7e-11
AFR035W Chr6 (498529..500688) [2160 bp, 719 aa] {ON} Syntenic ho...    67   8e-11
Skud_4.39 Chr4 complement(70857..72947) [2091 bp, 696 aa] {ON} Y...    67   8e-11
ZYRO0C02288g Chr3 complement(181604..184327) [2724 bp, 907 aa] {...    68   8e-11
KLTH0C02662g Chr3 complement(240347..242674) [2328 bp, 775 aa] {...    67   8e-11
YNL307C Chr14 complement(56446..57573) [1128 bp, 375 aa] {ON}  M...    66   8e-11
TBLA0B03860 Chr2 (887855..890821) [2967 bp, 988 aa] {ON} Anc_8.6...    68   8e-11
KNAG0D02140 Chr4 complement(362745..365357) [2613 bp, 870 aa] {O...    67   8e-11
Smik_13.507 Chr13 (835298..837058) [1761 bp, 586 aa] {ON} YMR291...    67   8e-11
NCAS0C01590 Chr3 (293327..295921) [2595 bp, 864 aa] {ON} Anc_8.654     67   9e-11
Skud_10.283 Chr10 (503324..505765) [2442 bp, 813 aa] {ON} YJR059...    67   9e-11
SAKL0F06094g Chr6 (457709..459442) [1734 bp, 577 aa] {ON} unipro...    67   9e-11
TBLA0B09590 Chr2 (2272405..2273328) [924 bp, 307 aa] {ON} Anc_2....    65   9e-11
ZYRO0A07062g Chr1 (576600..576615,576675..577561) [903 bp, 300 a...    65   9e-11
Smik_7.319 Chr7 complement(534132..535472) [1341 bp, 446 aa] {ON...    67   9e-11
NDAI0J01250 Chr10 complement(291314..294844) [3531 bp, 1176 aa] ...    67   9e-11
TDEL0A00600 Chr1 complement(101753..102877) [1125 bp, 374 aa] {O...    66   9e-11
Suva_7.106 Chr7 (202969..204540) [1572 bp, 523 aa] {ON} YGL158W ...    67   9e-11
TBLA0B03970 Chr2 complement(904167..907793) [3627 bp, 1208 aa] {...    67   1e-10
CAGL0J04290g Chr10 complement(403542..404615) [1074 bp, 357 aa] ...    66   1e-10
CAGL0B04147g Chr2 (402798..404498) [1701 bp, 566 aa] {ON} highly...    67   1e-10
TDEL0B06160 Chr2 complement(1086672..1088327) [1656 bp, 551 aa] ...    67   1e-10
YNL298W Chr14 (68915..71443) [2529 bp, 842 aa] {ON}  CLA4Cdc42p-...    67   1e-10
KAFR0B04630 Chr2 (964764..966302) [1539 bp, 512 aa] {ON} Anc_1.3...    67   1e-10
KAFR0F00380 Chr6 complement(91358..92800) [1443 bp, 480 aa] {ON}...    67   1e-10
KLLA0A07403g Chr1 (661261..663900) [2640 bp, 879 aa] {ON} simila...    67   1e-10
YJR059W Chr10 (545787..548243) [2457 bp, 818 aa] {ON}  PTK2Putat...    67   1e-10
KLLA0C04213g Chr3 (386815..387999) [1185 bp, 394 aa] {ON} simila...    66   1e-10
NDAI0E01960 Chr5 (397897..399717) [1821 bp, 606 aa] {ON} Anc_2.425     67   1e-10
Suva_6.208 Chr6 (369853..371880) [2028 bp, 675 aa] {ON} YJL128C ...    67   1e-10
Kwal_17.2687 s17 complement(6084..7172) [1089 bp, 362 aa] {ON} Y...    66   1e-10
ACR119W Chr3 (560761..563556) [2796 bp, 931 aa] {ON} Syntenic ho...    67   1e-10
NDAI0G01280 Chr7 complement(281834..283573) [1740 bp, 579 aa] {O...    67   1e-10
Suva_14.32 Chr14 complement(52757..53884) [1128 bp, 375 aa] {ON}...    66   1e-10
TBLA0H00370 Chr8 (71216..73393) [2178 bp, 725 aa] {ON} Anc_2.425...    67   1e-10
TBLA0H02950 Chr8 complement(721123..723906) [2784 bp, 927 aa] {O...    67   1e-10
KNAG0B01130 Chr2 complement(208528..210279) [1752 bp, 583 aa] {O...    67   1e-10
NDAI0E02390 Chr5 complement(496256..498907) [2652 bp, 883 aa] {O...    67   1e-10
ZYRO0B04796g Chr2 (385611..387683) [2073 bp, 690 aa] {ON} simila...    67   1e-10
Skud_10.49 Chr10 complement(81651..84206) [2556 bp, 851 aa] {ON}...    67   1e-10
TBLA0A07770 Chr1 complement(1916632..1917939) [1308 bp, 435 aa] ...    66   1e-10
Suva_11.54 Chr11 complement(116221..118401) [2181 bp, 726 aa] {O...    67   1e-10
Smik_7.93 Chr7 complement(158441..160132) [1692 bp, 563 aa] {ON}...    67   1e-10
Kpol_529.18 s529 (52782..55118) [2337 bp, 778 aa] {ON} (52782..5...    67   1e-10
Suva_14.42 Chr14 (65645..68239) [2595 bp, 864 aa] {ON} YNL298W (...    67   1e-10
Suva_7.83 Chr7 complement(159329..161038) [1710 bp, 569 aa] {ON}...    67   1e-10
Kpol_1018.148 s1018 (393064..394413) [1350 bp, 449 aa] {ON} (393...    66   1e-10
Kpol_534.14 s534 (34465..34591,34724..35616) [1020 bp, 339 aa] {...    65   1e-10
TPHA0G01710 Chr7 complement(350452..352869) [2418 bp, 805 aa] {O...    67   1e-10
KNAG0G01240 Chr7 (277868..280597) [2730 bp, 909 aa] {ON} Anc_8.1...    67   1e-10
AER222C Chr5 complement(1043479..1044750) [1272 bp, 423 aa] {ON}...    66   1e-10
Kpol_1035.17 s1035 complement(39908..41503) [1596 bp, 531 aa] {O...    66   1e-10
Ecym_8399 Chr8 (821221..824766) [3546 bp, 1181 aa] {ON} similar ...    67   1e-10
ZYRO0C12408g Chr3 (979857..981593) [1737 bp, 578 aa] {ON} highly...    66   2e-10
KAFR0E00330 Chr5 complement(74619..76574) [1956 bp, 651 aa] {ON}...    67   2e-10
SAKL0H24706g Chr8 (2145552..2149100) [3549 bp, 1182 aa] {ON} sim...    67   2e-10
YJL165C Chr10 complement(106894..109461) [2568 bp, 855 aa] {ON} ...    67   2e-10
TDEL0G02620 Chr7 (501589..501613,501677..502566) [915 bp, 304 aa...    65   2e-10
NDAI0H03520 Chr8 (860096..861472) [1377 bp, 458 aa] {ON}               66   2e-10
TBLA0D02240 Chr4 complement(561856..566547) [4692 bp, 1563 aa] {...    67   2e-10
Smik_10.106 Chr10 complement(175752..177776) [2025 bp, 674 aa] {...    66   2e-10
CAGL0M02519g Chr13 complement(290723..292993) [2271 bp, 756 aa] ...    67   2e-10
Kwal_23.3590 s23 complement(353755..355254) [1500 bp, 499 aa] {O...    66   2e-10
Skud_16.398 Chr16 (712145..713827) [1683 bp, 560 aa] {ON} YPR111...    66   2e-10
Kwal_47.17263 s47 complement(321115..324498) [3384 bp, 1127 aa] ...    67   2e-10
Kwal_26.7276 s26 (293129..295069) [1941 bp, 646 aa] {ON} YJL106W...    66   2e-10
KNAG0J01670 Chr10 complement(304021..307050) [3030 bp, 1009 aa] ...    67   2e-10
KNAG0J01590 Chr10 (292565..294982) [2418 bp, 805 aa] {ON} Anc_8....    66   2e-10
CAGL0M08360g Chr13 complement(833220..835520) [2301 bp, 766 aa] ...    66   2e-10
CAGL0E05720g Chr5 (569265..570341) [1077 bp, 358 aa] {ON} simila...    65   2e-10
TPHA0A02770 Chr1 complement(597703..600129) [2427 bp, 808 aa] {O...    66   2e-10
NDAI0G03920 Chr7 complement(934765..935889) [1125 bp, 374 aa] {O...    65   2e-10
Ecym_4523 Chr4 (1039929..1042070) [2142 bp, 713 aa] {ON} similar...    66   2e-10
TDEL0D04450 Chr4 complement(811665..812924) [1260 bp, 419 aa] {O...    65   2e-10
KLLA0F02838g Chr6 (264329..266596) [2268 bp, 755 aa] {ON} simila...    66   2e-10
KAFR0C03020 Chr3 complement(601565..603121) [1557 bp, 518 aa] {O...    66   2e-10
SAKL0H16632g Chr8 complement(1461613..1464801) [3189 bp, 1062 aa...    66   2e-10
TDEL0E05310 Chr5 (972769..973893) [1125 bp, 374 aa] {ON} Anc_6.2...    65   2e-10
CAGL0B01925g Chr2 (176316..179150) [2835 bp, 944 aa] {ON} simila...    66   2e-10
NDAI0D04110 Chr4 (966439..967560) [1122 bp, 373 aa] {ON} Anc_4.192     65   2e-10
Smik_15.417 Chr15 (725513..727933) [2421 bp, 806 aa] {ON} YOR233...    66   2e-10
NCAS0G03420 Chr7 (628644..630668) [2025 bp, 674 aa] {ON} Anc_1.507     66   2e-10
Smik_10.349 Chr10 (534756..537209) [2454 bp, 817 aa] {ON} YJR059...    66   2e-10
SAKL0C12386g Chr3 complement(1108341..1110923) [2583 bp, 860 aa]...    66   2e-10
YJL128C Chr10 complement(178097..180103) [2007 bp, 668 aa] {ON} ...    66   2e-10
KLTH0F17490g Chr6 (1413752..1414774) [1023 bp, 340 aa] {ON} high...    65   2e-10
AEL185C Chr5 complement(291129..292676) [1548 bp, 515 aa] {ON} S...    65   2e-10
TBLA0A01580 Chr1 complement(367370..369976) [2607 bp, 868 aa] {O...    66   2e-10
Smik_10.65 Chr10 complement(104987..107545) [2559 bp, 852 aa] {O...    66   3e-10
Ecym_3525 Chr3 (993328..995784) [2457 bp, 818 aa] {ON} similar t...    66   3e-10
Suva_16.439 Chr16 (755102..756796) [1695 bp, 564 aa] {ON} YPR111...    65   3e-10
YPR111W Chr16 (747306..749000) [1695 bp, 564 aa] {ON}  DBF20Ser/...    65   3e-10
Suva_6.246 Chr6 (439815..442373) [2559 bp, 852 aa] {ON} YJL165C ...    66   3e-10
Kwal_55.21709 s55 (948619..949641) [1023 bp, 340 aa] {ON} YOR061...    64   3e-10
Kwal_47.17868 s47 (587449..588546) [1098 bp, 365 aa] {ON} YMR139...    65   3e-10
Smik_16.354 Chr16 (625456..627150) [1695 bp, 564 aa] {ON} YPR111...    65   3e-10
KAFR0A01340 Chr1 (259300..261171) [1872 bp, 623 aa] {ON} Anc_1.2...    65   3e-10
TPHA0C04650 Chr3 complement(1006190..1007119) [930 bp, 309 aa] {...    64   3e-10
Ecym_8339 Chr8 (684113..686875) [2763 bp, 920 aa] {ON} similar t...    65   3e-10
CAGL0H09152g Chr8 complement(895722..898055) [2334 bp, 777 aa] {...    65   3e-10
KNAG0K01710 Chr11 (360438..361931) [1494 bp, 497 aa] {ON} Anc_3....    65   3e-10
NCAS0B08300 Chr2 (1582859..1584796) [1938 bp, 645 aa] {ON} Anc_1...    65   3e-10
SAKL0G08250g Chr7 (703212..705707) [2496 bp, 831 aa] {ON} simila...    65   3e-10
Kpol_1072.19 s1072 (44906..47596) [2691 bp, 896 aa] {ON} (44906....    65   4e-10
AEL118C Chr5 complement(399738..401789) [2052 bp, 683 aa] {ON} S...    65   4e-10
KAFR0A08360 Chr1 complement(1677561..1680050) [2490 bp, 829 aa] ...    65   4e-10
CAGL0H01837g Chr8 complement(176352..178736) [2385 bp, 794 aa] {...    65   4e-10
Kpol_1004.19 s1004 (36090..36101,36217..37689) [1485 bp, 494 aa]...    65   4e-10
YKL168C Chr11 complement(131288..133462) [2175 bp, 724 aa] {ON} ...    65   4e-10
TPHA0O01030 Chr15 complement(191875..193890) [2016 bp, 671 aa] {...    65   4e-10
ZYRO0E05588g Chr5 (430271..431686) [1416 bp, 471 aa] {ON} simila...    65   4e-10
KNAG0C02430 Chr3 complement(472213..474804) [2592 bp, 863 aa] {O...    65   4e-10
Kpol_1050.13 s1050 (34788..36578) [1791 bp, 596 aa] {ON} (34788....    65   4e-10
KLTH0H03982g Chr8 complement(363432..364628) [1197 bp, 398 aa] {...    64   4e-10
Kpol_1037.7 s1037 (15938..17182) [1245 bp, 414 aa] {ON} (15938.....    64   4e-10
ACL053C Chr3 complement(273163..276708) [3546 bp, 1181 aa] {ON} ...    65   4e-10
Ecym_3371 Chr3 (706573..706597,706675..707570) [921 bp, 306 aa] ...    64   4e-10
ZYRO0A07546g Chr1 complement(619278..620747,620833..620847) [148...    65   4e-10
Kpol_1031.32 s1031 (76827..78821) [1995 bp, 664 aa] {ON} (76827....    65   4e-10
NCAS0B01450 Chr2 (237824..239341) [1518 bp, 505 aa] {ON} Anc_8.652     65   5e-10
TDEL0E00690 Chr5 (144269..146770) [2502 bp, 833 aa] {ON} Anc_3.6...    65   5e-10
Ecym_2744 Chr2 complement(1442759..1444465) [1707 bp, 568 aa] {O...    65   5e-10
CAGL0J11308g Chr10 (1099969..1102155) [2187 bp, 728 aa] {ON} sim...    65   5e-10
Ecym_6136 Chr6 complement(248721..250187) [1467 bp, 488 aa] {ON}...    64   5e-10
Kwal_14.1159 s14 complement(219896..224461) [4566 bp, 1521 aa] {...    65   5e-10
NCAS0A11530 Chr1 (2281835..2283223) [1389 bp, 462 aa] {ON} Anc_3...    64   5e-10
CAGL0M03729g Chr13 complement(420316..422901) [2586 bp, 861 aa] ...    65   5e-10
KAFR0F01790 Chr6 complement(347491..349884) [2394 bp, 797 aa] {O...    65   6e-10
TPHA0L00500 Chr12 (83710..86589) [2880 bp, 959 aa] {ON} Anc_7.86...    65   6e-10
Suva_12.148 Chr12 (223571..225982) [2412 bp, 804 aa] {ON} YJR059...    65   6e-10
KAFR0A06190 Chr1 complement(1251546..1253690) [2145 bp, 714 aa] ...    65   6e-10
Kpol_448.13 s448 (25051..27063) [2013 bp, 670 aa] {ON} (25051..2...    65   6e-10
KAFR0H01460 Chr8 complement(269957..271705) [1749 bp, 582 aa] {O...    64   6e-10
TBLA0B06940 Chr2 (1639189..1643520) [4332 bp, 1443 aa] {ON} Anc_...    65   6e-10
KNAG0A02220 Chr1 complement(198240..199979) [1740 bp, 579 aa] {O...    64   6e-10
KLTH0D11044g Chr4 complement(901388..903937) [2550 bp, 849 aa] {...    65   7e-10
SAKL0D09240g Chr4 (764130..765761) [1632 bp, 543 aa] {ON} some s...    64   7e-10
KAFR0A03710 Chr1 (758918..760399) [1482 bp, 493 aa] {ON} Anc_8.6...    64   7e-10
Suva_16.274 Chr16 complement(476249..477916) [1668 bp, 555 aa] {...    64   7e-10
NDAI0G05060 Chr7 complement(1227369..1229495) [2127 bp, 708 aa] ...    64   7e-10
YOL128C Chr15 complement(78352..79479) [1128 bp, 375 aa] {ON}  Y...    64   7e-10
ZYRO0A05192g Chr1 complement(416951..418198) [1248 bp, 415 aa] {...    64   7e-10
KLLA0E15313g Chr5 (1362851..1365025) [2175 bp, 724 aa] {ON} simi...    64   7e-10
NCAS0C04540 Chr3 complement(929920..931056) [1137 bp, 378 aa] {O...    64   8e-10
KAFR0K01540 Chr11 (320997..322706) [1710 bp, 569 aa] {ON} Anc_3....    64   8e-10
AFL217C Chr6 complement(30765..32840) [2076 bp, 691 aa] {ON} Syn...    64   8e-10
TDEL0B06320 Chr2 (1118534..1119868) [1335 bp, 444 aa] {ON} Anc_1...    64   9e-10
Skud_6.89 Chr6 (166257..167594) [1338 bp, 446 aa] {ON} YFR014C (...    64   9e-10
KLLA0A06820g Chr1 complement(615686..618004) [2319 bp, 772 aa] {...    64   9e-10
Kpol_1056.20 s1056 complement(44529..46724) [2196 bp, 731 aa] {O...    64   9e-10
TDEL0G00630 Chr7 complement(128151..129764) [1614 bp, 537 aa] {O...    64   9e-10
Skud_10.87 Chr10 complement(153140..155164) [2025 bp, 674 aa] {O...    64   9e-10
Kpol_1069.13 s1069 complement(27223..28506) [1284 bp, 427 aa] {O...    64   9e-10
AEL205W Chr5 (246871..249252) [2382 bp, 793 aa] {ON} Syntenic ho...    64   1e-09
TBLA0B07330 Chr2 complement(1745229..1746821,1746990..1747013) [...    64   1e-09
TDEL0B04490 Chr2 (792559..793629) [1071 bp, 356 aa] {ON} Anc_8.1...    63   1e-09
YFR014C Chr6 complement(172537..173877) [1341 bp, 446 aa] {ON}  ...    64   1e-09
Suva_10.345 Chr10 (601536..603365) [1830 bp, 609 aa] {ON} YLR248...    64   1e-09
NCAS0H01780 Chr8 complement(341549..344773) [3225 bp, 1074 aa] {...    64   1e-09
Kpol_1045.46 s1045 complement(106567..108372) [1806 bp, 601 aa] ...    64   1e-09
KAFR0B00920 Chr2 (170792..172300) [1509 bp, 502 aa] {ON} Anc_7.3...    64   1e-09
KNAG0B04460 Chr2 (856495..859461) [2967 bp, 988 aa] {ON} Anc_5.3...    64   1e-09
TDEL0E03300 Chr5 complement(621448..626409) [4962 bp, 1653 aa] {...    64   1e-09
Kwal_23.5290 s23 complement(1095011..1097470) [2460 bp, 819 aa] ...    64   1e-09
KLTH0F06578g Chr6 complement(568519..570309) [1791 bp, 596 aa] {...    64   1e-09
KLTH0F09988g Chr6 complement(868693..869931) [1239 bp, 412 aa] {...    63   1e-09
YLR248W Chr12 (634252..636084) [1833 bp, 610 aa] {ON}  RCK2Prote...    64   1e-09
KLTH0E03652g Chr5 (330227..332671) [2445 bp, 814 aa] {ON} simila...    64   1e-09
Ecym_6359 Chr6 complement(699564..702176) [2613 bp, 870 aa] {ON}...    64   1e-09
YGL158W Chr7 (207033..208571) [1539 bp, 512 aa] {ON}  RCK1Protei...    64   1e-09
Kpol_1012.6 s1012 (11581..13467) [1887 bp, 628 aa] {ON} (11581.....    64   1e-09
NCAS0A08880 Chr1 (1756271..1757539) [1269 bp, 422 aa] {ON} Anc_1...    63   1e-09
KNAG0G01430 Chr7 complement(322758..323822) [1065 bp, 354 aa] {O...    63   1e-09
Suva_15.32 Chr15 complement(56314..57447) [1134 bp, 377 aa] {ON}...    63   1e-09
CAGL0H10208g Chr8 complement(996853..999936) [3084 bp, 1027 aa] ...    64   1e-09
SAKL0H19668g Chr8 (1736301..1737674) [1374 bp, 457 aa] {ON} high...    63   1e-09
Smik_11.60 Chr11 complement(116793..118970) [2178 bp, 725 aa] {O...    64   1e-09
Kwal_56.23717 s56 complement(674222..676798) [2577 bp, 858 aa] {...    64   1e-09
NCAS0A14050 Chr1 complement(2763082..2764551) [1470 bp, 489 aa] ...    63   1e-09
KLTH0G13288g Chr7 complement(1139058..1142486) [3429 bp, 1142 aa...    64   1e-09
SAKL0H11352g Chr8 complement(975064..976857) [1794 bp, 597 aa] {...    63   1e-09
CAGL0L12650g Chr12 (1360085..1361788) [1704 bp, 567 aa] {ON} sim...    63   1e-09
Ecym_2540 Chr2 (1048071..1049792) [1722 bp, 573 aa] {ON} similar...    63   1e-09
Skud_15.25 Chr15 complement(43728..44864) [1137 bp, 378 aa] {ON}...    62   1e-09
NDAI0C03610 Chr3 (829317..831476) [2160 bp, 719 aa] {ON} Anc_5.38      64   1e-09
Ecym_6425 Chr6 (825834..828095) [2262 bp, 753 aa] {ON} similar t...    64   1e-09
ABL143C Chr2 complement(128215..130392) [2178 bp, 725 aa] {ON} S...    63   2e-09
ZYRO0C02772g Chr3 (216325..217464) [1140 bp, 379 aa] {ON} highly...    62   2e-09
TPHA0C04570 Chr3 (985491..987071) [1581 bp, 526 aa] {ON} Anc_2.3...    63   2e-09
NCAS0A02180 Chr1 (410419..411489) [1071 bp, 356 aa] {ON} Anc_4.192     62   2e-09
KLTH0E11396g Chr5 (1018348..1020069) [1722 bp, 573 aa] {ON} simi...    63   2e-09
CAGL0F00649g Chr6 (71961..73505) [1545 bp, 514 aa] {ON} similar ...    63   2e-09
Kpol_1044.26 s1044 complement(60216..62666) [2451 bp, 816 aa] {O...    63   2e-09
Skud_7.350 Chr7 (580913..582022) [1110 bp, 369 aa] {ON} YGR052W ...    62   2e-09
NDAI0E01290 Chr5 complement(255593..257782) [2190 bp, 729 aa] {O...    63   2e-09
KLTH0B07106g Chr2 (571005..573260) [2256 bp, 751 aa] {ON} simila...    63   2e-09
ZYRO0G16632g Chr7 (1360854..1365827) [4974 bp, 1657 aa] {ON} hig...    64   2e-09
TPHA0O01120 Chr15 complement(217462..218751) [1290 bp, 429 aa] {...    62   2e-09
YDL214C Chr4 complement(74446..76545) [2100 bp, 699 aa] {ON}  PR...    63   2e-09
CAGL0G03047g Chr7 (282299..283918) [1620 bp, 539 aa] {ON} highly...    63   2e-09
YGR052W Chr7 (593596..594705) [1110 bp, 369 aa] {ON}  FMP48Putat...    62   2e-09
Smik_12.321 Chr12 (579087..580919) [1833 bp, 610 aa] {ON} YLR248...    63   2e-09
Smik_6.414 Chr6 (666806..667909) [1104 bp, 367 aa] {ON} YPL209C ...    62   2e-09
Suva_8.282 Chr8 (511665..513185) [1521 bp, 506 aa] {ON} YOR231W ...    62   2e-09
KAFR0H02510 Chr8 complement(476574..479213) [2640 bp, 879 aa] {O...    63   2e-09
KLTH0D03080g Chr4 (295808..297730) [1923 bp, 640 aa] {ON} simila...    63   2e-09
KLTH0A01320g Chr1 (118671..121115) [2445 bp, 814 aa] {ON} simila...    63   2e-09
KAFR0A07560 Chr1 (1525225..1527504) [2280 bp, 759 aa] {ON} Anc_2...    63   2e-09
ZYRO0E05170g Chr5 complement(390866..392593) [1728 bp, 575 aa] {...    63   2e-09
Ecym_8004 Chr8 complement(5273..7957) [2685 bp, 894 aa] {ON} sim...    63   2e-09
NDAI0A04040 Chr1 complement(907696..910041) [2346 bp, 781 aa] {O...    63   2e-09
TDEL0C02110 Chr3 (364853..366340) [1488 bp, 495 aa] {ON} Anc_7.3...    62   2e-09
Kwal_27.11830 s27 (964584..966311) [1728 bp, 575 aa] {ON} YPL042...    62   2e-09
TPHA0P01380 Chr16 (278259..279380) [1122 bp, 373 aa] {ON} Anc_3....    62   2e-09
KNAG0C02080 Chr3 complement(404332..405588) [1257 bp, 418 aa] {O...    62   3e-09
TBLA0B00770 Chr2 complement(168444..170519) [2076 bp, 691 aa] {O...    62   3e-09
Ecym_4291 Chr4 complement(620549..623986) [3438 bp, 1145 aa] {ON...    63   3e-09
YPL042C Chr16 complement(473040..474707) [1668 bp, 555 aa] {ON} ...    62   3e-09
CAGL0M10829g Chr13 complement(1076233..1081236) [5004 bp, 1667 a...    63   3e-09
TBLA0B08520 Chr2 complement(2038517..2041321) [2805 bp, 934 aa] ...    63   3e-09
NCAS0G01820 Chr7 complement(323288..325690) [2403 bp, 800 aa] {O...    62   3e-09
CAGL0L07810g Chr12 complement(859653..861443) [1791 bp, 596 aa] ...    62   3e-09
Smik_4.25 Chr4 complement(52454..54547) [2094 bp, 697 aa] {ON} Y...    62   3e-09
ZYRO0F06798g Chr6 (558198..559676) [1479 bp, 492 aa] {ON} simila...    62   3e-09
NDAI0G05190 Chr7 complement(1258638..1260452) [1815 bp, 604 aa] ...    62   3e-09
TBLA0C04600 Chr3 (1112043..1115990) [3948 bp, 1315 aa] {ON} Anc_...    63   3e-09
KNAG0E00360 Chr5 (54187..55563) [1377 bp, 458 aa] {ON}                 62   3e-09
TBLA0D04420 Chr4 complement(1097314..1099356) [2043 bp, 680 aa] ...    62   3e-09
KNAG0K01250 Chr11 (246241..247467) [1227 bp, 408 aa] {ON} Anc_3....    62   3e-09
ZYRO0G17094g Chr7 complement(1404552..1406804) [2253 bp, 750 aa]...    62   3e-09
Kwal_0.307 s0 (145676..147145) [1470 bp, 490 aa] {OFF} YCR008W (...    62   3e-09
KLLA0A09713g Chr1 (851952..853625) [1674 bp, 557 aa] {ON} simila...    62   3e-09
KNAG0B05880 Chr2 (1155395..1157695) [2301 bp, 766 aa] {ON} Anc_4...    62   3e-09
Kwal_YGOB_0.307 s0 (145676..147175) [1500 bp, 500 aa] {ON} ANNOT...    62   3e-09
AGR058W Chr7 (823626..826841) [3216 bp, 1071 aa] {ON} Syntenic h...    62   3e-09
Ecym_4647 Chr4 (1261859..1263511) [1653 bp, 550 aa] {ON} similar...    62   4e-09
CAGL0I03498g Chr9 (297344..298699) [1356 bp, 451 aa] {ON} simila...    62   4e-09
NDAI0C01850 Chr3 (407978..411712) [3735 bp, 1244 aa] {ON}              62   4e-09
Kwal_55.20189 s55 (288918..291356) [2439 bp, 812 aa] {ON} YHR082...    62   4e-09
KAFR0D04800 Chr4 complement(942369..944690) [2322 bp, 773 aa] {O...    62   4e-09
KNAG0A01330 Chr1 complement(34784..35977) [1194 bp, 397 aa] {ON}...    61   4e-09
Smik_12.155 Chr12 (312480..315968) [3489 bp, 1162 aa] {ON} YLR09...    62   4e-09
Ecym_8129 Chr8 (269437..271626) [2190 bp, 729 aa] {ON} similar t...    62   4e-09
SAKL0D05104g Chr4 (402641..404692) [2052 bp, 683 aa] {ON} simila...    62   4e-09
SAKL0D07656g Chr4 complement(627469..628767) [1299 bp, 432 aa] {...    61   4e-09
KAFR0D04500 Chr4 (887515..889989) [2475 bp, 824 aa] {ON} Anc_1.5...    62   4e-09
TDEL0F00530 Chr6 complement(88187..90517) [2331 bp, 776 aa] {ON}...    62   4e-09
Kwal_33.14434 s33 complement(672031..674310) [2280 bp, 759 aa] {...    62   4e-09
TPHA0J00820 Chr10 (193408..197064) [3657 bp, 1218 aa] {ON} Anc_8...    62   4e-09
Skud_4.225 Chr4 complement(400160..401992) [1833 bp, 610 aa] {ON...    62   4e-09
KAFR0G00460 Chr7 complement(128077..130023) [1947 bp, 648 aa] {O...    62   4e-09
TPHA0L01350 Chr12 (282034..283884) [1851 bp, 616 aa] {ON}              62   4e-09
ZYRO0D03344g Chr4 complement(278347..280326) [1980 bp, 659 aa] {...    62   4e-09
ZYRO0F08272g Chr6 (668685..670508) [1824 bp, 607 aa] {ON} simila...    62   4e-09
KAFR0I02100 Chr9 (431876..433258) [1383 bp, 460 aa] {ON} Anc_1.3...    61   4e-09
ADR300C Chr4 complement(1222344..1225016) [2673 bp, 890 aa] {ON}...    62   4e-09
KNAG0I00590 Chr9 (100275..102068) [1794 bp, 597 aa] {ON}               62   4e-09
KNAG0A03060 Chr1 complement(375640..377142) [1503 bp, 500 aa] {O...    62   4e-09
KNAG0K02370 Chr11 complement(475088..477739) [2652 bp, 883 aa] {...    62   4e-09
Smik_15.25 Chr15 complement(46541..47668) [1128 bp, 375 aa] {ON}...    61   5e-09
SAKL0F11110g Chr6 (868447..869832) [1386 bp, 461 aa] {ON} simila...    61   5e-09
KLLA0D11814g Chr4 complement(1007240..1009021) [1782 bp, 593 aa]...    62   5e-09
KAFR0I01570 Chr9 (330982..332574) [1593 bp, 530 aa] {ON} Anc_2.5...    62   5e-09
KLTH0H12650g Chr8 (1072961..1074592) [1632 bp, 543 aa] {ON} simi...    62   5e-09
NDAI0A00940 Chr1 complement(193710..195800) [2091 bp, 696 aa] {O...    62   5e-09
AFR076W Chr6 (564252..566714) [2463 bp, 820 aa] {ON} Syntenic ho...    62   5e-09
KLLA0D08415g Chr4 (714473..716797) [2325 bp, 774 aa] {ON} simila...    62   5e-09
Suva_4.33 Chr4 complement(63334..65427) [2094 bp, 697 aa] {ON} Y...    62   5e-09
CAGL0J04972g Chr10 (475587..476606) [1020 bp, 339 aa] {ON} some ...    60   5e-09
NCAS0D00630 Chr4 complement(107310..108593) [1284 bp, 427 aa] {O...    61   5e-09
Smik_2.191 Chr2 complement(338792..342118) [3327 bp, 1108 aa] {O...    62   5e-09
Kpol_1031.76 s1031 (193193..194923) [1731 bp, 576 aa] {ON} (1931...    61   5e-09
Kwal_33.14081 s33 complement(519343..521085) [1743 bp, 580 aa] {...    61   6e-09
ZYRO0C09768g Chr3 (740592..742925) [2334 bp, 777 aa] {ON} simila...    62   6e-09
Kwal_33.13222 s33 (127342..127788) [447 bp, 148 aa] {OFF} YDR507...    57   6e-09
CAGL0F04741g Chr6 (478256..479584) [1329 bp, 442 aa] {ON} simila...    61   6e-09
YDL025C Chr4 complement(405344..407206) [1863 bp, 620 aa] {ON}  ...    61   6e-09
YBR059C Chr2 complement(356861..360187) [3327 bp, 1108 aa] {ON} ...    62   6e-09
Smik_4.128 Chr4 (244339..244354,244439..245331) [909 bp, 302 aa]...    60   6e-09
NCAS0G00490 Chr7 complement(83953..84996) [1044 bp, 347 aa] {ON}...    60   6e-09
Ecym_5252 Chr5 (525687..526976) [1290 bp, 429 aa] {ON} similar t...    61   6e-09
ZYRO0E04246g Chr5 complement(322215..324035) [1821 bp, 606 aa] {...    61   7e-09
AGL249C Chr7 complement(234347..236092) [1746 bp, 581 aa] {ON} S...    61   7e-09
Skud_12.164 Chr12 (315700..319182) [3483 bp, 1160 aa] {ON} YLR09...    62   7e-09
Kwal_56.24584 s56 complement(1063271..1064578) [1308 bp, 435 aa]...    61   7e-09
KAFR0B02800 Chr2 (571295..574582) [3288 bp, 1095 aa] {ON} Anc_8....    61   7e-09
TDEL0A01120 Chr1 complement(189217..191466) [2250 bp, 749 aa] {O...    61   7e-09
Skud_4.97 Chr4 (168099..169670) [1572 bp, 523 aa] {ON} YDL159W (...    61   7e-09
TDEL0D01220 Chr4 complement(228529..230451) [1923 bp, 640 aa] {O...    61   8e-09
Suva_3.129 Chr3 (193311..194282) [972 bp, 323 aa] {ON} YCR091W (...    60   8e-09
KNAG0F01240 Chr6 complement(223003..225591) [2589 bp, 862 aa] {O...    61   8e-09
Skud_2.179 Chr2 complement(325193..328465) [3273 bp, 1090 aa] {O...    61   8e-09
TBLA0F02350 Chr6 complement(578797..580467) [1671 bp, 556 aa] {O...    61   8e-09
TBLA0C01320 Chr3 complement(289223..290626) [1404 bp, 467 aa] {O...    60   8e-09
NDAI0A04760 Chr1 complement(1088637..1090103) [1467 bp, 488 aa] ...    60   8e-09
Kwal_0.96 s0 complement(46082..47365) [1284 bp, 427 aa] {ON} YOL...    60   8e-09
CAGL0M02299g Chr13 (273725..276406) [2682 bp, 893 aa] {ON} simil...    61   8e-09
KAFR0B01510 Chr2 complement(284425..286092) [1668 bp, 555 aa] {O...    61   8e-09
ADR379C Chr4 complement(1386598..1388076) [1479 bp, 492 aa] {ON}...    60   8e-09
Kwal_YGOB_23.3471 s23 (305207..305234,305298..306196) [927 bp, 3...    60   9e-09
KNAG0C01040 Chr3 complement(203429..204976) [1548 bp, 515 aa] {O...    60   9e-09
NCAS0A09960 Chr1 complement(1993554..1995926) [2373 bp, 790 aa] ...    61   9e-09
NCAS0B04580 Chr2 (831695..835255) [3561 bp, 1186 aa] {ON} Anc_8....    61   9e-09
Kpol_1044.3 s1044 (4910..5845,5849..7711) [2799 bp, 932 aa] {ON}...    61   9e-09
Suva_15.155 Chr15 complement(267680..269038) [1359 bp, 452 aa] {...    60   1e-08
CAGL0M11396g Chr13 (1122109..1125687) [3579 bp, 1192 aa] {ON} si...    61   1e-08
Kpol_251.4 s251 (5802..8318) [2517 bp, 838 aa] {ON} (5802..8318)...    61   1e-08
TBLA0C06820 Chr3 (1645811..1647508) [1698 bp, 565 aa] {ON} Anc_5...    60   1e-08
Smik_3.94 Chr3 (128344..130155) [1812 bp, 603 aa] {ON} YCR008W (...    60   1e-08
KAFR0K00280 Chr11 complement(64906..65988) [1083 bp, 360 aa] {ON...    60   1e-08
YDL108W Chr4 (267698..267725,267807..268699) [921 bp, 306 aa] {O...    59   1e-08
Smik_4.209 Chr4 complement(385530..386995,387230..387623) [1860 ...    60   1e-08
TBLA0H01820 Chr8 (429920..433417) [3498 bp, 1165 aa] {ON} Anc_5....    61   1e-08
ZYRO0D06776g Chr4 complement(583027..586641) [3615 bp, 1204 aa] ...    61   1e-08
SAKL0E12958g Chr5 (1066434..1068653) [2220 bp, 739 aa] {ON} simi...    60   1e-08
Skud_7.114 Chr7 (211645..213153) [1509 bp, 502 aa] {ON} YGL158W ...    60   1e-08
Skud_16.70 Chr16 complement(129918..131021) [1104 bp, 367 aa] {O...    60   1e-08
TPHA0H00750 Chr8 complement(150811..152043) [1233 bp, 410 aa] {O...    60   1e-08
KNAG0I01360 Chr9 complement(262712..264556) [1845 bp, 614 aa] {O...    60   1e-08
ZYRO0G02816g Chr7 complement(213421..214980) [1560 bp, 519 aa] {...    60   1e-08
TPHA0A05460 Chr1 (1233608..1235170) [1563 bp, 520 aa] {ON} Anc_5...    60   1e-08
Suva_4.87 Chr4 (160236..161810) [1575 bp, 524 aa] {ON} YDL159W (...    60   1e-08
KLTH0F05918g Chr6 complement(525566..527254) [1689 bp, 562 aa] {...    60   1e-08
TPHA0D01770 Chr4 (365255..370279) [5025 bp, 1674 aa] {ON} Anc_5....    61   1e-08
TPHA0G02990 Chr7 complement(640488..642098) [1611 bp, 536 aa] {O...    60   1e-08
Skud_16.239 Chr16 complement(438063..439727) [1665 bp, 554 aa] {...    60   1e-08
Skud_3.73 Chr3 (110742..112556) [1815 bp, 604 aa] {ON} YCR008W (...    60   1e-08
KNAG0I01480 Chr9 (287733..289055) [1323 bp, 440 aa] {ON} Anc_1.3...    60   1e-08
TDEL0F04060 Chr6 (749896..753276) [3381 bp, 1126 aa] {ON} Anc_8....    60   1e-08
KAFR0F02710 Chr6 (528336..529493) [1158 bp, 385 aa] {ON} Anc_2.3...    60   1e-08
YOL016C Chr15 complement(294777..296120) [1344 bp, 447 aa] {ON} ...    60   1e-08
KLLA0C16577g Chr3 complement(1451181..1452695) [1515 bp, 504 aa]...    60   1e-08
SAKL0D08294g Chr4 (692455..693966) [1512 bp, 503 aa] {ON} some s...    60   1e-08
KLLA0E17073g Chr5 complement(1515721..1518279) [2559 bp, 852 aa]...    60   1e-08
NCAS0A12200 Chr1 (2417539..2419782) [2244 bp, 747 aa] {ON} Anc_1...    60   2e-08
NDAI0H03460 Chr8 complement(836849..838726) [1878 bp, 625 aa] {O...    60   2e-08
NCAS0A09570 Chr1 complement(1907017..1909200) [2184 bp, 727 aa] ...    60   2e-08
Smik_15.153 Chr15 complement(261920..263248) [1329 bp, 442 aa] {...    59   2e-08
KLLA0F12188g Chr6 (1122745..1124385) [1641 bp, 546 aa] {ON} some...    60   2e-08
SAKL0E06534g Chr5 complement(533369..534267,534334..534358) [924...    59   2e-08
Smik_16.193 Chr16 complement(350311..351978) [1668 bp, 555 aa] {...    60   2e-08
Smik_4.79 Chr4 (149246..150796) [1551 bp, 516 aa] {ON} YDL159W (...    60   2e-08
Skud_12.329 Chr12 (580813..582645) [1833 bp, 610 aa] {ON} YLR248...    60   2e-08
KLLA0F16467g Chr6 (1519800..1520822) [1023 bp, 340 aa] {ON} high...    59   2e-08
NDAI0J01990 Chr10 (491491..493758) [2268 bp, 755 aa] {ON} Anc_4....    60   2e-08
NDAI0E03080 Chr5 complement(653882..655798) [1917 bp, 638 aa] {O...    60   2e-08
Skud_15.144 Chr15 complement(254620..255969) [1350 bp, 449 aa] {...    59   2e-08
KAFR0I02440 Chr9 complement(493668..495128) [1461 bp, 486 aa] {O...    59   2e-08
TPHA0B01010 Chr2 complement(229538..231634) [2097 bp, 698 aa] {O...    60   2e-08
YHR082C Chr8 complement(268459..271548) [3090 bp, 1029 aa] {ON} ...    60   2e-08
YDL159W Chr4 (172481..174028) [1548 bp, 515 aa] {ON}  STE7Signal...    60   2e-08
AER195C Chr5 complement(1005431..1006945) [1515 bp, 504 aa] {ON}...    59   2e-08
Suva_4.297 Chr4 complement(523650..526973) [3324 bp, 1107 aa] {O...    60   2e-08
TPHA0O01620 Chr15 (321912..324359) [2448 bp, 815 aa] {ON} Anc_2....    60   2e-08
KAFR0C04480 Chr3 (894906..896213) [1308 bp, 435 aa] {ON} Anc_1.3...    59   2e-08
YCR008W Chr3 (128470..130281) [1812 bp, 603 aa] {ON}  SAT4Ser/Th...    60   2e-08
Suva_3.33 Chr3 (42176..44020) [1845 bp, 614 aa] {ON} YCR008W (REAL)    60   2e-08
TPHA0B03130 Chr2 complement(719624..721372) [1749 bp, 582 aa] {O...    59   2e-08
KNAG0D01090 Chr4 complement(183319..184437) [1119 bp, 372 aa] {O...    59   2e-08
Suva_4.223 Chr4 complement(395869..397719) [1851 bp, 616 aa] {ON...    59   2e-08
TBLA0B01990 Chr2 complement(458264..461623) [3360 bp, 1119 aa] {...    60   2e-08
NDAI0F03390 Chr6 (816047..818380) [2334 bp, 777 aa] {ON}               60   2e-08
TBLA0B09740 Chr2 (2312062..2314815) [2754 bp, 917 aa] {ON} Anc_2...    60   2e-08
KAFR0I02010 Chr9 complement(411589..412887) [1299 bp, 432 aa] {O...    59   2e-08
KLTH0G18612g Chr7 (1604066..1608640) [4575 bp, 1524 aa] {ON} sim...    60   2e-08
CAGL0K10604g Chr11 complement(1030055..1031395) [1341 bp, 446 aa...    59   2e-08
YNL183C Chr14 complement(293137..295509) [2373 bp, 790 aa] {ON} ...    60   2e-08
KLLA0E11947g Chr5 complement(1060048..1061892) [1845 bp, 614 aa]...    59   2e-08
TDEL0E01820 Chr5 complement(348423..349403) [981 bp, 326 aa] {ON...    58   3e-08
KLTH0F09504g Chr6 (824743..824770,824831..825729) [927 bp, 308 a...    58   3e-08
KNAG0E01390 Chr5 (275055..276776) [1722 bp, 573 aa] {ON} Anc_1.4...    59   3e-08
Suva_14.158 Chr14 complement(289281..291650) [2370 bp, 789 aa] {...    59   3e-08
KLLA0F22297g Chr6 complement(2083448..2085547) [2100 bp, 699 aa]...    59   3e-08
AAL029W Chr1 (289989..291593) [1605 bp, 534 aa] {ON} Syntenic ho...    59   3e-08
NDAI0E01690 Chr5 (335849..337051) [1203 bp, 400 aa] {ON} Anc_2.391     59   3e-08
Kpol_1027.1 s1027 (1..2088) [2088 bp, 695 aa] {ON} (1..2088) [20...    59   3e-08
Skud_8.143 Chr8 complement(242422..245535) [3114 bp, 1037 aa] {O...    59   3e-08
TPHA0H01500 Chr8 complement(336652..339639) [2988 bp, 995 aa] {O...    59   3e-08
KNAG0H03140 Chr8 complement(589553..592363) [2811 bp, 936 aa] {O...    59   3e-08
NCAS0C02390 Chr3 complement(446642..448468) [1827 bp, 608 aa] {O...    59   3e-08
Skud_14.151 Chr14 complement(284115..286490) [2376 bp, 791 aa] {...    59   3e-08
NDAI0D01450 Chr4 (339780..341948) [2169 bp, 722 aa] {ON} Anc_1.507     59   3e-08
NCAS0B05090 Chr2 (946126..949758) [3633 bp, 1210 aa] {ON}              59   3e-08
Kwal_0.155 s0 (84856..86619) [1764 bp, 587 aa] {ON} YLR248W (RCK...    59   3e-08
Skud_11.113 Chr11 complement(207796..209355) [1560 bp, 519 aa] {...    59   3e-08
TDEL0B05820 Chr2 complement(1031136..1032863) [1728 bp, 575 aa] ...    59   4e-08
KNAG0A05920 Chr1 complement(883522..884742) [1221 bp, 406 aa] {O...    58   4e-08
Skud_15.397 Chr15 (711559..713082) [1524 bp, 507 aa] {ON} YOR231...    59   4e-08
KLLA0F19536g Chr6 (1808263..1811577) [3315 bp, 1104 aa] {ON} sim...    59   4e-08
NCAS0A08770 Chr1 complement(1733181..1734890) [1710 bp, 569 aa] ...    59   4e-08
NCAS0C05490 Chr3 (1114733..1115755) [1023 bp, 340 aa] {ON} Anc_5...    58   4e-08
AEL149C Chr5 complement(348350..350533) [2184 bp, 727 aa] {ON} S...    59   4e-08
Smik_15.415 Chr15 (722292..723815) [1524 bp, 507 aa] {ON} YOR231...    58   4e-08
KNAG0G02110 Chr7 (477260..480838) [3579 bp, 1192 aa] {ON} Anc_8....    59   4e-08
TBLA0C00720 Chr3 (149299..151149) [1851 bp, 616 aa] {ON} Anc_1.4...    59   4e-08
Kpol_1072.31 s1072 complement(67104..68684) [1581 bp, 526 aa] {O...    58   5e-08
Kpol_487.14 s487 complement(56520..58394) [1875 bp, 624 aa] {ON}...    59   5e-08
YLR096W Chr12 (332590..336033) [3444 bp, 1147 aa] {ON}  KIN2Seri...    59   5e-08
Ecym_8337 Chr8 (679844..681460) [1617 bp, 538 aa] {ON} similar t...    58   5e-08
NCAS0E01560 Chr5 (294095..295345) [1251 bp, 416 aa] {ON}               58   5e-08
TBLA0C05800 Chr3 complement(1402262..1405207) [2946 bp, 981 aa] ...    59   5e-08
Smik_8.160 Chr8 complement(245207..248323) [3117 bp, 1038 aa] {O...    59   6e-08
Suva_7.334 Chr7 (568847..569956) [1110 bp, 369 aa] {ON} YGR052W ...    57   6e-08
NCAS0C01110 Chr3 (207664..209664) [2001 bp, 666 aa] {ON} Anc_8.716     58   6e-08
TBLA0D03740 Chr4 complement(926538..929057) [2520 bp, 839 aa] {O...    58   6e-08
KNAG0C03830 Chr3 (751393..752877) [1485 bp, 494 aa] {ON} Anc_7.3...    58   6e-08
KLTH0H01584g Chr8 (143065..144453) [1389 bp, 462 aa] {ON} simila...    58   6e-08
KLTH0H11396g Chr8 complement(973355..974668) [1314 bp, 437 aa] {...    57   7e-08
SAKL0G00990g Chr7 complement(89700..90824) [1125 bp, 374 aa] {ON...    57   7e-08
NCAS0D00710 Chr4 (122875..124737) [1863 bp, 620 aa] {ON}               58   7e-08
Kpol_1066.46 s1066 (82874..86551) [3678 bp, 1225 aa] {ON} (82874...    58   7e-08
Smik_6.136 Chr6 (219577..220686) [1110 bp, 369 aa] {ON} YGR052W ...    57   7e-08
TDEL0B01470 Chr2 complement(257397..259169) [1773 bp, 590 aa] {O...    58   7e-08
KLTH0H11858g Chr8 (1013677..1015374) [1698 bp, 565 aa] {ON} some...    58   7e-08
Smik_14.147 Chr14 complement(272373..274742) [2370 bp, 789 aa] {...    58   8e-08
NDAI0B02070 Chr2 (514024..517800) [3777 bp, 1258 aa] {ON}              58   8e-08
ADR313W Chr4 (1255930..1257666) [1737 bp, 578 aa] {ON} Syntenic ...    58   8e-08
AGR027C Chr7 complement(763303..766188) [2886 bp, 961 aa] {ON} S...    58   8e-08
Suva_10.180 Chr10 (337364..340843) [3480 bp, 1159 aa] {ON} YLR09...    58   8e-08
TBLA0F01550 Chr6 complement(385184..386716) [1533 bp, 510 aa] {O...    57   8e-08
ADL217W Chr4 (321491..323743) [2253 bp, 750 aa] {ON} Syntenic ho...    58   8e-08
YPL209C Chr16 complement(156490..157593) [1104 bp, 367 aa] {ON} ...    57   9e-08
Ecym_4773 Chr4 complement(1504949..1506541) [1593 bp, 530 aa] {O...    57   9e-08
TPHA0F02870 Chr6 complement(636574..638259) [1686 bp, 561 aa] {O...    57   9e-08
KAFR0D03100 Chr4 complement(610106..611635) [1530 bp, 509 aa] {O...    57   1e-07
Kpol_489.20 s489 complement(59150..60178) [1029 bp, 342 aa] {ON}...    57   1e-07
NCAS0H03070 Chr8 complement(590494..592440) [1947 bp, 648 aa] {O...    57   1e-07
Smik_4.157 Chr4 complement(289446..290605,290830..291250) [1581 ...    57   1e-07
KNAG0C02250 Chr3 complement(444156..446639) [2484 bp, 827 aa] {O...    57   1e-07
NCAS0C01580 Chr3 (291554..292873) [1320 bp, 439 aa] {ON} Anc_8.652     57   1e-07
SAKL0H01364g Chr8 complement(143450..145141) [1692 bp, 563 aa] {...    57   1e-07
Kwal_26.8703 s26 (905007..906341) [1335 bp, 444 aa] {ON} YOR231W...    57   1e-07
ZYRO0D10252g Chr4 (860458..863109) [2652 bp, 883 aa] {ON} simila...    57   1e-07
TDEL0A02330 Chr1 complement(420205..421662) [1458 bp, 485 aa] {O...    57   1e-07
TDEL0E02510 Chr5 (486415..489156) [2742 bp, 913 aa] {ON} Anc_5.3...    57   1e-07
NCAS0F02520 Chr6 (495799..500631) [4833 bp, 1610 aa] {ON} Anc_5....    58   1e-07
NDAI0E01310 Chr5 complement(260484..262094) [1611 bp, 536 aa] {O...    57   1e-07
ZYRO0D07502g Chr4 complement(652782..654320) [1539 bp, 512 aa] {...    57   1e-07
KLTH0D10670g Chr4 (877472..878806) [1335 bp, 444 aa] {ON} some s...    57   1e-07
Suva_15.275 Chr15 complement(470782..473862) [3081 bp, 1026 aa] ...    57   1e-07
TPHA0I00820 Chr9 (177222..179651) [2430 bp, 809 aa] {ON} Anc_1.2...    57   1e-07
SAKL0E04950g Chr5 (401903..402994) [1092 bp, 363 aa] {ON} highly...    56   1e-07
CAGL0D02244g Chr4 complement(229504..230967) [1464 bp, 487 aa] {...    57   1e-07
CAGL0K01661g Chr11 complement(147781..149229) [1449 bp, 482 aa] ...    57   1e-07
NDAI0G05300 Chr7 (1289208..1290521) [1314 bp, 437 aa] {ON} Anc_1...    57   1e-07
KLLA0F23507g Chr6 complement(2198603..2200066) [1464 bp, 487 aa]...    57   1e-07
TPHA0H01300 Chr8 (293254..294282) [1029 bp, 342 aa] {ON} Anc_5.6...    56   1e-07
Smik_1.78 Chr1 complement(147996..149303) [1308 bp, 435 aa] {ON}...    57   1e-07
TPHA0G01730 Chr7 complement(355001..356779) [1779 bp, 592 aa] {O...    57   1e-07
YDR283C Chr4 complement(1025070..1030049) [4980 bp, 1659 aa] {ON...    57   1e-07
KNAG0D04040 Chr4 (730581..731897) [1317 bp, 438 aa] {ON} Anc_4.1...    57   1e-07
YOR231W Chr15 (772601..774127) [1527 bp, 508 aa] {ON}  MKK1Mitog...    57   2e-07
Smik_4.532 Chr4 complement(956572..961554) [4983 bp, 1660 aa] {O...    57   2e-07
ADL283W Chr4 (205173..205197,205250..206145) [921 bp, 306 aa] {O...    55   2e-07
KNAG0L01860 Chr12 (336795..337817) [1023 bp, 340 aa] {ON} Anc_5....    56   2e-07
TDEL0H04100 Chr8 complement(706443..707306,707369..707974) [1470...    56   2e-07
NDAI0A01970 Chr1 (440268..442184) [1917 bp, 638 aa] {ON} Anc_7.335     57   2e-07
NDAI0H03740 Chr8 (912611..915373) [2763 bp, 920 aa] {ON} Anc_2.71      57   2e-07
AGR334W Chr7 (1355098..1356693) [1596 bp, 531 aa] {ON} Syntenic ...    57   2e-07
NDAI0G05370 Chr7 (1313015..1315555) [2541 bp, 846 aa] {ON} Anc_1...    57   2e-07
KNAG0J01950 Chr10 complement(352815..354317) [1503 bp, 500 aa] {...    56   2e-07
KLTH0A03542g Chr1 (306667..307803) [1137 bp, 378 aa] {ON} highly...    56   2e-07
NCAS0F02410 Chr6 complement(476683..478071) [1389 bp, 462 aa] {O...    56   2e-07
ZYRO0E06864g Chr5 complement(516731..520078) [3348 bp, 1115 aa] ...    57   2e-07
CAGL0G02035g Chr7 (179911..180930) [1020 bp, 339 aa] {ON} highly...    55   2e-07
Kpol_1052.22 s1052 (72364..75669) [3306 bp, 1101 aa] {ON} (72364...    57   2e-07
TDEL0A05980 Chr1 (1049221..1050771) [1551 bp, 516 aa] {ON} Anc_8...    56   2e-07
KLLA0C14278g Chr3 (1240990..1242615) [1626 bp, 541 aa] {ON} simi...    56   2e-07
TBLA0C03180 Chr3 complement(770462..775468) [5007 bp, 1668 aa] {...    57   2e-07
Kwal_33.13681 s33 complement(350547..352694) [2148 bp, 715 aa] {...    56   2e-07
Kpol_1041.29 s1041 (73725..74876) [1152 bp, 383 aa] {ON} (73725....    55   2e-07
Suva_2.449 Chr2 complement(789612..794603) [4992 bp, 1663 aa] {O...    57   2e-07
Suva_4.138 Chr4 (256421..257197) [777 bp, 258 aa] {ON} YDL108W (...    55   2e-07
NCAS0A08610 Chr1 complement(1700839..1702704) [1866 bp, 621 aa] ...    56   2e-07
ADR204W Chr4 (1062593..1063612) [1020 bp, 339 aa] {ON} Syntenic ...    55   3e-07
ZYRO0B16038g Chr2 (1300484..1301515) [1032 bp, 343 aa] {ON} high...    55   3e-07
TPHA0O01080 Chr15 complement(205407..207653) [2247 bp, 748 aa] {...    56   3e-07
TPHA0K02030 Chr11 (432238..434505) [2268 bp, 755 aa] {ON} Anc_4....    56   3e-07
ACR196C Chr3 complement(692321..693913) [1593 bp, 530 aa] {ON} S...    56   3e-07
KNAG0D02790 Chr4 (507235..508848) [1614 bp, 537 aa] {ON} Anc_5.3...    56   3e-07
CAGL0J03828g Chr10 (365325..366728) [1404 bp, 467 aa] {ON} simil...    55   3e-07
CAGL0L06820g Chr12 (769035..770135) [1101 bp, 366 aa] {ON} highl...    55   3e-07
KLTH0F03916g Chr6 complement(348177..350282) [2106 bp, 701 aa] {...    56   3e-07
SAKL0C04576g Chr3 complement(444365..446611) [2247 bp, 748 aa] {...    56   3e-07
KLTH0F18458g Chr6 complement(1491777..1493663) [1887 bp, 628 aa]...    56   3e-07
Skud_1.73 Chr1 (144821..146128) [1308 bp, 435 aa] {ON} YAR018C (...    55   3e-07
SAKL0C07458g Chr3 complement(687452..689395) [1944 bp, 647 aa] {...    56   3e-07
Ecym_4056 Chr4 complement(119406..120428) [1023 bp, 340 aa] {ON}...    55   3e-07
CAGL0K12562g Chr11 (1235695..1240743) [5049 bp, 1682 aa] {ON} si...    56   3e-07
KNAG0B01670 Chr2 (307587..309860) [2274 bp, 757 aa] {ON} Anc_1.2...    56   4e-07
NCAS0D01230 Chr4 complement(225213..226661) [1449 bp, 482 aa] {O...    55   4e-07
KAFR0J01370 Chr10 complement(250424..252766) [2343 bp, 780 aa] {...    55   4e-07
CAGL0K11550g Chr11 (1118971..1120587) [1617 bp, 538 aa] {ON} sim...    55   4e-07
Kpol_530.41 s530 (94710..96326) [1617 bp, 538 aa] {ON} (94710..9...    55   4e-07
TPHA0D00360 Chr4 complement(55596..60206) [4611 bp, 1536 aa] {ON...    56   4e-07
YAR018C Chr1 complement(170396..171703) [1308 bp, 435 aa] {ON}  ...    55   4e-07
NDAI0F00560 Chr6 complement(128674..129717) [1044 bp, 347 aa] {O...    55   4e-07
TPHA0N01450 Chr14 complement(318088..320340) [2253 bp, 750 aa] {...    55   4e-07
Smik_7.115 Chr7 (201140..202663) [1524 bp, 507 aa] {ON} YGL158W ...    55   4e-07
KLLA0C10802g Chr3 complement(926916..931934) [5019 bp, 1672 aa] ...    55   5e-07
TDEL0B02610 Chr2 complement(470263..471282) [1020 bp, 339 aa] {O...    54   5e-07
TBLA0A09370 Chr1 complement(2310412..2311443) [1032 bp, 343 aa] ...    54   5e-07
KAFR0C05130 Chr3 (1018035..1019402) [1368 bp, 455 aa] {ON} Anc_7...    55   5e-07
Suva_8.111 Chr8 (204414..205433) [1020 bp, 339 aa] {ON} YOR061W ...    54   5e-07
CAGL0H01199g Chr8 (110610..115556) [4947 bp, 1648 aa] {ON} highl...    55   5e-07
Smik_15.241 Chr15 (407598..408617) [1020 bp, 339 aa] {ON} YOR061...    54   5e-07
Kpol_2001.46 s2001 (127016..129376) [2361 bp, 786 aa] {ON} (1270...    55   5e-07
CAGL0G04455g Chr7 (426386..428641) [2256 bp, 751 aa] {ON} simila...    55   5e-07
Skud_11.20 Chr11 complement(51603..53558) [1956 bp, 651 aa] {ON}...    55   5e-07
YDL079C Chr4 complement(312951..314044,314337..314748) [1506 bp,...    55   5e-07
SAKL0G10384g Chr7 complement(883824..888848) [5025 bp, 1674 aa] ...    55   5e-07
CAGL0K00693g Chr11 complement(75466..78096) [2631 bp, 876 aa] {O...    55   6e-07
Kpol_1067.14 s1067 (29413..31050) [1638 bp, 545 aa] {ON} (29413....    55   6e-07
ZYRO0D04752g Chr4 complement(397364..398215,398290..398907) [147...    55   6e-07
CAGL0I05192g Chr9 complement(493635..494756) [1122 bp, 373 aa] {...    54   6e-07
TBLA0I01930 Chr9 complement(436511..440596) [4086 bp, 1361 aa] {...    55   7e-07
Smik_4.367 Chr4 (655941..659141) [3201 bp, 1066 aa] {ON} YDR122W...    55   7e-07
KNAG0G00280 Chr7 complement(43196..45262) [2067 bp, 688 aa] {ON}...    55   7e-07
YJL106W Chr10 (221390..223327) [1938 bp, 645 aa] {ON}  IME2Serin...    55   7e-07
YOR061W Chr15 (441534..442553) [1020 bp, 339 aa] {ON}  CKA2Alpha...    54   7e-07
KLTH0B09042g Chr2 (736520..738112) [1593 bp, 530 aa] {ON} simila...    55   7e-07
NDAI0K01480 Chr11 complement(337108..338706) [1599 bp, 532 aa] {...    55   7e-07
KAFR0A02560 Chr1 complement(532248..533351) [1104 bp, 367 aa] {O...    54   7e-07
Skud_4.146 Chr4 (263181..263196,263281..264173) [909 bp, 302 aa]...    54   8e-07
NDAI0G00640 Chr7 (139655..141520) [1866 bp, 621 aa] {ON} Anc_2.284     54   8e-07
Ecym_2650 Chr2 complement(1257641..1260325) [2685 bp, 894 aa] {O...    55   9e-07
Smik_9.156 Chr9 complement(261998..263116) [1119 bp, 372 aa] {ON...    54   9e-07
Smik_6.338 Chr6 (535192..536727) [1536 bp, 511 aa] {ON} YPL140C ...    54   9e-07
KLLA0A02717g Chr1 (245082..246380) [1299 bp, 432 aa] {ON} weakly...    54   9e-07
KLLA0B07579g Chr2 (659591..661759) [2169 bp, 722 aa] {ON} simila...    54   9e-07
TDEL0E02600 Chr5 (501545..504934) [3390 bp, 1129 aa] {ON} Anc_5....    55   9e-07
Suva_1.84 Chr1 complement(148430..149737) [1308 bp, 435 aa] {ON}...    54   9e-07
TBLA0B01650 Chr2 (370837..372306) [1470 bp, 489 aa] {ON} Anc_3.1...    54   9e-07
CAGL0I08349g Chr9 complement(813998..816001) [2004 bp, 667 aa] {...    54   9e-07
KAFR0A01040 Chr1 complement(197612..200350) [2739 bp, 912 aa] {O...    54   1e-06
TBLA0D02070 Chr4 complement(522456..523958) [1503 bp, 500 aa] {O...    54   1e-06
Ecym_6056 Chr6 complement(107449..108888) [1440 bp, 479 aa] {ON}...    54   1e-06
KLTH0D05082g Chr4 complement(457124..458680) [1557 bp, 518 aa] {...    54   1e-06
Suva_16.170 Chr16 complement(296877..298406) [1530 bp, 509 aa] {...    54   1e-06
ZYRO0G04488g Chr7 complement(360635..362545) [1911 bp, 636 aa] {...    54   1e-06
NDAI0C04000 Chr3 (907842..912812) [4971 bp, 1656 aa] {ON} Anc_5....    54   1e-06
ADL043C Chr4 complement(612088..614109) [2022 bp, 673 aa] {ON} S...    54   1e-06
KNAG0B04500 Chr2 (865766..869089) [3324 bp, 1107 aa] {ON} Anc_5....    54   1e-06
NDAI0G03110 Chr7 complement(725984..731107) [5124 bp, 1707 aa] {...    54   1e-06
TBLA0B10030 Chr2 (2399979..2402123) [2145 bp, 714 aa] {ON} Anc_4...    54   1e-06
Suva_11.24 Chr11 complement(52742..52930,52961..54523) [1752 bp,...    54   1e-06
CAGL0K04301g Chr11 (405248..406315) [1068 bp, 355 aa] {ON} simil...    53   1e-06
NCAS0B06260 Chr2 complement(1180650..1182821) [2172 bp, 723 aa] ...    54   1e-06
Kwal_47.18098 s47 (685497..686621) [1125 bp, 374 aa] {ON} YIL035...    53   1e-06
KAFR0B00520 Chr2 (105553..107502) [1950 bp, 649 aa] {ON} Anc_4.1...    54   1e-06
Skud_15.228 Chr15 (403382..404401) [1020 bp, 339 aa] {ON} YOR061...    53   1e-06
YIL035C Chr9 complement(287790..288908) [1119 bp, 372 aa] {ON}  ...    53   1e-06
KLLA0D07304g Chr4 (623352..624749) [1398 bp, 465 aa] {ON} some s...    54   1e-06
KAFR0B03170 Chr2 complement(656163..658025) [1863 bp, 620 aa] {O...    54   1e-06
Skud_9.134 Chr9 complement(256610..257728) [1119 bp, 372 aa] {ON...    53   1e-06
Skud_4.546 Chr4 complement(967636..972618) [4983 bp, 1660 aa] {O...    54   2e-06
SAKL0H24288g Chr8 (2099353..2101317) [1965 bp, 654 aa] {ON} simi...    54   2e-06
Skud_15.519 Chr15 complement(932720..934216) [1497 bp, 498 aa] {...    53   2e-06
NDAI0C05160 Chr3 (1199533..1201026) [1494 bp, 497 aa] {ON} Anc_8...    53   2e-06
KAFR0A00840 Chr1 complement(151896..152894) [999 bp, 332 aa] {ON...    53   2e-06
KAFR0B05410 Chr2 complement(1111152..1112771) [1620 bp, 539 aa] ...    53   2e-06
SAKL0D03234g Chr4 (262365..264941) [2577 bp, 858 aa] {ON} some s...    54   2e-06
Ecym_1508 Chr1 (1045857..1050941) [5085 bp, 1694 aa] {ON} simila...    54   2e-06
SAKL0B11044g Chr2 complement(962142..962940,963019..963086,96315...    53   2e-06
Suva_2.283 Chr2 (489490..492759) [3270 bp, 1089 aa] {ON} YDR122W...    54   2e-06
NCAS0A06000 Chr1 (1184842..1187133) [2292 bp, 763 aa] {ON} Anc_4...    54   2e-06
ACR117W Chr3 (557738..559312) [1575 bp, 524 aa] {ON} Syntenic ho...    53   2e-06
TDEL0F02980 Chr6 (539327..541549) [2223 bp, 740 aa] {ON} Anc_1.1...    53   2e-06
YPL140C Chr16 complement(287514..289034) [1521 bp, 506 aa] {ON} ...    53   2e-06
Kwal_23.3471 s23 (305414..306196) [783 bp, 260 aa] {OFF} YDL108W...    52   2e-06
Skud_15.432 Chr15 complement(761490..763601) [2112 bp, 703 aa] {...    53   2e-06
TBLA0B03590 Chr2 (834488..837022) [2535 bp, 844 aa] {ON} Anc_8.7...    53   2e-06
AFL143C Chr6 complement(164241..165326) [1086 bp, 361 aa] {ON} S...    52   2e-06
Suva_9.165 Chr9 complement(276469..277587) [1119 bp, 372 aa] {ON...    52   2e-06
TBLA0E02460 Chr5 (620609..621745) [1137 bp, 378 aa] {ON} Anc_7.2...    52   2e-06
SAKL0E03344g Chr5 (272024..273754) [1731 bp, 576 aa] {ON} simila...    53   2e-06
CAGL0I04422g Chr9 (394159..395427) [1269 bp, 422 aa] {ON} some s...    53   2e-06
TPHA0G00730 Chr7 (139442..141364) [1923 bp, 640 aa] {ON} Anc_8.7...    53   2e-06
KAFR0K01310 Chr11 (270172..271191) [1020 bp, 339 aa] {ON} Anc_5....    52   2e-06
Suva_8.405 Chr8 complement(730738..732348) [1611 bp, 536 aa] {ON...    53   2e-06
Suva_11.178 Chr11 complement(330253..332184) [1932 bp, 643 aa] {...    53   3e-06
YDR122W Chr4 (694700..697894) [3195 bp, 1064 aa] {ON}  KIN1Serin...    53   3e-06
TDEL0H02380 Chr8 complement(399810..400931) [1122 bp, 373 aa] {O...    52   3e-06
Kwal_14.1273 s14 complement(259953..261200) [1248 bp, 415 aa] {O...    52   3e-06
Kpol_1033.63 s1033 complement(158652..160205) [1554 bp, 517 aa] ...    53   3e-06
NDAI0E03760 Chr5 (817014..818765) [1752 bp, 583 aa] {ON} Anc_7.41      53   3e-06
ZYRO0B00638g Chr2 (42738..44930) [2193 bp, 730 aa] {ON} similar ...    53   3e-06
AAL083W Chr1 (196774..201870) [5097 bp, 1698 aa] {ON} Syntenic h...    53   3e-06
Skud_4.383 Chr4 (666354..669551) [3198 bp, 1065 aa] {ON} YDR122W...    53   3e-06
Skud_12.48 Chr12 complement(97218..99422) [2205 bp, 734 aa] {ON}...    53   3e-06
KNAG0B00260 Chr2 complement(36240..38477) [2238 bp, 745 aa] {ON}...    53   3e-06
Suva_9.104 Chr9 (178011..180428) [2418 bp, 805 aa] {ON} YIL095W ...    53   3e-06
Ecym_2302 Chr2 (587299..588951) [1653 bp, 550 aa] {ON} similar t...    52   3e-06
Smik_9.84 Chr9 (162983..165409) [2427 bp, 808 aa] {ON} YIL095W (...    53   3e-06
NDAI0A05700 Chr1 (1288604..1292077) [3474 bp, 1157 aa] {ON} Anc_...    53   3e-06
KLTH0H03080g Chr8 complement(274038..275078) [1041 bp, 346 aa] {...    52   3e-06
CAGL0D06600g Chr4 (626571..628748) [2178 bp, 725 aa] {ON} simila...    53   3e-06
ZYRO0F12122g Chr6 complement(984069..985910) [1842 bp, 613 aa] {...    52   3e-06
Smik_10.132 Chr10 (212933..214873) [1941 bp, 646 aa] {ON} YJL106...    52   3e-06
KAFR0E01490 Chr5 (298209..303167) [4959 bp, 1652 aa] {ON} Anc_5....    53   3e-06
CAGL0J03432g Chr10 (330031..331899) [1869 bp, 622 aa] {ON} simil...    52   3e-06
KAFR0C00430 Chr3 complement(88561..91410) [2850 bp, 949 aa] {ON}...    53   3e-06
Suva_6.268 Chr6 (470348..472519) [2172 bp, 723 aa] {ON} YJL187C ...    52   3e-06
Skud_16.141 Chr16 complement(259166..260707) [1542 bp, 513 aa] {...    52   3e-06
TBLA0G00820 Chr7 complement(191559..192833) [1275 bp, 424 aa] {O...    52   4e-06
YJL187C Chr10 complement(76803..79262) [2460 bp, 819 aa] {ON}  S...    52   4e-06
NCAS0I03020 Chr9 (555481..557853) [2373 bp, 790 aa] {ON} Anc_1.149     52   4e-06
NCAS0A04010 Chr1 complement(809163..810299) [1137 bp, 378 aa] {O...    52   4e-06
YKL198C Chr11 complement(68232..70220) [1989 bp, 662 aa] {ON}  P...    52   4e-06
SAKL0H07128g Chr8 complement(623681..625141) [1461 bp, 486 aa] {...    52   4e-06
NDAI0G01760 Chr7 (384420..385700) [1281 bp, 426 aa] {ON}               52   4e-06
Kpol_1041.9 s1041 (27806..29059) [1254 bp, 417 aa] {ON} (27806.....    52   4e-06
CAGL0F03707g Chr6 complement(359839..361665) [1827 bp, 608 aa] {...    52   4e-06
Ecym_7206 Chr7 complement(423402..425576) [2175 bp, 724 aa] {ON}...    52   4e-06
Kwal_33.14192 s33 complement(563582..565315) [1734 bp, 577 aa] {...    52   4e-06
CAGL0F03311g Chr6 complement(327599..330736) [3138 bp, 1045 aa] ...    52   5e-06
Kwal_55.21900 s55 complement(1027253..1029130) [1878 bp, 625 aa]...    52   5e-06
Suva_13.319 Chr13 (525309..526421) [1113 bp, 370 aa] {ON} YMR139...    52   5e-06
ZYRO0C12078g Chr3 (946320..948647) [2328 bp, 775 aa] {ON} simila...    52   5e-06
KNAG0H02860 Chr8 (531728..532843) [1116 bp, 371 aa] {ON}               51   5e-06
TPHA0C03380 Chr3 (740939..743032) [2094 bp, 697 aa] {ON} Anc_2.2...    52   5e-06
SAKL0F07854g Chr6 (600324..601442) [1119 bp, 372 aa] {ON} highly...    51   5e-06
Skud_10.107 Chr10 (189314..191254) [1941 bp, 646 aa] {ON} YJL106...    52   5e-06
ZYRO0F01034g Chr6 (80328..82826) [2499 bp, 832 aa] {ON} similar ...    52   5e-06
Klac_YGOB_Anc_8.34 Chr6 (836287..839007,839010..841004) [4716 bp...    52   5e-06
Kpol_1014.8 s1014 (13007..14368) [1362 bp, 453 aa] {ON} (13007.....    52   5e-06
Smik_13.338 Chr13 (528578..529690) [1113 bp, 370 aa] {ON} YMR139...    51   5e-06
Kpol_1063.4 s1063 complement(10790..11932) [1143 bp, 380 aa] {ON...    51   5e-06
KNAG0E03200 Chr5 complement(641437..646020) [4584 bp, 1527 aa] {...    52   5e-06
NDAI0D02970 Chr4 (701299..704058) [2760 bp, 919 aa] {ON} Anc_4.4...    52   6e-06
KLTH0D01386g Chr4 (129448..130053,130132..130974) [1449 bp, 482 ...    52   6e-06
ZYRO0D16170g Chr4 (1348849..1349982) [1134 bp, 377 aa] {ON} high...    51   6e-06
NDAI0A02720 Chr1 complement(612346..613455) [1110 bp, 369 aa] {O...    51   6e-06
AFR372W Chr6 (1109169..1111493) [2325 bp, 774 aa] {ON} Syntenic ...    52   6e-06
Ecym_4364 Chr4 (772870..773997) [1128 bp, 375 aa] {ON} similar t...    51   6e-06
ACR218W Chr3 (731433..736142) [4710 bp, 1569 aa] {ON} Syntenic h...    52   6e-06
NCAS0C03770 Chr3 complement(761101..765897) [4797 bp, 1598 aa] {...    52   6e-06
CAGL0J05082g Chr10 (483782..485743) [1962 bp, 653 aa] {ON} simil...    52   6e-06
NDAI0H00610 Chr8 complement(141913..143022) [1110 bp, 369 aa] {O...    51   7e-06
YMR139W Chr13 (546125..547237) [1113 bp, 370 aa] {ON}  RIM11Prot...    51   7e-06
CAGL0K11990g Chr11 complement(1156224..1159199) [2976 bp, 991 aa...    52   7e-06
Suva_11.108 Chr11 complement(207520..209070) [1551 bp, 516 aa] {...    51   7e-06
NCAS0G03810 Chr7 complement(703842..705827) [1986 bp, 661 aa] {O...    52   7e-06
TBLA0D01200 Chr4 (303528..305198) [1671 bp, 556 aa] {ON} Anc_8.7...    51   7e-06
KAFR0H03330 Chr8 complement(635910..637019) [1110 bp, 369 aa] {O...    51   7e-06
Kwal_23.5668 s23 (1263868..1268937) [5070 bp, 1689 aa] {ON} YDR2...    52   7e-06
SAKL0B01210g Chr2 complement(109892..114658) [4767 bp, 1588 aa] ...    52   7e-06
Ecym_8380 Chr8 (772519..774573) [2055 bp, 684 aa] {ON} similar t...    51   8e-06
NCAS0A13320 Chr1 (2622149..2623258) [1110 bp, 369 aa] {ON}             51   8e-06
Suva_6.182 Chr6 complement(328699..330642) [1944 bp, 647 aa] {ON...    51   8e-06
TPHA0G02090 Chr7 complement(429178..430527) [1350 bp, 449 aa] {O...    51   8e-06
Smik_11.24 Chr11 complement(52600..54522) [1923 bp, 640 aa] {ON}...    51   8e-06
KNAG0F03410 Chr6 (640115..645094) [4980 bp, 1659 aa] {ON}              51   9e-06
Kpol_1002.21 s1002 complement(62702..63895) [1194 bp, 397 aa] {O...    50   9e-06
Kpol_185.2 s185 complement(1614..3704) [2091 bp, 696 aa] {ON} co...    51   9e-06
TDEL0C00590 Chr3 complement(94223..99031) [4809 bp, 1602 aa] {ON...    51   1e-05
Kpol_1064.31 s1064 complement(52651..54350) [1700 bp, 566.666666...    51   1e-05
ADL102C Chr4 complement(503667..504785) [1119 bp, 372 aa] {ON} S...    50   1e-05
Kpol_YGOB_1064.31 s1064 complement(52620..54350) [1731 bp, 577 a...    51   1e-05
KAFR0F02730 Chr6 (537477..539309) [1833 bp, 610 aa] {ON} Anc_4.4...    51   1e-05
YOR267C Chr15 complement(822588..824867) [2280 bp, 759 aa] {ON} ...    51   1e-05
KLTH0G10318g Chr7 (872129..874501) [2373 bp, 790 aa] {ON} simila...    51   1e-05
SAKL0E07722g Chr5 complement(625066..627441) [2376 bp, 791 aa] {...    51   1e-05
NCAS0A10590 Chr1 complement(2108142..2111429) [3288 bp, 1095 aa]...    51   1e-05
TBLA0A03220 Chr1 complement(765108..768590) [3483 bp, 1160 aa] {...    51   1e-05
KLTH0G18194g Chr7 (1570885..1572132) [1248 bp, 415 aa] {ON} weak...    50   1e-05
Ecym_3323 Chr3 (618386..620632) [2247 bp, 748 aa] {ON} similar t...    51   1e-05
KLLA0E04247g Chr5 (382874..383995) [1122 bp, 373 aa] {ON} simila...    50   1e-05
Ecym_8164 Chr8 (342672..346076) [3405 bp, 1134 aa] {ON} similar ...    51   1e-05
Skud_13.300 Chr13 (519521..520633) [1113 bp, 370 aa] {ON} YMR139...    50   1e-05
YIL095W Chr9 (183937..186369) [2433 bp, 810 aa] {ON}  PRK1Protei...    51   1e-05
Skud_4.176 Chr4 complement(308461..309594) [1134 bp, 377 aa] {ON...    50   1e-05
Smik_12.44 Chr12 complement(92046..94262) [2217 bp, 738 aa] {ON}...    50   1e-05
AEL179W Chr5 (302948..303817) [870 bp, 289 aa] {ON} NOHBY510; No...    50   1e-05
NDAI0K01150 Chr11 complement(264377..266527) [2151 bp, 716 aa] {...    50   1e-05
TDEL0F01550 Chr6 (282677..284839) [2163 bp, 720 aa] {ON} Anc_4.4...    50   1e-05
SAKL0H11748g Chr8 complement(1002207..1003541) [1335 bp, 444 aa]...    50   1e-05
Kwal_47.17345 s47 complement(364905..367004) [2100 bp, 699 aa] {...    50   1e-05
Smik_15.535 Chr15 complement(940569..942050) [1482 bp, 493 aa] {...    50   1e-05
Kpol_1055.25 s1055 complement(62930..67933) [5004 bp, 1667 aa] {...    51   1e-05
Smik_14.311 Chr14 complement(558013..559926) [1914 bp, 637 aa] {...    50   1e-05
NCAS0E02230 Chr5 (429499..430176,430250..431104) [1533 bp, 510 a...    50   1e-05
SAKL0F15510g Chr6 complement(1251475..1253373) [1899 bp, 632 aa]...    50   2e-05
KAFR0C03520 Chr3 (715667..720019) [4353 bp, 1450 aa] {ON} Anc_8....    50   2e-05
NCAS0A04440 Chr1 complement(895181..896935) [1755 bp, 584 aa] {O...    50   2e-05
Smik_11.200 Chr11 complement(333676..335592) [1917 bp, 638 aa] {...    50   2e-05
YLL019C Chr12 complement(105686..107899) [2214 bp, 737 aa] {ON} ...    50   2e-05
Kwal_26.7682 s26 complement(470565..472121) [1557 bp, 518 aa] {O...    50   2e-05
KAFR0H01570 Chr8 complement(290698..291897) [1200 bp, 399 aa] {O...    50   2e-05
Suva_10.55 Chr10 complement(110943..113177) [2235 bp, 744 aa] {O...    50   2e-05
TDEL0A06610 Chr1 complement(1151052..1152824) [1773 bp, 590 aa] ...    50   2e-05
YPR161C Chr16 complement(864449..866422) [1974 bp, 657 aa] {ON} ...    50   2e-05
Kwal_23.4276 s23 complement(648061..649626) [1566 bp, 521 aa] {O...    50   2e-05
KNAG0H00560 Chr8 (89502..91268) [1767 bp, 588 aa] {ON} Anc_2.597...    50   2e-05
ADR253W Chr4 (1141941..1143083) [1143 bp, 380 aa] {ON} Syntenic ...    50   2e-05
Suva_8.316 Chr8 complement(561812..563914) [2103 bp, 700 aa] {ON...    50   2e-05
Suva_16.97 Chr16 complement(165977..167083) [1107 bp, 368 aa] {O...    49   2e-05
TDEL0G03220 Chr7 complement(600259..601350) [1092 bp, 363 aa] {O...    49   2e-05
KNAG0A06390 Chr1 complement(974644..976254) [1611 bp, 536 aa] {O...    50   2e-05
KLLA0D12100g Chr4 complement(1031728..1033161) [1434 bp, 477 aa]...    50   2e-05
KAFR0A04070 Chr1 complement(817388..819325) [1938 bp, 645 aa] {O...    50   2e-05
NCAS0B00420 Chr2 complement(54562..56718) [2157 bp, 718 aa] {ON}...    50   2e-05
Kpol_1051.42 s1051 (98030..99379,99382..100212) [2181 bp, 726 aa...    50   2e-05
TBLA0E02590 Chr5 complement(651679..654864) [3186 bp, 1061 aa] {...    50   2e-05
Kpol_1035.40 s1035 (101912..102910,102960..102968,103011..106556...    50   2e-05
Smik_16.420 Chr16 complement(725685..727658) [1974 bp, 657 aa] {...    50   2e-05
TDEL0D04390 Chr4 complement(799835..801340) [1506 bp, 501 aa] {O...    50   2e-05
YNL020C Chr14 complement(595623..597539) [1917 bp, 638 aa] {ON} ...    50   2e-05
KLTH0C07260g Chr3 (626334..629039) [2706 bp, 901 aa] {ON} simila...    50   2e-05
NCAS0C02510 Chr3 complement(468113..469390) [1278 bp, 425 aa] {O...    49   2e-05
TBLA0G01910 Chr7 complement(500551..502596) [2046 bp, 681 aa] {O...    50   2e-05
YOR351C Chr15 complement(995018..996511) [1494 bp, 497 aa] {ON} ...    50   2e-05
Smik_4.494 Chr4 (900954..902321) [1368 bp, 455 aa] {ON} YDR247W ...    49   2e-05
Smik_15.449 Chr15 complement(772245..774437) [2193 bp, 730 aa] {...    50   2e-05
Kwal_27.11542 s27 complement(841389..843764) [2376 bp, 791 aa] {...    50   2e-05
KLLA0F26983g Chr6 (2489326..2490729) [1404 bp, 467 aa] {ON} some...    49   2e-05
TPHA0B02780 Chr2 complement(633307..634449) [1143 bp, 380 aa] {O...    49   2e-05
KLLA0E08405g Chr5 complement(756205..758538) [2334 bp, 777 aa] {...    50   3e-05
Skud_11.181 Chr11 complement(326935..328845) [1911 bp, 636 aa] {...    50   3e-05
Skud_4.237 Chr4 (418979..420502) [1524 bp, 507 aa] {ON} YDL017W ...    49   3e-05
Kwal_27.9804 s27 (69307..70728) [1422 bp, 473 aa] {ON} YDL017W (...    49   3e-05
Suva_4.168 Chr4 complement(302527..303654) [1128 bp, 375 aa] {ON...    49   3e-05
CAGL0F03245g Chr6 complement(316924..320034) [3111 bp, 1036 aa] ...    50   3e-05
TBLA0I01310 Chr9 (279407..281245) [1839 bp, 612 aa] {ON} Anc_2.4...    49   3e-05
TPHA0A02630 Chr1 complement(562516..565164) [2649 bp, 882 aa] {O...    49   3e-05
KNAG0H02020 Chr8 complement(357248..359026) [1779 bp, 592 aa] {O...    49   3e-05
ZYRO0A05060g Chr1 complement(405402..406886) [1485 bp, 494 aa] {...    49   3e-05
TBLA0G03450 Chr7 (913497..919415) [5919 bp, 1972 aa] {ON} Anc_8....    50   3e-05
Ecym_8210 Chr8 (431406..434297) [2892 bp, 963 aa] {ON} similar t...    49   3e-05
TDEL0D03520 Chr4 (647828..650977) [3150 bp, 1049 aa] {ON} Anc_3....    49   3e-05
NDAI0J00420 Chr10 (73312..75606) [2295 bp, 764 aa] {ON} Anc_7.515      49   4e-05
Suva_15.271 Chr15 complement(460466..463813) [3348 bp, 1115 aa] ...    49   4e-05
ABR088C Chr2 complement(546325..547920) [1596 bp, 531 aa] {ON} S...    49   4e-05
KLLA0F17006g Chr6 complement(1561859..1563106) [1248 bp, 415 aa]...    49   4e-05
Kwal_27.11777 s27 (942591..943985) [1395 bp, 464 aa] {ON} YPL026...    49   4e-05
TDEL0D01930 Chr4 complement(373906..375753) [1848 bp, 615 aa] {O...    49   4e-05
SAKL0H05588g Chr8 (502752..504602) [1851 bp, 616 aa] {ON} simila...    49   4e-05
Skud_9.78 Chr9 (160531..162960) [2430 bp, 809 aa] {ON} YIL095W (...    49   4e-05
YKL116C Chr11 complement(221344..222900) [1557 bp, 518 aa] {ON} ...    49   4e-05
KLTH0E07128g Chr5 complement(657986..660064) [2079 bp, 692 aa] {...    49   4e-05
NDAI0E00960 Chr5 (195116..197251) [2136 bp, 711 aa] {ON} Anc_8.716     49   4e-05
AGR315C Chr7 complement(1319993..1322872) [2880 bp, 959 aa] {ON}...    49   4e-05
TDEL0B06900 Chr2 complement(1220590..1222257) [1668 bp, 555 aa] ...    49   5e-05
Ecym_7414 Chr7 (848665..850440) [1776 bp, 591 aa] {ON} similar t...    49   5e-05
Kpol_1072.1 s1072 (686..2683) [1998 bp, 665 aa] {ON} (686..2683)...    49   5e-05
Smik_10.45 Chr10 complement(74813..77278) [2466 bp, 821 aa] {ON}...    49   5e-05
ABR177C Chr2 complement(735829..738090) [2262 bp, 753 aa] {ON} S...    49   5e-05
KLLA0B06501g Chr2 complement(576636..579089) [2454 bp, 817 aa] {...    49   5e-05
Suva_16.491 Chr16 complement(848824..850794) [1971 bp, 656 aa] {...    49   5e-05
TPHA0G01450 Chr7 (297855..299861) [2007 bp, 668 aa] {ON}               49   5e-05
Ecym_1313 Chr1 complement(633556..634455) [900 bp, 299 aa] {ON} ...    48   5e-05
KAFR0F02310 Chr6 (452380..453912) [1533 bp, 510 aa] {ON} Anc_3.1...    49   5e-05
TDEL0G02150 Chr7 (422718..424703) [1986 bp, 661 aa] {ON} Anc_2.2...    49   5e-05
ZYRO0A08448g Chr1 complement(677122..678225) [1104 bp, 367 aa] {...    48   6e-05
Skud_14.309 Chr14 complement(566344..568263) [1920 bp, 639 aa] {...    49   6e-05
ZYRO0F03014g Chr6 complement(255189..260003) [4815 bp, 1604 aa] ...    49   6e-05
TPHA0M01120 Chr13 complement(223548..225914) [2367 bp, 788 aa] {...    49   6e-05
YKL048C Chr11 complement(347214..349136) [1923 bp, 640 aa] {ON} ...    48   6e-05
KNAG0K01660 Chr11 complement(345808..347331) [1524 bp, 507 aa] {...    48   6e-05
KLTH0G06468g Chr7 complement(513119..518251) [5133 bp, 1710 aa] ...    49   7e-05
Suva_6.26 Chr6 complement(42811..48072) [5262 bp, 1753 aa] {ON} ...    49   7e-05
CAGL0M13167g Chr13 complement(1293074..1294906) [1833 bp, 610 aa...    48   8e-05
TBLA0B05930 Chr2 (1400163..1402316) [2154 bp, 717 aa] {ON} Anc_2...    48   8e-05
Smik_6.46 Chr6 complement(84451..89733) [5283 bp, 1760 aa] {ON} ...    48   8e-05
YDL017W Chr4 (424209..425732) [1524 bp, 507 aa] {ON}  CDC7DDK (D...    48   8e-05
Kpol_1066.19 s1066 (31013..32806) [1794 bp, 597 aa] {OFF} (31013...    48   8e-05
Kpol_YGOB_1066.19 s1066 (30983..32806) [1824 bp, 607 aa] {ON} AN...    48   8e-05
TPHA0A04030 Chr1 (901665..904829) [3165 bp, 1054 aa] {ON} Anc_3....    48   9e-05
KAFR0E02850 Chr5 (575512..576786) [1275 bp, 424 aa] {ON} Anc_8.4...    47   1e-04
ADR163W Chr4 (989728..991008) [1281 bp, 426 aa] {ON} Syntenic ho...    47   1e-04
KAFR0F01630 Chr6 complement(323802..326057) [2256 bp, 751 aa] {O...    48   1e-04
KNAG0C01020 Chr3 (200271..202595) [2325 bp, 774 aa] {ON} Anc_1.1...    48   1e-04
KLTH0E15972g Chr5 complement(1414595..1416016) [1422 bp, 473 aa]...    47   1e-04
TBLA0J00250 Chr10 (42058..44457) [2400 bp, 799 aa] {ON} Anc_7.51...    48   1e-04
TPHA0L01240 Chr12 (263357..264814) [1458 bp, 485 aa] {ON} Anc_8....    47   1e-04
KNAG0I03000 Chr9 (596789..598840) [2052 bp, 683 aa] {ON} Anc_4.4...    47   1e-04
KLLA0C07535g Chr3 (658746..660620) [1875 bp, 624 aa] {ON} some s...    47   1e-04
Smik_8.156 Chr8 complement(234928..238269) [3342 bp, 1113 aa] {O...    48   1e-04
AER216C Chr5 complement(1032840..1034348) [1509 bp, 502 aa] {ON}...    47   1e-04
TBLA0B08810 Chr2 (2094401..2095375) [975 bp, 324 aa] {ON} Anc_2....    47   1e-04
KNAG0B05340 Chr2 complement(1031600..1033588) [1989 bp, 662 aa] ...    47   1e-04
CAGL0C02893g Chr3 complement(286017..287966) [1950 bp, 649 aa] {...    47   1e-04
Kpol_1039.33 s1039 complement(102096..104201) [2106 bp, 701 aa] ...    47   1e-04
Smik_4.218 Chr4 (406174..407697) [1524 bp, 507 aa] {ON} YDL017W ...    47   1e-04
CAGL0K11275g Chr11 (1094626..1096203) [1578 bp, 525 aa] {ON} sim...    47   1e-04
Skud_6.38 Chr6 complement(72416..77692) [5277 bp, 1758 aa] {ON} ...    47   1e-04
NDAI0C00570 Chr3 (108274..110547) [2274 bp, 757 aa] {ON}               47   1e-04
Skud_8.139 Chr8 complement(232178..235534) [3357 bp, 1118 aa] {O...    47   1e-04
Kpol_1010.68 s1010 complement(168093..169595) [1503 bp, 500 aa] ...    47   1e-04
KLLA0F18612g Chr6 (1711131..1713575) [2445 bp, 814 aa] {ON} some...    47   2e-04
KLTH0H10582g Chr8 (914695..916440) [1746 bp, 581 aa] {ON} weakly...    47   2e-04
SAKL0G13882g Chr7 complement(1191656..1194604) [2949 bp, 982 aa]...    47   2e-04
TPHA0I02660 Chr9 (582108..584219) [2112 bp, 703 aa] {ON} Anc_1.3...    47   2e-04
Skud_10.30 Chr10 complement(51698..54124) [2427 bp, 808 aa] {ON}...    47   2e-04
Suva_2.413 Chr2 (735541..736923) [1383 bp, 460 aa] {ON} YDR247W ...    46   2e-04
SAKL0A03344g Chr1 complement(305149..306243) [1095 bp, 364 aa] {...    46   2e-04
TPHA0A04330 Chr1 (974713..976218) [1506 bp, 501 aa] {ON} Anc_3.1...    47   2e-04
Suva_14.327 Chr14 complement(578572..580470) [1899 bp, 632 aa] {...    47   2e-04
NDAI0A06470 Chr1 (1470263..1472083) [1821 bp, 606 aa] {ON} Anc_3...    47   2e-04
TPHA0H01470 Chr8 complement(329451..333578) [4128 bp, 1375 aa] {...    47   2e-04
Kpol_1013.52 s1013 (123332..125881) [2550 bp, 849 aa] {ON} (1233...    47   2e-04
Kwal_26.8941 s26 complement(1014543..1016528) [1986 bp, 661 aa] ...    47   2e-04
Kwal_14.2554 s14 (811455..813233) [1779 bp, 592 aa] {ON} YJL057C...    46   3e-04
SAKL0D06820g Chr4 (566145..567938) [1794 bp, 597 aa] {ON} simila...    46   3e-04
KAFR0A01740 Chr1 complement(356086..358035) [1950 bp, 649 aa] {O...    46   3e-04
Ecym_5258 Chr5 (536868..538376) [1509 bp, 502 aa] {ON} similar t...    46   3e-04
Kpol_365.3 s365 complement(2204..4177,4180..4206,4209..4874) [26...    46   3e-04
KLLA0D13266g Chr4 complement(1137750..1141208) [3459 bp, 1152 aa...    46   3e-04
Skud_16.460 Chr16 complement(807116..809077) [1962 bp, 653 aa] {...    46   3e-04
Suva_4.232 Chr4 (417104..418627) [1524 bp, 507 aa] {ON} YDL017W ...    46   3e-04
TBLA0D05210 Chr4 (1279846..1282323) [2478 bp, 825 aa] {ON} Anc_1...    46   3e-04
CAGL0I08899g Chr9 complement(863906..866701) [2796 bp, 931 aa] {...    46   3e-04
YHR079C Chr8 complement(258244..261591) [3348 bp, 1115 aa] {ON} ...    46   3e-04
Kpol_209.1 s209 (1823..5734) [3912 bp, 1303 aa] {ON} (1823..5734...    46   4e-04
YFL033C Chr6 complement(69115..74427) [5313 bp, 1770 aa] {ON}  R...    46   4e-04
TBLA0B06620 Chr2 complement(1556378..1559671) [3294 bp, 1097 aa]...    46   4e-04
Kwal_27.10945 s27 (565717..568524) [2808 bp, 935 aa] {ON} YBR059...    46   4e-04
KLLA0F01408g Chr6 (135424..136302) [879 bp, 292 aa] {ON} conserv...    45   4e-04
Ecym_6294 Chr6 complement(551351..552982) [1632 bp, 543 aa] {ON}...    45   4e-04
Ecym_1502 Chr1 (1030765..1031838) [1074 bp, 357 aa] {ON} similar...    45   4e-04
Kwal_33.15381 s33 complement(1080902..1083868) [2967 bp, 988 aa]...    46   5e-04
NCAS0A15040 Chr1 complement(2962030..2964036) [2007 bp, 668 aa] ...    45   5e-04
KLTH0B02178g Chr2 (171582..174551) [2970 bp, 989 aa] {ON} simila...    46   5e-04
ZYRO0F03190g Chr6 complement(270262..271371) [1110 bp, 369 aa] {...    45   5e-04
Kpol_1035.34 s1035 (79914..80978) [1065 bp, 354 aa] {ON} (79914....    45   5e-04
KLTH0D12166g Chr4 complement(987310..989061) [1752 bp, 583 aa] {...    45   6e-04
CAGL0K12496g Chr11 (1219220..1220302) [1083 bp, 360 aa] {ON} sim...    45   6e-04
NDAI0H02930 Chr8 (715278..716846) [1569 bp, 522 aa] {ON} Anc_2.391     45   6e-04
NCAS0I01870 Chr9 (345214..346866) [1653 bp, 550 aa] {ON} Anc_3.1...    45   7e-04
Kpol_1065.6 s1065 (12266..12916,12918..13280,13332..13340,13394....    45   7e-04
KLLA0D11044g Chr4 complement(942458..944068) [1611 bp, 536 aa] {...    45   7e-04
ABL055C Chr2 complement(295495..297105) [1611 bp, 536 aa] {ON} S...    45   7e-04
TPHA0G01380 Chr7 (279600..281579) [1980 bp, 659 aa] {ON} Anc_8.7...    45   7e-04
KNAG0G02780 Chr7 complement(615058..617202) [2145 bp, 714 aa] {O...    45   0.001
Smik_11.125 Chr11 complement(208208..209764) [1557 bp, 518 aa] {...    44   0.001
KAFR0D04760 Chr4 complement(932849..936205) [3357 bp, 1118 aa] {...    45   0.001
NDAI0F01340 Chr6 complement(327928..329148) [1221 bp, 406 aa] {O...    44   0.001
Kpol_1031.67 s1031 (174170..175663) [1494 bp, 497 aa] {ON} (1741...    44   0.001
Suva_13.399 Chr13 complement(679223..681388) [2166 bp, 721 aa] {...    44   0.001
Skud_13.385 Chr13 complement(672612..674966) [2355 bp, 784 aa] {...    44   0.001
Kpol_1064.42 s1064 complement(78573..80207) [1635 bp, 544 aa] {O...    44   0.001
Kwal_56.24274 s56 (932404..933444) [1041 bp, 346 aa] {ON} YPL236...    44   0.001
NDAI0A00920 Chr1 (189693..192521) [2829 bp, 942 aa] {ON} Anc_1.1...    44   0.001
Kwal_55.20221 s55 (304482..308006) [3525 bp, 1174 aa] {ON} YHR07...    44   0.001
TPHA0N00370 Chr14 (68298..69650) [1353 bp, 450 aa] {ON} Anc_7.41...    44   0.001
KLLA0C04345g Chr3 (397899..399326) [1428 bp, 475 aa] {ON} simila...    44   0.001
Kwal_33.13225 s33 (127676..130570) [2895 bp, 964 aa] {ON} YFR016...    44   0.001
KNAG0A04080 Chr1 complement(551409..552635) [1227 bp, 408 aa] {O...    44   0.001
TBLA0D00250 Chr4 (61918..63618) [1701 bp, 566 aa] {ON} Anc_2.105...    44   0.001
ADR174C Chr4 complement(1008796..1010811) [2016 bp, 671 aa] {ON}...    44   0.002
TDEL0A06750 Chr1 (1179818..1180936) [1119 bp, 372 aa] {ON} Anc_6...    44   0.002
TPHA0D01540 Chr4 complement(316471..318594) [2124 bp, 707 aa] {O...    44   0.002
TDEL0H00560 Chr8 (94614..96500) [1887 bp, 628 aa] {ON} Anc_7.515...    44   0.002
TBLA0D01110 Chr4 (283160..285640) [2481 bp, 826 aa] {ON} Anc_8.7...    44   0.002
KNAG0E03260 Chr5 complement(654134..655246) [1113 bp, 370 aa] {O...    43   0.002
TDEL0B01590 Chr2 complement(280143..281573) [1431 bp, 476 aa] {O...    44   0.002
NDAI0C01890 Chr3 (419452..423777) [4326 bp, 1441 aa] {ON} Anc_5....    44   0.002
CAGL0K01815g Chr11 (162973..164487) [1515 bp, 504 aa] {ON} simil...    44   0.002
TDEL0E04680 Chr5 complement(875878..878862) [2985 bp, 994 aa] {O...    44   0.002
Kwal_26.8347 s26 complement(748254..750032) [1779 bp, 592 aa] {O...    44   0.002
SAKL0C07876g Chr3 (732534..733970) [1437 bp, 478 aa] {ON} simila...    43   0.002
Kpol_1003.35 s1003 (89266..91407) [2142 bp, 713 aa] {ON} (89266....    44   0.002
NCAS0B02530 Chr2 complement(422882..424207) [1326 bp, 441 aa] {O...    43   0.002
ADR293C Chr4 complement(1207021..1210425) [3405 bp, 1134 aa] {ON...    44   0.002
SAKL0B11308g Chr2 complement(984543..986369) [1827 bp, 608 aa] {...    43   0.002
NCAS0B08320 Chr2 complement(1585766..1588471) [2706 bp, 901 aa] ...    43   0.002
NCAS0A09170 Chr1 (1813960..1815846) [1887 bp, 628 aa] {ON} Anc_1...    43   0.003
YDR247W Chr4 (956013..957398) [1386 bp, 461 aa] {ON}  VHS1Cytopl...    43   0.003
Smik_13.424 Chr13 complement(682907..685177) [2271 bp, 756 aa] {...    43   0.003
CAGL0I05390g Chr9 complement(508677..510041) [1365 bp, 454 aa] {...    43   0.003
KLLA0F22605g Chr6 complement(2109034..2111913) [2880 bp, 959 aa]...    43   0.003
TBLA0J01200 Chr10 (271800..275420) [3621 bp, 1206 aa] {ON} Anc_1...    43   0.003
Smik_16.209 Chr16 complement(377965..379425) [1461 bp, 486 aa] {...    43   0.003
NDAI0G05790 Chr7 complement(1433294..1435252) [1959 bp, 652 aa] ...    43   0.003
Skud_16.256 Chr16 complement(465728..467362) [1635 bp, 544 aa] {...    43   0.003
TPHA0C01810 Chr3 complement(413495..414790) [1296 bp, 431 aa] {O...    42   0.004
YPL026C Chr16 complement(500675..502183) [1509 bp, 502 aa] {ON} ...    42   0.004
Smik_10.183 Chr10 complement(319743..321746) [2004 bp, 667 aa] {...    42   0.004
KNAG0D00830 Chr4 complement(130823..131986) [1164 bp, 387 aa] {O...    42   0.004
Suva_16.291 Chr16 complement(504006..505433) [1428 bp, 475 aa] {...    42   0.004
Skud_4.509 Chr4 (910551..911945) [1395 bp, 464 aa] {ON} YDR247W ...    42   0.004
ZYRO0G20570g Chr7 (1695518..1697305) [1788 bp, 595 aa] {ON} simi...    42   0.005
TPHA0G00610 Chr7 (114519..116138) [1620 bp, 539 aa] {ON} Anc_8.7...    42   0.005
Ecym_6044 Chr6 complement(84500..85756) [1257 bp, 418 aa] {ON} s...    42   0.005
NCAS0A01090 Chr1 (216576..218042) [1467 bp, 488 aa] {ON} Anc_6.215     42   0.005
TBLA0A01660 Chr1 complement(391368..392828) [1461 bp, 486 aa] {O...    42   0.005
NDAI0B00400 Chr2 (74403..76643) [2241 bp, 746 aa] {ON} Anc_1.149       42   0.006
NCAS0H01740 Chr8 complement(331436..335284) [3849 bp, 1282 aa] {...    42   0.006
NDAI0B03560 Chr2 complement(892839..895109) [2271 bp, 756 aa] {O...    42   0.006
NDAI0A07790 Chr1 (1790683..1795206) [4524 bp, 1507 aa] {ON} Anc_...    42   0.006
ZYRO0A06182g Chr1 (493846..496062) [2217 bp, 738 aa] {ON} simila...    42   0.006
KLLA0D10527g Chr4 (892955..894892) [1938 bp, 645 aa] {ON} simila...    42   0.007
NCAS0A07080 Chr1 complement(1400590..1403607) [3018 bp, 1005 aa]...    42   0.008
Ecym_3160 Chr3 complement(304537..306957) [2421 bp, 806 aa] {ON}...    42   0.008
YMR216C Chr13 complement(698811..701039) [2229 bp, 742 aa] {ON} ...    41   0.010
KNAG0F03730 Chr6 complement(697517..699586) [2070 bp, 689 aa] {O...    41   0.010
SAKL0A04444g Chr1 (412103..413527) [1425 bp, 474 aa] {ON} highly...    41   0.011
NDAI0D02140 Chr4 complement(496708..499785) [3078 bp, 1025 aa] {...    41   0.012
TBLA0A02240 Chr1 (539297..540538) [1242 bp, 413 aa] {ON} Anc_6.2...    41   0.012
KLTH0D08712g Chr4 complement(728072..729886) [1815 bp, 604 aa] {...    41   0.012
AEL173W Chr5 (313261..314856) [1596 bp, 531 aa] {ON} Syntenic ho...    41   0.012
CAGL0H08437g Chr8 complement(825191..829423) [4233 bp, 1410 aa] ...    41   0.014
ZYRO0A01848g Chr1 (152134..154248) [2115 bp, 704 aa] {ON} simila...    41   0.014
ZYRO0A02772g Chr1 complement(223226..224473) [1248 bp, 415 aa] {...    40   0.014
ZYRO0G05412g Chr7 (435657..437408) [1752 bp, 583 aa] {ON} simila...    41   0.014
Suva_16.70 Chr16 complement(110631..111725) [1095 bp, 364 aa] {O...    40   0.015
ZYRO0G12232g Chr7 (964508..967591) [3084 bp, 1027 aa] {ON} simil...    41   0.016
TPHA0H01880 Chr8 (441140..442402) [1263 bp, 420 aa] {ON} Anc_6.2...    40   0.017
SAKL0B01474g Chr2 complement(145734..146777) [1044 bp, 347 aa] {...    40   0.017
KAFR0K00880 Chr11 (188439..191069) [2631 bp, 876 aa] {ON} Anc_5....    40   0.017
KNAG0H01220 Chr8 (209884..212625) [2742 bp, 913 aa] {ON} Anc_3.2...    40   0.018
NDAI0B04530 Chr2 complement(1128472..1130094) [1623 bp, 540 aa] ...    40   0.018
CAGL0F03905g Chr6 complement(377962..380088) [2127 bp, 708 aa] {...    40   0.018
NDAI0K01030 Chr11 (239418..241712) [2295 bp, 764 aa] {ON} Anc_8....    40   0.018
Kpol_538.20 s538 (39404..42382) [2979 bp, 992 aa] {ON} (39404..4...    40   0.019
Skud_14.179 Chr14 complement(334239..335924) [1686 bp, 561 aa] {...    40   0.019
CAGL0H00979g Chr8 complement(94328..95527) [1200 bp, 399 aa] {ON...    40   0.020
KLTH0E03828g Chr5 (345775..349131) [3357 bp, 1118 aa] {ON} simil...    40   0.020
Smik_14.174 Chr14 complement(323054..324709) [1656 bp, 551 aa] {...    40   0.021
NCAS0B07200 Chr2 complement(1363351..1364940) [1590 bp, 529 aa] ...    40   0.021
Smik_6.306 Chr6 complement(480942..484031) [3090 bp, 1029 aa] {O...    40   0.021
TPHA0A02760 Chr1 (594482..597502) [3021 bp, 1006 aa] {ON} Anc_1....    40   0.022
NCAS0I01210 Chr9 complement(218242..222582) [4341 bp, 1446 aa] {...    40   0.023
KNAG0F01490 Chr6 (270931..272604) [1674 bp, 557 aa] {ON} Anc_2.1...    40   0.024
Suva_14.185 Chr14 complement(340104..341789) [1686 bp, 561 aa] {...    40   0.025
Kwal_33.13825 s33 (409772..412477) [2706 bp, 901 aa] {ON} YKL171...    40   0.026
Kwal_26.9032 s26 complement(1047382..1049157) [1776 bp, 591 aa] ...    40   0.027
KLLA0D03168g Chr4 (265761..267278) [1518 bp, 505 aa] {ON} simila...    40   0.027
Kwal_33.14596 s33 (735962..737464) [1503 bp, 500 aa] {ON} YNL154...    40   0.028
KAFR0G00440 Chr7 (124896..127328) [2433 bp, 810 aa] {ON} Anc_1.1...    40   0.031
Kpol_1027.20 s1027 complement(43412..44974) [1563 bp, 520 aa] {O...    40   0.031
KAFR0A07320 Chr1 complement(1478564..1480033) [1470 bp, 489 aa] ...    39   0.032
ZYRO0E07876g Chr5 (616134..617243) [1110 bp, 369 aa] {ON} simila...    39   0.034
SAKL0G08448g Chr7 (718250..721717) [3468 bp, 1155 aa] {ON} simil...    40   0.035
SAKL0B04752g Chr2 (416940..418259) [1320 bp, 439 aa] {ON} weakly...    39   0.035
TBLA0D02510 Chr4 complement(626101..627234) [1134 bp, 377 aa] {O...    39   0.036
TDEL0F00910 Chr6 (157379..159070) [1692 bp, 563 aa] {ON} Anc_2.1...    39   0.037
Kpol_2001.31 s2001 complement(90402..93110) [2709 bp, 902 aa] {O...    39   0.037
Kwal_56.24064 s56 complement(831165..832592) [1428 bp, 475 aa] {...    39   0.037
YNL154C Chr14 complement(343636..345276) [1641 bp, 546 aa] {ON} ...    39   0.038
TPHA0J03180 Chr10 complement(691886..694882) [2997 bp, 998 aa] {...    39   0.039
NCAS0C01030 Chr3 (192001..194043) [2043 bp, 680 aa] {ON} Anc_8.732     39   0.040
Suva_6.29 Chr6 complement(51588..52691) [1104 bp, 367 aa] {ON} Y...    39   0.041
Kpol_413.7 s413 complement(18363..20267) [1905 bp, 634 aa] {ON} ...    39   0.045
TBLA0J01000 Chr10 complement(227869..231072) [3204 bp, 1067 aa] ...    39   0.048
TPHA0E02830 Chr5 (591805..593364) [1560 bp, 519 aa] {ON} Anc_6.2...    39   0.050
AFR040W Chr6 (505602..507245) [1644 bp, 547 aa] {ON} Syntenic ho...    39   0.050
SAKL0E12100g Chr5 complement(1004036..1005622) [1587 bp, 528 aa]...    39   0.050
KLTH0B06204g Chr2 complement(502282..503778) [1497 bp, 498 aa] {...    39   0.051
Suva_3.128 Chr3 (192094..193266) [1173 bp, 390 aa] {ON} YCR091W ...    39   0.052
KNAG0J02030 Chr10 complement(368141..370327) [2187 bp, 728 aa] {...    39   0.055
KLLA0F01507g Chr6 (144356..145774) [1419 bp, 472 aa] {ON} some s...    39   0.056
Ecym_2202 Chr2 (399184..400629) [1446 bp, 481 aa] {ON} similar t...    39   0.057
Skud_11.54 Chr11 (113775..116570) [2796 bp, 931 aa] {ON} YKL171W...    39   0.061
Skud_5.255 Chr5 complement(415109..416686) [1578 bp, 525 aa] {ON...    39   0.065
KNAG0D01130 Chr4 (190658..191947) [1290 bp, 429 aa] {ON} Anc_6.2...    38   0.069
KLTH0D12518g Chr4 complement(1023214..1024992) [1779 bp, 592 aa]...    39   0.071
NCAS0G02120 Chr7 (381894..383465) [1572 bp, 523 aa] {ON} Anc_2.105     39   0.073
Kpol_1033.51 s1033 complement(127843..129165) [1323 bp, 440 aa] ...    38   0.073
SAKL0H05214g Chr8 (468419..470185) [1767 bp, 588 aa] {ON} simila...    39   0.074
TBLA0B09215 Chr2 complement(2180179..2181375) [1197 bp, 398 aa] ...    38   0.074
TPHA0A03700 Chr1 complement(808996..813273) [4278 bp, 1425 aa] {...    39   0.081
KAFR0B03270 Chr2 complement(677477..679231) [1755 bp, 584 aa] {O...    38   0.083
Ecym_2357 Chr2 (700079..701914) [1836 bp, 611 aa] {ON} similar t...    38   0.084
NDAI0F03150 Chr6 complement(757283..758923) [1641 bp, 546 aa] {O...    38   0.088
YFL029C Chr6 complement(78055..79161) [1107 bp, 368 aa] {ON}  CA...    38   0.091
Smik_6.409 Chr6 complement(658629..660119) [1491 bp, 496 aa] {ON...    38   0.097
Ecym_6239 Chr6 complement(445704..447791) [2088 bp, 695 aa] {ON}...    38   0.099
Suva_16.102 Chr16 (173734..175209) [1476 bp, 491 aa] {ON} YPL204...    38   0.11 
TDEL0B03770 Chr2 (676581..678575) [1995 bp, 664 aa] {ON} Anc_8.7...    38   0.11 
NDAI0F01640 Chr6 (401323..403086) [1764 bp, 587 aa] {ON} Anc_6.215     38   0.11 
KAFR0K00320 Chr11 (72569..73942) [1374 bp, 457 aa] {ON} Anc_6.21...    38   0.12 
TPHA0I01240 Chr9 (283537..285210) [1674 bp, 557 aa] {ON} Anc_2.1...    38   0.12 
Suva_11.52 Chr11 (112355..115156) [2802 bp, 933 aa] {ON} YKL171W...    38   0.12 
AFR150C Chr6 complement(707303..708352) [1050 bp, 349 aa] {ON} S...    37   0.13 
Smik_5.268 Chr5 (413820..415397) [1578 bp, 525 aa] {ON} YER123W ...    37   0.13 
YPL204W Chr16 (164276..165760) [1485 bp, 494 aa] {ON}  HRR25Prot...    37   0.14 
Smik_11.58 Chr11 (112932..115715) [2784 bp, 927 aa] {ON} YKL171W...    38   0.14 
TBLA0A06660 Chr1 complement(1626147..1630400) [4254 bp, 1417 aa]...    38   0.14 
Skud_16.75 Chr16 (137624..139108) [1485 bp, 494 aa] {ON} YPL204W...    37   0.15 
YER123W Chr5 (404813..406387) [1575 bp, 524 aa] {ON}  YCK3Palmit...    37   0.15 
TDEL0E05230 Chr5 complement(958851..960323) [1473 bp, 490 aa] {O...    37   0.15 
AEL120W Chr5 (396394..398715) [2322 bp, 773 aa] {ON} Syntenic ho...    37   0.15 
KAFR0C02290 Chr3 complement(449963..451204) [1242 bp, 413 aa] {O...    37   0.16 
KLTH0H04158g Chr8 (378344..379798) [1455 bp, 484 aa] {ON} simila...    37   0.17 
NDAI0B02430 Chr2 (608926..610590) [1665 bp, 554 aa] {ON} Anc_8.132     37   0.17 
Skud_2.225 Chr2 (405095..409459) [4365 bp, 1454 aa] {ON} YBR097W...    37   0.17 
TBLA0D02730 Chr4 complement(674994..676427) [1434 bp, 477 aa] {O...    37   0.18 
NCAS0D03820 Chr4 complement(708820..710241) [1422 bp, 473 aa] {O...    37   0.18 
AFL091W Chr6 (272431..273867) [1437 bp, 478 aa] {ON} Syntenic ho...    37   0.19 
KNAG0H03710 Chr8 complement(687550..689184) [1635 bp, 544 aa] {O...    37   0.19 
TBLA0F01730 Chr6 complement(431961..433004) [1044 bp, 347 aa] {O...    37   0.20 
ZYRO0C15884g Chr3 (1241605..1245873) [4269 bp, 1422 aa] {ON} sim...    37   0.20 
TDEL0C00660 Chr3 complement(107849..108952) [1104 bp, 367 aa] {O...    37   0.22 
YGR188C Chr7 complement(872044..875109) [3066 bp, 1021 aa] {ON} ...    37   0.23 
Kpol_1006.14 s1006 (52420..54042) [1623 bp, 540 aa] {ON} (52420....    37   0.23 
Ecym_8392 Chr8 (803292..804806) [1515 bp, 504 aa] {ON} similar t...    37   0.23 
TDEL0C04810 Chr3 (867670..871932) [4263 bp, 1420 aa] {ON} Anc_3....    37   0.24 
Skud_7.518 Chr7 complement(847291..850359) [3069 bp, 1022 aa] {O...    37   0.24 
Skud_16.42 Chr16 complement(75193..76287) [1095 bp, 364 aa] {ON}...    37   0.24 
NDAI0E03210 Chr5 complement(686073..687317) [1245 bp, 414 aa] {O...    37   0.25 
NCAS0G01210 Chr7 complement(215860..216963) [1104 bp, 367 aa] {O...    36   0.26 
CAGL0H03553g Chr8 complement(328668..330155) [1488 bp, 495 aa] {...    37   0.28 
NCAS0B04520 Chr2 (821360..822787) [1428 bp, 475 aa] {ON} Anc_8.132     36   0.29 
AER348C Chr5 complement(1275897..1277774) [1878 bp, 625 aa] {ON}...    37   0.29 
TPHA0J02370 Chr10 complement(523628..525016) [1389 bp, 462 aa] {...    36   0.32 
YKL171W Chr11 (127475..130261) [2787 bp, 928 aa] {ON}  NNK1Prote...    37   0.32 
Ecym_3487 Chr3 complement(910575..914810) [4236 bp, 1411 aa] {ON...    37   0.32 
TBLA0A02040 Chr1 complement(493305..495056) [1752 bp, 583 aa] {O...    36   0.34 
ZYRO0D10472g Chr4 (876899..880357) [3459 bp, 1152 aa] {ON} simil...    36   0.36 
NDAI0I01070 Chr9 (259836..261278) [1443 bp, 480 aa] {ON} Anc_6.215     36   0.37 
Suva_7.481 Chr7 complement(829537..832644) [3108 bp, 1035 aa] {O...    36   0.38 
Suva_5.243 Chr5 (380441..382012) [1572 bp, 523 aa] {ON} YER123W ...    36   0.38 
Smik_8.216 Chr8 complement(349478..351145) [1668 bp, 555 aa] {ON...    36   0.38 
Skud_6.41 Chr6 complement(81310..82416) [1107 bp, 368 aa] {ON} Y...    36   0.39 
CAGL0J05940g Chr10 (562687..564147) [1461 bp, 486 aa] {ON} simil...    36   0.40 
CAGL0G06138g Chr7 complement(585585..587204) [1620 bp, 539 aa] {...    36   0.40 
ZYRO0G08866g Chr7 complement(713156..714661) [1506 bp, 501 aa] {...    36   0.42 
KLTH0G18282g Chr7 complement(1576512..1577558) [1047 bp, 348 aa]...    36   0.42 
KLTH0E11110g Chr5 (997486..998847) [1362 bp, 453 aa] {ON} simila...    36   0.43 
CAGL0K02299g Chr11 complement(206161..207777) [1617 bp, 538 aa] ...    36   0.44 
YPR106W Chr16 (740061..741392) [1332 bp, 443 aa] {ON}  ISR1Predi...    36   0.46 
SAKL0B07326g Chr2 (627224..631477) [4254 bp, 1417 aa] {ON} simil...    36   0.47 
Suva_15.332 Chr15 complement(575263..575547,575959..576084,57614...    36   0.48 
KNAG0A02350 Chr1 complement(223757..225022) [1266 bp, 421 aa] {O...    35   0.48 
KNAG0F01980 Chr6 (379013..380368) [1356 bp, 451 aa] {ON} Anc_6.2...    35   0.51 
ADL053C Chr4 complement(589599..591014) [1416 bp, 471 aa] {ON} S...    35   0.53 
YBR097W Chr2 (436951..441315) [4365 bp, 1454 aa] {ON}  VPS15Myri...    35   0.64 
Kpol_1002.53 s1002 (150289..151668) [1380 bp, 459 aa] {ON} (1502...    35   0.69 
ZYRO0F09174g Chr6 complement(744109..745638) [1530 bp, 509 aa] {...    35   0.74 
KLLA0C07216g Chr3 (626227..628278) [2052 bp, 683 aa] {ON} simila...    35   0.77 
KAFR0B02070 Chr2 (408079..409539) [1461 bp, 486 aa] {ON} Anc_8.1...    35   0.78 
Skud_8.196 Chr8 complement(346056..346463,346494..347684) [1599 ...    35   0.79 
KAFR0C03480 Chr3 (708186..709277) [1092 bp, 363 aa] {ON} Anc_8.4...    35   0.80 
YPL236C Chr16 complement(101608..102702) [1095 bp, 364 aa] {ON} ...    35   0.86 
YHR135C Chr8 complement(372694..374310) [1617 bp, 538 aa] {ON}  ...    35   0.88 
KNAG0D02200 Chr4 complement(374609..376075) [1467 bp, 488 aa] {O...    35   0.91 
KLLA0B11924g Chr2 complement(1043344..1047582) [4239 bp, 1412 aa...    35   0.94 
KAFR0F00520 Chr6 (111106..112659) [1554 bp, 517 aa] {ON} Anc_2.1...    35   0.95 
TBLA0G02780 Chr7 (730835..732529) [1695 bp, 564 aa] {ON} Anc_8.1...    35   1.1  
KNAG0A07560 Chr1 (1186540..1187550) [1011 bp, 336 aa] {ON} Anc_3...    34   1.2  
ZYRO0F18524g Chr6 (1528741..1529748) [1008 bp, 335 aa] {ON} simi...    34   1.5  
KAFR0G01670 Chr7 (363200..367459) [4260 bp, 1419 aa] {ON} Anc_3....    34   1.5  
Smik_6.441 Chr6 (721619..722713) [1095 bp, 364 aa] {ON} YPL236C ...    34   1.5  
TBLA0B05310 Chr2 complement(1251914..1253494) [1581 bp, 526 aa] ...    34   1.6  
Smik_2.239 Chr2 (421843..426207) [4365 bp, 1454 aa] {ON} YBR097W...    34   1.7  
KLTH0E15026g Chr5 (1331171..1335730) [4560 bp, 1519 aa] {ON} sim...    34   1.7  
KLLA0A06776g Chr1 (612115..614517) [2403 bp, 800 aa] {ON} simila...    34   1.7  
Suva_4.344 Chr4 (606007..610371) [4365 bp, 1454 aa] {ON} YBR097W...    33   2.3  
KLLA0F08877g Chr6 (825217..826182) [966 bp, 321 aa] {ON} uniprot...    33   2.4  
Smik_6.49 Chr6 complement(93305..94408) [1104 bp, 367 aa] {ON} Y...    33   2.6  
KNAG0K02490 Chr11 complement(494756..498550) [3795 bp, 1264 aa] ...    33   2.6  
Ecym_3052 Chr3 complement(96898..98286,98404..98700) [1686 bp, 5...    33   2.8  
TDEL0F01010 Chr6 complement(178943..180418) [1476 bp, 491 aa] {O...    33   2.9  
NDAI0G03150 Chr7 complement(741321..742463) [1143 bp, 380 aa] {O...    33   3.5  
KNAG0E03740 Chr5 complement(738877..741528) [2652 bp, 883 aa] {O...    33   3.6  
KLLA0E13531g Chr5 (1193481..1194902) [1422 bp, 473 aa] {ON} some...    33   3.7  
TPHA0D00430 Chr4 complement(73651..74730) [1080 bp, 359 aa] {ON}...    33   3.8  
TPHA0D01000 Chr4 (202605..204125) [1521 bp, 506 aa] {ON} Anc_8.1...    33   4.1  
ZYRO0E02376g Chr5 complement(181177..182817) [1641 bp, 546 aa] {...    32   5.0  
NCAS0C03810 Chr3 complement(772530..773660) [1131 bp, 376 aa] {O...    32   8.2  

>Smik_4.207 Chr4 complement(381159..383456) [2298 bp, 765 aa] {ON}
           YDL028C (REAL)
          Length = 765

 Score = 1401 bits (3626), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 693/765 (90%), Positives = 693/765 (90%)

Query: 1   MSTNSFHDYMDLNSRTNMRQFSDDEEFTTPPKLSNFGSALLSHSEKTSAPETLSSHKTNK 60
           MSTNSFHDYMDLNSRTNMRQFSDDEEFTTPPKLSNFGSALLSHSEKTSAPETLSSHKTNK
Sbjct: 1   MSTNSFHDYMDLNSRTNMRQFSDDEEFTTPPKLSNFGSALLSHSEKTSAPETLSSHKTNK 60

Query: 61  MTNHVLEEMDXXXXXXXXXXXMGNLXXXXXXXXXXXXLFGRYLRNNHQTSMTTMNTNDIE 120
           MTNHVLEEMD           MGNL            LFGRYLRNNHQTSMTTMNTNDIE
Sbjct: 61  MTNHVLEEMDRSSSRSHPPSSMGNLTSGHTSTSSHSTLFGRYLRNNHQTSMTTMNTNDIE 120

Query: 121 INVGNSLDKSFERIRNLRQNMKEDMTSKYAERRSKRFLISNRTTKLGPAKRATTLTNVFD 180
           INVGNSLDKSFERIRNLRQNMKEDMTSKYAERRSKRFLISNRTTKLGPAKRATTLTNVFD
Sbjct: 121 INVGNSLDKSFERIRNLRQNMKEDMTSKYAERRSKRFLISNRTTKLGPAKRATTLTNVFD 180

Query: 181 EEVPNSSNLPINPRETIETLLEDSNKSGFRESKKNMDYESIEFGDLNPIQYIKKHNLPTS 240
           EEVPNSSNLPINPRETIETLLEDSNKSGFRESKKNMDYESIEFGDLNPIQYIKKHNLPTS
Sbjct: 181 EEVPNSSNLPINPRETIETLLEDSNKSGFRESKKNMDYESIEFGDLNPIQYIKKHNLPTS 240

Query: 241 DLPLISQIYFDKQREENRQAALRKHSSRELLYKNRXXXXXXXXXXXXXXXXXXITFINSS 300
           DLPLISQIYFDKQREENRQAALRKHSSRELLYKNR                  ITFINSS
Sbjct: 241 DLPLISQIYFDKQREENRQAALRKHSSRELLYKNRSSSTSLSSNNLLPSKDNSITFINSS 300

Query: 301 LPXXXXXXXXXXXXXXXXXXXALKENIDTSNNSSFNSPIHNIHKEISRNKDSDSEKRGVL 360
           LP                   ALKENIDTSNNSSFNSPIHNIHKEISRNKDSDSEKRGVL
Sbjct: 301 LPRRKISTGSSSSKSSIEIRRALKENIDTSNNSSFNSPIHNIHKEISRNKDSDSEKRGVL 360

Query: 361 RNISINANHADNILQQDNKRLKRSLDDVITNENENKKIQEVFYHRPAPKPPVTKKVEIVE 420
           RNISINANHADNILQQDNKRLKRSLDDVITNENENKKIQEVFYHRPAPKPPVTKKVEIVE
Sbjct: 361 RNISINANHADNILQQDNKRLKRSLDDVITNENENKKIQEVFYHRPAPKPPVTKKVEIVE 420

Query: 421 PAKSASSSNNRSMITVNDSQYEKIELLGRGGSSRVYKVKGSGNKIYALKRXXXXXXXXXX 480
           PAKSASSSNNRSMITVNDSQYEKIELLGRGGSSRVYKVKGSGNKIYALKR          
Sbjct: 421 PAKSASSSNNRSMITVNDSQYEKIELLGRGGSSRVYKVKGSGNKIYALKRVSFDAFDDSS 480

Query: 481 XXGFKGEIELLEKLKDQRRVIQLLDYEMGDGLLYLIMECGDHDLSQILNQRSNMPLDFNF 540
             GFKGEIELLEKLKDQRRVIQLLDYEMGDGLLYLIMECGDHDLSQILNQRSNMPLDFNF
Sbjct: 481 VDGFKGEIELLEKLKDQRRVIQLLDYEMGDGLLYLIMECGDHDLSQILNQRSNMPLDFNF 540

Query: 541 VRFYTKEMLLCIKVVHDAGIVHSDLKPANFVLVKGILKIIDFGIANAVPEHTVNIYRETQ 600
           VRFYTKEMLLCIKVVHDAGIVHSDLKPANFVLVKGILKIIDFGIANAVPEHTVNIYRETQ
Sbjct: 541 VRFYTKEMLLCIKVVHDAGIVHSDLKPANFVLVKGILKIIDFGIANAVPEHTVNIYRETQ 600

Query: 601 IGTPNYMAPEALVAMNYTQSSDNQHEGNKWKVGRPSDMWSCGCIIYQMIYGKPPYGSFQG 660
           IGTPNYMAPEALVAMNYTQSSDNQHEGNKWKVGRPSDMWSCGCIIYQMIYGKPPYGSFQG
Sbjct: 601 IGTPNYMAPEALVAMNYTQSSDNQHEGNKWKVGRPSDMWSCGCIIYQMIYGKPPYGSFQG 660

Query: 661 QNRLLAIMNPDVKIPFPEYTSNNEKIPKSAIELMKACLYRNPDKRWTVDKVLSSTFLQPF 720
           QNRLLAIMNPDVKIPFPEYTSNNEKIPKSAIELMKACLYRNPDKRWTVDKVLSSTFLQPF
Sbjct: 661 QNRLLAIMNPDVKIPFPEYTSNNEKIPKSAIELMKACLYRNPDKRWTVDKVLSSTFLQPF 720

Query: 721 MISGSIMEDLIKNAVRYGSEKPQISHDDLNDVVETVLRKFSDYKI 765
           MISGSIMEDLIKNAVRYGSEKPQISHDDLNDVVETVLRKFSDYKI
Sbjct: 721 MISGSIMEDLIKNAVRYGSEKPQISHDDLNDVVETVLRKFSDYKI 765

>YDL028C Chr4 complement(400997..403291) [2295 bp, 764 aa] {ON}
           MPS1Dual-specificity kinase required for spindle pole
           body (SPB) duplication and spindle checkpoint function;
           substrates include SPB proteins Spc42p, Spc110p, and
           Spc98p, mitotic exit network protein Mob1p, and
           checkpoint protein Mad1p
          Length = 764

 Score = 1267 bits (3279), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 626/765 (81%), Positives = 660/765 (86%), Gaps = 1/765 (0%)

Query: 1   MSTNSFHDYMDLNSRTNMRQFSDDEEFTTPPKLSNFGSALLSHSEKTSAPETLSSHKTNK 60
           MSTNSFHDY+DL SRTN RQFSDDEEFTTPPKLSNFGSALLSH+EKTSA E LSSH  +K
Sbjct: 1   MSTNSFHDYVDLKSRTNTRQFSDDEEFTTPPKLSNFGSALLSHTEKTSASEILSSHNNDK 60

Query: 61  MTNHVLEEMDXXXXXXXXXXXMGNLXXXXXXXXXXXXLFGRYLRNNHQTSMTTMNTNDIE 120
           + N  LEEMD           MGNL            LFGRYLRNNHQTSMTTMNT+DIE
Sbjct: 61  IANR-LEEMDRSSSRSHPPPSMGNLTSGHTSTSSHSTLFGRYLRNNHQTSMTTMNTSDIE 119

Query: 121 INVGNSLDKSFERIRNLRQNMKEDMTSKYAERRSKRFLISNRTTKLGPAKRATTLTNVFD 180
           INVGNSLDKSFERIRNLRQNMKED+T+KYAERRSKRFLISNRTTKLGPAKRA TLTN+FD
Sbjct: 120 INVGNSLDKSFERIRNLRQNMKEDITAKYAERRSKRFLISNRTTKLGPAKRAMTLTNIFD 179

Query: 181 EEVPNSSNLPINPRETIETLLEDSNKSGFRESKKNMDYESIEFGDLNPIQYIKKHNLPTS 240
           E+VPNS N PIN RET+E  LEDS+++ F+E+K+N DY+SI+FGDLNPIQYIKKHNLPTS
Sbjct: 180 EDVPNSPNQPINARETVELPLEDSHQTNFKETKRNTDYDSIDFGDLNPIQYIKKHNLPTS 239

Query: 241 DLPLISQIYFDKQREENRQAALRKHSSRELLYKNRXXXXXXXXXXXXXXXXXXITFINSS 300
           DLPLISQIYFDKQREENRQAALRKHSSRELLYK+R                  IT  N S
Sbjct: 240 DLPLISQIYFDKQREENRQAALRKHSSRELLYKSRSSSSSLSSNNLLANKDNSITSNNGS 299

Query: 301 LPXXXXXXXXXXXXXXXXXXXALKENIDTSNNSSFNSPIHNIHKEISRNKDSDSEKRGVL 360
            P                   ALKENIDTSNNS+FNSPIH I+K ISRNKDSDSEKR VL
Sbjct: 300 QPRRKVSTGSSSSKSSIEIRRALKENIDTSNNSNFNSPIHKIYKGISRNKDSDSEKREVL 359

Query: 361 RNISINANHADNILQQDNKRLKRSLDDVITNENENKKIQEVFYHRPAPKPPVTKKVEIVE 420
           RNISINANHADN+LQQ+NKRLKRSLDD ITNEN N K  EVFYHRPAPKPPVTKKVEIVE
Sbjct: 360 RNISINANHADNLLQQENKRLKRSLDDAITNENINSKNLEVFYHRPAPKPPVTKKVEIVE 419

Query: 421 PAKSASSSNNRSMITVNDSQYEKIELLGRGGSSRVYKVKGSGNKIYALKRXXXXXXXXXX 480
           PAKSAS SNNR++ITVNDSQYEKIELLGRGGSSRVYKVKGSGN++YALKR          
Sbjct: 420 PAKSASLSNNRNIITVNDSQYEKIELLGRGGSSRVYKVKGSGNRVYALKRVSFDAFDDSS 479

Query: 481 XXGFKGEIELLEKLKDQRRVIQLLDYEMGDGLLYLIMECGDHDLSQILNQRSNMPLDFNF 540
             GFKGEIELLEKLKDQ+RVIQLLDYEMGDGLLYLIMECGDHDLSQILNQRS MPLDFNF
Sbjct: 480 IDGFKGEIELLEKLKDQKRVIQLLDYEMGDGLLYLIMECGDHDLSQILNQRSGMPLDFNF 539

Query: 541 VRFYTKEMLLCIKVVHDAGIVHSDLKPANFVLVKGILKIIDFGIANAVPEHTVNIYRETQ 600
           VRFYTKEMLLCIKVVHDAGIVHSDLKPANFVLVKGILKIIDFGIANAVPEHTVNIYRETQ
Sbjct: 540 VRFYTKEMLLCIKVVHDAGIVHSDLKPANFVLVKGILKIIDFGIANAVPEHTVNIYRETQ 599

Query: 601 IGTPNYMAPEALVAMNYTQSSDNQHEGNKWKVGRPSDMWSCGCIIYQMIYGKPPYGSFQG 660
           IGTPNYMAPEALVAMNYTQ+S+NQHEGNKWKVGRPSDMWSCGCIIYQMIYGKPPYGSFQG
Sbjct: 600 IGTPNYMAPEALVAMNYTQNSENQHEGNKWKVGRPSDMWSCGCIIYQMIYGKPPYGSFQG 659

Query: 661 QNRLLAIMNPDVKIPFPEYTSNNEKIPKSAIELMKACLYRNPDKRWTVDKVLSSTFLQPF 720
           QNRLLAIMNPDVKIPFPE+TSNNEKIPKSAIELMKACLYRNPDKRWTVDKVLSSTFLQPF
Sbjct: 660 QNRLLAIMNPDVKIPFPEHTSNNEKIPKSAIELMKACLYRNPDKRWTVDKVLSSTFLQPF 719

Query: 721 MISGSIMEDLIKNAVRYGSEKPQISHDDLNDVVETVLRKFSDYKI 765
           MISGSIMEDLI+NAVRYGSEKP IS DDLNDVV+TVLRKF+DYKI
Sbjct: 720 MISGSIMEDLIRNAVRYGSEKPHISQDDLNDVVDTVLRKFADYKI 764

>Suva_4.221 Chr4 complement(391492..393789) [2298 bp, 765 aa] {ON}
           YDL028C (REAL)
          Length = 765

 Score = 1205 bits (3118), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 596/766 (77%), Positives = 645/766 (84%), Gaps = 2/766 (0%)

Query: 1   MSTNSFHDYMDLNSRTNMRQFSDDEEFTTPPKLSNFGSALLSHSEKTSAPETLSSHKTNK 60
           MSTNSFHDYMD  SR N RQFSDDEEFTTPPKLSNFGSALLSH+EKTS  + LS +K +K
Sbjct: 1   MSTNSFHDYMDSKSRMNARQFSDDEEFTTPPKLSNFGSALLSHTEKTSVSQELS-NKNDK 59

Query: 61  MTNHVLEEMDXXXXXXXXXXXMGNLXXXXXXXXXXXXLFGRYLRNNHQTSMTTMNTNDIE 120
           + N V EE +           MGNL            LFGRYL+NNHQTSMTTMNTNDIE
Sbjct: 60  IANPVFEETNRSSSRSHPPSSMGNLTSGHTSTSSHSTLFGRYLKNNHQTSMTTMNTNDIE 119

Query: 121 INVGNSLDKSFERIRNLRQNMKEDMTSKYAERRSKRFLISNRTTKLGPAKRATTLTNVFD 180
           INVGNSLDKSFE+IR+LRQNMKED+TSKY ERRSKRFLISNRTTKLGPAKRA+TLTNVFD
Sbjct: 120 INVGNSLDKSFEKIRSLRQNMKEDITSKYTERRSKRFLISNRTTKLGPAKRASTLTNVFD 179

Query: 181 EEVPNSSNLPI-NPRETIETLLEDSNKSGFRESKKNMDYESIEFGDLNPIQYIKKHNLPT 239
           ++VPNSSN  I N RET E+ L+D +++ F+E+KKN DYESI FGDLNPIQYIKKHNLPT
Sbjct: 180 DDVPNSSNQLISNLRETTESPLDDPSETEFKETKKNSDYESINFGDLNPIQYIKKHNLPT 239

Query: 240 SDLPLISQIYFDKQREENRQAALRKHSSRELLYKNRXXXXXXXXXXXXXXXXXXITFINS 299
           SDLP+ISQIYFDKQREENRQAALRKHSSRELL KNR                  IT  ++
Sbjct: 240 SDLPMISQIYFDKQREENRQAALRKHSSRELLSKNRSSSTPLSNSYSLVNKDHSITSNSN 299

Query: 300 SLPXXXXXXXXXXXXXXXXXXXALKENIDTSNNSSFNSPIHNIHKEISRNKDSDSEKRGV 359
           S P                    LKENIDT N S+  SPI+ I++E SRNKDSDSEKR  
Sbjct: 300 SQPRRKISTGSSSSKSSIEIRKVLKENIDTDNYSNLKSPINKIYRESSRNKDSDSEKREA 359

Query: 360 LRNISINANHADNILQQDNKRLKRSLDDVITNENENKKIQEVFYHRPAPKPPVTKKVEIV 419
           LRNISIN +HAD+ LQQDNKRLKRSLDD I ++NEN K Q+VFYHRPAPKPPVTKKVEIV
Sbjct: 360 LRNISINTSHADSGLQQDNKRLKRSLDDAIIHDNENMKNQDVFYHRPAPKPPVTKKVEIV 419

Query: 420 EPAKSASSSNNRSMITVNDSQYEKIELLGRGGSSRVYKVKGSGNKIYALKRXXXXXXXXX 479
           EP KSAS SN+R++ITVNDSQYEKIELLGRGGSSRVYKVKG+GNK+YALKR         
Sbjct: 420 EPIKSASLSNSRNIITVNDSQYEKIELLGRGGSSRVYKVKGAGNKVYALKRVSFDAFDDS 479

Query: 480 XXXGFKGEIELLEKLKDQRRVIQLLDYEMGDGLLYLIMECGDHDLSQILNQRSNMPLDFN 539
              GFKGEIELLEKLKDQ+RVIQLLDYEMGDGLLYLIMECGDHDLSQILNQRSNM LDFN
Sbjct: 480 SVDGFKGEIELLEKLKDQKRVIQLLDYEMGDGLLYLIMECGDHDLSQILNQRSNMSLDFN 539

Query: 540 FVRFYTKEMLLCIKVVHDAGIVHSDLKPANFVLVKGILKIIDFGIANAVPEHTVNIYRET 599
           F+RFY KEML CIKVVHDAGIVHSDLKPANFVLVKGILKIIDFGIANAVPEHTVNIYRET
Sbjct: 540 FIRFYAKEMLQCIKVVHDAGIVHSDLKPANFVLVKGILKIIDFGIANAVPEHTVNIYRET 599

Query: 600 QIGTPNYMAPEALVAMNYTQSSDNQHEGNKWKVGRPSDMWSCGCIIYQMIYGKPPYGSFQ 659
           QIGTPNYMAPEALVAMNYTQ+++N+ EGNKWKVGRPSDMWSCGCI+YQMIYGKPPYGSFQ
Sbjct: 600 QIGTPNYMAPEALVAMNYTQTNENRQEGNKWKVGRPSDMWSCGCIVYQMIYGKPPYGSFQ 659

Query: 660 GQNRLLAIMNPDVKIPFPEYTSNNEKIPKSAIELMKACLYRNPDKRWTVDKVLSSTFLQP 719
           GQNRLLAIMNPDVKIPFP++TSNNE+IPKSAIELMKACLYRNPDKRWTVDKVLSSTFLQP
Sbjct: 660 GQNRLLAIMNPDVKIPFPDHTSNNERIPKSAIELMKACLYRNPDKRWTVDKVLSSTFLQP 719

Query: 720 FMISGSIMEDLIKNAVRYGSEKPQISHDDLNDVVETVLRKFSDYKI 765
           FMISGSIMEDLI+NAVRYGSEKPQISHDDLNDVVETVLRKF+DYKI
Sbjct: 720 FMISGSIMEDLIRNAVRYGSEKPQISHDDLNDVVETVLRKFADYKI 765

>Skud_4.223 Chr4 complement(395836..398145) [2310 bp, 769 aa] {ON}
           YDL028C (REAL)
          Length = 769

 Score = 1191 bits (3080), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 591/769 (76%), Positives = 645/769 (83%), Gaps = 4/769 (0%)

Query: 1   MSTNSFHDYMDLNSRTNMRQFSDDEEFTTPPKLSNFGSALLSHSEKTSAPETLSSHKTNK 60
           MSTNSFHDYMD  S+ N RQ SDDEEFTTPPKLSNFGSALLSH+EK S  E LS++K +K
Sbjct: 1   MSTNSFHDYMDSKSKMNTRQLSDDEEFTTPPKLSNFGSALLSHTEKASTSEALSTNKNDK 60

Query: 61  MTNHVLEEMDXXXXXXXXXXXMGNLXXXXXXXXXXXXLFGRYLRNNHQTSMTTMNTNDIE 120
           + N V EEM+           MGNL            LFGRYLRN+HQTSMTTMNT+DIE
Sbjct: 61  IANPVFEEMNRSSSRSHPPSSMGNLTSGHTSTSSQSTLFGRYLRNSHQTSMTTMNTSDIE 120

Query: 121 INVGNSLDKSFERIRNLRQNMKEDMTSKYAERRSKRFLISNRTTKLGPAKRATTLTNVFD 180
           ++VGNSLDKSFERI+NLRQNMKED+TSKYAERRSKRFLISNRTTKLGPAKRATTL +VFD
Sbjct: 121 MSVGNSLDKSFERIKNLRQNMKEDITSKYAERRSKRFLISNRTTKLGPAKRATTLKSVFD 180

Query: 181 EEVPNSSNLPIN-PRETIETLLEDSNKSGFRES-KKNMDYESIEFGDLNPIQYIKKHNLP 238
           ++V +SSN  I+  RET E+ L DS ++GFR + KK+M YESI+F DLNPIQYIKKHNL 
Sbjct: 181 DDVADSSNQLISISRETTESPLADSYQAGFRGTRKKDMKYESIDFEDLNPIQYIKKHNLS 240

Query: 239 TSDLPLISQIYFDKQREENRQAALRKHSSRELLYKNRXXXXXXXXXXXXXXXXXXITFIN 298
           TSDLP+ISQIYFD+QREEN+QAALRKHSSRELL +NR                  ITF +
Sbjct: 241 TSDLPIISQIYFDRQREENKQAALRKHSSRELLSRNRSSSTSLSSGNSLANKDASITFNS 300

Query: 299 SSLPXXXXXXXXXXXXXXXXXXXALKENIDTSNNSSFNSPIHNIHKEISRNKDSDSEKRG 358
           SS P                     KEN++ SN +S N P+H I+KEISRNKD D EKR 
Sbjct: 301 SSQPRRKVSTGSFSSKSSVEIRKTFKENVNASNINSPNGPVHKIYKEISRNKDPDCEKRE 360

Query: 359 VLRNISINANHADNILQQDNKRLKRSLDDVITNENE--NKKIQEVFYHRPAPKPPVTKKV 416
           VLRNISINANHADNILQQ+NKRLKRSLDD I NENE  N K QEVFYHRPAPKPPVTKKV
Sbjct: 361 VLRNISINANHADNILQQENKRLKRSLDDAIINENEDVNVKNQEVFYHRPAPKPPVTKKV 420

Query: 417 EIVEPAKSASSSNNRSMITVNDSQYEKIELLGRGGSSRVYKVKGSGNKIYALKRXXXXXX 476
           EIVEPA++A+SS+NR+MITVNDSQYEKIELLGRGGSSRVYKVKGSGNK+YALKR      
Sbjct: 421 EIVEPARTATSSSNRNMITVNDSQYEKIELLGRGGSSRVYKVKGSGNKVYALKRVSFDAF 480

Query: 477 XXXXXXGFKGEIELLEKLKDQRRVIQLLDYEMGDGLLYLIMECGDHDLSQILNQRSNMPL 536
                 GFKGEIELLEKLKD++RVIQLLDYEMGDGLLYLIMECGDHDLSQILNQR NM L
Sbjct: 481 DDSSIDGFKGEIELLEKLKDEKRVIQLLDYEMGDGLLYLIMECGDHDLSQILNQRGNMSL 540

Query: 537 DFNFVRFYTKEMLLCIKVVHDAGIVHSDLKPANFVLVKGILKIIDFGIANAVPEHTVNIY 596
           DFNFVRFY KEML CIKVVHDAGIVHSDLKPANFVLVKGILKIIDFGIANAVPEHTVNIY
Sbjct: 541 DFNFVRFYAKEMLQCIKVVHDAGIVHSDLKPANFVLVKGILKIIDFGIANAVPEHTVNIY 600

Query: 597 RETQIGTPNYMAPEALVAMNYTQSSDNQHEGNKWKVGRPSDMWSCGCIIYQMIYGKPPYG 656
           RETQIGTPNYMAPEALVAMNYTQ++DN+H+GNKWKVGRPSDMWSCGCI+YQMIYGKPPYG
Sbjct: 601 RETQIGTPNYMAPEALVAMNYTQNNDNRHDGNKWKVGRPSDMWSCGCIVYQMIYGKPPYG 660

Query: 657 SFQGQNRLLAIMNPDVKIPFPEYTSNNEKIPKSAIELMKACLYRNPDKRWTVDKVLSSTF 716
           SFQGQNRLLAIMNPDVKIPFPE+TSN+EKIPKSAIELMKACLYRNPDKRWTVDKVL+STF
Sbjct: 661 SFQGQNRLLAIMNPDVKIPFPEHTSNDEKIPKSAIELMKACLYRNPDKRWTVDKVLNSTF 720

Query: 717 LQPFMISGSIMEDLIKNAVRYGSEKPQISHDDLNDVVETVLRKFSDYKI 765
           LQPFMIS SIMEDLI+NAVRYGSEKPQISHD+LNDVVETVLRKF+DYKI
Sbjct: 721 LQPFMISESIMEDLIRNAVRYGSEKPQISHDNLNDVVETVLRKFADYKI 769

>TDEL0D04600 Chr4 (843530..845917) [2388 bp, 795 aa] {ON} Anc_3.162
           YDL028C
          Length = 795

 Score =  650 bits (1678), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 364/792 (45%), Positives = 491/792 (61%), Gaps = 69/792 (8%)

Query: 22  SDDEEFTTPPKLSNFGSALLSHSEKTSAPETL-------SSHKTNKMTNHVLEEMDXXXX 74
           SDDE+ T PPKLS+FG ALL   E   AP  +       +S K    T       D    
Sbjct: 25  SDDEKITGPPKLSDFGVALLMEKENM-APSMVRRGEPSPNSFKRELKTRFGPTNTDYFSG 83

Query: 75  XXXXXXXMGNLXXXXXXXXXXXXLFGRYLRNNHQTSMTTMNTNDIEINVGNSLDKSFERI 134
                                  +F +  R N Q SMTTM+TN I+I   + L+ SF RI
Sbjct: 84  SNNQTSFSQTYVSANSGEPSQSTIFAQS-RFNQQPSMTTMDTNGIKIPASD-LETSFGRI 141

Query: 135 RNLRQNMKEDMTSKYAERRSKRFLISNRTTKLGPAKRATTLTNVFD---------EEVPN 185
           ++++QNM+E++T+++A+RRS+RFL   R   LGPAKRA++ TN  D         + V  
Sbjct: 142 KSMQQNMREELTTRHAQRRSRRFLHGTRIGVLGPAKRASS-TNGADMSDLSIGNVQMVQQ 200

Query: 186 SSNLPINPRETIETLLE---DSNKSGFRESKKNMDYESIEFGDLNPIQYIKKHNLPTSDL 242
           + N P+     +++  E   D  K   R ++  +DY+SI+FGD+NP+QY+K HNL +S+L
Sbjct: 201 TDNTPLEEHREVQSPAEIKPDLTKKETR-TRDVLDYKSIDFGDMNPVQYLKLHNLSSSEL 259

Query: 243 PLISQIYFDKQREENRQAALRKH-SSRELLYKNRXXXXXXXXXXXXXXXXXXITFINSSL 301
           P +S++YF++QREE  Q AL+K  SSRE L  N+                       SS+
Sbjct: 260 PKLSKVYFERQREEIHQMALQKSISSREAL-TNKVQRSFSSISSSGNSIRR-----ESSM 313

Query: 302 PXXXXXXXXXXXXXXXXXXXALKENIDTSNNSSFNSPI---------------------- 339
           P                   ++     TS  SSF+SP+                      
Sbjct: 314 PLYPRRKLSDT---------SVSSAAKTSFQSSFSSPLAYPKKNFLIDQPVVTSKPAADH 364

Query: 340 -HNIHKEISRNK----DSDSEKRGVLRNISINANHADNILQQDNKRLKRSLDDVITNENE 394
             N+ K+ ++ +    +S  +KR  L NI IN N  +++ Q    +  R+ + +  +   
Sbjct: 365 GKNLTKQYAQREQYTLESSFKKREALANIDINRNSQESLQQPKRFKPIRTQEQLSESHLP 424

Query: 395 NKKI-QEVFYHRPAPKPPVTKKVEIVEPAKSASSSNNRSMITVNDSQYEKIELLGRGGSS 453
              + +E + +R  PKP  TK+VEI+EP  S   S  ++++ VND +YEK+ELLGRGGSS
Sbjct: 425 EPYVNKEEYLNREPPKPRATKRVEILEPKPSQGQSR-KNVVKVNDVEYEKVELLGRGGSS 483

Query: 454 RVYKVKGSGNKIYALKRXXXXXXXXXXXXGFKGEIELLEKLKDQRRVIQLLDYEMGDGLL 513
           +VYKV+   N +YALKR            GFKGEIELL+KL++Q RV+QL+D+EM  G+L
Sbjct: 484 KVYKVRDRSNNVYALKRVVFDEFDDSSVSGFKGEIELLKKLENQNRVVQLVDHEMEHGVL 543

Query: 514 YLIMECGDHDLSQILNQRSNMPLDFNFVRFYTKEMLLCIKVVHDAGIVHSDLKPANFVLV 573
           YLIMECGDHDLS+ILN R+ MPLD  FVR++ +EML C+KVVHD+GIVHSDLKPANFV V
Sbjct: 544 YLIMECGDHDLSRILNHRAGMPLDMEFVRYHAREMLRCVKVVHDSGIVHSDLKPANFVFV 603

Query: 574 KGILKIIDFGIANAVPEHTVNIYRETQIGTPNYMAPEALVAMNYTQSSDNQHEGNKWKVG 633
           KGILKIIDFGIANAVP+HTVNIYRE QIGTPNYMAPEALVAMNYTQ  +   + N+WKVG
Sbjct: 604 KGILKIIDFGIANAVPDHTVNIYRENQIGTPNYMAPEALVAMNYTQDDEKYQQQNRWKVG 663

Query: 634 RPSDMWSCGCIIYQMIYGKPPYGSFQGQNRLLAIMNPDVKIPFPEYTSNNEKIPKSAIEL 693
           +PSD+WSCGCIIYQMIYG+PPYG FQGQNRLLAIMNPDVKI F + TS +E IP+SA++ 
Sbjct: 664 KPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIMNPDVKIIFSDKTSRDETIPRSALDT 723

Query: 694 MKACLYRNPDKRWTVDKVLSSTFLQPFMISGSIMEDLIKNAVRYGSEKPQISHDDLNDVV 753
           MKACL RNPDKR TVD+VL S FL+P M++   + DLIKNAVRYG+++ ++S + + ++ 
Sbjct: 724 MKACLTRNPDKRLTVDEVLESNFLKPLMVTPFFIRDLIKNAVRYGADQKEVSKEKVEELA 783

Query: 754 ETVLRKFSDYKI 765
           + VL + SD+++
Sbjct: 784 DDVLSRLSDFRL 795

>NCAS0I02080 Chr9 (390551..392875) [2325 bp, 774 aa] {ON} Anc_3.162
          Length = 774

 Score =  637 bits (1644), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 366/813 (45%), Positives = 495/813 (60%), Gaps = 87/813 (10%)

Query: 1   MSTNSFHDYMDLNSRTNMRQF--------SDDEEFTTPPKLSNFGSALLSHSEKTSAPET 52
           M+  S+H  + ++ R  ++          SDDE+ + PP LSNF SA LS  +K ++   
Sbjct: 1   MAKYSYHSRLSIHRREPLQNLGTNIEPDDSDDEKVSGPPVLSNFASAFLSEGDKNTS--N 58

Query: 53  LSSHKTNKMTNHVLEEMDXXXXXXXXXXXMGNLXXXXXXXXXXXXLFGRYLRNNHQTSMT 112
           +   +TN   N  ++ +              +L            LF   +  N Q+S+T
Sbjct: 59  IREEETNVFNNSNMK-LSQTPNNSIEPNQADDLSLHST-------LFANTV-GNRQSSLT 109

Query: 113 TMN-TNDIEINVGNS-----LDKSFERIRNLRQNMKEDMTSKYAERRSKRFLISNRTTKL 166
           TMN TN+  +N   +      + + ++I++L+Q MKE++TS+Y ERR+KRFL S R   L
Sbjct: 110 TMNSTNNFALNHDTNKEHTVFEDNLQKIKSLQQTMKEELTSRYIERRNKRFLTSRRNN-L 168

Query: 167 GPAKRATT------LTNVFDEEVPNSSNLPINPRETIETLLEDSNK---------SGFRE 211
           GPAKRA+T        + + E   +S+N   + ++    L +   +           F+ 
Sbjct: 169 GPAKRASTSAISASTEDRYQENDKHSNNEKYSTQDDSNILAKQVGRLSSPLNRQNRAFQS 228

Query: 212 S-------KKNMDYESIEFGDLNPIQYIKKHNLPTSDLPLISQIYFDKQREENRQAALRK 264
           S       K+ +DY SIEFG+L P +Y+KKH+LPTS+LP IS+IYF+KQ+ ENRQ  LRK
Sbjct: 229 SNGDDTNMKEPVDYSSIEFGELTPFEYLKKHDLPTSELPYISRIYFEKQKLENRQTVLRK 288

Query: 265 H--SSRELL----------YKNRXXXXXXXXXXXXXXXXXXITFINSSLPXXXXXXXXXX 312
              SS+E L          Y N                   I+  +S +           
Sbjct: 289 RRFSSKESLSLGTTSSLAPYSNSKNNTTNQVSRDLSLPRRKISDTSSKI----------- 337

Query: 313 XXXXXXXXXALKENIDTSNNSSFNSPIHNIHKEISRNKDSDSEKRGVLRNISINANHADN 372
                     LK NI+ S + S   P     + I R  +S +EK      I +N N+   
Sbjct: 338 ------SKQILKSNINLSESGSHGFPPD--LQSIQRQHES-AEKLSRAPLIDLNVNNVSP 388

Query: 373 ILQQDNKRLKRSLDDVITNENENKKIQEVFYHRPAPKPPVTKKVEIVEPAKSASSSNNRS 432
                 +   +  D  +  ++ +KK   V Y + AP+    KKVEIVEP +S S    R+
Sbjct: 389 KRMDKLRETHKFSDSRLNVQDFSKKTDVVVYEKQAPR----KKVEIVEPKRSHSKLAKRN 444

Query: 433 MITVNDSQYEKIELLGRGGSSRVYKVKGSGNKIYALKRXXXXXXXXXXXXGFKGEIELLE 492
            ITVND++YEKIELLGRGGSSRVYKVK S NK++ALKR            GFKGEIELLE
Sbjct: 445 TITVNDTEYEKIELLGRGGSSRVYKVKNSQNKVFALKRVSFDEFDDSSVDGFKGEIELLE 504

Query: 493 KLKDQRRVIQLLDYEMGDGLLYLIMECGDHDLSQILNQRSNMPLDFNFVRFYTKEMLLCI 552
           KL ++ RV++L DY+M  G+L+LIMECGDHDLSQIL+QRS+MPLD +FVR++ +E++ CI
Sbjct: 505 KLSNESRVVKLFDYQMDSGVLFLIMECGDHDLSQILSQRSDMPLDMDFVRYHAREVVRCI 564

Query: 553 KVVHDAGIVHSDLKPANFVLVKGILKIIDFGIANAVPEHTVNIYRETQIGTPNYMAPEAL 612
           K+VHDAGIVHSDLKPANFV VKGILKIIDFGIANA+P+HTVNIYRE QIGTPNYMAPEAL
Sbjct: 565 KIVHDAGIVHSDLKPANFVFVKGILKIIDFGIANAIPDHTVNIYRENQIGTPNYMAPEAL 624

Query: 613 VAMNYTQSSDNQHEGNKWKVGRPSDMWSCGCIIYQMIYGKPPYGSFQGQNRLLAIMNPDV 672
           VAMNYT  +D    GNKWKVG+PSD+WSCGCIIYQMIYG+PPY  FQGQNRLLAIMNPDV
Sbjct: 625 VAMNYTNENDG---GNKWKVGKPSDIWSCGCIIYQMIYGRPPYAGFQGQNRLLAIMNPDV 681

Query: 673 KIPFPEYTSNNEKIPKSAIELMKACLYRNPDKRWTVDKVLSSTFLQPFMISGSIMEDLIK 732
           K+ F E T+NNE IP+S I+LMK CL R+P+KRW+VD+VL S F  P +++   ++DLIK
Sbjct: 682 KVIFSEKTANNESIPRSLIDLMKGCLTRDPEKRWSVDQVLESPFFNPIVVTPFFIKDLIK 741

Query: 733 NAVRYGSEKPQISHDDLNDVVETVLRKFSDYKI 765
           NAVRYG ++ ++S++ + ++   VL + +D+K+
Sbjct: 742 NAVRYGVDQREVSNEKIEELANDVLGRLTDFKM 774

>ZYRO0B04906g Chr2 (395546..398089) [2544 bp, 847 aa] {ON} similar
           to uniprot|P54199 Saccharomyces cerevisiae YDL028C MPS1
           Dual-specificity kinase required for spindle pole body
           (SPB) duplication and spindle checkpoint function
           substrates include SPB proteins Spc42p Spc110p and
           Spc98p mitotic exit network protein Mob1p and checkpoint
           protein Mad1p
          Length = 847

 Score =  629 bits (1623), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 376/842 (44%), Positives = 500/842 (59%), Gaps = 108/842 (12%)

Query: 7   HDYMDLNSRTNMRQFSDDEEFTTPPKLSNFGSALLSHSEK---------------TSAPE 51
           HD   ++++T     SDDE+ + PPKLSNFGSALLS  EK               +  P 
Sbjct: 31  HDQKKVSTKTIFTDDSDDEKISIPPKLSNFGSALLSEKEKENINENDLFEMLPKDSVKPS 90

Query: 52  TLSSHKTNKMTNHVLEEMDXXXXXXXXXXXMGN-LXXXXXXXXXXXXLFGRYLRNNHQTS 110
           +L++       NH                  GN              LF +Y R++ Q S
Sbjct: 91  SLNNEPYYNSVNHT----------------PGNTYASIHSGDPSQSTLFAQY-RSHQQPS 133

Query: 111 MTTMNTNDIEINVGNSLDKSFERIRNLRQNMKEDMTSKYAERRSKRFLISNRTTKLGPAK 170
           MTTMN+ D++   GN  + SF++I++++Q+M+E++TS++AERRS+RFL S+R   LGPAK
Sbjct: 134 MTTMNSTDVQDKDGNDFENSFQKIKSMQQSMREELTSRHAERRSRRFLNSSRKEFLGPAK 193

Query: 171 RATTLTNVFDEEV------PNSSNLPINPRETIETLLEDSNKSGFRESKKNMDYESIEFG 224
           RA+    +F E +        +SN   +   + + LL+  N+    E K ++  + ++ G
Sbjct: 194 RASA---IFPEALDRRFSGTTNSNGTNDNNNSTDGLLQ-LNREESPEEKLSLSSQ-VDLG 248

Query: 225 DLNPIQYIKKHNLPTSDLPLISQIYFDKQREENRQAALRKHSSRELLYKNRXXXXXXXXX 284
           DLNP+QY+KKH+LPTS+LP IS++YF+KQ+    + A  K   +E+L ++R         
Sbjct: 249 DLNPVQYLKKHDLPTSELPRISRLYFEKQKPRKMELARLK---QEILRESRTSSSGNNGS 305

Query: 285 XXXXXXXXXITFINSSL-PXXXXXXXXXXXXXXXXXXXALKENIDTSNN--SSFNSPIHN 341
                       ++++  P                    +  ++D+  N  S  +S  HN
Sbjct: 306 GVQHIPIRRENSLSAATQPRRKLSDTSSRNIFQRGFSSPVARSVDSQRNILSDKSSLKHN 365

Query: 342 IHKEISRNKD--SDSEKRGVLRNISINANHADNILQQDNKRLK---------RSLD---- 386
            +     +        KR  L NI +N N+ D I + + KR K         R+ D    
Sbjct: 366 EYDSYPHSNTLLYSHRKREALANIDVNRNNNDQIYEPELKRYKYFDEHHNNNRNNDYEPE 425

Query: 387 ----DVIT---NENENKKIQEVFYHR-PAPKPPVT------------------------K 414
               D+     N N NK  + +   R P+  PPV                         K
Sbjct: 426 SKRYDLFEDHRNGNNNKDEKPISLERLPSEAPPVAIPIHPSVIQENEFHHREAPKPPVVK 485

Query: 415 KVEIVEPAK----SASSSNN-----RSMITVNDSQYEKIELLGRGGSSRVYKVKGSGNKI 465
           KVEIVEP K       SSN      R+  TVND +YEKIELLGRGGSS+VYKVK + NK+
Sbjct: 486 KVEIVEPEKRTDSKGKSSNGEALTRRNATTVNDVEYEKIELLGRGGSSKVYKVKDNNNKL 545

Query: 466 YALKRXXXXXXXXXXXXGFKGEIELLEKLKDQRRVIQLLDYEMGDGLLYLIMECGDHDLS 525
           YALKR            GFKGEIELL KLKD+ RV++L DYEM  G+LYLIMECGDHDLS
Sbjct: 546 YALKRVVFDEFDDSSVNGFKGEIELLNKLKDKTRVVKLFDYEMEHGVLYLIMECGDHDLS 605

Query: 526 QILNQRSNMPLDFNFVRFYTKEMLLCIKVVHDAGIVHSDLKPANFVLVKGILKIIDFGIA 585
           QILNQR+ MPLD  FVR++ +EML C+KVVHDAGIVHSDLKPANFV VKGILKIIDFGIA
Sbjct: 606 QILNQRAGMPLDIEFVRYHAREMLKCVKVVHDAGIVHSDLKPANFVFVKGILKIIDFGIA 665

Query: 586 NAVPEHTVNIYRETQIGTPNYMAPEALVAMNYTQSSDNQ--HEGNKWKVGRPSDMWSCGC 643
           NAVP+HTVNIYRETQIGTPNYMAPEALVAMNYT  +D     + N+WKVG+PSD+WSCGC
Sbjct: 666 NAVPDHTVNIYRETQIGTPNYMAPEALVAMNYTGQNDGDKYKQQNRWKVGKPSDVWSCGC 725

Query: 644 IIYQMIYGKPPYGSFQGQNRLLAIMNPDVKIPFPEYTSNNEKIPKSAIELMKACLYRNPD 703
           IIYQMIYG+PPYG FQGQNRLLAIMNP+VKI F E T+N+E +P+S ++ MKACL RNPD
Sbjct: 726 IIYQMIYGRPPYGGFQGQNRLLAIMNPEVKIIFSEKTANDEAVPRSILDTMKACLLRNPD 785

Query: 704 KRWTVDKVLSSTFLQPFMISGSIMEDLIKNAVRYGSEKPQISHDDLNDVVETVLRKFSDY 763
           KR TVD+VL S FL+P M++   + DLIKNAVRYG+++ ++S + + ++ + VL K +D 
Sbjct: 786 KRLTVDEVLDSPFLKPVMVTPFFIRDLIKNAVRYGADQKEVSKEKVEELADDVLGKLADI 845

Query: 764 KI 765
           ++
Sbjct: 846 RL 847

>KAFR0F02220 Chr6 (432967..435210) [2244 bp, 747 aa] {ON} Anc_3.162
           YDL028C
          Length = 747

 Score =  585 bits (1509), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 335/766 (43%), Positives = 458/766 (59%), Gaps = 73/766 (9%)

Query: 25  EEFTTPPKLSNFGSALLSHSEKTSAPETLSSHKTNKMTNHVLEEMDXXXXXXXXXXXMGN 84
           E    PPKLSNFGSALL+ ++ +       +   +   N V   +            +  
Sbjct: 30  ENIIGPPKLSNFGSALLTENDNSGTTSRFHTQFRSLNGNSVHSPISLSRNNSYGSYGIA- 88

Query: 85  LXXXXXXXXXXXXLFGRYLRNNHQTSMTTMNTNDIEINVGNSLDKSFE----RIRNLRQN 140
                        +F   + NN   SMTT+     + NV N+++  +E    +I  ++Q+
Sbjct: 89  ------EQSPQTSIFATTI-NNRPISMTTIQNGSADSNVTNNVNDKYESSYNKINKIQQS 141

Query: 141 MKEDMTSKYAERRSKRFLISNRTTKLGPAKRATTLTNVFDEEVPNSSNLPINPRETIETL 200
           +K+++TS++  R  KRFL +NR  KLGPAKRA+T+    D  +P ++N   N    + + 
Sbjct: 142 IKDELTSRHTGR-IKRFLNTNRMNKLGPAKRASTME--VDIPLPANTNDSYNSSSDVFSG 198

Query: 201 LEDSNKSGFRESKKNMDYESIEFGDLNPIQYIKKHNLPTSDLPLISQIYFDKQREENRQA 260
                 +  +E + N DY +I FGDLNP Q+++K+NLPT++LP IS+IYF++Q+EENR +
Sbjct: 199 QAIEEANDIKEVQ-NYDYSNINFGDLNPFQFLRKYNLPTTELPNISKIYFERQKEENRLS 257

Query: 261 ALRKHSSREL-------------LYKNRXXXXXXXXXXXXXXXXXXITFINSSLPXXXXX 307
            L+KH++                + KN                    T +NS+L      
Sbjct: 258 ILKKHTNNNTGAKTNGNDIKDFSISKNLTSEDKTDLKNTVNTGLVSRTLLNSTLSSRKTN 317

Query: 308 XXXXXXXXXXXXXXALKENIDTSNNSSFNSPIHNIHKEISRNKDS--DSEKRGVLRNISI 365
                                + +N+ FNS      K ++ N D    +++R  L ++S 
Sbjct: 318 SSLSPK---------------SKDNNEFNSLDVEEPKHLTSNNDEIRPNKRREPLVDLST 362

Query: 366 NANHAD----NILQQDNKRLKRSLDDVITNENENKKIQEVFYHRPAPKPPVTKKVEIVEP 421
           N    +       +++ KR      D I NE EN  +Q+V        P   K+VEI+EP
Sbjct: 363 NRKEPELKRFKTFEENKKR------DEIINEKENV-VQDV--------PKSMKRVEIMEP 407

Query: 422 AKSASSSNNRSMITVNDSQYEKIELLGRGGSSRVYKVKGSGNKIYALKRXXXXXXXXXXX 481
             S      R++I VN+++YEKIELLGRGGSS+VYKVKG  NK++ALKR           
Sbjct: 408 KMSHRQ---RNVINVNETEYEKIELLGRGGSSKVYKVKGPSNKVFALKRVVFDEFDDSSI 464

Query: 482 XGFKGEIELLEKLKDQRRVIQLLDYEMGDGLLYLIMECGDHDLSQILNQRSNM--PLDFN 539
            GFKGEI+LL KL+++ RV++L DYEM  GLLYLIMECGD DLSQILNQ+ N+  P D  
Sbjct: 465 NGFKGEIKLLNKLRNENRVVKLFDYEMNQGLLYLIMECGDVDLSQILNQKINLNLPFDIE 524

Query: 540 FVRFYTKEMLLCIKVVHDAGIVHSDLKPANFVLVKGILKIIDFGIANAVPEHTVNIYRET 599
           F+R+YT+EM+ C+KVVHD GIVHSDLKPANFVLVKG+LKIIDFGIA+AVP+HTVNIYRET
Sbjct: 525 FIRYYTREMIKCVKVVHDNGIVHSDLKPANFVLVKGVLKIIDFGIADAVPDHTVNIYRET 584

Query: 600 QIGTPNYMAPEALVAMNYTQSSDNQHEGNKWKVGRPSDMWSCGCIIYQMIYGKPPYGSFQ 659
           Q GTPNYMAPE L+AMNYT   +N  +  KWKVG+PSD+WSCGCIIYQMIYGK PY  FQ
Sbjct: 585 QTGTPNYMAPETLIAMNYT---NNGAKDLKWKVGKPSDVWSCGCIIYQMIYGKAPYAGFQ 641

Query: 660 GQNRLLAIMNPDVKIPFPEYTSNNEKIPKSAIELMKACLYRNPDKRWTVDKVLSSTFLQP 719
           GQ+R+ AIMN DVKI +PE T+  E IPK+ +ELMK CL R+P KRWTVD +LSSTFL P
Sbjct: 642 GQHRIFAIMNSDVKIVYPEKTNEEELIPKTMVELMKNCLRRDPGKRWTVDDILSSTFLNP 701

Query: 720 FMISGSIMEDLIKNAVRYGSEKPQISHDDLNDVVETVLRKFSDYKI 765
            + S S + DLIKNA+ +GS++  +S D +ND+   VL +  ++K+
Sbjct: 702 IVTSQSFIRDLIKNAITFGSQQKIVSEDKINDLTNDVLTRLQEFKM 747

>Kwal_33.14167 s33 (554863..557379) [2517 bp, 838 aa] {ON} YDL028C
           (MPS1) - serine/threonine/tyrosine protein kinase (dual
           specificity), able to autophosphorylate as well as act
           on Mad1p. A mutation predicted to abolish kinase
           function eliminates in vitro protein kinase activity and
           behaves like a null mutation in vivo. [contig 105] FULL
          Length = 838

 Score =  588 bits (1515), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 358/842 (42%), Positives = 491/842 (58%), Gaps = 120/842 (14%)

Query: 13  NSRTNMRQFSDDEEFTTPPKLSNFGSALLSHSEKTSAPETLSS---HKTNKMT------- 62
           N  +  R  SDDE    PP LSNFGSALLS  E      + +S   H  N+M+       
Sbjct: 28  NIHSTARDDSDDENMLGPPTLSNFGSALLSDKENVEPHRSTASSRHHPLNQMSRTHSQLP 87

Query: 63  --NHVLEEMDXXXXXXXXXXXMGNLXXXXXXXXXXXXLFGRYLRNNHQTSMTTMNTNDIE 120
                L                G              LF  +  N  Q SMTT N +D  
Sbjct: 88  SRTETLAMSREFSTANTNSSYTGPHSTIHSVDHSDSTLFATFKDN--QQSMTTFNPDDQL 145

Query: 121 INVG---NSLDKSFERIRNLRQNMKEDMTSKYAERRSKRFLISNRTTKLGPAKRATTLT- 176
              G    SL++S  +I++L+Q +++D++S+ ++RR++RF  S+R + LGPAKRA++ + 
Sbjct: 146 HQSGLDRVSLEQSRSKIKSLQQALRDDLSSRNSKRRTRRF-ASSRLSLLGPAKRASSTSG 204

Query: 177 -----------NVFDEE--VPNSS-----------NLPINPRETIETLLEDSNKSGFRES 212
                      N+   E  + NSS           N+   P+ + + +   S+ S F  S
Sbjct: 205 TPNRSELIEESNISQPEGNISNSSTRTASANLNEHNIFYEPQNSNQAI--QSSHSPFISS 262

Query: 213 KKNMDYESIEFGDLNPIQYIKKHNLPTSDLPLISQIYFDKQREENRQAALRKHSSRELLY 272
              ++YE +EFGDLNP QY+KK+NLPT++LP IS+IYF++Q+ +NR+AALRK  + +   
Sbjct: 263 --TINYEDVEFGDLNPYQYLKKYNLPTTELPNISRIYFERQKGQNRKAALRKSIASKDAI 320

Query: 273 KNRXXXXXXXXXXXXXXXXXXITFINSSLPXXXXXXXXXXXXXXXXXXXALKENIDTSNN 332
           +NR                   T    S P                    + E+  +++ 
Sbjct: 321 QNRIA----------------TTSSPHSPPVDADAIRRDNSAFKRQPRRKISESATSNDP 364

Query: 333 SSFNSPIHNIHKEI---SRNKD--------SDSE-----------KRGVLRNISINANHA 370
            +++SP   I+      +R  D        S++E           +R  L NI+IN+  A
Sbjct: 365 KAWSSPFSGINNPTVASARRTDQYQADEKYSNTEIPDPNAFDSFRRREALSNININSYSA 424

Query: 371 DNILQQDNK----------RLKR-SLDD--VITNENENKKIQEVFYHRPAPKPPVTKKVE 417
                +  K          RL R SL++   I+N+ E +     F HR  P  P  K VE
Sbjct: 425 AQPQHKKPKYSDYNPQEFGRLPRPSLENRSPISNKEEPQ-----FKHRSPPLIP-GKHVE 478

Query: 418 IVEPAKS---------ASSSN----NRSMITVNDSQYEKIELLGRGGSSRVYKVK-GSGN 463
           IVEP ++         ASS +     R ++ VN ++YEK+ELLGRGG+S+VYKVK  + N
Sbjct: 479 IVEPIRTKESIPLKPPASSDDINGRKRPVVYVNGTEYEKLELLGRGGTSKVYKVKNANNN 538

Query: 464 KIYALKRXXXXXXXXXXXXGFKGEIELLEKLKDQRRVIQLLDYEMGDGLLYLIMECGDHD 523
           K+YALKR            GFKGEIELL+KL+ Q RV++L+D+EM  G+LY++MECGDHD
Sbjct: 539 KVYALKRVSFDEFDDSSIDGFKGEIELLKKLETQPRVVKLIDHEMDHGVLYVVMECGDHD 598

Query: 524 LSQILNQRSNMPLDFNFVRFYTKEMLLCIKVVHDAGIVHSDLKPANFVLVKGILKIIDFG 583
           LSQ L  RS MPLD  FVR++ +EML C+KVVHDAGIVHSDLKPANFV VKGILKIIDFG
Sbjct: 599 LSQTLAHRSGMPLDVEFVRYHAQEMLKCVKVVHDAGIVHSDLKPANFVFVKGILKIIDFG 658

Query: 584 IANAVPEHTVNIYRETQIGTPNYMAPEALVAMNYTQSSDNQHEGNKWKVGRPSDMWSCGC 643
           IANAVPEHTVNIYRETQIGTPNYMAPEALVAMNYT   +   E ++WKVG+PSD+WSCGC
Sbjct: 659 IANAVPEHTVNIYRETQIGTPNYMAPEALVAMNYTH--NQAPEQSRWKVGKPSDIWSCGC 716

Query: 644 IIYQMIYGKPPYGSFQGQNRLLAIMNPDVKIPFPEYTSNNEKIPKSAIELMKACLYRNPD 703
           IIYQMIYG+PPYG FQGQNRLLAIMNP+VKI +PE TSN + +PK+AI+ MKACL RNP+
Sbjct: 717 IIYQMIYGRPPYGGFQGQNRLLAIMNPEVKIVYPEKTSNGDTVPKTAIDTMKACLERNPN 776

Query: 704 KRWTVDKVLSSTFLQPFMISGSIMEDLIKNAVRYGSEKPQISHDDLNDVVETVLRKFSDY 763
           KRWTV++V + +F++P  ++   + DLI+N+VRYG+ + +IS   + ++ E V  +  ++
Sbjct: 777 KRWTVEEVANGSFVKPVSVTHFFIRDLIENSVRYGANQKEISSAKVEELAEDVWHRLEEF 836

Query: 764 KI 765
           ++
Sbjct: 837 RL 838

>KLTH0F06468g Chr6 (559256..561769) [2514 bp, 837 aa] {ON} similar
           to uniprot|P54199 Saccharomyces cerevisiae YDL028C MPS1
           Dual-specificity kinase required for spindle pole body
           (SPB) duplication and spindle checkpoint function
           substrates include SPB proteins Spc42p Spc110p and
           Spc98p mitotic exit network protein Mob1p and checkpoint
           protein Mad1p
          Length = 837

 Score =  581 bits (1497), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 348/836 (41%), Positives = 475/836 (56%), Gaps = 120/836 (14%)

Query: 19  RQFSDDEEFTTPPKLSNFGSALLSHSE-----------KTSAPETLSSHKTNKMTNHVLE 67
           R  SDDE    PPKLSNFGSALLS  E             S  +  S             
Sbjct: 33  RDDSDDENMLGPPKLSNFGSALLSDKENVEPYPYSRNQSVSNAKRYSQPPRAAARPETFG 92

Query: 68  EMDXXXXXXXXXXXMGNLXXXXXXXXXXXXLFGRYLRNNHQTSMTTMNTNDIEINVGNS- 126
            +             G              +F     N  Q SMTT N  +     G   
Sbjct: 93  AVREFSSSNTNNSVAGPYSTFHSEEHSDSTMFATSKHN--QQSMTTFNP-ETPSEQGKPE 149

Query: 127 ---LDKSFERIRNLRQNMKEDMTSKYAERRSKRFLISNRTTKLGPAKRATTLTNVFDE-E 182
              L+KS  R+++++Q ++++++ + ++RR++RF +S+R   LGPAKRA++ T   +  E
Sbjct: 150 DMYLEKSRSRVKSMQQTLRDELSLRSSKRRNRRF-VSSRFNLLGPAKRASSNTGTPNHSE 208

Query: 183 VPNSSNLPINPRETIETLLEDSNKSG----------FRESK---------------KNMD 217
           + + SN+        E     S+ +G          F ES+                +++
Sbjct: 209 LADESNV-----SQQEANFSHSSSAGATAHQNEYNVFYESQNSSSPQKDSAAPTDHTSIN 263

Query: 218 YESIEFGDLNPIQYIKKHNLPTSDLPLISQIYFDKQREENRQAALRKHSSRELLYKNRXX 277
           Y++IEFGDLNP QY+KKHN+PT++LP IS++YF++Q+ ENR+ ALRK+ + +  ++ R  
Sbjct: 264 YDNIEFGDLNPYQYLKKHNIPTTELPNISRLYFERQKGENRKTALRKNIAAKDAFQTRLT 323

Query: 278 XXXXXXXXXXXXXXXXITFINSSLPXXXXXXXXXXXXXXXXXXXALKENIDTSNNSSFNS 337
                            +  NS L                     + ++   +++ +++S
Sbjct: 324 SA---------------SLSNSPLLKHVDLIKREQSIPKRQPRRKISDHATNNDSKAWSS 368

Query: 338 PI-----------------------HNIHKEISRNKDSDSEKRGVLRNISINANHADNIL 374
           P+                        NI +   R+      +R  L NI+IN+N+     
Sbjct: 369 PVSSSKGLKTAPSRDGTSPRASEMYENIERP-ERDTFGSIRRREALSNININSNYH---- 423

Query: 375 QQDNKRLKRSLDDV-----ITNENENKKIQEV------FYHRPAPKPPVTKKVEIVEP-- 421
           Q  NKR K S +++     I        +QE       F HR  P  P  K VEIVEP  
Sbjct: 424 QLQNKRTKYSTENLEEARGIHRPPFEHSVQEERFANHGFKHRSPPAVPERKHVEIVEPLK 483

Query: 422 ----------AKSASSSNNRS-MITVNDSQYEKIELLGRGGSSRVYKVKG-SGNKIYALK 469
                     A S  S N R   I VN ++YEK+ELLGRGGSS+VYKVK  + NK+YALK
Sbjct: 484 TTESIPLKPPATSGDSYNRRKPTIYVNGTEYEKLELLGRGGSSKVYKVKNVANNKVYALK 543

Query: 470 RXXXXXXXXXXXXGFKGEIELLEKLKDQRRVIQLLDYEMGDGLLYLIMECGDHDLSQILN 529
           R            GFKGEIELL+KL+ + RV++L+D+EM  G+LY +MECGDHDLS  L 
Sbjct: 544 RVSFDEFDDSSIEGFKGEIELLKKLETKPRVVKLIDHEMDHGVLYEVMECGDHDLSHTLA 603

Query: 530 QRSNMPLDFNFVRFYTKEMLLCIKVVHDAGIVHSDLKPANFVLVKGILKIIDFGIANAVP 589
            RS M LD  FVRF+++EML C+KVVHD+GIVHSDLKPANFV VKGILKIIDFGIANAVP
Sbjct: 604 LRSGMGLDVEFVRFHSQEMLKCVKVVHDSGIVHSDLKPANFVFVKGILKIIDFGIANAVP 663

Query: 590 EHTVNIYRETQIGTPNYMAPEALVAMNYTQSSDNQHEGNKWKVGRPSDMWSCGCIIYQMI 649
           EHTVNIYRETQIGTPNYMAPEALVAMNYTQ      E N+WKVG+PSD+WSCGCIIYQMI
Sbjct: 664 EHTVNIYRETQIGTPNYMAPEALVAMNYTQG--QPAEQNRWKVGKPSDIWSCGCIIYQMI 721

Query: 650 YGKPPYGSFQGQNRLLAIMNPDVKIPFPEYTSNNEKIPKSAIELMKACLYRNPDKRWTVD 709
           YG+PPYG FQGQNRLLAIMNP+VKI +PE TSN + +PK+AI+ MKACL RNP+KRW+VD
Sbjct: 722 YGRPPYGGFQGQNRLLAIMNPEVKIVYPEKTSNGDVVPKTAIDTMKACLERNPEKRWSVD 781

Query: 710 KVLSSTFLQPFMISGSIMEDLIKNAVRYGSEKPQISHDDLNDVVETVLRKFSDYKI 765
           +VL+  F++P  ++   + DLIKN+V+YG+ + +IS++ + ++ E V  + +D+++
Sbjct: 782 EVLNGPFVKPIAVTHFFIRDLIKNSVKYGANQREISNEKIEELAEDVWHRLADFRL 837

>Kpol_1032.10 s1032 (24479..26854) [2376 bp, 791 aa] {ON}
           (24479..26854) [2376 nt, 792 aa]
          Length = 791

 Score =  509 bits (1311), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 251/424 (59%), Positives = 319/424 (75%), Gaps = 19/424 (4%)

Query: 355 EKRGVLRNISINANHADNILQ-QDNKRLKRSLDDV------ITNEN---ENKKIQEVFYH 404
           +KR  L +I++N NH  +  +  DNKR K S   +      +   N   E +K++++  +
Sbjct: 374 KKREALSSINVNTNHNHSYQELGDNKRNKISTKGIESEIEHVAARNSMLEQQKVEQL--N 431

Query: 405 RPAPKPPVTKKVEIVEPAKSASSSN--NRSMITVNDSQYEKIELLGRGGSSRVYKVKG-S 461
                    KKVEI+EP KSAS++   ++S+++VN  +YEKIELLGRGGSS+VYKVK   
Sbjct: 432 SANIHKHGKKKVEIIEP-KSASANRIASKSVVSVNGVEYEKIELLGRGGSSKVYKVKNVH 490

Query: 462 GNKIYALKRXXXXXXXXXXXXGFKGEIELLEKLKDQRRVIQLLDYEMGDGLLYLIMECGD 521
            NKI+ALKR             FKGEIELL+KL++++RV+ L+ ++M  G+L LIMECGD
Sbjct: 491 NNKIFALKRVMFDEFDESSIDSFKGEIELLKKLENEKRVVTLIQHQMESGVLLLIMECGD 550

Query: 522 HDLSQILNQRSNMPLDFNFVRFYTKEMLLCIKVVHDAGIVHSDLKPANFVLVKGILKIID 581
           HDLSQILNQR NMPLD  F+RF+ +EML C+KVVHDAGIVHSDLKPANFV VKGILKIID
Sbjct: 551 HDLSQILNQRMNMPLDIEFIRFHAREMLKCVKVVHDAGIVHSDLKPANFVFVKGILKIID 610

Query: 582 FGIANAVPEHTVNIYRETQIGTPNYMAPEALVAMNYTQSSDNQHEGNKWKVGRPSDMWSC 641
           FGIANAVP+HTVNIYRETQIGTPNYMAPEALVAMN  Q SD Q   NKWKVG+PSD+WSC
Sbjct: 611 FGIANAVPDHTVNIYRETQIGTPNYMAPEALVAMNSQQDSDQQ---NKWKVGKPSDIWSC 667

Query: 642 GCIIYQMIYGKPPYGSFQGQNRLLAIMNPDVKIPFPEYTSNNEKIPKSAIELMKACLYRN 701
           GCI+YQM YG+PPYGSFQGQNRLLAIMNP+VKI F E TSNNE+IP+SA+E MKACL RN
Sbjct: 668 GCILYQMFYGRPPYGSFQGQNRLLAIMNPNVKIVFSEKTSNNERIPRSALETMKACLIRN 727

Query: 702 PDKRWTVDKVLSSTFLQPFMISGSIMEDLIKNAVRYGSEKPQISHDDLNDVVETVLRKFS 761
           PDKRW VD+VL  +F  P M++  I+ DLIKNAV YG+++  ++ + + ++ + VL + +
Sbjct: 728 PDKRWAVDQVLEGSFFNPVMVTSFIIRDLIKNAVNYGADQRYVTDEKITELADDVLNRLA 787

Query: 762 DYKI 765
           D+++
Sbjct: 788 DFRL 791

 Score =  108 bits (271), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 91/280 (32%), Positives = 143/280 (51%), Gaps = 65/280 (23%)

Query: 17  NMRQFSDDEEFTTPPKLSNFGSALLSHSEKTSAPETLSSHKTNKMTNHVLEEMDXXXXXX 76
           N++  SDDE+ T  PKLSNFGSALL     TS  E ++    NK+TN  L   D      
Sbjct: 41  NIQDDSDDEQITGFPKLSNFGSALL-----TSEKENITK---NKLTNTNLTLNDDKSLAY 92

Query: 77  XXXXXMGNLXXXXXXXXXXXXLFGRYLRNNHQTSMT------TMNTNDIEINVGNSLDKS 130
                  ++               R    N  +SM+        N +   I+ GNS   +
Sbjct: 93  DNYSSTLSI--------------NRAGNVNTTSSMSKANNNYEYNNSSENISTGNS---T 135

Query: 131 FERIRNLRQNMKEDMTSKYAERR-SKRFLISNRTTKLGPAKRATTLTNVFDEEVPNSSNL 189
           F+R + L +++K+++ +K  ERR ++RF    +   LGPA R    TN+ +E++  +S  
Sbjct: 136 FQRFKGLHESIKDELNTKNLERRKTRRFFNRTKMGVLGPAMR----TNLENEKLGKNS-- 189

Query: 190 PINPRETIETLL------------------------EDSNKSGFRESKKNMDYESIEFGD 225
                ETIE  +                         D+++S  + S+  ++Y+ I+FG+
Sbjct: 190 ---KHETIEEKINKYDQPAHLISSSSTVASSSYTSYHDTHQSINQTSQTTINYDLIDFGE 246

Query: 226 LNPIQYIKKHNLPTSDLPLISQIYFDKQREENRQAALRKH 265
           LNP+QYIKK+NLPT++LP IS++YF++QR E+R+ AL+KH
Sbjct: 247 LNPVQYIKKNNLPTTELPTISKLYFERQRAESRKIALKKH 286

>TPHA0M00300 Chr13 (59377..61701) [2325 bp, 774 aa] {ON} Anc_3.162
           YDL028C
          Length = 774

 Score =  505 bits (1300), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 223/356 (62%), Positives = 296/356 (83%), Gaps = 5/356 (1%)

Query: 412 VTKKVEIVEPAKSASS-SNNRSMITVNDSQYEKIELLGRGGSSRVYKVKGSGN-KIYALK 469
           + KKVEIVEP  S ++  +++S+++VND +YE+IELLGRGGSS+VYKVK + N ++YALK
Sbjct: 422 IVKKVEIVEPPTSMTNRKSSKSIVSVNDIEYERIELLGRGGSSKVYKVKNTNNNRVYALK 481

Query: 470 RXXXXXXXXXXXXGFKGEIELLEKLKDQRRVIQLLDYEMGDGLLYLIMECGDHDLSQILN 529
           R             FKGEIELL+KL++++RV++L+ Y+M +G+LYL+MECGDHDLSQILN
Sbjct: 482 RVVFDEFDDTSVDAFKGEIELLKKLENEKRVVKLIQYQMDNGVLYLVMECGDHDLSQILN 541

Query: 530 QRSNMPLDFNFVRFYTKEMLLCIKVVHDAGIVHSDLKPANFVLVKGILKIIDFGIANAVP 589
           QR+NMPLD +F+R+Y++EML C+KVVHDAGIVHSDLKPANFVLVKGILKIIDFGIANAVP
Sbjct: 542 QRANMPLDVDFIRYYSREMLKCVKVVHDAGIVHSDLKPANFVLVKGILKIIDFGIANAVP 601

Query: 590 EHTVNIYRETQIGTPNYMAPEALVAMNYTQSSDNQHEGNKWKVGRPSDMWSCGCIIYQMI 649
           +HTVNIYR+TQIGTPNYMAPEALVA+N      N  + N+W+VG+PSD+WSCGCI+YQM 
Sbjct: 602 DHTVNIYRDTQIGTPNYMAPEALVALNEVS---NVEKKNRWRVGKPSDIWSCGCIMYQMF 658

Query: 650 YGKPPYGSFQGQNRLLAIMNPDVKIPFPEYTSNNEKIPKSAIELMKACLYRNPDKRWTVD 709
           YG+PPYG+FQ QNRLLAIMNP+VKI F E TS NE++PKSA++ MKACL R+P+KRWT D
Sbjct: 659 YGRPPYGAFQNQNRLLAIMNPEVKIVFSEKTSKNERVPKSALDTMKACLIRSPEKRWTAD 718

Query: 710 KVLSSTFLQPFMISGSIMEDLIKNAVRYGSEKPQISHDDLNDVVETVLRKFSDYKI 765
           ++L ++FL P +++  I+ DLI+NAV YGS++ Q+S D + ++ + VL + +D+++
Sbjct: 719 EILDASFLNPVLVTPYIVRDLIRNAVYYGSDQGQVSEDKITELADDVLNRLADFRL 774

 Score = 71.6 bits (174), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 78/303 (25%), Positives = 120/303 (39%), Gaps = 101/303 (33%)

Query: 24  DEEFTTPPKLSNFGSALLSHSEKTSAPETLSSHKTNKMTNHVLEEMDXXXXXXXXXXXMG 83
           DE+ T  PKLSNFGSAL+S   +     +L++   +  +N+                   
Sbjct: 30  DEKLTVLPKLSNFGSALISEKNENITRNSLTNSSISMSSNY------------------- 70

Query: 84  NLXXXXXXXXXXXXLFGRYLRNNHQTSMTTMNTNDIEINVGNSLDKSFERIRNLRQNMKE 143
                               +NN    + T+N+N    N G      F+ I+NL   + +
Sbjct: 71  -------------NQINTLTKNNE---IGTINSN---FNNGQIASPKFKGIKNL---IDQ 108

Query: 144 DMTSKYAERR-SKRFLISNRTTKLGPAKRA--------TTLTNV---------------- 178
           +MT K+ ERR  +R         LG AKR         + +T V                
Sbjct: 109 EMTVKHNERRKGRRIFRKIELNSLGKAKRTNLDYTIAPSHMTEVNYDQYQENDHKTFESM 168

Query: 179 --FDEEVP----------------------NSSNLPINPRETIETLLEDSNKSGFRESKK 214
              + ++P                      NS N    P  +  + L  S  + F +S  
Sbjct: 169 NDMENDIPKYKTTTDSILSNNKSTDNLAGKNSKNHVTTPSSSFGSTLYSSTTNPFTDSNT 228

Query: 215 N-----------MDYESIEFGDLNPIQYIKKHNLPTSDLPLISQIYFDKQREENRQAALR 263
                       +DY  IE GDLNP Q +KK+NLP+++L  IS++YF+KQ+EENR+  ++
Sbjct: 229 YNHSNTSLPNTMIDYNLIEIGDLNPFQVLKKYNLPSTELATISKLYFEKQKEENRKNIMK 288

Query: 264 KHS 266
           K S
Sbjct: 289 KRS 291

>ADR317C Chr4 complement(1263080..1265539) [2460 bp, 819 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDL028C
           (MPS1)
          Length = 819

 Score =  504 bits (1297), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 243/437 (55%), Positives = 316/437 (72%), Gaps = 42/437 (9%)

Query: 353 DSEKRGVLRNISINANHADNILQQDNKRLKRSLDDVITNENENKKIQEVF-YHRPAPKPP 411
           +++KR  L ++ +NAN   +I+                   + +K+ E+  Y + AP   
Sbjct: 401 NTKKREALNSLDVNANRHPSII------------------TKKQKVDELHDYLKKAPAAA 442

Query: 412 VTKKVEIVEPAK------------SASSSNN--------RSMITVNDSQYEKIELLGRGG 451
             KKVEIVEP +            SA    N        R +ITVN S+YEK+ELLGRGG
Sbjct: 443 SVKKVEIVEPVRDPVITTIPLKPPSAEVPANVHQLPQRKRQVITVNGSEYEKVELLGRGG 502

Query: 452 SSRVYKVKGSGNKIYALKRXXXXXXXXXXXXGFKGEIELLEKLKDQRRVIQLLDYEMGDG 511
           SS+VYKV+ S N+IYALKR            GFKGEIELL+KL++Q RV++L+D+EM  G
Sbjct: 503 SSKVYKVRNSSNRIYALKRVSFDEFDDASADGFKGEIELLKKLENQTRVVKLIDHEMNHG 562

Query: 512 LLYLIMECGDHDLSQILNQRSNMPLDFNFVRFYTKEMLLCIKVVHDAGIVHSDLKPANFV 571
           +LY++MECGDHDLSQ+L QRS+MPLD  FVR++ +EML C+KVVHDAGIVHSDLKPANFV
Sbjct: 563 VLYVVMECGDHDLSQVLAQRSSMPLDIEFVRYHAQEMLKCVKVVHDAGIVHSDLKPANFV 622

Query: 572 LVKGILKIIDFGIANAVPEHTVNIYRETQIGTPNYMAPEALVAMNYTQSSDN-QHE--GN 628
            VKGILKIIDFGIANAVP+HTVNIYR+TQIGTPNYMAPEALVAMNYTQ SD  Q E   N
Sbjct: 623 FVKGILKIIDFGIANAVPDHTVNIYRDTQIGTPNYMAPEALVAMNYTQDSDQIQQEMHHN 682

Query: 629 KWKVGRPSDMWSCGCIIYQMIYGKPPYGSFQGQNRLLAIMNPDVKIPFPEYTSNNEKIPK 688
           +WKVG+PSD+WSCGCI+YQMIYGKPPYGSFQGQNRLLAIMNP+VKI +PE T   + +P+
Sbjct: 683 RWKVGKPSDIWSCGCIMYQMIYGKPPYGSFQGQNRLLAIMNPEVKIVYPEKTPTGDFVPR 742

Query: 689 SAIELMKACLYRNPDKRWTVDKVLSSTFLQPFMISGSIMEDLIKNAVRYGSEKPQISHDD 748
           +A++ +KACL RNP++RWTVD++L   F++P  ++   + DLIKNAV+YGS++  +S + 
Sbjct: 743 TALDTIKACLERNPERRWTVDELLRGPFIKPITVTHFFIRDLIKNAVKYGSDQRYVSKEK 802

Query: 749 LNDVVETVLRKFSDYKI 765
           + ++ + V  + SD+++
Sbjct: 803 VENLADDVWHRLSDFRL 819

 Score =  114 bits (284), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 91/269 (33%), Positives = 126/269 (46%), Gaps = 41/269 (15%)

Query: 22  SDDEEFTTPPKLSNFGSALLSHSEKTSAPETLSSHKTNKMTNHVLEEMDXXXXXXXXXXX 81
           SDD+    PPKLSNFGSALL+  E  + P  L    T+    +                 
Sbjct: 38  SDDDHPLGPPKLSNFGSALLTDKENET-PTYLRRSGTSLQGGNA--------TATSGHTK 88

Query: 82  MGNLXXXXXXXXXXXXLFGRYLRNNHQTSMTTMNTNDIEINVGNSLDKSFERIRNLRQNM 141
                           LF     + HQ SMTT+   D E         S  R + ++Q+M
Sbjct: 89  PSTFTGTMNTEDSHSTLFSSM--SKHQPSMTTV---DAERTAPGDDGLSSHRYQVIQQSM 143

Query: 142 KEDMTSKYAERRSKRFLISNRTTKLGPAKRATTLTNV-FDEEVPNSSNLPINPRE----- 195
           K+++ S+   RRS+RF I++R   LGPAKR +T TN  F   + +     ++ +E     
Sbjct: 144 KDEILSRQGTRRSRRF-ITSRLATLGPAKRNSTTTNFEFSSNISHDEPRDVSHQEGNVST 202

Query: 196 -------------------TIETLLEDSNKSGFRESKKNM-DYESIEFGDLNPIQYIKKH 235
                              T E    D  +S     +  + DY +I FGDLNP QY+KKH
Sbjct: 203 SSNSNSGVLNNNGYNVFLDTEERARHDDKESHSAARQSGLSDYGNISFGDLNPYQYLKKH 262

Query: 236 NLPTSDLPLISQIYFDKQREENRQAALRK 264
           NLPTS+LP IS+IYF+ Q+ ENR+AA+RK
Sbjct: 263 NLPTSELPNISRIYFEMQKRENRRAAVRK 291

>Ecym_5236 Chr5 (486270..488864) [2595 bp, 864 aa] {ON} similar to
           Ashbya gossypii ADR317C
          Length = 864

 Score =  502 bits (1292), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 231/394 (58%), Positives = 300/394 (76%), Gaps = 22/394 (5%)

Query: 394 ENKKIQEVFYH-RPAPKPPVTKKVEIVEPAKSA----------SSSNN--------RSMI 434
           ++K  ++ FYH R AP PP  KKVEI+EP K            S+ N         R +I
Sbjct: 471 KHKSDEQNFYHIRKAPNPPAVKKVEIIEPVKDTVITTIPLKPPSTENGSYQTPQRKRQII 530

Query: 435 TVNDSQYEKIELLGRGGSSRVYKVKGSGNKIYALKRXXXXXXXXXXXXGFKGEIELLEKL 494
            VN S+YEK+ELLGRGGSS+VYKV+ S NKIYALKR            GFKGEIELL++L
Sbjct: 531 QVNGSEYEKVELLGRGGSSKVYKVRSSNNKIYALKRVSFDEFDDTSIDGFKGEIELLKRL 590

Query: 495 KDQRRVIQLLDYEMGDGLLYLIMECGDHDLSQILNQRSNMPLDFNFVRFYTKEMLLCIKV 554
           +DQ RV++L+D+EM  G+LY++MECGDHDLSQ+L QR+NMP D  FVR++ +EML C++V
Sbjct: 591 EDQTRVVKLIDHEMNHGVLYVVMECGDHDLSQVLAQRANMPFDIEFVRYHAQEMLKCVQV 650

Query: 555 VHDAGIVHSDLKPANFVLVKGILKIIDFGIANAVPEHTVNIYRETQIGTPNYMAPEALVA 614
           VHD GIVHSDLKPANFV VKGILKIIDFGIANAVP+HTVNIYR+TQIGTPNYMAPEALVA
Sbjct: 651 VHDTGIVHSDLKPANFVFVKGILKIIDFGIANAVPDHTVNIYRDTQIGTPNYMAPEALVA 710

Query: 615 MNYTQ---SSDNQHEGNKWKVGRPSDMWSCGCIIYQMIYGKPPYGSFQGQNRLLAIMNPD 671
           MNYT     ++ + + N+WKVG+PSD+WSCGCIIYQMIYG+PPYG FQGQNRLLAIMNP+
Sbjct: 711 MNYTPDQGQTEQEIQQNRWKVGKPSDIWSCGCIIYQMIYGRPPYGGFQGQNRLLAIMNPE 770

Query: 672 VKIPFPEYTSNNEKIPKSAIELMKACLYRNPDKRWTVDKVLSSTFLQPFMISGSIMEDLI 731
           VKI +PE T++ + +P++A++ +KACL RNP++RWTVD +L   F++P  ++   + DLI
Sbjct: 771 VKIVYPEKTTHGDLVPRTALDTIKACLERNPERRWTVDDLLRGPFIKPVSVTHFFIRDLI 830

Query: 732 KNAVRYGSEKPQISHDDLNDVVETVLRKFSDYKI 765
           KNAV+YGS++  +S + + D+ + V  + SD+++
Sbjct: 831 KNAVKYGSDQRYVSKEKVEDLADDVWNRLSDFRL 864

 Score =  118 bits (296), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 92/269 (34%), Positives = 138/269 (51%), Gaps = 39/269 (14%)

Query: 22  SDDEEFTTPPKLSNFGSALLSHSEKTSAPETLSSHKTNKMTNHVLEEMDXXXXXXXXXXX 81
           SDDE   +PPKLSNFGSAL +  E     ET +  + + +        +           
Sbjct: 39  SDDENPLSPPKLSNFGSALFTDKEN----ETPTYLRKSGVVAQPAPYPNINMNANKPPTL 94

Query: 82  MGNLXXXXXXXXXXXXLFGRYLRNNHQTSMTTMNTNDIEINVGNSLDKSFERIRNLRQNM 141
            G L            LF    +  HQ SMTT+N    +   G     S+ R + ++Q+M
Sbjct: 95  TGTLHMDDGSHST---LFTSVSK--HQPSMTTVNQE--QRTPGEEGLGSY-RFQMIQQSM 146

Query: 142 KEDMTSKYAERRSKRFLISNRTTKLGPAKRATTLTNVFD----------EEVPNSSNLPI 191
           K++++S+   RRS+RF I++R + LGPAKR TTLT   D           ++ +      
Sbjct: 147 KDELSSRQIMRRSRRF-ITSRLSTLGPAKRNTTLTANLDFSSNMSHEDSRDLSHQDGNIS 205

Query: 192 NPRETIETLLEDSNKSGFRESKKN----------------MDYESIEFGDLNPIQYIKKH 235
           +       LL++ + + F +++ N                +DY++I FGDLNP QY+KKH
Sbjct: 206 SSSNNHSGLLQNQDYNVFLDTEPNCRPDSKENDGLKSASSIDYDNISFGDLNPYQYLKKH 265

Query: 236 NLPTSDLPLISQIYFDKQREENRQAALRK 264
           NLPTS+LP IS+IYF+ Q++ENR+AA+RK
Sbjct: 266 NLPTSELPNISRIYFEIQKKENRRAAVRK 294

>SAKL0C07348g Chr3 (677348..679933) [2586 bp, 861 aa] {ON} some
           similarities with uniprot|P54199 Saccharomyces
           cerevisiae YDL028C MPS1 Dual-specificity kinase required
           for spindle pole body (SPB) duplication and spindle
           checkpoint function substrates include SPB proteins
           Spc42p Spc110p and Spc98p mitotic exit network protein
           Mob1p and checkpoint protein Mad1p
          Length = 861

 Score =  484 bits (1246), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 216/357 (60%), Positives = 281/357 (78%), Gaps = 4/357 (1%)

Query: 409 KPPVTKKVEIVEPAKSASSSNNRSMITVNDSQYEKIELLGRGGSSRVYKVKGSGNKIYAL 468
           KPP T  ++   PA   S +  +  I VN ++YEK+ELLGRGGSS+VYKV+   NK+YAL
Sbjct: 509 KPPATGSLK--PPASLDSHARRKPTIQVNGTEYEKMELLGRGGSSKVYKVRTPNNKVYAL 566

Query: 469 KRXXXXXXXXXXXXGFKGEIELLEKLKDQRRVIQLLDYEMGDGLLYLIMECGDHDLSQIL 528
           KR            GFKGEIELL+KL++Q RV++L+DYEM  G+L+++MECGDHDLS IL
Sbjct: 567 KRVAFDEFDESSVDGFKGEIELLKKLENQPRVVRLVDYEMAHGVLFVVMECGDHDLSSIL 626

Query: 529 NQRSNMPLDFNFVRFYTKEMLLCIKVVHDAGIVHSDLKPANFVLVKGILKIIDFGIANAV 588
             R+++PLD  FVR++ +EML C+KVVHDA IVHSDLKPANFV VKGILKIIDFGIANAV
Sbjct: 627 AHRASLPLDIEFVRYHAQEMLRCVKVVHDADIVHSDLKPANFVFVKGILKIIDFGIANAV 686

Query: 589 PEHTVNIYRETQIGTPNYMAPEALVAMNYTQSSDNQHEGNKWKVGRPSDMWSCGCIIYQM 648
           P+HTVNIYRETQIGTPNYMAPEALVAMNY Q     H+ N+WKVG+PSD+WSCGCI+YQM
Sbjct: 687 PDHTVNIYRETQIGTPNYMAPEALVAMNYAQG--QPHQQNRWKVGKPSDIWSCGCILYQM 744

Query: 649 IYGKPPYGSFQGQNRLLAIMNPDVKIPFPEYTSNNEKIPKSAIELMKACLYRNPDKRWTV 708
           IYG+PPYG FQGQNRLLAIMNP+VKI +PE T + + +P++A++ MKACL RNPDKR TV
Sbjct: 745 IYGRPPYGGFQGQNRLLAIMNPEVKIVYPEKTPSGDVVPRTALDTMKACLERNPDKRCTV 804

Query: 709 DKVLSSTFLQPFMISGSIMEDLIKNAVRYGSEKPQISHDDLNDVVETVLRKFSDYKI 765
           D+VL+  F++P  ++   + DLIKNAV+YGSE+ ++S + + ++ + V  + +++++
Sbjct: 805 DEVLNGAFIRPVSVTHFFVRDLIKNAVKYGSEQREVSSEKVEELADDVWNRLAEFRL 861

 Score =  120 bits (302), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 75/194 (38%), Positives = 120/194 (61%), Gaps = 24/194 (12%)

Query: 102 YLRNNHQTSMTTMNTNDIEINVGNSLDKSFERIRNLRQNMKEDMTSKYAERRSKRFLISN 161
           +  + HQ SMTT++     ++   S ++S  R+R L+ ++KE+++S++A+RR++RF +S+
Sbjct: 132 FTTSRHQPSMTTVHPEPHGLDSSKS-EQSSHRLRALQHSLKEELSSRHAKRRNRRF-VSS 189

Query: 162 RTTKLGPAKRATTLTNVF--------------DEEVPNSSNLP--INPRETIETLLEDSN 205
           R   LGPAKRA++   +               +  V  SS+    +   E     LE   
Sbjct: 190 RLGLLGPAKRASSTAGLAYTDSGNDDASISQQEANVSGSSSTSGFVGNNEGYNVFLESHT 249

Query: 206 KSGFRE---SKKN--MDYESIEFGDLNPIQYIKKHNLPTSDLPLISQIYFDKQREENRQA 260
            +G R+   S K+  +DY  ++FGDLNP QY+KKHNLPTS+LP IS+IYF++Q+EENR+ 
Sbjct: 250 GAGERQHHTSSKDTGVDYRDVDFGDLNPYQYLKKHNLPTSELPNISKIYFERQKEENRRT 309

Query: 261 ALRKH-SSRELLYK 273
           ALRK+  +RE L++
Sbjct: 310 ALRKNVVTRETLHE 323

 Score = 38.1 bits (87), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 18/35 (51%), Positives = 23/35 (65%)

Query: 7  HDYMDLNSRTNMRQFSDDEEFTTPPKLSNFGSALL 41
          H +   + R +++  SDDE    PPKLSNFGSALL
Sbjct: 21 HLFQRSSQRVSLKDDSDDEHPIGPPKLSNFGSALL 55

>NDAI0A06620 Chr1 complement(1510218..1512461) [2244 bp, 747 aa]
           {ON} 
          Length = 747

 Score =  470 bits (1210), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 217/366 (59%), Positives = 279/366 (76%), Gaps = 7/366 (1%)

Query: 403 YHRPAPKPPVTKKVEIVEPAKSASS--SNNRSMITVNDSQYEKIELLGRGGSSRVYKVKG 460
           Y R +PK    KKVEI+EP   A    +  +  ITVN   YEKIELLGRGGSS+VYKVK 
Sbjct: 386 YKRLSPK----KKVEIIEPFIYAQKKKTGKKLSITVNGIDYEKIELLGRGGSSKVYKVKN 441

Query: 461 SGNKIYALKRXXXXXXXXXXXXGFKGEIELLEKLKDQRRVIQLLDYEMGDGLLYLIMECG 520
             NKI+ALKR            GFKGEIELLEKL  + RV++L DY+M  G+LYLIMECG
Sbjct: 442 DQNKIFALKRVSFDEFDDSSIAGFKGEIELLEKLCKEPRVVRLFDYQMSSGVLYLIMECG 501

Query: 521 DHDLSQILNQRSNMPLDFNFVRFYTKEMLLCIKVVHDAGIVHSDLKPANFVLVKGILKII 580
           D+DLSQ+LNQR   PLD +F+R++ +E+L C+K VHDAGIVHSDLKPANFV +KG+LK+I
Sbjct: 502 DNDLSQVLNQRMGFPLDMDFLRYHVRELLKCVKAVHDAGIVHSDLKPANFVFIKGLLKLI 561

Query: 581 DFGIANAVPEHTVNIYRETQIGTPNYMAPEALVAMNYT-QSSDNQHEGNKWKVGRPSDMW 639
           DFGIAN +P+HTVN+YRE+QIGTPNYMAPE L+A N++ + SD   E +KWKVG+PSD+W
Sbjct: 562 DFGIANVIPDHTVNVYRESQIGTPNYMAPETLIATNHSIEQSDLNKEMSKWKVGKPSDVW 621

Query: 640 SCGCIIYQMIYGKPPYGSFQGQNRLLAIMNPDVKIPFPEYTSNNEKIPKSAIELMKACLY 699
           SCGCIIYQMIYG+PPY  FQGQNRLLAIMNP+VK+ F E T+ +EKIP S I+LMKACL 
Sbjct: 622 SCGCIIYQMIYGRPPYAGFQGQNRLLAIMNPEVKVIFSERTAKDEKIPTSLIDLMKACLL 681

Query: 700 RNPDKRWTVDKVLSSTFLQPFMISGSIMEDLIKNAVRYGSEKPQISHDDLNDVVETVLRK 759
           R+P KRW++DK+L S F  P +++   ++DLIKNAV+YG+++  ++   + ++   VL +
Sbjct: 682 RDPAKRWSIDKLLCSPFFNPIIVTPFFIKDLIKNAVKYGTDQKTVTDAKIEELSNDVLER 741

Query: 760 FSDYKI 765
            +D+K+
Sbjct: 742 LNDFKM 747

 Score =  115 bits (289), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 92/259 (35%), Positives = 135/259 (52%), Gaps = 21/259 (8%)

Query: 22  SDDEEFTTPPKLSNFGSALLSHSEKTSAPETLSSHKTNKMTNHVLEEMDXXXXXXXXXXX 81
           SDDE  + PPKLS F SAL S   K S+ +   S   N  TN  + +             
Sbjct: 26  SDDEPLSDPPKLSTFASALFS--VKDSSNQLDFSENYNSTTNGPINKYAGLKNVSANESH 83

Query: 82  MGNLXXXXXXXXXXXXLFGRYLRNN--HQTSMTTMNTN----DIEINVGNS-----LDKS 130
             N+            +   +   N   Q S+TT N N    D    +  S     ++ +
Sbjct: 84  --NITNNATQFDDHSSISTIFAHTNLPRQPSITTTNNNVPGDDDNARLAESYNELEMESN 141

Query: 131 FERIRNLRQNMKEDMTSKYAERRSKRFLISNRTTKLGPAKRATTLTNVFD--EEVPNSSN 188
            +RI+ L+Q+MKE++TS+Y ERR++RFL S R T+LGPAKRA++  +  D    + N++ 
Sbjct: 142 LQRIKVLQQSMKEELTSRYVERRNRRFLTS-RLTRLGPAKRASSAVSEKDILRSIDNNTQ 200

Query: 189 LPINPRETIE-TLLEDSNKSGFRES--KKNMDYESIEFGDLNPIQYIKKHNLPTSDLPLI 245
             +    T   ++L+    S   ES  + N+DY SI+FG L P +Y+KK  LPTS+LP I
Sbjct: 201 HLLPEYHTPPLSVLDQKEISTVPESAARGNIDYSSIDFGRLKPFEYLKKKKLPTSELPSI 260

Query: 246 SQIYFDKQREENRQAALRK 264
           S+ YF KQ+EE+ Q  L+K
Sbjct: 261 SKAYFQKQKEESLQNTLKK 279

>CAGL0K01617g Chr11 complement(143308..145632) [2325 bp, 774 aa]
           {ON} similar to uniprot|P54199 Saccharomyces cerevisiae
           YDL028c Serine/threonine protein kinase
          Length = 774

 Score =  469 bits (1206), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 219/412 (53%), Positives = 298/412 (72%), Gaps = 15/412 (3%)

Query: 356 KRGVLRNISINANHADNILQQDNKRLKRSLDDVITNENENKKIQEVFYHRPAPKPPVTKK 415
           +R  L+NI +N+N  D  +  D KR K +L D   +   +KK           K    K+
Sbjct: 375 QREALQNIDVNSNVRDGAI--DYKRQKIALKDSEFDGILDKK-----------KYRGIKR 421

Query: 416 VEIVEPAKSASSSNNRSMITVNDSQYEKIELLGRGGSSRVYKVKGSGNKIYALKRXXXXX 475
           VEIVEP  S    + +++++VN ++YE++ELLGRGGSS VYKV+G  N++YALK+     
Sbjct: 422 VEIVEPPTSTRPPSRKNVVSVNGTEYERVELLGRGGSSNVYKVRGLKNRVYALKKVSFDE 481

Query: 476 XXXXXXXGFKGEIELLEKLKDQRRVIQLLDYEMGDGLLYLIMECGDHDLSQILNQRSNMP 535
                  GFKGEI LL++L++Q RV+QL D+EMG G+LYL+MECGD+DLSQ+L+QR+N P
Sbjct: 482 FDESSVEGFKGEISLLKQLQNQNRVVQLYDFEMGSGVLYLLMECGDYDLSQVLHQRANQP 541

Query: 536 LDFNFVRFYTKEMLLCIKVVHDAGIVHSDLKPANFVLVKGILKIIDFGIANAVPEHTVNI 595
            D  F+R++ +EM+ C+KVVHDAGIVHSDLKPANFV VKGILKIIDFGIANAVP+HTVNI
Sbjct: 542 FDMEFIRYHAREMVTCVKVVHDAGIVHSDLKPANFVFVKGILKIIDFGIANAVPDHTVNI 601

Query: 596 YRETQIGTPNYMAPEALVAMNYTQSSDNQHE--GNKWKVGRPSDMWSCGCIIYQMIYGKP 653
           YR+ QIGTPNYMAPEALVA NYT  +D +++   NKWK+G+P+D+WSCGCIIYQMIYGKP
Sbjct: 602 YRDMQIGTPNYMAPEALVANNYTADNDGKYDQKTNKWKIGKPADIWSCGCIIYQMIYGKP 661

Query: 654 PYGSFQGQNRLLAIMNPDVKIPFPEYTSNNEKIPKSAIELMKACLYRNPDKRWTVDKVLS 713
           PY  +QGQ RLL+IM+P+VKI + E   +   IP  A+ELM+ CL RNP++RW+  ++L 
Sbjct: 662 PYAKYQGQERLLSIMDPNVKIEYKEVLPDKTVIPSLALELMQYCLMRNPEERWSALQILD 721

Query: 714 STFLQPFMISGSIMEDLIKNAVRYGSEKPQISHDDLNDVVETVLRKFSDYKI 765
           S FL P M+S   +++LI  AV YG+ +  +S   L  + ++VL + +D+++
Sbjct: 722 SPFLNPLMVSQDFIKNLITTAVSYGAREGDVSPSRLEALTDSVLARLADFRM 773

 Score =  105 bits (263), Expect = 9e-23,   Method: Compositional matrix adjust.
 Identities = 86/272 (31%), Positives = 132/272 (48%), Gaps = 35/272 (12%)

Query: 20  QFSDDEEFTTPPKLSNFGSALLSHSEKTSAPETLSSHKTNKMTNHVLEEMDXXXXXXXXX 79
           Q SDD E   PPKLSNFGS L+S      A E ++ ++++K    + EE           
Sbjct: 18  QDSDDGEIGNPPKLSNFGSELIS-----DAIENINPNRSDKKL--ISEETRIHESHSQQL 70

Query: 80  XXMGNLXXXXXXXXXXXXLF-----GRYLRNNHQTSMTTMNTNDIEINVGNSLDKSFERI 134
               N              F           +  ++  +  T DI     +   KSF ++
Sbjct: 71  NTDINQSTRVTHSASSPLYFEDTSPSTMFVQSQASAQPSATTYDISSQDYSDSSKSFIKL 130

Query: 135 RNLRQNMKEDMTSKYAERRSKRFL-ISNRTTKLGPAKRATT-----------LTNVFDEE 182
           ++ +  +K+++T++Y+ERR++RFL  +NRTTKLGPA R  T           + N  +E 
Sbjct: 131 KSKQDTLKQELTTRYSERRTRRFLHATNRTTKLGPALRNLTSPALAINDNNSIDNKMNET 190

Query: 183 VPNSSNLPIN--------PRETIETLLEDSNKS---GFRESKKNMDYESIEFGDLNPIQY 231
              +S+   N         ++ I T  E+ N +   G   + +  DY  I   + NPIQY
Sbjct: 191 SKVNSSFDTNNAYVDFHQTKQDIYTSGEEHNNTKDNGKIGATQQNDYSDINIHECNPIQY 250

Query: 232 IKKHNLPTSDLPLISQIYFDKQREENRQAALR 263
           +K HNLPTS+L  IS+ YF+KQ+EENR+ AL+
Sbjct: 251 MKMHNLPTSELSKISKAYFEKQKEENRKKALK 282

>TBLA0F00860 Chr6 (219628..222570) [2943 bp, 980 aa] {ON} Anc_3.162
           YDL028C
          Length = 980

 Score =  466 bits (1198), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 238/459 (51%), Positives = 320/459 (69%), Gaps = 38/459 (8%)

Query: 327 IDTSNNSSFNSPIHNIHKEISRNKDSDSEKR--GVLRNISINANHADNILQQDNKRLKRS 384
           ID +  S + SP     +E  R+K +D+ K    VL + S   + A+ I    N R K +
Sbjct: 536 IDINKRSGYASP----SREHKRSKTTDNYKMDVSVLESNSRIPSSANRI----NYRSKSA 587

Query: 385 LDDVITNENENKKIQEVFYHRPAPKPPVT------------------KKVEIVEPAKSAS 426
           L D       N  +Q++  H P+ +PPV                   KKVEI+EP ++  
Sbjct: 588 LADY------NNPMQDID-HLPSSQPPVRPPPHFIPSLSQPQPQQVRKKVEIIEP-EAKI 639

Query: 427 SSNNRSMITVNDSQYEKIELLGRGGSSRVYKVKGSGNKIYALKRXXXXXXXXXXXXGFKG 486
            +  + +I VN+ +YEK+ LLGRGGSS+VYKVKG  N  YALKR            GFKG
Sbjct: 640 HNYQKPIIIVNNIEYEKVALLGRGGSSKVYKVKGPKNSYYALKRVLFDEFDDSSIEGFKG 699

Query: 487 EIELLEKLKDQRRVIQLLDYEMGDGLLYLIMECGDHDLSQILNQRSNMPLDFNFVRFYTK 546
           EIELL+KL+ + RV++L DY+M +G L+LIMECGD DLS+IL+QRS  PLD  F+R+Y++
Sbjct: 700 EIELLKKLEHEERVVRLFDYKMENGTLHLIMECGDLDLSRILHQRSKQPLDLEFIRYYSR 759

Query: 547 EMLLCIKVVHDAGIVHSDLKPANFVLVKGILKIIDFGIANAVPEHTVNIYRETQIGTPNY 606
           EML C++VVH+  IVHSDLKPANFVLV  +LKIIDFGIANAVP+HTVNIYRE QIGTPNY
Sbjct: 760 EMLKCVQVVHNNDIVHSDLKPANFVLVGSVLKIIDFGIANAVPDHTVNIYRECQIGTPNY 819

Query: 607 MAPEALVAMNYT--QSSDNQHEGNKWKVGRPSDMWSCGCIIYQMIYGKPPYGSFQGQNRL 664
           MAPEALV+MN T  ++ + Q   N+WKVG+PSD+WSCGCI+YQM YGKPPYG +QGQNRL
Sbjct: 820 MAPEALVSMNLTSNENENAQKPVNRWKVGKPSDVWSCGCILYQMFYGKPPYGHYQGQNRL 879

Query: 665 LAIMNPDVKIPFPEYTSNNEKIPKSAIELMKACLYRNPDKRWTVDKVLSSTFLQPFMISG 724
           LAIMNP+V+I +PE+T NNE IP+SAI+ MKACLYR+P KR+T++++L++ F  P M++ 
Sbjct: 880 LAIMNPEVEIKYPEFTPNNEPIPRSAIDTMKACLYRDPSKRFTIEELLNNPFFSPIMVTP 939

Query: 725 SIMEDLIKNAVRYGSEKPQISHDDLNDVVETVLRKFSDY 763
             ++DLIKN+VRYG ++  IS+++L  + + VL +  ++
Sbjct: 940 FFLQDLIKNSVRYGIDRKNISNEELEKMSDDVLNRLREF 978

 Score = 70.5 bits (171), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 30/59 (50%), Positives = 44/59 (74%)

Query: 217 DYESIEFGDLNPIQYIKKHNLPTSDLPLISQIYFDKQREENRQAALRKHSSRELLYKNR 275
           DY SIEF  LNP+QY +KH+LP S+LP +++ Y  KQREENR+A L++ S+  ++  N+
Sbjct: 319 DYSSIEFNGLNPMQYWRKHDLPPSELPKLNKAYLQKQREENRKAVLKQRSTSRMILSNK 377

 Score = 46.6 bits (109), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 58/205 (28%), Positives = 92/205 (44%), Gaps = 43/205 (20%)

Query: 5   SFHDYMDLNSRTNMRQFSDDEEFTT--PPKLSNFGSALLSHSEKTSAPETLSSHKTNKMT 62
           S H+YMD          SDDE+     PPKLSNFGSALLS+ E+          + NK  
Sbjct: 24  SSHNYMD---------DSDDEDNIERGPPKLSNFGSALLSNQEE----------QNNKQ- 63

Query: 63  NHVLEEMDXXXXXXXXXXXMGNLXXXXXXXXXXXXLFGR-------------YLRNNHQT 109
            H  + M+                           LFG               +R +   
Sbjct: 64  -HQQDVMESKDSLQIKTDKHNIWRNNTNINNTSNTLFGHTDEHSQTSTSTMTSVRMHDHQ 122

Query: 110 SMTTMNTNDIEINVGNSL--DKSFERIRNLRQNMKEDMTSKYAERRSKRFLISNRTTKLG 167
           S+TT+ +++   ++ N+L  D +    R+L+Q  +E++ S+   +R++R L + +   LG
Sbjct: 123 SVTTLYSDNNGKDLNNTLVKDSNKSTFRSLKQLSREELPSR---QRNRRLLQNLKAGNLG 179

Query: 168 PAKRATT-LTN-VFDEEVPNSSNLP 190
           PA R ++ LTN  F+  +P S+N P
Sbjct: 180 PASRTSSLLTNESFNSSMPLSTNTP 204

>KLLA0C03828g Chr3 (349187..351568) [2382 bp, 793 aa] {ON} similar
           to uniprot|P54199 Saccharomyces cerevisiae YDL028C MPS1
           Dual-specificity kinase required for spindle pole body
           (SPB) duplication and spindle checkpoint function
           substrates include SPB proteins Spc42p Spc110p and
           Spc98p mitotic exit network protein Mob1p and checkpoint
           protein Mad1p
          Length = 793

 Score =  455 bits (1170), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 217/401 (54%), Positives = 281/401 (70%), Gaps = 40/401 (9%)

Query: 402 FYHRPAPKPPVTK---KVEIVEPAKS-------------ASSSNNRS------------- 432
           F HR AP P  +K   KVEIVEP KS              SS  N+              
Sbjct: 396 FSHRKAPSPHDSKPFKKVEIVEPPKSTVEVIPLKSEGCDVSSKLNKGDNYLNYNGSFDTK 455

Query: 433 --------MITVNDSQYEKIELLGRGGSSRVYKVKGSGNKIYALKRXXXXXXXXXXXXGF 484
                    ITVN + YEK+ELLG+GGS +VYKVK S +K+YALKR            GF
Sbjct: 456 KRTSYAVPTITVNGTAYEKVELLGKGGSGKVYKVKSSDHKVYALKRVSFDEFDESSIDGF 515

Query: 485 KGEIELLEKLKDQRRVIQLLDYEMGDGLLYLIMECGDHDLSQILNQRSNMPLDFNFVRFY 544
           KGEIELL+KL++++RV++L+DY MG G+L+L+MECG+HDLSQ+L QRS +P D  FVR++
Sbjct: 516 KGEIELLKKLENKQRVVKLIDYHMGQGVLFLLMECGEHDLSQVLTQRSKIPFDTEFVRYH 575

Query: 545 TKEMLLCIKVVHDAGIVHSDLKPANFVLVKGILKIIDFGIANAVPEHTVNIYRETQIGTP 604
            +EM+ C+KVVHDA IVHSDLKPANFV VKG+LKIIDFGIANAVP+HTVNIYR+ QIGTP
Sbjct: 576 FQEMIKCVKVVHDADIVHSDLKPANFVFVKGMLKIIDFGIANAVPDHTVNIYRDNQIGTP 635

Query: 605 NYMAPEALVAMNYTQSSDNQHEGNKWKVGRPSDMWSCGCIIYQMIYGKPPYGSFQGQNRL 664
           NYMAPE LVAMN+T+   N  E  KWKVG+PSD+WSCGCI+YQM+YGKPPYG+FQG NRL
Sbjct: 636 NYMAPETLVAMNFTR---NDGEQAKWKVGKPSDVWSCGCILYQMVYGKPPYGTFQGNNRL 692

Query: 665 LAIMNPDVKIPFPEYTSNNEKIPKSAIELMKACLYRNPDKRWTVDKVLSSTFLQPFMISG 724
            AIMNPDVKIP+PE  S    IP++ I+ +++CL RNP  R T+D++LS   + P  ++ 
Sbjct: 693 YAIMNPDVKIPYPEKDSFGTVIPRTVIDTIRSCLERNPISRVTIDQLLSGALINPVTVTK 752

Query: 725 SIMEDLIKNAVRYGSEKPQISHDDLNDVVETVLRKFSDYKI 765
             + DLIKNAV YG ++  ++++ + ++ E V  K +++K+
Sbjct: 753 FFIHDLIKNAVNYGCDQKHVNNERVEELSEDVWNKLAEFKL 793

 Score = 96.7 bits (239), Expect = 8e-20,   Method: Compositional matrix adjust.
 Identities = 74/230 (32%), Positives = 117/230 (50%), Gaps = 65/230 (28%)

Query: 108 QTSMTTMNT-----NDIEINVGNSLDK-----------------SFERIRNLRQNMKEDM 145
           Q SMTTMNT     NDI  +  N  +K                 + ++ + L+Q+MKE++
Sbjct: 78  QPSMTTMNTVVKEDNDISNSNSNHDNKYNKLNEESLMKDDTHSHTSQKFKVLQQSMKEEL 137

Query: 146 ---TSKYAERRSKRFLISNRTTKLGPAKR--ATTL-----------------------TN 177
              T+K + +R++RF I++R + LGPAKR  +T+                        +N
Sbjct: 138 YNSTTKSSNKRNRRF-ITSRLSSLGPAKRNLSTSFNVDSPSESRVDNSQINSSIINDTSN 196

Query: 178 VFDEEVPNSS--------------NLPINPRETIETLLEDSNKSGFRESKKNMDYESIEF 223
           +  +++ NS               N+ +       T   D NK      + N++YE+I+F
Sbjct: 197 ISQQDIENSHTSNSSNTGYRYHDHNIFLETHRQHSTPSHDENKDPSANLQPNINYENIDF 256

Query: 224 GDLNPIQYIKKHNLPTSDLPLISQIYFDKQREENRQAALRKHSSRELLYK 273
           GDLNP QY+KK+NLP+ +LP IS++YF++Q+EENR+  LRK +S  L  K
Sbjct: 257 GDLNPYQYLKKYNLPSGELPYISKVYFERQKEENRKTVLRKATSGTLALK 306

>KNAG0K01740 Chr11 (364195..366492) [2298 bp, 765 aa] {ON} Anc_3.162
           YDL028C
          Length = 765

 Score =  434 bits (1115), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 206/357 (57%), Positives = 260/357 (72%), Gaps = 8/357 (2%)

Query: 409 KPPVTKKVEIVEPAKSASSSNNRSMITVNDSQYEKIELLGRGGSSRVYKVKGSGNKIYAL 468
           KP + K+VEI EP  S  +++    I +N+ +YEKIELLG GGSS+VYKV+ S  K++AL
Sbjct: 417 KPAIIKRVEIQEPKPSKKNTS----IVINNEEYEKIELLGSGGSSKVYKVRDSSKKVFAL 472

Query: 469 KRXXXXXXXXXXXXGFKGEIELLEKLKDQRRVIQLLDYEMGDGLLYLIMECGDHDLSQIL 528
           KR             FKGEI LLEKLK+Q RV+QL +Y +   +LYLIMECGD+DLS +L
Sbjct: 473 KRVAIDMFEESSVESFKGEIALLEKLKNQERVVQLYNYALESSVLYLIMECGDYDLSVML 532

Query: 529 NQRSNMPLDFNFVRFYTKEMLLCIKVVHDAGIVHSDLKPANFVLVKGILKIIDFGIANAV 588
            +R N PLD  FVR+Y +E+  C+KVVHD GIVHSDLKPANF+ VKG LKIIDFGIANAV
Sbjct: 533 RERLNKPLDTEFVRYYAREISHCVKVVHDVGIVHSDLKPANFIFVKGTLKIIDFGIANAV 592

Query: 589 PEHTVNIYRETQIGTPNYMAPEALVAMNYTQSSDNQHEGNKWKVGRPSDMWSCGCIIYQM 648
           PEHTVNIYRETQIGTPNYMAPEALVAMNYT    N    ++WKVG+PSD+WS GCIIYQM
Sbjct: 593 PEHTVNIYRETQIGTPNYMAPEALVAMNYTNGESNV---SRWKVGKPSDVWSLGCIIYQM 649

Query: 649 IYGKPPYGSFQGQNRLLAIMNPDVKIPFPEYTSNNEKIPKSAIELMKACLYRNPDKRWTV 708
           +YGKPPY SFQG +R+ AI+ P VKI +P        +P S IEL+K CL R+P+KR  V
Sbjct: 650 VYGKPPYASFQGNDRIRAIIKPSVKIEYPS-VKEGVTVPNSIIELIKVCLNRDPNKRVDV 708

Query: 709 DKVLSSTFLQPFMISGSIMEDLIKNAVRYGSEKPQISHDDLNDVVETVLRKFSDYKI 765
           D +L+STFL P ++S + + DL+KNAV YG ++  +S   ++ +   V+ K S+Y+I
Sbjct: 709 DGMLNSTFLSPILVSEAFVRDLVKNAVEYGIKQGDVSITTIDALANDVIEKLSEYRI 765

 Score =  105 bits (262), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 83/270 (30%), Positives = 126/270 (46%), Gaps = 50/270 (18%)

Query: 30  PPKLSNFGSALLSHSEKTSAPETLSSHKTNKMTNHVLEEMDXXXXXXXXXXXMGNLXXXX 89
           PPKLS+FGS LL+ S   S   T         +  V + +D            G      
Sbjct: 48  PPKLSDFGSNLLNESANHSGTFTKFRGLGMAHSPRVTQRIDGPGGNNIVSHRNG------ 101

Query: 90  XXXXXXXXLFGRYLRNNHQ-TSMTTMN------TNDIEINVGNSLDKSFER--------- 133
                   +FG  + N  + +SMTT+N      ++ I     + L+++ ER         
Sbjct: 102 -SSPSSSSIFGSTVYNPARPSSMTTVNNLKHEDSSRISTVKNDVLNRTLERRRLSRTASS 160

Query: 134 ------------------IRNLRQNMKEDMTSKYAERRSKRFLISNRTTKLGPAKRATTL 175
                             I  ++Q ++++ TSK  ERR+KRFL   R  +LGPAKR +  
Sbjct: 161 LSNPPTVNSIDLKDHEVNIEKIKQTIRDETTSKLLERRAKRFLNLERRNRLGPAKRTSMT 220

Query: 176 TNVFDEEVPNSSNLPINPRETIETLLEDSNKSGFRESKKNMDYESIEFGDLNPIQYIKKH 235
           +++   E+    +L I      E   +D      RE    +DY +I FGDLNP QY+ K+
Sbjct: 221 SSLITSEM---DDLLIQRDAKGEVEQQD------REMTPQVDYSNIVFGDLNPFQYVNKY 271

Query: 236 NLPTSDLPLISQIYFDKQREENRQAALRKH 265
           N+P  +LP IS++Y +K++EENR+ ALRKH
Sbjct: 272 NIPMEELPQISKVYIEKRKEENRRVALRKH 301

>NCAS0C03560 Chr3 complement(710551..712476) [1926 bp, 641 aa] {ON}
           Anc_3.162
          Length = 641

 Score =  350 bits (899), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 170/368 (46%), Positives = 244/368 (66%), Gaps = 14/368 (3%)

Query: 394 ENKKIQEVFYHRPAPKPPVTKKVEIVEPAKSASSSNNRSMITVNDSQYEKIELLGRGGSS 453
           +NKK Q +    P  + PV + V    P+++   S   S IT  D +   +ELLG+GGSS
Sbjct: 284 QNKKHQTI----PKIEAPVPQSV----PSQANLMSKQWSRIT--DEELSIVELLGKGGSS 333

Query: 454 RVYKVKGSGNKIYALKRXXXXXXXXXXXXGFKGEIELLEKLKDQRRVIQLLDYEMGDGLL 513
           +VYKV+    K YALK+              + EIELL++L  + RV++L++Y++ D ++
Sbjct: 334 KVYKVQDRTGKYYALKQILLEELDENLKTDLEREIELLKRLAREERVVKLIEYKIDDRMV 393

Query: 514 YLIMECGDHDLSQILNQRSNMPLDFNFVRFYTKEMLLCIKVVHDAGIVHSDLKPANFVLV 573
            ++MECG+ DLS +L++R N P D NFVR  +KEM+ CIK VHD+ IVHSDLKPANF+ V
Sbjct: 394 QVLMECGNFDLSHVLHERVNRPFDINFVRLMSKEMIECIKAVHDSDIVHSDLKPANFIFV 453

Query: 574 KGILKIIDFGIANAVPEHTVNIYRETQIGTPNYMAPEALVAMNYTQSSDNQHEGNKWKVG 633
           KG LK+IDFGIAN + ++T+N+YR TQ+GTPNYMAPE L++ NY+ +++N      WK+G
Sbjct: 454 KGTLKLIDFGIANKIADNTLNVYRNTQMGTPNYMAPETLISQNYSNNNNNL----LWKIG 509

Query: 634 RPSDMWSCGCIIYQMIYGKPPYGSFQGQNRLLAIMNPDVKIPFPEYTSNNEKIPKSAIEL 693
           +PSD+WS GCI+YQM YG PPY SF G +RLLAIMNP+++I +P  +   +K+P+S + L
Sbjct: 510 KPSDIWSYGCILYQMTYGHPPYSSFLGHDRLLAIMNPNIQIDYPNESPCGKKVPQSLVAL 569

Query: 694 MKACLYRNPDKRWTVDKVLSSTFLQPFMISGSIMEDLIKNAVRYGSEKPQISHDDLNDVV 753
           +K CL R+P  R T D++   +F  P +IS   +E LI NA+ YG E   I+ D +  + 
Sbjct: 570 IKTCLNRDPQLRATTDEIQHCSFFNPMIISKPFLESLIDNAINYGIENQNITQDRIKLLS 629

Query: 754 ETVLRKFS 761
             V+ K S
Sbjct: 630 NEVVSKLS 637

 Score = 58.9 bits (141), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 38/142 (26%), Positives = 75/142 (52%), Gaps = 16/142 (11%)

Query: 131 FERIRNLRQNMKEDMTSKYAERRSKRFLISNRTTKLGPAKRATTLTN--VFDEEVPNSSN 188
           +  I  +++ MK+ +T K  ++R  R+   +++  LGPA+R+T   N       + +  N
Sbjct: 55  YNDIMEMQREMKDQITFKTEQKRLYRWRTRSKSHVLGPARRSTQALNKTTAKSHLSDLEN 114

Query: 189 LPINPRETIETLLEDSNKSGFRESKKNMDYESIEFGDLNPIQYIKKHNLPTSDLPLISQI 248
           +    RE+I        ++G +E+         E G+LNP QY+KK+NLPT +L  ++++
Sbjct: 115 INEPKRESIL-----GEETGLKET---------ELGELNPFQYLKKNNLPTKELSRLTKL 160

Query: 249 YFDKQREENRQAALRKHSSREL 270
           Y +++ +E R    +   + E+
Sbjct: 161 YCNRKLDETRSKKTQAIDAHEM 182

>KNAG0E00850 Chr5 complement(158992..161127) [2136 bp, 711 aa] {ON}
           Anc_6.31 YMR001C
          Length = 711

 Score =  112 bits (281), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 90/326 (27%), Positives = 149/326 (45%), Gaps = 31/326 (9%)

Query: 404 HRPAPKPPVTKKVEIVEPAKSASSSNNRSMITVNDSQYEKIELLGRGGSSRVYKVKGSGN 463
           H    +PPV KK E +    SA      S+I      Y +   LG GG +R +++K    
Sbjct: 58  HLQDQQPPVKKKKEKL----SALCKTPPSLIKTRGRDYHRGHFLGEGGFARCFQIKDESG 113

Query: 464 KIYALKRXXXXX-XXXXXXXGFKGEIELLEKLKDQRRVIQLLDYEMGDGLLYLIME-CGD 521
           KI+A K                  EI++ + ++    V+Q +D    D  +Y+++E C +
Sbjct: 114 KIFAAKTVAKISIKSEKTRKKLLSEIQIHKSMR-HFNVVQFIDCFEDDTNVYILLEICPN 172

Query: 522 HDLSQILNQRSNMPLDFNFVRFYTKEMLLCIKVVHDAGIVHSDLKPANFVLVKGI-LKII 580
             L ++L +R  +      VR++  ++   IK +H   ++H DLK  N    K   LKI 
Sbjct: 173 GSLMELLKKRRTVTEPE--VRYFMTQICGAIKYMHSRRVIHRDLKLGNIFFDKNYNLKIG 230

Query: 581 DFGIANAVPEHTVNIYRETQIGTPNYMAPEALVAMNYTQSSDNQHEGNKWKVGRPSDMWS 640
           DFG+A  +       Y  T  GTPNY+APE L+          +H G+ ++V    D+WS
Sbjct: 231 DFGLAAVLANDRERKY--TVCGTPNYIAPEVLMG---------KHSGHSYEV----DIWS 275

Query: 641 CGCIIYQMIYGKPPYGSFQGQNRLLAIMNPDVKIPFPEYTSNNEKIPKSAIELMKACLYR 700
            G +IY ++ GKPP+ S         I N D   P  +Y SN  K       L+   L  
Sbjct: 276 IGVMIYALLIGKPPFQSKDVNMIYERIKNRDFAFPKDKYISNEAKT------LIHDILST 329

Query: 701 NPDKRWTVDKVLSSTFLQPFMISGSI 726
           +P +R ++++++   + +    S ++
Sbjct: 330 DPLERPSIEEIIDYVWFRGIFPSCTL 355

>Kwal_56.22476 s56 complement(145039..147132) [2094 bp, 697 aa] {ON}
           YMR001C (CDC5) - protein kinase which functions at the
           G(sub)2/M boundary [contig 185] FULL
          Length = 697

 Score =  112 bits (280), Expect = 6e-25,   Method: Compositional matrix adjust.
 Identities = 87/313 (27%), Positives = 150/313 (47%), Gaps = 36/313 (11%)

Query: 424 SASSSNNRSMITVNDSQYEKIELLGRGGSSRVYKVKGSGNKIYALKRXXXXX-XXXXXXX 482
           SA      S+I      Y +   LG GG +R +++K  G KI+A K              
Sbjct: 62  SALCKTPPSLIKTRGRDYHRGHFLGEGGFARCFQIKDDGGKIFAAKTVAKISIKSEKTRK 121

Query: 483 GFKGEIELLEKLKDQRRVIQLLDYEMGDGLLYLIME-CGDHDLSQILNQRSNMPLDFNFV 541
               EI++ + ++    ++Q +D    D  +Y+++E C +  L  +L +R    L    V
Sbjct: 122 KLLSEIQIHKSMR-HTNIVQFVDCFEDDTNVYILLEICPNGSLMDLLKRRKM--LTEPEV 178

Query: 542 RFYTKEMLLCIKVVHDAGIVHSDLKPANFVLVKGI-LKIIDFGIANAVPEHTVNIYRETQ 600
           RF+T +++  +K +H   ++H DLK  N    K   LK+ DFG+A  +       Y  T 
Sbjct: 179 RFFTTQIVGAVKYMHSRRVIHRDLKLGNIFFDKHYNLKVGDFGLAAVLANDRERKY--TV 236

Query: 601 IGTPNYMAPEALVAMNYTQSSDNQHEGNKWKVGRPSDMWSCGCIIYQMIYGKPPYGSFQG 660
            GTPNY+APE L           +H G+ ++V    D+WSCG +IY ++ GKPP+     
Sbjct: 237 CGTPNYIAPEVLTG---------KHTGHSYEV----DIWSCGVMIYALLIGKPPF----- 278

Query: 661 QNRLLAIMNPDVK---IPFPEYTSNNEKIPKSAIELMKACLYRNPDKRWTVDKVLSSTFL 717
           Q + + I+   +K     FP+    ++ I   A+ L+K  L  +P +R ++D+++   + 
Sbjct: 279 QAKEVNIIYERIKCGDFVFPK----DKFISPEALVLIKDILSIDPLERPSLDEIIDYVWF 334

Query: 718 Q---PFMISGSIM 727
           +   P  I  S++
Sbjct: 335 RGLFPSRIDASVL 347

>KLTH0C10912g Chr3 (898372..900465) [2094 bp, 697 aa] {ON} highly
           similar to uniprot|P32562 Saccharomyces cerevisiae
           YMR001C
          Length = 697

 Score =  111 bits (277), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 86/313 (27%), Positives = 149/313 (47%), Gaps = 36/313 (11%)

Query: 424 SASSSNNRSMITVNDSQYEKIELLGRGGSSRVYKVKGSGNKIYALKRXXXXX-XXXXXXX 482
           SA      S+I      Y +   LG GG +R +++K    KI+A K              
Sbjct: 62  SALCKTPPSLIKTRGRDYHRGHFLGEGGFARCFQIKDDSGKIFAAKTVAKISIKSEKTRK 121

Query: 483 GFKGEIELLEKLKDQRRVIQLLDYEMGDGLLYLIME-CGDHDLSQILNQRSNMPLDFNFV 541
               EI++ + ++    ++Q +D    D  +Y+++E C +  L  +L +R    L    V
Sbjct: 122 KLLSEIQIHKSMR-HFNIVQFIDCFEDDTNVYILLEICPNGSLMDLLKRRK--VLTEPEV 178

Query: 542 RFYTKEMLLCIKVVHDAGIVHSDLKPANFVLVKGI-LKIIDFGIANAVPEHTVNIYRETQ 600
           RF+T +++  +K +H   ++H DLK  N    K   LKI DFG+A  +       Y  T 
Sbjct: 179 RFFTTQIVGAVKYMHSRRVIHRDLKLGNIFFDKHYNLKIGDFGLAAVLANDRERKY--TV 236

Query: 601 IGTPNYMAPEALVAMNYTQSSDNQHEGNKWKVGRPSDMWSCGCIIYQMIYGKPPYGSFQG 660
            GTPNY+APE L           +H G+ ++V    D+WSCG +IY ++ GKPP+     
Sbjct: 237 CGTPNYIAPEVLTG---------KHTGHSYEV----DIWSCGVMIYALLIGKPPF----- 278

Query: 661 QNRLLAIMNPDVKIP---FPEYTSNNEKIPKSAIELMKACLYRNPDKRWTVDKVLSSTFL 717
           Q + + I+   +K     FP     ++ I + A+ L++  L  +P +R ++D+++   + 
Sbjct: 279 QAKEVNIIYERIKCGDYVFPR----DKCISQEALTLIRDILSIDPLERPSLDEIIDYVWF 334

Query: 718 Q---PFMISGSIM 727
           +   P  I  S++
Sbjct: 335 RGIFPPRIDASVL 347

>Kpol_1037.20 s1037 (41658..43772) [2115 bp, 704 aa] {ON}
           (41658..43772) [2115 nt, 705 aa]
          Length = 704

 Score =  108 bits (271), Expect = 8e-24,   Method: Compositional matrix adjust.
 Identities = 84/305 (27%), Positives = 143/305 (46%), Gaps = 30/305 (9%)

Query: 432 SMITVNDSQYEKIELLGRGGSSRVYKVKGSGNKIYALKRXXXXX-XXXXXXXGFKGEIEL 490
           S+I      Y +   LG GG +R +++K    KI+A K                  EI++
Sbjct: 73  SLIKTRGRDYHRGHFLGEGGFARCFQIKDDSGKIFAAKTVAKLSIKSEKTRKKLLSEIQI 132

Query: 491 LEKLKDQRRVIQLLDYEMGDGLLYLIME-CGDHDLSQILNQRSNMPLDFNFVRFYTKEML 549
            + +K Q  V+Q +D    D  +Y+++E C +  L  +L +R    L    VRF+T ++ 
Sbjct: 133 HKSMKHQ-NVVQFIDCFEDDTNVYILLEICPNGSLMDLLKKRK--LLTEPEVRFFTTQIC 189

Query: 550 LCIKVVHDAGIVHSDLKPANFVLVKGI-LKIIDFGIANAVPEHTVNIYRETQIGTPNYMA 608
             IK +H   ++H DLK  N    +   LKI DFG+A  +       Y  T  GTPNY+A
Sbjct: 190 GAIKYMHSRRVIHRDLKLGNIFFDRNYNLKIGDFGLAAVLANDRERKY--TVCGTPNYIA 247

Query: 609 PEALVAMNYTQSSDNQHEGNKWKVGRPSDMWSCGCIIYQMIYGKPPYGSFQGQNRLLAIM 668
           PE L+          +H G+ ++V    D+WS G ++Y ++ GKPP+ S         I 
Sbjct: 248 PEVLMG---------KHSGHSYEV----DIWSIGVMLYALLIGKPPFQSKDVNTIYERIK 294

Query: 669 NPDVKIPFPEYTSNNEKIPKSAIELMKACLYRNPDKRWTVDKVLSSTFLQ---PFMISGS 725
             D   P  ++ SN  K+      L++  L  +P +R ++ +++   + +   P  I  +
Sbjct: 295 CCDFSFPKEKHISNEAKV------LIQDLLSLDPLERPSISEIMDYVWFRGIFPPYIEST 348

Query: 726 IMEDL 730
           +M ++
Sbjct: 349 VMTEV 353

>NDAI0C02680 Chr3 complement(621951..624203) [2253 bp, 750 aa] {ON}
           Anc_6.31
          Length = 750

 Score =  108 bits (271), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 85/305 (27%), Positives = 145/305 (47%), Gaps = 30/305 (9%)

Query: 432 SMITVNDSQYEKIELLGRGGSSRVYKVKGSGNKIYALKRXXX-XXXXXXXXXGFKGEIEL 490
           S+I      Y +   LG GG +R +++K    KI+A K                  EI++
Sbjct: 86  SLIKTRGRDYRREHFLGEGGFARCFQIKDESGKIFAAKTVAKISIKSEKTKRKLLSEIQI 145

Query: 491 LEKLKDQRRVIQLLDYEMGDGLLYLIME-CGDHDLSQILNQRSNMPLDFNFVRFYTKEML 549
            + +K    ++Q +D    D  +Y+++E C +  L  +L +R +  L    VRF+T ++ 
Sbjct: 146 HKSMK-HSNIVQFIDCFEDDANVYILLEICPNGSLMDLLKKRKS--LTEPEVRFFTTQIC 202

Query: 550 LCIKVVHDAGIVHSDLKPANFVLVKGI-LKIIDFGIANAVPEHTVNIYRETQIGTPNYMA 608
             IK +H   I+H DLK  N    K   LK+ DFG+A  +       Y  T  GTPNY+A
Sbjct: 203 GAIKYLHSRRIIHRDLKLGNIFFDKDYNLKVGDFGLAAVLANDRERKY--TVCGTPNYIA 260

Query: 609 PEALVAMNYTQSSDNQHEGNKWKVGRPSDMWSCGCIIYQMIYGKPPYGSFQGQNRLLAIM 668
           PE L+          +H G+ ++V    D+WS G +IY ++ GKPP+     Q + + ++
Sbjct: 261 PEVLMG---------KHSGHSFEV----DIWSIGVMIYALLVGKPPF-----QAKDVNVI 302

Query: 669 NPDVKIPFPEYTSNNEKIPKSAIELMKACLYRNPDKRWTVDKVLSSTFLQ---PFMISGS 725
              +K+    Y   ++ + K A  L+   L  NP +R T+  ++   + +   P  IS  
Sbjct: 303 YERIKLCKYGY-PKDKYVSKEAEILIHDILSLNPLQRPTIIDIIDDVWFRGVFPARISPD 361

Query: 726 IMEDL 730
           +M+ +
Sbjct: 362 VMDTV 366

>TPHA0J00420 Chr10 complement(96445..98568) [2124 bp, 707 aa] {ON}
           Anc_6.31 YMR001C
          Length = 707

 Score =  107 bits (266), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 85/305 (27%), Positives = 141/305 (46%), Gaps = 30/305 (9%)

Query: 432 SMITVNDSQYEKIELLGRGGSSRVYKVKGSGNKIYALKRXXXXX-XXXXXXXGFKGEIEL 490
           S+I      Y +   LG GG +R ++      KI+A K                  EI++
Sbjct: 74  SLIKTRGRDYHRGHFLGEGGFARCFQFNDDSGKIFAAKTVAKLSIKSEKTRRKLLSEIQI 133

Query: 491 LEKLKDQRRVIQLLDYEMGDGLLYLIME-CGDHDLSQILNQRSNMPLDFNFVRFYTKEML 549
            + +K+   ++Q +D    D  +Y+++E C +  L  +L +R +  L    VRF+T ++ 
Sbjct: 134 HKSMKNVN-IVQFIDCFEDDTNVYILLEICPNGSLMDLLKKRKS--LTEPEVRFFTTQIC 190

Query: 550 LCIKVVHDAGIVHSDLKPANFVLVKGI-LKIIDFGIANAVPEHTVNIYRETQIGTPNYMA 608
             IK +H   ++H DLK  N    K   LKI DFG+A  +       Y  T  GTPNY+A
Sbjct: 191 GAIKYMHSRRVIHRDLKLGNIFFDKDYNLKIGDFGLAAVLANDRERKY--TVCGTPNYIA 248

Query: 609 PEALVAMNYTQSSDNQHEGNKWKVGRPSDMWSCGCIIYQMIYGKPPYGSFQGQNRLLAIM 668
           PE L+          +H G+ ++V    D+WS G ++Y ++ GKPP+ S         I 
Sbjct: 249 PEVLMG---------KHTGHSYEV----DIWSIGVMLYALLIGKPPFQSKDVNTIYERIK 295

Query: 669 NPDVKIPFPEYTSNNEKIPKSAIELMKACLYRNPDKRWTVDKVLSSTFLQ---PFMISGS 725
             D   P  +Y S   KI      L++  L  +P +R +VD+++   + +   P  I   
Sbjct: 296 CCDFTFPKDKYISPEAKI------LIQDLLSLDPLERPSVDEIIDYVWFRGLFPPQIESD 349

Query: 726 IMEDL 730
           +M ++
Sbjct: 350 VMTNI 354

>TBLA0B00490 Chr2 complement(94755..97118) [2364 bp, 787 aa] {ON}
           Anc_6.31 YMR001C
          Length = 787

 Score =  107 bits (266), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 81/305 (26%), Positives = 143/305 (46%), Gaps = 30/305 (9%)

Query: 432 SMITVNDSQYEKIELLGRGGSSRVYKVKGSGNKIYALKRXXX-XXXXXXXXXGFKGEIEL 490
           S+I      Y + + LG GG +R +++K    KI+A K                  EI++
Sbjct: 133 SLIKTRGRDYRRGQFLGEGGFARCFQIKDESGKIFAAKTVAKISIKTEKTRRKLLSEIQI 192

Query: 491 LEKLKDQRRVIQLLD-YEMGDGLLYLIMECGDHDLSQILNQRSNMPLDFNFVRFYTKEML 549
            + +K Q  ++Q +D +E    +  L+  C +  L ++L +R    L    VRF+T ++ 
Sbjct: 193 HKSMKHQ-NIVQFVDCFEDHINVYILLGMCPNGSLMELLKKRK--ILTEPEVRFFTVQIC 249

Query: 550 LCIKVVHDAGIVHSDLKPANFVLVKGI-LKIIDFGIANAVPEHTVNIYRETQIGTPNYMA 608
             IK +H   ++H DLK  N    +   LKI DFG+A  +       Y  T  GTPNY+A
Sbjct: 250 GAIKYMHSRRVIHRDLKLGNIFFDENYNLKIGDFGLAAVLANDRERKY--TVCGTPNYIA 307

Query: 609 PEALVAMNYTQSSDNQHEGNKWKVGRPSDMWSCGCIIYQMIYGKPPYGSFQGQNRLLAIM 668
           PE L+          +H G+ ++V    D+WS G +I+ ++ GKPP+ +         I 
Sbjct: 308 PEVLLG---------KHSGHSYEV----DIWSIGVMIFALLIGKPPFQAKDVNTIYSRIK 354

Query: 669 NPDVKIPFPEYTSNNEKIPKSAIELMKACLYRNPDKRWTVDKVLSSTFLQ---PFMISGS 725
           N +   P       N+ I + A  L++  L  +P  R ++++++   + +   P M S +
Sbjct: 355 NSEYTFPI------NKSISQEAKTLIQDILINDPIARPSINEIMEYVWFRGTFPSMTSNT 408

Query: 726 IMEDL 730
           +  ++
Sbjct: 409 VFTEI 413

>ACL006W Chr3 (344395..346521) [2127 bp, 708 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR001C (CDC5)
          Length = 708

 Score =  106 bits (264), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 87/310 (28%), Positives = 142/310 (45%), Gaps = 30/310 (9%)

Query: 424 SASSSNNRSMITVNDSQYEKIELLGRGGSSRVYKVKGSGNKIYALKRXXXXX-XXXXXXX 482
           SA      S+I      Y +   LG GG +R +++K    K++A K              
Sbjct: 56  SALCKTPPSLIKTKGRDYHRGMFLGEGGFARCFQMKDDSGKVFAAKTVAKISIKSEKTRK 115

Query: 483 GFKGEIELLEKLKDQRRVIQLLDYEMGDGLLYLIME-CGDHDLSQILNQRSNMPLDFNFV 541
               EI++ + +K    ++Q  D    D  +Y+++E C +  L  +L QR    L    V
Sbjct: 116 KLLSEIQIHKSMK-HPNIVQFTDCFEDDTNVYILLEICPNGSLMDLLKQRKQ--LTEPEV 172

Query: 542 RFYTKEMLLCIKVVHDAGIVHSDLKPANFVLVKGI-LKIIDFGIANAVPEHTVNIYRETQ 600
           RF+T +++  IK +H   I+H DLK  N    K   LKI DFG+A  +       Y  T 
Sbjct: 173 RFFTTQIVGAIKYMHSRRIIHRDLKLGNIFFDKHFNLKIGDFGLAAVLANDRERKY--TI 230

Query: 601 IGTPNYMAPEALVAMNYTQSSDNQHEGNKWKVGRPSDMWSCGCIIYQMIYGKPPYGSFQG 660
            GTPNY+APE L           +H G+ ++V    D+WS G +IY ++ GKPP+ + + 
Sbjct: 231 CGTPNYIAPEVLTG---------KHTGHSFEV----DIWSIGVMIYALLIGKPPFQAKEV 277

Query: 661 QNRLLAIMNPDVKIPFPEYTSNNEKIPKSAIELMKACLYRNPDKRWTVDKVLSSTFLQ-- 718
                 I   D   P  +  S+  K+      L+K  L  +P +R ++ +++   + +  
Sbjct: 278 NTIYERIKVCDFSFPKDKPISSEAKV------LIKDILSLDPLERPSLAEIMEYVWFRNV 331

Query: 719 -PFMISGSIM 727
            P  I+G I+
Sbjct: 332 FPARINGDIL 341

>KAFR0G02690 Chr7 complement(555573..557714) [2142 bp, 713 aa] {ON}
           Anc_6.31 YMR001C
          Length = 713

 Score =  106 bits (264), Expect = 7e-23,   Method: Compositional matrix adjust.
 Identities = 93/336 (27%), Positives = 156/336 (46%), Gaps = 33/336 (9%)

Query: 386 DDVITNENENKKIQEVFYHRPAPKPPVTKKVEIVEPAKSASSSNNRSMITVNDSQYEKIE 445
           ++++   N N K  +  YH    +PP  KK E +    S+      S+I      Y +  
Sbjct: 46  ENIVIQTNSNNKRTD--YHHRHDQPPQKKKKEKL----SSLCKTPPSLIKTRGRDYHRGH 99

Query: 446 LLGRGGSSRVYKVKGSGNKIYALKRXXXXX-XXXXXXXGFKGEIELLEKLKDQRRVIQLL 504
            LG GG +R ++++    KI+A K                  EI++ + +K    ++Q +
Sbjct: 100 FLGEGGFARCFQIRDDSGKIFAAKTVAKISIKSEKTRKKLLSEIQIHKSMK-HVNIVQFI 158

Query: 505 DYEMGDGLLYLIME-CGDHDLSQILNQRSNMPLDFNFVRFYTKEMLLCIKVVHDAGIVHS 563
           D    D  +Y+++E C +  L  +L +R +  L    VRF+T ++   IK +H   ++H 
Sbjct: 159 DCFEDDTNVYILLEICPNGSLMDLLKKRKS--LTEPEVRFFTTQICGAIKYMHSRKVIHR 216

Query: 564 DLKPAN-FVLVKGILKIIDFGIANAVPEHTVNIYRETQIGTPNYMAPEALVAMNYTQSSD 622
           DLK  N F   K  LKI DFG+A  +       Y  T  GTPNY+APE L+         
Sbjct: 217 DLKLGNIFFDRKYNLKIGDFGLAATLANDRERKY--TVCGTPNYIAPEVLMG-------- 266

Query: 623 NQHEGNKWKVGRPSDMWSCGCIIYQMIYGKPPYGSFQGQNRLLAIMNPDVKIPFPEYTSN 682
            +H G+ ++V    D+WS G +IY +I G+PP+ S         I   D   P  +  S+
Sbjct: 267 -KHSGHSYEV----DIWSIGVMIYALIIGRPPFQSKDVNTIYERIKCRDFSFPKDKLISS 321

Query: 683 NEKIPKSAIELMKACLYRNPDKRWTVDKVLSSTFLQ 718
             KI      L++  L  +P +R +V++++   + +
Sbjct: 322 EAKI------LIQDILSLDPLERPSVNEIMDYIWFR 351

>KNAG0F00290 Chr6 (31750..35127) [3378 bp, 1125 aa] {ON} Anc_1.52
           YDR507C
          Length = 1125

 Score =  106 bits (264), Expect = 9e-23,   Method: Compositional matrix adjust.
 Identities = 74/240 (30%), Positives = 120/240 (50%), Gaps = 26/240 (10%)

Query: 483 GFKGEIELLEKLKDQRRVIQLLDYEMGDGLLYLIMECGDH-DLSQILNQRSNMPLDFNFV 541
           G + EI ++ KL +   V++L D    +  LY+++E  +  +L  +L +R  +P +   +
Sbjct: 74  GIEREIVIM-KLLNHANVLRLYDVWETNSNLYMVLEYAEKGELFNLLVERGPLP-ENEAI 131

Query: 542 RFYTKEMLLCIKVVHDAGIVHSDLKPANFVL-VKGILKIIDFGIANAVPEHTVNIYRETQ 600
           RF+ +++++ I   H  GIVH DLKP N +L  K  +KI DFG+A    E  +    ET 
Sbjct: 132 RFF-RQIIIGISYCHALGIVHRDLKPENLLLDTKYNIKIADFGMAALETEDKL---LETS 187

Query: 601 IGTPNYMAPEALVAMNYTQSSDNQHEGNKWKVGRPSDMWSCGCIIYQMIYGKPPYGSFQG 660
            G+P+Y APE +  + Y               G  SD+WSCG I+Y ++ G+ P+    G
Sbjct: 188 CGSPHYAAPEIVSGIPYH--------------GFASDVWSCGVILYALLTGRLPFDEEDG 233

Query: 661 QNRLLAIMNPDVKIPFPEYTSNNEKIPKSAIELMKACLYRNPDKRWTVDKVLSSTFLQPF 720
             R L +     +   PE    +++I K A  L+   L  NP +R T   +L    LQ +
Sbjct: 234 NIRNLLLKVQAGQFEMPE----DDEISKEAQNLISKILVVNPAERITARDILKHPLLQKY 289

>CAGL0K05709g Chr11 complement(556732..560043) [3312 bp, 1103 aa]
           {ON} similar to uniprot|Q12263 Saccharomyces cerevisiae
           YDR507c GIN4
          Length = 1103

 Score =  106 bits (264), Expect = 9e-23,   Method: Compositional matrix adjust.
 Identities = 69/235 (29%), Positives = 122/235 (51%), Gaps = 29/235 (12%)

Query: 490 LLEKLKDQRRVIQLLDYEMGDGLLYLIMECGDH-DLSQILNQRSNMPLDFNFVRFYTKEM 548
           ++ KL +   V++L D    +  LYL++E  +  +L  +L +R  +P +   VR + +++
Sbjct: 81  IIMKLLNHPNVLRLFDVWETNSDLYLVLEYAEKGELFNMLVERGPLP-ENEAVRAF-RQI 138

Query: 549 LLCIKVVHDAGIVHSDLKPANFVLVKGI-LKIIDFGIANAVPEHTVNIYRETQIGTPNYM 607
           ++ I   H  G+VH DLKP N +L   + +KI DFG+A    E  +    ET  G+P+Y 
Sbjct: 139 IIGISYCHSLGVVHRDLKPENLLLDNKLNIKIADFGMAALESEDKL---LETSCGSPHYA 195

Query: 608 APEALVAMNYTQSSDNQHEGNKWKVGRPSDMWSCGCIIYQMIYGKPPYGSFQG--QNRLL 665
           APE +  + Y               G  SD+WSCG I++ ++ G+ P+    G  +N LL
Sbjct: 196 APEIISGLPYE--------------GFSSDVWSCGVILFALLTGRLPFDEEDGNIRNLLL 241

Query: 666 AIMNPDVKIPFPEYTSNNEKIPKSAIELMKACLYRNPDKRWTVDKVLSSTFLQPF 720
            +   + ++P      ++++I K A +L+   L  +P KR T+ ++L    LQ +
Sbjct: 242 KVQKGEFEMP------DDDEITKEAQDLLARLLTVDPSKRITIREILKHPLLQKY 290

>TDEL0G04380 Chr7 (792278..794446) [2169 bp, 722 aa] {ON} Anc_6.31
           YMR001C
          Length = 722

 Score =  105 bits (262), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 85/313 (27%), Positives = 144/313 (46%), Gaps = 30/313 (9%)

Query: 424 SASSSNNRSMITVNDSQYEKIELLGRGGSSRVYKVKGSGNKIYALKRXXXXX-XXXXXXX 482
           SA      S+I      Y +   LG GG +R +++K    KI+A K              
Sbjct: 84  SALCKTPPSLIKTRGRDYHRGHFLGEGGFARCFQIKDDSGKIFAAKTVAKLSIKTEKTRK 143

Query: 483 GFKGEIELLEKLKDQRRVIQLLDYEMGDGLLYLIME-CGDHDLSQILNQRSNMPLDFNFV 541
               EI++ + ++    ++Q +D    +  +Y+++E C +  L ++L +R    L    V
Sbjct: 144 KLLSEIQIHKSMR-HANIVQFIDCFEDETNVYILLEICPNGSLMELLKKRKT--LTEPEV 200

Query: 542 RFYTKEMLLCIKVVHDAGIVHSDLKPANFVLVKGI-LKIIDFGIANAVPEHTVNIYRETQ 600
           RF+T ++   IK +H   ++H DLK  N    K   LKI DFG+A  +       Y  T 
Sbjct: 201 RFFTTQICGGIKYMHSRRVIHRDLKLGNIFFDKNYNLKIGDFGLAAVLANDRERKY--TV 258

Query: 601 IGTPNYMAPEALVAMNYTQSSDNQHEGNKWKVGRPSDMWSCGCIIYQMIYGKPPYGSFQG 660
            GTPNY+APE L+          +H G+ ++V    D+WS G +IY ++ GKPP+ +   
Sbjct: 259 CGTPNYIAPEVLMG---------KHSGHSYEV----DIWSIGVMIYALLIGKPPFQAKDV 305

Query: 661 QNRLLAIMNPDVKIPFPEYTSNNEKIPKSAIELMKACLYRNPDKRWTVDKVLSSTFLQ-- 718
                 I   D   P  +Y S+  +I      L++  L  +P +R ++ +VL   + +  
Sbjct: 306 NTIYERIKCCDFVFPKEKYISSEARI------LVQDLLSLDPLERPSIMEVLDYVWFRGI 359

Query: 719 -PFMISGSIMEDL 730
            P  I   +M ++
Sbjct: 360 FPPYIQSDVMTEV 372

>Ecym_3035 Chr3 complement(70391..72613) [2223 bp, 740 aa] {ON}
           similar to Ashbya gossypii ACL006W
          Length = 740

 Score =  105 bits (262), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 86/310 (27%), Positives = 142/310 (45%), Gaps = 30/310 (9%)

Query: 424 SASSSNNRSMITVNDSQYEKIELLGRGGSSRVYKVKGSGNKIYALKRXXXXX-XXXXXXX 482
           SA      S+I      Y +   LG GG +R +++K    KI+A K              
Sbjct: 56  SALCKTPPSLIKTKGRDYHRGMFLGEGGFARCFQMKDDSGKIFAAKTVAKISIKSEKTRK 115

Query: 483 GFKGEIELLEKLKDQRRVIQLLDYEMGDGLLYLIME-CGDHDLSQILNQRSNMPLDFNFV 541
               EI++ + ++    ++Q  D    D  +Y+++E C +  L  +L QR    L    V
Sbjct: 116 KLLSEIQIHKSMR-HPNIVQFTDCFEDDTNVYILLEICPNGSLMDLLKQRKQ--LTEPEV 172

Query: 542 RFYTKEMLLCIKVVHDAGIVHSDLKPANFVLVKGI-LKIIDFGIANAVPEHTVNIYRETQ 600
           RF+T +++  IK +H   I+H DLK  N    K   LKI DFG+A  +       Y  T 
Sbjct: 173 RFFTTQIVGAIKYMHSRRIIHRDLKLGNIFFDKHFNLKIGDFGLAAVLANDRERKY--TI 230

Query: 601 IGTPNYMAPEALVAMNYTQSSDNQHEGNKWKVGRPSDMWSCGCIIYQMIYGKPPYGSFQG 660
            GTPNY+APE L           +H G+ ++V    D+WS G +IY ++ GKPP+ + + 
Sbjct: 231 CGTPNYIAPEVLTG---------KHTGHSFEV----DVWSIGVMIYALLIGKPPFQAKEV 277

Query: 661 QNRLLAIMNPDVKIPFPEYTSNNEKIPKSAIELMKACLYRNPDKRWTVDKVLSSTFLQ-- 718
                 I   D   P  +  S+  K+      L+K  L  +P +R ++ +++   + +  
Sbjct: 278 NTIYERIKVCDFNFPRDKPISSEAKV------LIKDILSLDPLERPSLTEIMEYVWFRNV 331

Query: 719 -PFMISGSIM 727
            P  I+G ++
Sbjct: 332 FPMRINGDVL 341

>CAGL0L12474g Chr12 complement(1347340..1348248) [909 bp, 302 aa]
           {ON} highly similar to uniprot|P17157 Saccharomyces
           cerevisiae YPL031c cyclin-dependent protein kinase
          Length = 302

 Score =  100 bits (250), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 87/312 (27%), Positives = 147/312 (47%), Gaps = 56/312 (17%)

Query: 436 VNDSQYEKIELLGRGGSSRVYKVKGSGNKIY-ALKRXXXXXXXXXXXXGFKGEIELLEKL 494
           ++ SQ++++E LG G  + VYK       +Y ALK               + EI L+++L
Sbjct: 1   MSSSQFKQLEKLGNGTYATVYKGLNKSTGVYVALKEVKLDSEEGTPSTAIR-EISLMKEL 59

Query: 495 KDQRRVIQLLDYEMGDGLLYLIMECGDHDLSQILNQRS--NMP--LDFNFVRFYTKEMLL 550
           K    +++L D    +  L L+ E  D+DL + ++ R+  N P  L+ N V+++  ++L 
Sbjct: 60  K-HDNIVRLYDVIHTENKLTLVFEYMDNDLKKYMDSRTVGNAPRGLEMNLVKYFQWQLLE 118

Query: 551 CIKVVHDAGIVHSDLKPANFVLVK-GILKIIDFGIANA--VPEHTVNIYRETQIGTPNYM 607
            +   H+  I+H DLKP N ++ K G LK+ DFG+A A  +P +T +    +++ T  Y 
Sbjct: 119 GLAFCHENKILHRDLKPQNLLITKRGQLKLGDFGLARAFGIPVNTFS----SEVVTLWYR 174

Query: 608 APEALVAMNYTQSSDNQHEGNKWKVGRPSDMWSCGCIIYQMIYGKPPYGSFQGQNRLLAI 667
           AP+ L+      +S               D+WSCGCI+ +MI GKP +     + +L  I
Sbjct: 175 APDVLMGSRTYSTS--------------IDIWSCGCILAEMITGKPLFPGTNDEEQLKLI 220

Query: 668 MN----------PDVKIPFPEYTSN-NEKIPK----------------SAIELMKACLYR 700
            +          P V    P+Y  N  +++PK                + I+L+   L  
Sbjct: 221 FDKMGTPNETTWPGV-TSLPKYNPNFQQRLPKDLKAELQPYVKEPLDDNVIDLLHGLLQL 279

Query: 701 NPDKRWTVDKVL 712
           NPD R +  + L
Sbjct: 280 NPDMRLSAKQAL 291

>YHR102W Chr8 (316572..319814) [3243 bp, 1080 aa] {ON}  KIC1Protein
           kinase of the PAK/Ste20 family, required for cell
           integrity; physically interacts with Cdc31p (centrin),
           which is a component of the spindle pole body; part of
           the RAM network that regulates cellular polarity and
           morphogenesis
          Length = 1080

 Score =  104 bits (260), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 82/299 (27%), Positives = 141/299 (47%), Gaps = 34/299 (11%)

Query: 439 SQYEKIELLGRGGSSRVYK---VKGSGNKIYALKRXXXXXXXXXXXXGFKGEIELLEKLK 495
           S +++ E++GRG    VYK   VK    ++YA+K               + EI+ L  LK
Sbjct: 21  SLFKRTEVIGRGKFGVVYKGYNVKTG--RVYAIK-VLNLDSDSDEVEDVQREIQFLASLK 77

Query: 496 DQRRVIQLLDYEMGDGLLYLIME-CGDHDLSQILNQRSNMPLDFNFVRFYTKEMLLCIKV 554
               + +     + D  L++IME C    L  +L       +D  ++    +E+L+ +K 
Sbjct: 78  QISNITRYYGSYLKDTSLWIIMEHCAGGSLRSLLRPGK---IDEKYIGVIMRELLVALKC 134

Query: 555 VHDAGIVHSDLKPANFVLV-KGILKIIDFGIANAVPEHTVNIYRETQIGTPNYMAPEALV 613
           +H   ++H D+K AN ++  +G +K+ DFG+A  V  +  ++ R+T  GTP +MAPE ++
Sbjct: 135 IHKDNVIHRDIKAANVLITNEGNVKLCDFGVAAQV--NQTSLRRQTMAGTPYWMAPEVIM 192

Query: 614 AMNYTQSSDNQHEGNKWKVGRPSDMWSCGCIIYQMIYGKPPYGSFQGQNRLLAIMNPDVK 673
              Y  +          KV    D+WS G   Y++  G PPY   +    +  I+    K
Sbjct: 193 EGVYYDT----------KV----DIWSLGITTYEIATGNPPYCDVEALRAMQLII--KSK 236

Query: 674 IPFPEYTSNNEKIPKSAIELMKACLYRNPDKRWTVDKVLSSTFLQPFMIS-GSIMEDLI 731
            P  E    +     S  E +  CL  +P +R + D +L S F++    +  SI+++LI
Sbjct: 237 PPRLE----DRSYSTSLKEFIALCLDEDPKERLSADDLLKSKFIRAHKATPTSILKELI 291

>YMR001C Chr13 complement(269019..271136) [2118 bp, 705 aa] {ON}
           CDC5Polo-like kinase with multiple functions in mitosis
           and cytokinesis through substrate phosphorylation, also
           functions in adaptation to DNA damage during meiosis;
           has similarity to Xenopus Plx1 and S. pombe Plo1p;
           possible Cdc28p substrate
          Length = 705

 Score =  103 bits (258), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 94/360 (26%), Positives = 163/360 (45%), Gaps = 43/360 (11%)

Query: 381 LKRSLDDVITNENENKKIQEV-----FYHRPAPKPPVTKKVEIVEPAKSASSSNNRSMIT 435
           +K +  D++  EN  K+ + +      +H+PA K    KK E +    SA      S+I 
Sbjct: 25  IKGNTADLVGKENHFKQTKRLDPNNDHHHQPAQK----KKREKL----SALCKTPPSLIK 76

Query: 436 VNDSQYEKIELLGRGGSSRVYKVKGSGNKIYALKRXXXXX-XXXXXXXGFKGEIELLEKL 494
                Y +   LG GG +R +++K    +I+A K                  EI+ + K 
Sbjct: 77  TRGKDYHRGHFLGEGGFARCFQIKDDSGEIFAAKTVAKASIKSEKTRKKLLSEIQ-IHKS 135

Query: 495 KDQRRVIQLLDYEMGDGLLYLIME-CGDHDLSQILNQRSNMPLDFNFVRFYTKEMLLCIK 553
                ++Q +D    D  +Y+++E C +  L ++L +R    L    VRF+T ++   IK
Sbjct: 136 MSHPNIVQFIDCFEDDSNVYILLEICPNGSLMELLKRRK--VLTEPEVRFFTTQICGAIK 193

Query: 554 VVHDAGIVHSDLKPANFVLVKGI-LKIIDFGIANAVPEHTVNIYRETQIGTPNYMAPEAL 612
            +H   ++H DLK  N        LKI DFG+A  +   +   Y  T  GTPNY+APE L
Sbjct: 194 YMHSRRVIHRDLKLGNIFFDSNYNLKIGDFGLAAVLANESERKY--TICGTPNYIAPEVL 251

Query: 613 VAMNYTQSSDNQHEGNKWKVGRPSDMWSCGCIIYQMIYGKPPYGSFQGQNRLLAIMNPDV 672
           +          +H G+ ++V    D+WS G ++Y ++ GKPP+ +         I   D 
Sbjct: 252 MG---------KHSGHSFEV----DIWSLGVMLYALLIGKPPFQARDVNTIYERIKCRDF 298

Query: 673 KIPFPEYTSNNEKIPKSAIELMKACLYRNPDKRWTVDKVLSSTFLQ---PFMISGSIMED 729
             P  +  S+  KI      L++  L  +P +R ++ +++   + +   P  I  ++M +
Sbjct: 299 SFPRDKPISDEGKI------LIRDILSLDPIERPSLTEIMDYVWFRGTFPPSIPSTVMSE 352

>TPHA0C01780 Chr3 complement(407048..407965) [918 bp, 305 aa] {ON}
           Anc_8.482 YPL031C
          Length = 305

 Score = 99.8 bits (247), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 88/314 (28%), Positives = 144/314 (45%), Gaps = 56/314 (17%)

Query: 434 ITVNDSQYEKIELLGRGGSSRVYKVKGSGNKIY-ALKRXXXXXXXXXXXXGFKGEIELLE 492
           ++ + SQ++++E LG G  + VYK       I+ ALK               + EI L++
Sbjct: 1   MSSSSSQFKQLEKLGNGTYATVYKGLNKTTGIFVALKEVKLDSEEGTPSTAIR-EISLMK 59

Query: 493 KLKDQRRVIQLLDYEMGDGLLYLIMECGDHDLSQILNQR----SNMPLDFNFVRFYTKEM 548
           +LK +  +++L D    +  L L+ E  D DL   ++ R    S   L+ + V+++  ++
Sbjct: 60  ELKHEN-IVRLYDVIHTENKLTLVFEYMDKDLKNYMDSRTSGNSTRGLELSLVKYFQWQL 118

Query: 549 LLCIKVVHDAGIVHSDLKPANFVLV-KGILKIIDFGIANA--VPEHTVNIYRETQIGTPN 605
              +   H+  I+H DLKP N ++  KG LK+ DFG+A A  +P +T +    T++ T  
Sbjct: 119 FEGVTFCHENKILHRDLKPQNLLINNKGQLKLGDFGLARAFGIPVNTFS----TEVVTLW 174

Query: 606 YMAPEALVAMNYTQSSDNQHEGNKWKVGRPSDMWSCGCIIYQMIYGKPPYGSFQGQNRLL 665
           Y AP+ L+      +S               DMWSCGCI+ +MI GKP +     + +L 
Sbjct: 175 YRAPDVLMGSRSYSTS--------------IDMWSCGCILAEMITGKPLFPGTNDEEQLK 220

Query: 666 AIMN----PDVKIPFPEYTS---NNEKIPK--------------------SAIELMKACL 698
            I +    PD ++ +P  TS    N  +PK                      I+L+   L
Sbjct: 221 LIFDIMGTPDEQL-WPAVTSLPKYNRNLPKKEPKDLKKLLQAHTKEIVDDQVIDLVTGLL 279

Query: 699 YRNPDKRWTVDKVL 712
             NPD R T  + L
Sbjct: 280 QLNPDARLTAKQAL 293

>Smik_8.180 Chr8 (292993..296214) [3222 bp, 1073 aa] {ON} YHR102W
           (REAL)
          Length = 1073

 Score =  104 bits (259), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 82/299 (27%), Positives = 142/299 (47%), Gaps = 34/299 (11%)

Query: 439 SQYEKIELLGRGGSSRVYK---VKGSGNKIYALKRXXXXXXXXXXXXGFKGEIELLEKLK 495
           S +++ E++GRG    VYK   VK    ++YA+K               + EI+ L  LK
Sbjct: 21  SLFKRTEVIGRGKFGVVYKGYNVKT--RRVYAIK-VLNLDSDSDEVEDVQREIQFLASLK 77

Query: 496 DQRRVIQLLDYEMGDGLLYLIME-CGDHDLSQILNQRSNMPLDFNFVRFYTKEMLLCIKV 554
               + +     + D  L++IME C    L  +L       +D  ++    +E+L+ +K 
Sbjct: 78  QISNITRYYGSYLKDTSLWIIMEYCAGGSLRSLLRPGK---IDEKYIGVIMRELLVALKC 134

Query: 555 VHDAGIVHSDLKPANFVLV-KGILKIIDFGIANAVPEHTVNIYRETQIGTPNYMAPEALV 613
           +H   ++H D+K AN ++  +G +K+ DFG+A  V  +  ++ R+T  GTP +MAPE ++
Sbjct: 135 IHKDNVIHRDIKAANVLITNEGNVKLCDFGVAAQV--NQTSLRRQTMAGTPYWMAPEVIM 192

Query: 614 AMNYTQSSDNQHEGNKWKVGRPSDMWSCGCIIYQMIYGKPPYGSFQGQNRLLAIMNPDVK 673
              Y  +          KV    D+WS G   Y++  G PPY   +    +  I+    K
Sbjct: 193 EGVYYDT----------KV----DIWSLGITTYEIATGNPPYCDVEALRAMQLII--KSK 236

Query: 674 IPFPEYTSNNEKIPKSAIELMKACLYRNPDKRWTVDKVLSSTFLQPFMIS-GSIMEDLI 731
            P  E  S +     S  E +  CL  +P +R + D +L S F++    +  SI+++L+
Sbjct: 237 PPRLEGRSYS----PSLKEFIALCLDEDPKERLSADDLLRSKFIKAHRATPTSILKELV 291

>Skud_8.163 Chr8 (290415..293645) [3231 bp, 1076 aa] {ON} YHR102W
           (REAL)
          Length = 1076

 Score =  104 bits (259), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 81/300 (27%), Positives = 143/300 (47%), Gaps = 36/300 (12%)

Query: 439 SQYEKIELLGRGGSSRVYK---VKGSGNKIYALKRXXXXXXXXXXXXGFKGEIELLEKLK 495
           S +++ E++GRG    VYK   VK    ++YA+K               + EI+ L  LK
Sbjct: 21  SLFKRTEVVGRGKFGVVYKGYNVKT--RRVYAIK-VLNLDSDSDEVEDVQREIQFLASLK 77

Query: 496 DQRRVIQLLDYEMGDGLLYLIME-CGDHDLSQILNQRSNMPLDFNFVRFYTKEMLLCIKV 554
               + +     + D  L+++ME C    L  +L       +D  ++    +E+L+ +K 
Sbjct: 78  QMPNITRYYGSYLKDTSLWILMEYCAGGSLRSLLRPGK---IDEKYIGVIMRELLVALKC 134

Query: 555 VHDAGIVHSDLKPANFVLV-KGILKIIDFGIANAVPEHTVNIYRETQIGTPNYMAPEALV 613
           +H   ++H D+K AN ++  +G +K+ DFG+A  V  +  ++ R+T  GTP +MAPE ++
Sbjct: 135 IHKDNVIHRDIKAANVLITNEGSVKLCDFGVAAQV--NQTSLRRQTMAGTPYWMAPEVIM 192

Query: 614 AMNYTQSSDNQHEGNKWKVGRPSDMWSCGCIIYQMIYGKPPYGSFQGQNRL-LAIMNPDV 672
              Y  +          KV    D+WS G   Y++  G PPY   +    + L I +   
Sbjct: 193 EGVYYDT----------KV----DIWSLGITTYEIATGNPPYCDVEALRAMQLIIKSKPP 238

Query: 673 KIPFPEYTSNNEKIPKSAIELMKACLYRNPDKRWTVDKVLSSTFLQPFMIS-GSIMEDLI 731
           ++    Y+S       S  E +  CL  +P +R + D +L S F++    +  SI+++LI
Sbjct: 239 RLEGRSYSS-------SLKEFIALCLDEDPKERLSADDLLRSKFIKTHRATPTSILKELI 291

>TBLA0A07150 Chr1 (1776160..1780335) [4176 bp, 1391 aa] {ON}
           Anc_1.52 YDR507C
          Length = 1391

 Score =  104 bits (259), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 71/242 (29%), Positives = 124/242 (51%), Gaps = 30/242 (12%)

Query: 483 GFKGEIELLEKLKDQRRVIQLLDYEMGDGLLYLIMECGDH-DLSQILNQRSNMPLDFNFV 541
           G + EI ++ KL +   V++L D    D  LY+++E  +  +L  +L +R  +P +   +
Sbjct: 77  GIEREI-IIMKLLNHPNVLRLYDVWETDSNLYMVLEYAEKGELFNLLVERGPLP-ENEAI 134

Query: 542 RFYTKEMLLCIKVVHDAGIVHSDLKPANFVLV-KGILKIIDFGIANAVPEHTVNIYRETQ 600
           RF+ +++++ I   H  GIVH DLKP N +L  K  +KI DFG+A      T +   ET 
Sbjct: 135 RFF-RQIIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAAL---ETEDKLLETS 190

Query: 601 IGTPNYMAPEALVAMNYTQSSDNQHEGNKWKVGRPSDMWSCGCIIYQMIYGKPPYGSFQG 660
            G+P+Y APE +  + Y               G  +D+WSCG I++ ++ G+ P+    G
Sbjct: 191 CGSPHYAAPEIISGLPYH--------------GLETDVWSCGIILFALLTGRLPFDEEDG 236

Query: 661 --QNRLLAIMNPDVKIPFPEYTSNNEKIPKSAIELMKACLYRNPDKRWTVDKVLSSTFLQ 718
             +N LL + +   ++P       N++I + A +L+   L  +P KR    ++L    +Q
Sbjct: 237 NIRNLLLKVQSGQFEMP------GNDEISREAQDLISKILTVDPKKRIKTREILKHPLVQ 290

Query: 719 PF 720
            +
Sbjct: 291 KY 292

>SAKL0E01584g Chr5 complement(121830..123917) [2088 bp, 695 aa] {ON}
           highly similar to uniprot|P32562 Saccharomyces
           cerevisiae YMR001C
          Length = 695

 Score =  103 bits (256), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 84/310 (27%), Positives = 145/310 (46%), Gaps = 30/310 (9%)

Query: 424 SASSSNNRSMITVNDSQYEKIELLGRGGSSRVYKVKGSGNKIYALKRXXXXX-XXXXXXX 482
           SA      S+I      Y +   LG GG +R +++K    KI+A K              
Sbjct: 60  SALCKTPPSLIKTRGRDYHRGHFLGEGGFARCFQMKDDSGKIFAAKTVAKISIKSEKTRK 119

Query: 483 GFKGEIELLEKLKDQRRVIQLLDYEMGDGLLYLIME-CGDHDLSQILNQRSNMPLDFNFV 541
               EI++ + +K    ++Q +D    D  +Y+++E C +  L  +L +R    L    V
Sbjct: 120 KLLSEIQIHKSMK-HPNIVQFIDCFEDDTNVYILLEICPNGSLMDLLKKRK--VLTEPEV 176

Query: 542 RFYTKEMLLCIKVVHDAGIVHSDLKPANFVLVKGI-LKIIDFGIANAVPEHTVNIYRETQ 600
           R++T +++  IK +H+  ++H DLK  N        LKI DFG+A  +       Y  T 
Sbjct: 177 RYFTTQIVGAIKYMHNRRVIHRDLKLGNIFFDSNYNLKIGDFGLAAVLANDRERKY--TV 234

Query: 601 IGTPNYMAPEALVAMNYTQSSDNQHEGNKWKVGRPSDMWSCGCIIYQMIYGKPPYGSFQG 660
            GTPNY+APE L           +H G+ ++V    D+WS G +IY ++ GKPP+ + + 
Sbjct: 235 CGTPNYIAPEVLAG---------KHSGHSYEV----DIWSIGVMIYALLIGKPPFQAKEV 281

Query: 661 QNRLLAIMNPDVKIPFPEYTSNNEKIPKSAIELMKACLYRNPDKRWTVDKVLSSTFLQ-- 718
                 I + D   P  + TS      K  + L++  L  +P +R ++D+++   + +  
Sbjct: 282 NIIYERIKSGDYIFPREKPTS------KEVMVLIQDILSIDPIERPSLDEIMDYVWFRGI 335

Query: 719 -PFMISGSIM 727
            P  I+G ++
Sbjct: 336 FPARINGDVL 345

>Smik_13.159 Chr13 complement(260249..262366) [2118 bp, 705 aa] {ON}
           YMR001C (REAL)
          Length = 705

 Score =  102 bits (255), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 94/361 (26%), Positives = 163/361 (45%), Gaps = 43/361 (11%)

Query: 381 LKRSLDDVITNENENKKIQEVF-----YHRPAPKPPVTKKVEIVEPAKSASSSNNRSMIT 435
           +K S  D+   EN  K+ + +      +H+PA K    KK E +    SA      S+I 
Sbjct: 25  IKGSTADLAGKENHFKQTKRLDPNNDNHHQPAQK----KKREKL----SALCKTPPSLIK 76

Query: 436 VNDSQYEKIELLGRGGSSRVYKVKGSGNKIYALKRXXXXX-XXXXXXXGFKGEIELLEKL 494
                Y +   LG GG +R +++K     I+A K                  EI++ + +
Sbjct: 77  TRGKDYHRGHFLGEGGFARCFQIKDDSGDIFAAKTVAKASIKSEKTRKKLLSEIQIHKSM 136

Query: 495 KDQRRVIQLLDYEMGDGLLYLIME-CGDHDLSQILNQRSNMPLDFNFVRFYTKEMLLCIK 553
                ++Q +D    D  +Y+++E C +  L ++L +R    L    VRF+T ++   IK
Sbjct: 137 A-HPNIVQFIDCFEDDSNVYILLEICPNGSLMELLKRRK--VLSEPEVRFFTTQICGAIK 193

Query: 554 VVHDAGIVHSDLKPANFVLVKGI-LKIIDFGIANAVPEHTVNIYRETQIGTPNYMAPEAL 612
            +H   ++H DLK  N        LKI DFG+A  +   +   Y  T  GTPNY+APE L
Sbjct: 194 YMHSRRVIHRDLKLGNIFFDSNYNLKIGDFGLAAVLANESERKY--TICGTPNYIAPEVL 251

Query: 613 VAMNYTQSSDNQHEGNKWKVGRPSDMWSCGCIIYQMIYGKPPYGSFQGQNRLLAIMNPDV 672
           +          +H G+ ++V    D+WS G ++Y ++ GKPP+ +         I   D 
Sbjct: 252 MG---------KHSGHSFEV----DIWSLGVMLYALLIGKPPFQARDVNTIYERIKCRDF 298

Query: 673 KIPFPEYTSNNEKIPKSAIELMKACLYRNPDKRWTVDKVLSSTFLQ---PFMISGSIMED 729
             P  +  S+  KI      L++  L  +P +R ++ +++   + +   P  I  ++M +
Sbjct: 299 SFPKDKPISDEGKI------LIRDILSLDPIERPSLTEIMDYVWFRGTFPPSIPSTVMSE 352

Query: 730 L 730
           +
Sbjct: 353 V 353

>Skud_13.154 Chr13 complement(255263..257380) [2118 bp, 705 aa] {ON}
           YMR001C (REAL)
          Length = 705

 Score =  102 bits (255), Expect = 8e-22,   Method: Compositional matrix adjust.
 Identities = 89/334 (26%), Positives = 152/334 (45%), Gaps = 38/334 (11%)

Query: 403 YHRPAPKPPVTKKVEIVEPAKSASSSNNRSMITVNDSQYEKIELLGRGGSSRVYKVKGSG 462
           +H+PA K    KK E +    SA      S+I      Y +   LG GG +R +++K   
Sbjct: 52  HHQPAQK----KKREKL----SALCKTPPSLIKTRGKDYHRGHFLGEGGFARCFQIKDDS 103

Query: 463 NKIYALKRXXXXX-XXXXXXXGFKGEIELLEKLKDQRRVIQLLDYEMGDGLLYLIME-CG 520
            +I+A K                  EI+ + K      ++Q +D    D  +Y+++E C 
Sbjct: 104 GEIFAAKTVAKASIKSEKTRKKLLSEIQ-IHKSMSHPNIVQFIDCFEDDSNVYILLEICP 162

Query: 521 DHDLSQILNQRSNMPLDFNFVRFYTKEMLLCIKVVHDAGIVHSDLKPANFVLVKGI-LKI 579
           +  L ++L +R    L    VRF+T ++   IK +H   ++H DLK  N        LKI
Sbjct: 163 NGSLMELLKRRK--VLTEPEVRFFTTQICGAIKYMHSRRVIHRDLKLGNIFFDSNYNLKI 220

Query: 580 IDFGIANAVPEHTVNIYRETQIGTPNYMAPEALVAMNYTQSSDNQHEGNKWKVGRPSDMW 639
            DFG+A  +   +   Y  T  GTPNY+APE L+          +H G+ ++V    D+W
Sbjct: 221 GDFGLAAVLANESERKY--TICGTPNYIAPEVLMG---------KHSGHSFEV----DIW 265

Query: 640 SCGCIIYQMIYGKPPYGSFQGQNRLLAIMNPDVKIPFPEYTSNNEKIPKSAIELMKACLY 699
           S G ++Y ++ GKPP+ +         I   D   P  +  S+  KI      L++  L 
Sbjct: 266 SLGVMLYALLIGKPPFQARDVNTIYERIKCRDFSFPKDKPISDEGKI------LIRDILS 319

Query: 700 RNPDKRWTVDKVLSSTFLQ---PFMISGSIMEDL 730
            +P +R ++ +++   + +   P  I  ++M ++
Sbjct: 320 LDPIERPSLTEIMDYVWFRGTFPPSIPATVMSEV 353

>ZYRO0C07480g Chr3 (565426..567750) [2325 bp, 774 aa] {ON} highly
           similar to uniprot|P32562 Saccharomyces cerevisiae
           YMR001C
          Length = 774

 Score =  102 bits (255), Expect = 8e-22,   Method: Compositional matrix adjust.
 Identities = 80/313 (25%), Positives = 145/313 (46%), Gaps = 30/313 (9%)

Query: 424 SASSSNNRSMITVNDSQYEKIELLGRGGSSRVYKVKGSGNKIYALKRXXXXX-XXXXXXX 482
           SA      S+I      Y +   LG GG +R ++++    K++A K              
Sbjct: 128 SALCKTPPSLIKTRGRDYHRGHFLGEGGFARCFQIRDDSGKLFAAKTVAKLSIKTEKTRK 187

Query: 483 GFKGEIELLEKLKDQRRVIQLLDYEMGDGLLYLIME-CGDHDLSQILNQRSNMPLDFNFV 541
               EI++ + +K Q  ++Q +D    D  +Y+++E C +  L ++L +R    L    V
Sbjct: 188 KLLSEIQIHKSMKHQN-IVQFIDCFEDDTNVYILLEICPNGSLMELLKKRKQ--LTEPEV 244

Query: 542 RFYTKEMLLCIKVVHDAGIVHSDLKPANFVLVKGI-LKIIDFGIANAVPEHTVNIYRETQ 600
           RF+T ++   IK +H   ++H DLK  N    +   LKI DFG+A  +       +  T 
Sbjct: 245 RFFTTQICGAIKYMHSRRVIHRDLKLGNIFFDRNYNLKIGDFGLAAVLANDRERKF--TV 302

Query: 601 IGTPNYMAPEALVAMNYTQSSDNQHEGNKWKVGRPSDMWSCGCIIYQMIYGKPPYGSFQG 660
            GTPNY+APE L+          +H G+ ++V    D+WS G ++Y ++ GKPP+ +   
Sbjct: 303 CGTPNYIAPEVLMG---------KHSGHSYEV----DVWSIGVMVYALLVGKPPFQAKDV 349

Query: 661 QNRLLAIMNPDVKIPFPEYTSNNEKIPKSAIELMKACLYRNPDKRWTVDKVLSSTFLQ-- 718
                 I   D   P  +  S+  K+      L++  L  +P +R ++ +++   + +  
Sbjct: 350 NTIYERIKCCDFIFPKEKPISHEAKV------LVQDLLSLDPLERPSISEIMDYVWFRGI 403

Query: 719 -PFMISGSIMEDL 730
            P  I  ++M ++
Sbjct: 404 FPPYIQSNVMTEV 416

>NDAI0C01700 Chr3 complement(367077..370139) [3063 bp, 1020 aa] {ON}
           Anc_5.406
          Length = 1020

 Score =  103 bits (256), Expect = 8e-22,   Method: Compositional matrix adjust.
 Identities = 82/298 (27%), Positives = 137/298 (45%), Gaps = 30/298 (10%)

Query: 438 DSQYEKIELLGRGGSSRVYKVKGSGNK-IYALKRXXXXXXXXXXXXGFKGEIELLEKLKD 496
           +S + + E++GRG    VYK      K IYA+K               + EI+ L  LK 
Sbjct: 39  NSVFRRTEVIGRGKFGIVYKGYHVKTKQIYAIK-VLNLDSDEDEVEDVQREIQFLASLKQ 97

Query: 497 QRRVIQLLDYEMGDGLLYLIME-CGDHDLSQILNQRSNMPLDFNFVRFYTKEMLLCIKVV 555
              + +     + D  L++IME C    L  +L       +D  ++   T+E+L+ +K +
Sbjct: 98  LPNITRYYGSYLKDTSLWIIMEYCAGGSLRTLLRPGK---IDEKYIGVITREILIALKYI 154

Query: 556 HDAGIVHSDLKPANFVLV-KGILKIIDFGIANAVPEHTVNIYRETQIGTPNYMAPEALVA 614
           H   I+H D+K AN ++  +G +K+ DFG+A  + + T    R+T  GTP +MAPE ++ 
Sbjct: 155 HKDNIIHRDIKAANVLITNEGSIKLCDFGVAAQLNQSTKR--RQTMAGTPYWMAPEVIME 212

Query: 615 MNYTQSSDNQHEGNKWKVGRPSDMWSCGCIIYQMIYGKPPYGSFQGQNRLLAIMNPDVKI 674
             Y  +          KV    D+WS G   Y++  G PPY   +     L  M    K 
Sbjct: 213 GVYYDT----------KV----DIWSLGITTYEIATGNPPYCEIEA----LRAMQLITKS 254

Query: 675 PFPEYTSNNEKIPKSAIELMKACLYRNPDKRWTVDKVLSSTFLQPFMISG-SIMEDLI 731
             P     N        E +  CL  +P +R + + +L + F++   ++  SI+++LI
Sbjct: 255 KPPRLEGRNYS--PLLKEFVALCLDEDPKERMSAEDLLKTKFIKAHKLTPVSILKELI 310

>KLLA0F24618g Chr6 complement(2288943..2290613) [1671 bp, 556 aa]
           {ON} similar to uniprot|P38070 Saccharomyces cerevisiae
           YBR028C Hypothetical ORF
          Length = 556

 Score =  101 bits (252), Expect = 9e-22,   Method: Compositional matrix adjust.
 Identities = 73/235 (31%), Positives = 104/235 (44%), Gaps = 44/235 (18%)

Query: 488 IELLEKLKDQRRVIQLLDYEMGDGLLYLIMECGDHDLSQILNQRSNMPLDFNFVRFYTKE 547
           ++L     D  ++  +L Y  G  L Y + E G               LD   V FY  E
Sbjct: 244 VKLFYSFHDNHKLYLVLQYIPGGELFYHLKEQGT--------------LDEGTVAFYAAE 289

Query: 548 MLLCIKVVHDAGIVHSDLKPANFVL-VKGILKIIDFGIAN-------AVPEHTVNIYR-E 598
           +   +K +H  GIV+ DLKP N +L  +G L + DFG++        A PE   N+ +  
Sbjct: 290 LSCALKFLHSKGIVYRDLKPENCLLNERGHLVLTDFGLSKKSVFDDAATPEEGENVNQLY 349

Query: 599 TQIGTPNYMAPEALVAMNYTQSSDNQHEGNKWKVGRPSDMWSCGCIIYQMIYGKPPYGSF 658
           + IGTP Y APE L    YTQ+ D       W        +S GC++Y M+ GKPP+   
Sbjct: 350 SIIGTPEYCAPEILAGEPYTQNCD-------W--------YSLGCLVYDMLIGKPPFTGV 394

Query: 659 QGQNRLLAIMNPDVKIPFPEYTSNNEKIPKSAIELMKACLYRNPDKRWTVDKVLS 713
             +  L  I         P Y S+  K      + + A L ++P KRW VDK  +
Sbjct: 395 NHKIILNKIKQEKTGARIPSYLSDGFK------DYLGALLRKDPTKRWDVDKYWA 443

>YDR507C Chr4 complement(1462358..1465786) [3429 bp, 1142 aa] {ON}
           GIN4Protein kinase involved in bud growth and assembly
           of the septin ring, proposed to have kinase-dependent
           and kinase-independent activities; undergoes
           autophosphorylation; similar to Kcc4p and Hsl1p
          Length = 1142

 Score =  103 bits (256), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 70/242 (28%), Positives = 125/242 (51%), Gaps = 30/242 (12%)

Query: 483 GFKGEIELLEKLKDQRRVIQLLDYEMGDGLLYLIMECGDH-DLSQILNQRSNMPLDFNFV 541
           G + EI ++ KL +   V++L D    +  LYL++E  +  +L  +L +R  +P +   +
Sbjct: 77  GIEREI-IIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLP-EHEAI 134

Query: 542 RFYTKEMLLCIKVVHDAGIVHSDLKPANFVL-VKGILKIIDFGIANAVPEHTVNIYRETQ 600
           RF+ +++++ +   H  GIVH DLKP N +L  K  +KI DFG+A    E  +    ET 
Sbjct: 135 RFF-RQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEGKL---LETS 190

Query: 601 IGTPNYMAPEALVAMNYTQSSDNQHEGNKWKVGRPSDMWSCGCIIYQMIYGKPPYGSFQG 660
            G+P+Y APE +  + Y               G  SD+WSCG I++ ++ G+ P+    G
Sbjct: 191 CGSPHYAAPEIVSGIPYQ--------------GFASDVWSCGVILFALLTGRLPFDEEDG 236

Query: 661 QNR--LLAIMNPDVKIPFPEYTSNNEKIPKSAIELMKACLYRNPDKRWTVDKVLSSTFLQ 718
             R  LL +   + ++P      ++++I + A +L++  L  +P++R     +L    LQ
Sbjct: 237 NIRTLLLKVQKGEFEMP------SDDEISREAQDLIRKILTVDPERRIKTRDILKHPLLQ 290

Query: 719 PF 720
            +
Sbjct: 291 KY 292

>Suva_15.297 Chr15 (518854..520850,520945..522172) [3225 bp, 1074
           aa] {ON} YHR102W (REAL)
          Length = 1074

 Score =  102 bits (255), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 82/299 (27%), Positives = 142/299 (47%), Gaps = 34/299 (11%)

Query: 439 SQYEKIELLGRGGSSRVYK---VKGSGNKIYALKRXXXXXXXXXXXXGFKGEIELLEKLK 495
           S +++ E++GRG    VYK   VK    +++A+K               + EI+ L  LK
Sbjct: 21  SLFKRTEVIGRGKFGVVYKGYNVKT--RRVFAIK-VLNLDSDSDEVEDVQREIQFLASLK 77

Query: 496 DQRRVIQLLDYEMGDGLLYLIME-CGDHDLSQILNQRSNMPLDFNFVRFYTKEMLLCIKV 554
               + +     + D  L++IME C    L  +L       +D  ++    +E+L+ +K 
Sbjct: 78  QIHNITRYYGSYLKDTSLWIIMEYCAGGSLRSLLRPGK---IDEKYIGVIMREVLVALKC 134

Query: 555 VHDAGIVHSDLKPANFVLV-KGILKIIDFGIANAVPEHTVNIYRETQIGTPNYMAPEALV 613
           +H   ++H D+K AN ++  +G +K+ DFG+A  V  +  ++ R+T  GTP +MAPE ++
Sbjct: 135 IHKDNVIHRDIKAANVLITNEGNVKLCDFGVAAQV--NQTSLRRQTMAGTPYWMAPEVIM 192

Query: 614 AMNYTQSSDNQHEGNKWKVGRPSDMWSCGCIIYQMIYGKPPYGSFQGQNRLLAIMNPDVK 673
              Y  +          KV    D+WS G   Y++  G PPY   +    +  I+    K
Sbjct: 193 EGVYYDT----------KV----DIWSLGITTYEIATGNPPYCEVEALRAMQLII--KSK 236

Query: 674 IPFPEYTSNNEKIPKSAIELMKACLYRNPDKRWTVDKVLSSTFLQPFMIS-GSIMEDLI 731
            P  E  S +     S  E +  CL  +P +R + D +L S F++    +  SI+++LI
Sbjct: 237 PPRLEGRSYS----PSLKEFIALCLDEDPKERLSADDLLKSKFIKNHKTTPTSILKELI 291

>TDEL0B01540 Chr2 complement(272561..273458,273562..273578) [915 bp,
           304 aa] {ON} Anc_8.482 YPL031C
          Length = 304

 Score = 97.8 bits (242), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 86/316 (27%), Positives = 148/316 (46%), Gaps = 54/316 (17%)

Query: 439 SQYEKIELLGRGGSSRVYKVKGSGNKIY-ALKRXXXXXXXXXXXXGFKGEIELLEKLKDQ 497
           SQ++++E LG G  + VYK       +Y ALK               + EI L+++LK +
Sbjct: 5   SQFKQLEKLGNGTYATVYKGLNKTTGVYVALKEVKLDSEEGTPSTAIR-EISLMKELKHE 63

Query: 498 RRVIQLLDYEMGDGLLYLIMECGDHDLSQILNQRS--NMP--LDFNFVRFYTKEMLLCIK 553
             +++L D    +  L L+ E  D+DL + ++ R+  N P  L+ + V+++  ++L  + 
Sbjct: 64  N-IVRLYDVIHTENKLTLVFEYMDNDLKKYMDSRTVGNNPQGLELSLVKYFHWQLLEGVS 122

Query: 554 VVHDAGIVHSDLKPANFVLV-KGILKIIDFGIANA--VPEHTVNIYRETQIGTPNYMAPE 610
             H++ I+H DLKP N ++  KG LK+ DFG+A A  +P +T +    +++ T  Y AP+
Sbjct: 123 FCHESKILHRDLKPQNLLINNKGQLKLGDFGLARAFGIPVNTFS----SEVVTLWYRAPD 178

Query: 611 ALVAMNYTQSSDNQHEGNKWKVGRPSDMWSCGCIIYQMIYGKPPYGSFQGQNRLLAIM-- 668
            L+      +S               DMWSCGCI+ +MI GKP +     + +L  I   
Sbjct: 179 VLMGSRTYSTS--------------IDMWSCGCILAEMITGKPLFPGTNDEEQLKLIFEI 224

Query: 669 --NPDVKI-----PFPEYTSN-NEKIPK----------------SAIELMKACLYRNPDK 704
              P+          P+Y  N ++K+P+                + I L+   L  NPD 
Sbjct: 225 MGTPNESTWSGVSSLPKYNPNFSQKLPRDLRTILQPHTKEPLDDNLINLLHGLLQLNPDM 284

Query: 705 RWTVDKVLSSTFLQPF 720
           R +  + L   +   +
Sbjct: 285 RLSAKQALHHPWFAEY 300

>Skud_16.251 Chr16 complement(457106..458006,458108..458124) [918
           bp, 305 aa] {ON} YPL031C (REAL)
          Length = 305

 Score = 97.4 bits (241), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 72/241 (29%), Positives = 124/241 (51%), Gaps = 28/241 (11%)

Query: 437 NDSQYEKIELLGRGGSSRVYKVKGSGNKIY-ALKRXXXXXXXXXXXXGFKGEIELLEKLK 495
           + SQ++++E LG G  + VYK       +Y ALK               + EI L+++LK
Sbjct: 3   SSSQFKQLEKLGNGTYATVYKGLNKTTGVYVALKEVKLDSEEGTPSTAIR-EISLMKELK 61

Query: 496 DQRRVIQLLDYEMGDGLLYLIMECGDHDLSQILNQRS--NMP--LDFNFVRFYTKEMLLC 551
            +  +++L D    +  L L+ E  D+DL + ++ R+  N P  L+ N V+++  ++L  
Sbjct: 62  HEN-IVRLYDVIHTENKLTLVFEFMDNDLKKYMDSRTVGNTPRGLELNLVKYFQWQLLQG 120

Query: 552 IKVVHDAGIVHSDLKPANFVL-VKGILKIIDFGIANA--VPEHTVNIYRETQIGTPNYMA 608
           +   H++ I+H DLKP N ++  KG LK+ DFG+A A  +P +T +    +++ T  Y A
Sbjct: 121 LAFCHESKILHRDLKPQNLLINKKGQLKLGDFGLARAFGIPVNTFS----SEVVTLWYRA 176

Query: 609 PEALVAMNYTQSSDNQHEGNKWKVGRPSDMWSCGCIIYQMIYGKPPYGSFQGQNRLLAIM 668
           P+ L+      +S               D+WSCGCI+ +MI GKP +     + +L  I 
Sbjct: 177 PDVLMGSRTYSTS--------------IDIWSCGCILAEMITGKPLFPGTNDEEQLKLIF 222

Query: 669 N 669
           +
Sbjct: 223 D 223

>KNAG0A02310 Chr1 complement(216545..217453) [909 bp, 302 aa] {ON}
           Anc_8.482 YPL031C
          Length = 302

 Score = 97.4 bits (241), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 86/317 (27%), Positives = 147/317 (46%), Gaps = 56/317 (17%)

Query: 439 SQYEKIELLGRGGSSRVYKVKGSGNKIY-ALKRXXXXXXXXXXXXGFKGEIELLEKLKDQ 497
           SQ++++E LG G  + VYK       +Y ALK               + EI L+++LK  
Sbjct: 5   SQFKQLEKLGNGTYATVYKGLNKTTGVYVALKEVKLDSEEGTPSTAIR-EISLMKELK-H 62

Query: 498 RRVIQLLDYEMGDGLLYLIMECGDHDLSQILNQR--SNMP--LDFNFVRFYTKEMLLCIK 553
             +++L D    +  L L+ E  D+DL + ++ R   N P  L+ + V+++  ++L  + 
Sbjct: 63  DNIVRLYDVIHTENKLTLVFEYMDNDLKKYMDSRIVGNTPRGLELHLVKYFQWQLLEGLA 122

Query: 554 VVHDAGIVHSDLKPANFVL-VKGILKIIDFGIANA--VPEHTVNIYRETQIGTPNYMAPE 610
             H+  I+H DLKP N ++  KG LK+ DFG+A A  +P +T +    +++ T  Y AP+
Sbjct: 123 FCHENKILHRDLKPQNLLINKKGQLKLGDFGLARAFGIPVNTFS----SEVVTLWYRAPD 178

Query: 611 ALVAMNYTQSSDNQHEGNKWKVGRPSDMWSCGCIIYQMIYGKPPYGSFQGQNRLLAIMN- 669
            L+      +S               D+WSCGCI+ +MI GKP +     + +L  I + 
Sbjct: 179 VLMGSRTYSTS--------------IDIWSCGCILAEMITGKPLFLGSNDEEQLKLIFDT 224

Query: 670 ---------PDVKIPFPEYTSN-NEKIPK----------------SAIELMKACLYRNPD 703
                    P V    P+Y +N  +++PK                + I+L+   L  NPD
Sbjct: 225 MGTPNEATWPGVT-SLPKYNANFQQRLPKDLKMILQPYCESPLDDTVIDLLHGLLQLNPD 283

Query: 704 KRWTVDKVLSSTFLQPF 720
            R +  + L   +   +
Sbjct: 284 MRLSAKQALHHPWFAEY 300

>Suva_13.163 Chr13 complement(259136..261253) [2118 bp, 705 aa] {ON}
           YMR001C (REAL)
          Length = 705

 Score =  101 bits (252), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 88/333 (26%), Positives = 152/333 (45%), Gaps = 38/333 (11%)

Query: 403 YHRPAPKPPVTKKVEIVEPAKSASSSNNRSMITVNDSQYEKIELLGRGGSSRVYKVKGSG 462
           +H+PA K    KK E +    SA      S+I      Y +   LG GG +R +++K   
Sbjct: 52  HHQPAQK----KKREKL----SALCKTPPSLIKTRGKDYHRGHFLGEGGFARCFQIKDDS 103

Query: 463 NKIYALKRXXXXX-XXXXXXXGFKGEIELLEKLKDQRRVIQLLDYEMGDGLLYLIME-CG 520
            +I+A K                  EI++ + +     ++Q +D    D  +Y+++E C 
Sbjct: 104 GEIFAAKTVAKASIKSEKTRKKLLSEIQIHKSMA-HPNIVQFVDCFEDDSNVYILLEICP 162

Query: 521 DHDLSQILNQRSNMPLDFNFVRFYTKEMLLCIKVVHDAGIVHSDLKPANFVLVKGI-LKI 579
           +  L ++L +R    L    VRF+T ++   IK +H   ++H DLK  N        LKI
Sbjct: 163 NGSLMELLKRRK--VLTEPEVRFFTTQICGAIKYMHSRRVIHRDLKLGNIFFDSNYNLKI 220

Query: 580 IDFGIANAVPEHTVNIYRETQIGTPNYMAPEALVAMNYTQSSDNQHEGNKWKVGRPSDMW 639
            DFG+A  +   +   Y  T  GTPNY+APE L+          +H G+ ++V    D+W
Sbjct: 221 GDFGLAAVLANESERKY--TICGTPNYIAPEVLMG---------KHSGHSFEV----DIW 265

Query: 640 SCGCIIYQMIYGKPPYGSFQGQNRLLAIMNPDVKIPFPEYTSNNEKIPKSAIELMKACLY 699
           S G ++Y ++ GKPP+ +         I   D   P  +  S+  KI      L++  L 
Sbjct: 266 SLGVMLYALLIGKPPFQARDVNTIYERIKCRDFSFPKDKPISDEGKI------LIRDILS 319

Query: 700 RNPDKRWTVDKVLSSTFLQ---PFMISGSIMED 729
            +P +R ++ +++   + +   P  I  ++M +
Sbjct: 320 LDPIERPSLTEIMDYVWFRGTFPPSIPSTVMSE 352

>Smik_4.789 Chr4 complement(1385209..1388619) [3411 bp, 1136 aa]
           {ON} YDR507C (REAL)
          Length = 1136

 Score =  102 bits (253), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 70/242 (28%), Positives = 124/242 (51%), Gaps = 30/242 (12%)

Query: 483 GFKGEIELLEKLKDQRRVIQLLDYEMGDGLLYLIMECGDH-DLSQILNQRSNMPLDFNFV 541
           G + EI ++ KL +   V++L D    +  LYL++E  +  +L  +L +R  +P +   +
Sbjct: 77  GIEREI-IIMKLLNHPNVLRLYDVWETNADLYLVLEYAEKGELFNLLVERGPLP-ENEAI 134

Query: 542 RFYTKEMLLCIKVVHDAGIVHSDLKPANFVL-VKGILKIIDFGIANAVPEHTVNIYRETQ 600
           RF+ +++++ +   H  GIVH DLKP N +L  K  +KI DFG+A    E  +    ET 
Sbjct: 135 RFF-RQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEGKL---LETS 190

Query: 601 IGTPNYMAPEALVAMNYTQSSDNQHEGNKWKVGRPSDMWSCGCIIYQMIYGKPPYGSFQG 660
            G+P+Y APE +  + Y               G  SD+WSCG I++ ++ G+ P+    G
Sbjct: 191 CGSPHYAAPEIVSGIPYQ--------------GFASDVWSCGVILFALLTGRLPFDEEDG 236

Query: 661 QNR--LLAIMNPDVKIPFPEYTSNNEKIPKSAIELMKACLYRNPDKRWTVDKVLSSTFLQ 718
             R  LL +   + ++P      ++++I + A +L+   L  +P++R     +L    LQ
Sbjct: 237 NIRTLLLKVQKGEFELP------SDDEISREAQDLISRILTVDPERRIKTRDILKHPLLQ 290

Query: 719 PF 720
            +
Sbjct: 291 KY 292

>Ecym_2531 Chr2 (1034031..1034047,1034135..1035023) [906 bp, 301 aa]
           {ON} similar to Ashbya gossypii AGL242C 1-intron
          Length = 301

 Score = 97.4 bits (241), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 86/316 (27%), Positives = 143/316 (45%), Gaps = 54/316 (17%)

Query: 439 SQYEKIELLGRGGSSRVYKVKGSGNKIY-ALKRXXXXXXXXXXXXGFKGEIELLEKLKDQ 497
           SQ++++E LG G  + VYK       +Y ALK               + EI L+++LK +
Sbjct: 5   SQFKQLEKLGNGTYATVYKGLNKTTGLYVALKEVKLDSEEGTPSTAIR-EISLMKELKHE 63

Query: 498 RRVIQLLDYEMGDGLLYLIMECGDHDLSQILNQRSN--MP--LDFNFVRFYTKEMLLCIK 553
             +++L D    +  L L+ E  D+DL + ++ R +  MP  L+ + V+++  ++L  + 
Sbjct: 64  N-IVRLYDVIHTENKLTLVFEFMDNDLKKFMDSRVDREMPRGLELSLVKYFQWQLLQGVA 122

Query: 554 VVHDAGIVHSDLKPANFVLV-KGILKIIDFGIANA--VPEHTVNIYRETQIGTPNYMAPE 610
             H+  I+H DLKP N ++  KG LK+ DFG+A A  +P +T +    +++ T  Y AP+
Sbjct: 123 FCHENRILHRDLKPQNLLINNKGQLKLGDFGLARAFGIPVNTFS----SEVVTLWYRAPD 178

Query: 611 ALVAMNYTQSSDNQHEGNKWKVGRPSDMWSCGCIIYQMIYGKPPYGSFQGQNRLLAIMN- 669
            L+      +S               D+WSCGCI+ +MI GK  +       +L  I   
Sbjct: 179 VLMGSRSYCTS--------------IDIWSCGCILAEMIMGKALFPGTNDDEQLKLIFET 224

Query: 670 ---------------PDVKIPFPEY----------TSNNEKIPKSAIELMKACLYRNPDK 704
                          PD     P Y           + NEKI    I L+   L  NPD 
Sbjct: 225 LGTPTEQMWPGASQLPDYNPQIPLYPPKDLKQLLQPTTNEKISDILISLLHGLLQLNPDM 284

Query: 705 RWTVDKVLSSTFLQPF 720
           R +  + L+  + + +
Sbjct: 285 RLSAQQALNHHWFEEY 300

>NCAS0C02470 Chr3 complement(460460..461378,461483..461499) [936 bp,
           311 aa] {ON} Anc_8.482
          Length = 311

 Score = 97.4 bits (241), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 87/319 (27%), Positives = 147/319 (46%), Gaps = 56/319 (17%)

Query: 437 NDSQYEKIELLGRGGSSRVYKVKGSGNKIY-ALKRXXXXXXXXXXXXGFKGEIELLEKLK 495
           + SQ++++E LG G  + VYK        Y ALK               + EI L+++LK
Sbjct: 3   SSSQFKQLEKLGNGTYATVYKGLNKTTGAYVALKEVKLDSEEGTPSTAIR-EISLMKELK 61

Query: 496 DQRRVIQLLDYEMGDGLLYLIMECGDHDLSQILNQRS--NMP--LDFNFVRFYTKEMLLC 551
            +  +++L D    +  L L+ E  D+DL + ++ R+  N P  L+ N V+++  ++L  
Sbjct: 62  HEN-IVRLYDVIHTENKLTLVFEYMDNDLKKYMDSRTVGNSPRGLELNLVKYFQWQLLEG 120

Query: 552 IKVVHDAGIVHSDLKPANFVL-VKGILKIIDFGIANA--VPEHTVNIYRETQIGTPNYMA 608
           +   H+  I+H DLKP N ++  KG LK+ DFG+A A  +P +T +    +++ T  Y A
Sbjct: 121 LAFCHENKILHRDLKPQNLLINKKGALKLGDFGLARAFGIPVNTFS----SEVVTLWYRA 176

Query: 609 PEALVAMNYTQSSDNQHEGNKWKVGRPSDMWSCGCIIYQMIYGKPPYGSFQGQNRLLAIM 668
           P+ L+      +S               D+WSCGCI+ +MI GKP +     + +L  I 
Sbjct: 177 PDVLMGSRTYSTS--------------IDIWSCGCILAEMITGKPLFPGSNDEEQLKLIF 222

Query: 669 N----------PDVKIPFPEYTSN-NEKIPK----------------SAIELMKACLYRN 701
                      P V    P+Y  N  +++PK                + I+L+   L  N
Sbjct: 223 ETMGTPTEATWPGVSA-LPKYNPNFPQRLPKDLRMVLQPYCKEPLDDNVIDLLHGLLQLN 281

Query: 702 PDKRWTVDKVLSSTFLQPF 720
           PD R +  + L   +   +
Sbjct: 282 PDMRLSAKQALHHPWFAEY 300

>Ecym_6145 Chr6 complement(266766..267863) [1098 bp, 365 aa] {ON}
           similar to Ashbya gossypii ACL191C
          Length = 365

 Score = 98.2 bits (243), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 85/324 (26%), Positives = 150/324 (46%), Gaps = 63/324 (19%)

Query: 439 SQYEKIELLGRGGSSRVYKV--KGSGNKIYALKRXXXXXXXXXXXXGFKGEIELLEKLKD 496
           S+Y+ ++L+G G    V     K +G K+ A+K+              + E++LL+    
Sbjct: 11  SRYKLVDLIGEGAYGTVCSAIHKPTGTKV-AIKKIQPFTRAMFVTRTLR-ELKLLKFFHS 68

Query: 497 QRRVIQLLD------YEMGDGLLYLIMECGDHDLSQILNQRSNMPLDFNFVRFYTKEMLL 550
              +I +LD      Y+  D + YL+ E  + DL +I++Q +N   D + ++++T ++L 
Sbjct: 69  HENIISVLDIVRPTSYQEFDAV-YLVQELMETDLQRIISQTNNFLSD-DHIQYFTYQILR 126

Query: 551 CIKVVHDAGIVHSDLKPANFVLVKGI-LKIIDFGIANAVP------EHTVNIYRETQIGT 603
            +K +H A ++H DLKP+N +L     LK+ DFG++  +       E+ V    E  + T
Sbjct: 127 ALKSLHSAQVIHRDLKPSNLLLNSSCDLKLCDFGLSRCLASSDRSRENMVGFMTE-YVAT 185

Query: 604 PNYMAPEALVAMN-YTQSSDNQHEGNKWKVGRPSDMWSCGCIIYQMIYGKPPYGSFQGQN 662
             Y APE +++   YT +                D+WSCGCI+ +MI GKP +      +
Sbjct: 186 RWYRAPEIMLSFQEYTTA---------------MDIWSCGCILAEMISGKPLFPGRDYHH 230

Query: 663 RLLAIM----NPD----------------------VKIPFPEYTSNNEKIPKSAIELMKA 696
           +L  I+     P                       +KIP+      N+  P  A++L+  
Sbjct: 231 QLWVILEILGTPSYEDFAQIKSKRAKAYILNLPMRLKIPWNVALGTNDINP-LAMDLLDK 289

Query: 697 CLYRNPDKRWTVDKVLSSTFLQPF 720
            L  NPDKR + ++ L   +L+ +
Sbjct: 290 MLTFNPDKRISAEEALKHPYLETY 313

>ZYRO0F08074g Chr6 (654009..654025,654107..655004) [915 bp, 304 aa]
           {ON} highly similar to uniprot|P17157 Saccharomyces
           cerevisiae YPL031C PHO85 Cyclin-dependent kinase with
           ten cyclin partners involved in environmental stress
           response in phosphate-rich conditions Pho85p-Pho80p
           complex phosphorylates Pho4p which in turn represses
           PHO5
          Length = 304

 Score = 96.7 bits (239), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 84/316 (26%), Positives = 143/316 (45%), Gaps = 54/316 (17%)

Query: 439 SQYEKIELLGRGGSSRVYKVKGSGNKIY-ALKRXXXXXXXXXXXXGFKGEIELLEKLKDQ 497
           SQ++++E LG G  + VYK       +Y ALK               + EI L+++LK  
Sbjct: 5   SQFKQLEKLGNGTYATVYKGLNKTTGVYVALKEVKLDSEEGTPSTAIR-EISLMKELK-H 62

Query: 498 RRVIQLLDYEMGDGLLYLIMECGDHDLSQILNQRS--NMP--LDFNFVRFYTKEMLLCIK 553
             V++L D    +  L L+ E  D+DL + ++ R+  N P  L+ N V+++  +++    
Sbjct: 63  DNVVRLYDVIHTENKLTLVFEYMDNDLKKYMDSRTVGNNPQGLELNLVKYFQWQLMEGAA 122

Query: 554 VVHDAGIVHSDLKPANFVLV-KGILKIIDFGIANA--VPEHTVNIYRETQIGTPNYMAPE 610
             H+  I+H DLKP N ++  KG LK+ DFG+A A  +P +T +    +++ T  Y AP+
Sbjct: 123 FCHENKILHRDLKPQNLLINNKGQLKLGDFGLARAFGIPVNTFS----SEVVTLWYRAPD 178

Query: 611 ALVAMNYTQSSDNQHEGNKWKVGRPSDMWSCGCIIYQMIYGKPPYGSFQGQNRLLAIMN- 669
            L+      +S               DMWSCGCI+ +M+ GKP +     + +L  I + 
Sbjct: 179 VLMGSRTYSTS--------------IDMWSCGCILAEMVTGKPLFPGTNDEEQLKLIFDI 224

Query: 670 ---------------PDVKIPFPE----------YTSNNEKIPKSAIELMKACLYRNPDK 704
                          P   + FP+             + E +  + I+L+   L  NPD 
Sbjct: 225 MGTPNESTWPGVSSLPKFNLNFPQKLPRDLRSILQVCSKEPLDDNLIDLLHGLLQLNPDM 284

Query: 705 RWTVDKVLSSTFLQPF 720
           R +  + L   +   +
Sbjct: 285 RLSAKQALHHPWFAEY 300

>Suva_2.687 Chr2 complement(1215095..1218481) [3387 bp, 1128 aa]
           {ON} YCL024W (REAL)
          Length = 1128

 Score =  101 bits (251), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 70/242 (28%), Positives = 124/242 (51%), Gaps = 30/242 (12%)

Query: 483 GFKGEIELLEKLKDQRRVIQLLDYEMGDGLLYLIMECGDH-DLSQILNQRSNMPLDFNFV 541
           G + EI ++ KL +   V++L D    +  LYL++E  +  +L  +L +R  +P +   +
Sbjct: 77  GIEREI-IIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLP-ENEAI 134

Query: 542 RFYTKEMLLCIKVVHDAGIVHSDLKPANFVLV-KGILKIIDFGIANAVPEHTVNIYRETQ 600
           RF+ +++++ +   H  GIVH DLKP N +L  K  +KI DFG+A    E  +    ET 
Sbjct: 135 RFF-RQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEGKL---LETS 190

Query: 601 IGTPNYMAPEALVAMNYTQSSDNQHEGNKWKVGRPSDMWSCGCIIYQMIYGKPPYGSFQG 660
            G+P+Y APE +  + Y               G  SD+WSCG I++ ++ G+ P+    G
Sbjct: 191 CGSPHYAAPEIVSGIPYQ--------------GFASDVWSCGVILFALLTGRLPFDEEDG 236

Query: 661 QNR--LLAIMNPDVKIPFPEYTSNNEKIPKSAIELMKACLYRNPDKRWTVDKVLSSTFLQ 718
             R  LL +   + ++P      ++++I + A +L+   L  +P++R     +L    LQ
Sbjct: 237 NIRALLLKVQKGEFELP------SDDEISREAQDLISKILTVDPERRIKARDILKHPLLQ 290

Query: 719 PF 720
            +
Sbjct: 291 KY 292

>KAFR0D04950 Chr4 (971956..974982) [3027 bp, 1008 aa] {ON} Anc_5.406
           YHR102W
          Length = 1008

 Score =  101 bits (251), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 78/298 (26%), Positives = 136/298 (45%), Gaps = 34/298 (11%)

Query: 440 QYEKIELLGRGGSSRVYKVKGSGNK-IYALKRXXXXXXXXXXXXGFKGEIELLEKLKDQR 498
           ++ +  ++GRG    VYK      K +YA+K               + EI+ L  LK   
Sbjct: 34  KFRRTNVIGRGKFGVVYKGYHLNTKHVYAIK-VLNLDSDEDEVEDVQKEIQFLASLKQLP 92

Query: 499 RVIQLLDYEMGDGLLYLIME-CGDHDLSQILNQRSNMPLDFNFVRFYTKEMLLCIKVVHD 557
            + +     + +  L++IME CG   L  +L       +D  ++    +E+L+ +K +H 
Sbjct: 93  NITRYYGSYLKNTSLWIIMEYCGGGSLRSLLRPGK---IDEKYIGVIMREILIALKYIHK 149

Query: 558 AGIVHSDLKPANFVLVK-GILKIIDFGIANAVPEHTVNIYRETQIGTPNYMAPEALVAMN 616
             ++H D+K AN ++   G +K+ DFG+A  +  +     R+T  GTP +MAPE ++   
Sbjct: 150 DNVIHRDIKAANVLINNDGSIKLCDFGVAAQL--NQTKSRRQTMAGTPYWMAPEVIMEGV 207

Query: 617 YTQSSDNQHEGNKWKVGRPSDMWSCGCIIYQMIYGKPPYGSFQGQNRLLAIMNPDVKIPF 676
           Y  +               +D+WS G   Y++  G PPY   +     L  M    K   
Sbjct: 208 YYDTK--------------ADIWSTGITAYEVTTGNPPYCDVEA----LRAMQLIAKSKP 249

Query: 677 PEYTSNNEKIPKSAI--ELMKACLYRNPDKRWTVDKVLSSTFLQPFM-ISGSIMEDLI 731
           P     N     SA+  E +  CL  +P +R T D++L + F++ +  +  SI+++LI
Sbjct: 250 PRLEGRN----YSALIKEFIATCLDEDPSERPTADELLKTAFIKTYKPLPTSILKELI 303

>Skud_4.764 Chr4 complement(1351725..1353995) [2271 bp, 756 aa] {ON}
           YDR490C (REAL)
          Length = 756

 Score =  100 bits (250), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 77/260 (29%), Positives = 123/260 (47%), Gaps = 50/260 (19%)

Query: 483 GFKGEIELLEKLKDQRRVIQLLDYEMGDGLLYLIMECGDHDLSQILNQRSNMPLDFNFVR 542
           G KG I L    +D+  +  LL+Y      L LI + G       LN++          R
Sbjct: 182 GTKGIIRLFFTFQDEASLYFLLEYASHGDFLGLIKKYGS------LNEKC--------AR 227

Query: 543 FYTKEMLLCIKVVHDAGIVHSDLKPANFVLVKGI-LKIIDFGIANAVPEHTVN------- 594
           +Y  +++  +  +H  GI+H D+KP N +L K + +K+ DFG A  +PE   N       
Sbjct: 228 YYASQIIDAVDSLHAIGIIHRDIKPENILLDKDMKVKLTDFGTAKILPEQPSNNADGKPC 287

Query: 595 --IYRETQ--IGTPNYMAPEALVAMNYTQSSDNQHEGNKWKVGRPSDMWSCGCIIYQMIY 650
             +Y  ++  +GT  Y++PE L+  +YT S                D+W+ GCI+YQM+ 
Sbjct: 288 FDLYARSKSFVGTAEYVSPE-LLNDSYTDSR--------------CDIWAFGCILYQMVA 332

Query: 651 GKPPYGSFQGQNRLLAIMNPDVKIPFPEYTSNNEKIPKSAIELMKACLYRNPDKRWTVDK 710
           GKPP   F+  N  L      +KI +  +T+     P  A +L+K  L R P+ R TV++
Sbjct: 333 GKPP---FKAANEYLTFQKV-MKIQY-AFTAG---FPLIAKDLVKKLLVREPNDRLTVEQ 384

Query: 711 VLSSTFLQPFMIS-GSIMED 729
           + +  F        GS+ +D
Sbjct: 385 IKAHVFFHGVHFEDGSVWDD 404

>SAKL0B04488g Chr2 (395136..396242) [1107 bp, 368 aa] {ON} highly
           similar to uniprot|P14681 Saccharomyces cerevisiae
           YGR040W KSS1 Mitogen-activated protein kinase (MAPK)
           involved in signal transduction pathways that control
           filamentous growth and pheromone response
          Length = 368

 Score = 97.8 bits (242), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 84/324 (25%), Positives = 140/324 (43%), Gaps = 60/324 (18%)

Query: 439 SQYEKIELLGRGGSSRVYKV--KGSGNKIYALKRXXXXXXXXXXXXGFKGEIELLEKLKD 496
           + Y+ ++L+G G    V     K SG K+ A+K+              + E++LL+   D
Sbjct: 11  AHYQLVDLIGEGAYGTVCSAVHKPSGTKV-AIKKIQPFSKPLFVTRTLR-ELKLLKFFHD 68

Query: 497 QRRVIQLLDYEMGDGL-----LYLIMECGDHDLSQIL---NQRSNMPLDFNFVRFYTKEM 548
              +I +LD      L     +YL+ E  + DL +I+   N  S  PL  + ++++  +M
Sbjct: 69  HENIISVLDIVRPTSLAKFDAVYLVQELMETDLHRIIANSNGHSGTPLSDDHIQYFVYQM 128

Query: 549 LLCIKVVHDAGIVHSDLKPANFVLVKGI-LKIIDFGIANAVP------EHTVNIYRETQI 601
           L  +K +H A ++H DLKP+N +L     LK+ DFG+A  +       E+ V    E  +
Sbjct: 129 LRALKAMHSAQVIHRDLKPSNLLLNSNCDLKVCDFGLARCLASSSNSRENLVGFMTE-YV 187

Query: 602 GTPNYMAPEALVAMN-YTQSSDNQHEGNKWKVGRPSDMWSCGCIIYQMIYGKPPYGSFQG 660
            T  Y APE ++    YT +                D+WSCGCI+ +MI GKP +     
Sbjct: 188 ATRWYRAPEIMLTFQEYTTA---------------MDIWSCGCILAEMITGKPLFPGRDY 232

Query: 661 QNRLLAIM------------------------NPDVKIPFPEYTSNNEKIPKSAIELMKA 696
            ++L  I+                        N  ++   P      + +   AI+L+  
Sbjct: 233 HHQLWLILEVLGTPSYQDFEQIKSKRAKEYIANLPLRPRVPWKIVLGQHVNPDAIDLLDK 292

Query: 697 CLYRNPDKRWTVDKVLSSTFLQPF 720
            L  NPDKR    + L   +L+ +
Sbjct: 293 MLTFNPDKRIGASEALKHPYLKVY 316

>Suva_16.286 Chr16 complement(495354..496254,496351..496367) [918
           bp, 305 aa] {ON} YPL031C (REAL)
          Length = 305

 Score = 96.7 bits (239), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 72/241 (29%), Positives = 123/241 (51%), Gaps = 28/241 (11%)

Query: 437 NDSQYEKIELLGRGGSSRVYKVKGSGNKIY-ALKRXXXXXXXXXXXXGFKGEIELLEKLK 495
           + SQ++++E LG G  + VYK       +Y ALK               + EI L+++LK
Sbjct: 3   SSSQFKQLEKLGNGTYATVYKGLNKTTGVYVALKEVKLDSEEGTPSTAIR-EISLMKELK 61

Query: 496 DQRRVIQLLDYEMGDGLLYLIMECGDHDLSQILNQRS--NMP--LDFNFVRFYTKEMLLC 551
            +  +++L D    +  L L+ E  D+DL + ++ R+  N P  L+ N V+++  ++L  
Sbjct: 62  HEN-IVRLYDVIHTENKLTLVFEFMDNDLKKYMDSRTVGNTPRGLELNLVKYFQWQLLQG 120

Query: 552 IKVVHDAGIVHSDLKPANFVL-VKGILKIIDFGIANA--VPEHTVNIYRETQIGTPNYMA 608
           +   H+  I+H DLKP N ++  KG LK+ DFG+A A  +P +T +    +++ T  Y A
Sbjct: 121 LAFCHENKILHRDLKPQNLLINKKGQLKLGDFGLARAFGIPVNTFS----SEVVTLWYRA 176

Query: 609 PEALVAMNYTQSSDNQHEGNKWKVGRPSDMWSCGCIIYQMIYGKPPYGSFQGQNRLLAIM 668
           P+ L+      +S               D+WSCGCI+ +MI GKP +     + +L  I 
Sbjct: 177 PDVLMGSRTYSTS--------------IDIWSCGCILAEMITGKPLFPGTNDEEQLKLIF 222

Query: 669 N 669
           +
Sbjct: 223 D 223

>KLTH0E11220g Chr5 (1005953..1005969,1006040..1006931) [909 bp, 302
           aa] {ON} highly similar to uniprot|P17157 Saccharomyces
           cerevisiae YPL031C PHO85 Cyclin-dependent kinase with
           ten cyclin partners involved in environmental stress
           response in phosphate-rich conditions Pho85p-Pho80p
           complex phosphorylates Pho4p which in turn represses
           PHO5
          Length = 302

 Score = 96.3 bits (238), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 85/320 (26%), Positives = 146/320 (45%), Gaps = 56/320 (17%)

Query: 436 VNDSQYEKIELLGRGGSSRVYKVKGSGNKIY-ALKRXXXXXXXXXXXXGFKGEIELLEKL 494
            + SQ++++E LG G  + VYK       IY ALK               + EI L+++L
Sbjct: 2   ASSSQFKQLEKLGNGTYATVYKGLNKTTGIYVALKEVKLDSEEGTPSTAVR-EISLMKEL 60

Query: 495 KDQRRVIQLLDYEMGDGLLYLIMECGDHDLSQILNQR--SNMPLDF--NFVRFYTKEMLL 550
           K +  +++L D    +  L L+ E  D+DL + ++ R   N P  F  + V+++  ++L 
Sbjct: 61  KHEN-IVRLYDVIHTENKLTLVFEFMDNDLKKYMDSRIVGNTPYGFEMSLVKYFEWQLLQ 119

Query: 551 CIKVVHDAGIVHSDLKPANFVLV-KGILKIIDFGIANA--VPEHTVNIYRETQIGTPNYM 607
            +   H+  I+H DLKP N ++  KG LK+ DFG+A A  +P +T +    +++ T  Y 
Sbjct: 120 GVAFCHENRILHRDLKPQNLLINNKGQLKLGDFGLARAFGIPVNTFS----SEVVTLWYR 175

Query: 608 APEALVAMNYTQSSDNQHEGNKWKVGRPSDMWSCGCIIYQMIYGKPPYGSFQGQNRLLAI 667
           AP+ L+      +S               D+WSCGCI+ +MI G+P +     + +L  I
Sbjct: 176 APDVLMGSRTYSTS--------------IDIWSCGCILAEMITGRPLFPGTNDEEQLKLI 221

Query: 668 MN----------PDVKIPFPEY-----------------TSNNEKIPKSAIELMKACLYR 700
                       P V    P+Y                 +   EK+  + I+L+   L  
Sbjct: 222 FETMGTPTERTWPGVST-LPKYNPRLPQHLPKDLGALLQSQTREKMELTLIDLLYGLLQL 280

Query: 701 NPDKRWTVDKVLSSTFLQPF 720
           NPD+R +  + L+  +   +
Sbjct: 281 NPDRRLSAKQALNHPWFAEY 300

>KLLA0D11990g Chr4 complement(1022895..1023792,1023928..1023944)
           [915 bp, 304 aa] {ON} highly similar to uniprot|P17157
           Saccharomyces cerevisiae YPL031C PHO85 Cyclin-dependent
           kinase with ten cyclin partners involved in
           environmental stress response in phosphate-rich
           conditions Pho85p-Pho80p complex phosphorylates Pho4p
           which in turn represses PHO5
          Length = 304

 Score = 96.3 bits (238), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 85/320 (26%), Positives = 148/320 (46%), Gaps = 56/320 (17%)

Query: 436 VNDSQYEKIELLGRGGSSRVYKVKGSGNKIY-ALKRXXXXXXXXXXXXGFKGEIELLEKL 494
           V  SQ++++E +G G  + VYK       +Y ALK               + EI L+++L
Sbjct: 2   VAPSQFKQLEKVGNGTYATVYKGLNKTTGVYVALKEVKLDSEEGTPSTAIR-EISLMKEL 60

Query: 495 KDQRRVIQLLDYEMGDGLLYLIMECGDHDLSQILNQR----SNMPLDFNFVRFYTKEMLL 550
           K    +++L D    +  L L+ E  D+DL + ++ R    S+  L+ + V+++  ++L 
Sbjct: 61  K-HDNIVRLFDVIHTENKLTLVFEFMDNDLKKFMDNRNKGNSHKGLEMDLVKYFQWQLLQ 119

Query: 551 CIKVVHDAGIVHSDLKPANFVLV-KGILKIIDFGIANA--VPEHTVNIYRETQIGTPNYM 607
            +   H+  I+H DLKP N ++  +G LK+ DFG+A A  +P +T +    +++ T  Y 
Sbjct: 120 GVAFCHENRILHRDLKPQNLLINNRGQLKLGDFGLARAFGIPVNTFS----SEVVTLWYR 175

Query: 608 APEALV-AMNYTQSSDNQHEGNKWKVGRPSDMWSCGCIIYQMIYGKPPYGSFQGQNRLLA 666
           AP+ L+ + NY  S D               +WSCGCI+ +MI GKP +     + +L  
Sbjct: 176 APDVLMGSRNYCTSID---------------IWSCGCILAEMIMGKPLFPGSNDEEQLKL 220

Query: 667 I---MNPDVKIPFPEYT---------------------SNN--EKIPKSAIELMKACLYR 700
           I   M   V+  +P+ T                      NN  E +  + ++L+   L  
Sbjct: 221 IFDTMGTPVEQTWPQVTQLAKYNPLLPPHMPRDLKQLLQNNTEEVLDDNVVDLLHGLLQL 280

Query: 701 NPDKRWTVDKVLSSTFLQPF 720
           NPD R +    L+  +   +
Sbjct: 281 NPDARLSAKDALNHPWFAEY 300

>YPL031C Chr16 complement(492018..492918,493021..493037) [918 bp,
           305 aa] {ON}  PHO85Cyclin-dependent kinase, with ten
           cyclin partners; involved in regulating the cellular
           response to nutrient levels and environmental conditions
           and progression through the cell cycle
          Length = 305

 Score = 96.3 bits (238), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 84/319 (26%), Positives = 146/319 (45%), Gaps = 56/319 (17%)

Query: 437 NDSQYEKIELLGRGGSSRVYKVKGSGNKIY-ALKRXXXXXXXXXXXXGFKGEIELLEKLK 495
           + SQ++++E LG G  + VYK       +Y ALK               + EI L+++LK
Sbjct: 3   SSSQFKQLEKLGNGTYATVYKGLNKTTGVYVALKEVKLDSEEGTPSTAIR-EISLMKELK 61

Query: 496 DQRRVIQLLDYEMGDGLLYLIMECGDHDLSQILNQRS--NMP--LDFNFVRFYTKEMLLC 551
            +  +++L D    +  L L+ E  D+DL + ++ R+  N P  L+ N V+++  ++L  
Sbjct: 62  HEN-IVRLYDVIHTENKLTLVFEFMDNDLKKYMDSRTVGNTPRGLELNLVKYFQWQLLQG 120

Query: 552 IKVVHDAGIVHSDLKPANFVLVK-GILKIIDFGIANA--VPEHTVNIYRETQIGTPNYMA 608
           +   H+  I+H DLKP N ++ K G LK+ DFG+A A  +P +T +    +++ T  Y A
Sbjct: 121 LAFCHENKILHRDLKPQNLLINKRGQLKLGDFGLARAFGIPVNTFS----SEVVTLWYRA 176

Query: 609 PEALVAMNYTQSSDNQHEGNKWKVGRPSDMWSCGCIIYQMIYGKPPYGSFQGQNRLLAIM 668
           P+ L+      +S               D+WSCGCI+ +MI GKP +     + +L  I 
Sbjct: 177 PDVLMGSRTYSTS--------------IDIWSCGCILAEMITGKPLFPGTNDEEQLKLIF 222

Query: 669 N----------PDVKIPFPEYTSNNEKIP-----------------KSAIELMKACLYRN 701
           +          P V    P+Y  N ++ P                  + ++ +   L  N
Sbjct: 223 DIMGTPNESLWPSVT-KLPKYNPNIQQRPPRDLRQVLQPHTKEPLDGNLMDFLHGLLQLN 281

Query: 702 PDKRWTVDKVLSSTFLQPF 720
           PD R +  + L   +   +
Sbjct: 282 PDMRLSAKQALHHPWFAEY 300

>SAKL0C01716g Chr3 (143880..147527) [3648 bp, 1215 aa] {ON} similar
           to uniprot|Q12263 Saccharomyces cerevisiae YDR507C
          Length = 1215

 Score =  100 bits (250), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 73/242 (30%), Positives = 123/242 (50%), Gaps = 30/242 (12%)

Query: 483 GFKGEIELLEKLKDQRRVIQLLDYEMGDGLLYLIMECGDH-DLSQILNQRSNMPLDFNFV 541
           G + EI ++ KL +   V++L D       LY+++E  +  +L  +L +R  +P +   V
Sbjct: 85  GIEREI-IIMKLLNHTNVLRLYDVWETKSNLYMVLEYVEKGELFNLLVERGPLP-ENEAV 142

Query: 542 RFYTKEMLLCIKVVHDAGIVHSDLKPANFVLV-KGILKIIDFGIANAVPEHTVNIYRETQ 600
           RF+ +++++ I   H  GIVH DLKP N +L  K  +KI DFG+A      + +   ET 
Sbjct: 143 RFF-RQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAAL---ESKDKLLETS 198

Query: 601 IGTPNYMAPEALVAMNYTQSSDNQHEGNKWKVGRPSDMWSCGCIIYQMIYGKPPYGSFQG 660
            G+P+Y APE +  + Y               G  SD+WSCG I+Y ++ G+ P+    G
Sbjct: 199 CGSPHYAAPEIVSGLPYH--------------GFESDVWSCGVILYALLTGRLPFDEDNG 244

Query: 661 QNR--LLAIMNPDVKIPFPEYTSNNEKIPKSAIELMKACLYRNPDKRWTVDKVLSSTFLQ 718
             R  LL + + + ++P       N++I   A +L+   L  +PD+R    ++L    LQ
Sbjct: 245 NIRSLLLKVQSGEYEMP------GNDEISSEAQDLIAKILTVDPDRRIKTREILKHPLLQ 298

Query: 719 PF 720
            +
Sbjct: 299 KY 300

>NDAI0A00660 Chr1 (121773..124841) [3069 bp, 1022 aa] {ON} Anc_1.52
          Length = 1022

 Score =  100 bits (249), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 71/242 (29%), Positives = 124/242 (51%), Gaps = 30/242 (12%)

Query: 483 GFKGEIELLEKLKDQRRVIQLLDYEMGDGLLYLIMECGDH-DLSQILNQRSNMPLDFNFV 541
           G + EI ++ KL     V+ L D    +  LY+I+E  +  +L  +L +R  +P +   +
Sbjct: 76  GIEREI-IIMKLLRHPNVLSLYDVWETNSKLYMILEYAEKGELFNLLVERGPLP-EKEAI 133

Query: 542 RFYTKEMLLCIKVVHDAGIVHSDLKPANFVLVKGI-LKIIDFGIANAVPEHTVNIYRETQ 600
           RF+ +++++ I   H  GIVH DLKP N +L   + +KI DFG+A      T +   ET 
Sbjct: 134 RFF-RQIIIGISYCHALGIVHRDLKPENLLLDHKLNIKIADFGMAAL---ETKDKMLETS 189

Query: 601 IGTPNYMAPEALVAMNYTQSSDNQHEGNKWKVGRPSDMWSCGCIIYQMIYGKPPYGSFQG 660
            G+P+Y APE +  + Y               G  SD+WSCG I++ ++ G+ P+    G
Sbjct: 190 CGSPHYAAPEIVSGVPYH--------------GFQSDVWSCGVILFALLTGRLPFDEEDG 235

Query: 661 --QNRLLAIMNPDVKIPFPEYTSNNEKIPKSAIELMKACLYRNPDKRWTVDKVLSSTFLQ 718
             +N LL + + + ++P      ++++I K A +L+   L  +P++R     +L    LQ
Sbjct: 236 NIRNLLLKVQSGEYEMP------DDDEISKEAQDLIGRILTVDPEQRIKTRDILKHPLLQ 289

Query: 719 PF 720
            +
Sbjct: 290 KY 291

>YDR490C Chr4 complement(1431968..1434268) [2301 bp, 766 aa] {ON}
           PKH1Serine/threonine protein kinase involved in
           sphingolipid-mediated signaling pathway that controls
           endocytosis; activates Ypk1p and Ykr2p, components of
           signaling cascade required for maintenance of cell wall
           integrity; redundant with Pkh2p
          Length = 766

 Score =  100 bits (248), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 87/330 (26%), Positives = 155/330 (46%), Gaps = 46/330 (13%)

Query: 417 EIVEPAKSASSSNNRSMITVNDSQYEKIELLGRGGSSRVY--KVKGSGNKIYALKRXXXX 474
           ++V+PA   +    + ++ +    ++  E LG G  S V     + SG K YA+K     
Sbjct: 104 DVVDPA---TGELTKHVVKMGIKDFKFGEQLGDGSYSSVVLATARDSGKK-YAVKVLSKE 159

Query: 475 XXXXXXXXGFKGEIEL-LEKLKDQRRVIQLLDYEMGDGLLYLIMECGDH-DLSQILNQRS 532
                    +    +L L+KL   + + +L      +  LY ++E   H D   ++ +  
Sbjct: 160 YLIRQKKVKYVTVEKLALQKLNGTKGIFKLFFTFQDEASLYFLLEYAPHGDFLGLIKKYG 219

Query: 533 NMPLDFNFVRFYTKEMLLCIKVVHDAGIVHSDLKPANFVLVKGI-LKIIDFGIANAVPEH 591
           +  L+    R+Y  +++  +  +H+ GI+H D+KP N +L K + +K+ DFG A  +PE 
Sbjct: 220 S--LNETCARYYASQIIDAVDSLHNIGIIHRDIKPENILLDKNMKVKLTDFGTAKILPEE 277

Query: 592 TVN---------IYRETQ--IGTPNYMAPEALVAMNYTQSSDNQHEGNKWKVGRPSDMWS 640
             N         +Y +++  +GT  Y++PE L+  NYT S                D+W+
Sbjct: 278 PSNTADGKPYFDLYAKSKSFVGTAEYVSPE-LLNDNYTDSR--------------CDIWA 322

Query: 641 CGCIIYQMIYGKPPYGSFQGQNRLLAIMNPDVKIPFPEYTSNNEKIPKSAIELMKACLYR 700
            GCI+YQM+ GKPP   F+  N  L      +KI +  +T+     P+   +L+K  L R
Sbjct: 323 FGCILYQMLAGKPP---FKAANEYLTFQKV-MKIQY-AFTAG---FPQIVKDLVKKLLVR 374

Query: 701 NPDKRWTVDKVLSSTFLQPFMIS-GSIMED 729
           +P+ R T+ ++ +  F        GS+ +D
Sbjct: 375 DPNDRLTIKQIKAHLFFHEVNFEDGSVWDD 404

>TBLA0A03570 Chr1 (892930..895857) [2928 bp, 975 aa] {ON} Anc_5.406
           YHR102W
          Length = 975

 Score =  100 bits (248), Expect = 7e-21,   Method: Compositional matrix adjust.
 Identities = 77/298 (25%), Positives = 140/298 (46%), Gaps = 35/298 (11%)

Query: 441 YEKIELLGRGGSSRVYK---VKGSGNKIYALKRXXXXXXXXXXXXGFKGEIELLEKLKDQ 497
           + + E++GRG    VYK   +K  G  +YA+K               + EI+ L  LK  
Sbjct: 42  FRRTEIIGRGKFGVVYKGYHMKTKG--VYAIK-VLSLESDLDEVADIQREIQFLVSLKQV 98

Query: 498 RRVIQLLDYEMGDGLLYLIME-CGDHDLSQILNQRSNMPLDFNFVRFYTKEMLLCIKVVH 556
             + +     + D  L++IME C    +  +L       +D  ++    +E+L+ +  +H
Sbjct: 99  PNITRYYASYLKDTSLWIIMEYCAGGSVRTLLRPGK---IDEKYIAVIMRELLVALHYIH 155

Query: 557 DAGIVHSDLKPANFVLV-KGILKIIDFGIANAVPEHTVNIYRETQIGTPNYMAPEALVAM 615
              ++H D+K AN ++  +G +K+ DFG+A  + ++T  + R+T  GTP +MAPE ++  
Sbjct: 156 KDNVIHRDIKAANLLITNEGNVKLCDFGVAAQLNQNT--MRRQTMAGTPYWMAPEVIM-- 211

Query: 616 NYTQSSDNQHEGNKWKVGRPSDMWSCGCIIYQMIYGKPPYGSFQGQNRLLAIMNPDVKIP 675
                     EG  +     +D+WS G   Y++  G PP+   +    +  I       P
Sbjct: 212 ----------EGISYDTK--ADIWSVGITAYEIATGNPPFCEMEALRAMQVISKSK---P 256

Query: 676 FPEYTSNNEKIPKSAIELMKACLYRNPDKRWTVDKVL-SSTFLQPFM-ISGSIMEDLI 731
                 N++ + K   E +  CL  +P +R T DK+L  S F++ +     S++++LI
Sbjct: 257 ARLEGKNHDPLLK---EFIAMCLDEDPQERPTADKLLHESAFIKHYKNTHTSVLKELI 311

>NCAS0D02100 Chr4 (385878..388058) [2181 bp, 726 aa] {ON} Anc_6.31
          Length = 726

 Score = 99.8 bits (247), Expect = 8e-21,   Method: Compositional matrix adjust.
 Identities = 66/227 (29%), Positives = 110/227 (48%), Gaps = 21/227 (9%)

Query: 432 SMITVNDSQYEKIELLGRGGSSRVYKVKGSGNKIYALKRXXX-XXXXXXXXXGFKGEIEL 490
           S+I      Y +   LG GG +R +++K    KI+A K                  EI++
Sbjct: 83  SLIKTRGRDYRRGHFLGEGGFARCFQIKDESGKIFAAKTVAKISIKTEKTKKKLLSEIQI 142

Query: 491 LEKLKDQRRVIQLLDYEMGDGLLYLIME-CGDHDLSQILNQRSNMPLDFNFVRFYTKEML 549
            + +K    ++  +D    D  +Y+++E C +  L  ++ +R    L    VRF+T ++ 
Sbjct: 143 HKSMK-HPNIVHFVDCFEDDTNVYILLEICSNGSLMDLMKKRKT--LTEPEVRFFTTQIC 199

Query: 550 LCIKVVHDAGIVHSDLKPANFVLVKGI-LKIIDFGIANAVPEHTVNIYRETQIGTPNYMA 608
             +K +H   ++H DLK  N    K   LK+ DFG+A  +  +    Y  T  GTPNY+A
Sbjct: 200 GAVKYMHSRRVIHRDLKLGNIFFDKDYNLKVGDFGLAAVLANNRERKY--TVCGTPNYIA 257

Query: 609 PEALVAMNYTQSSDNQHEGNKWKVGRPSDMWSCGCIIYQMIYGKPPY 655
           PE L+          +H G+ ++V    D+WS G +IY ++ GKPP+
Sbjct: 258 PEVLMG---------KHAGHSFEV----DIWSIGVMIYALLVGKPPF 291

>Smik_2.146 Chr2 complement(275270..276850) [1581 bp, 526 aa] {ON}
           YBR028C (REAL)
          Length = 526

 Score = 98.6 bits (244), Expect = 8e-21,   Method: Compositional matrix adjust.
 Identities = 78/246 (31%), Positives = 108/246 (43%), Gaps = 62/246 (25%)

Query: 488 IELLEKLKDQRRVIQLLDYEMGDGLLYLIMECGDHDLSQILNQRSNMPLDFNFVRFYTKE 547
           ++L     D  ++  LL Y  G  L Y + E G               LD   V FY  E
Sbjct: 216 VKLFYSFHDNSKLYLLLQYIPGGELFYHLKEHGT--------------LDETTVSFYAAE 261

Query: 548 MLLCIKVVHDAGIVHSDLKPANFVL-VKGILKIIDFGIANAV----------PEHTVNIY 596
           +   ++ +H  G+V+ DLKP N +L  +G L + DFG++             PE+   +Y
Sbjct: 262 ISCALRFLHTKGVVYRDLKPENCLLNQRGHLVLTDFGLSKKSANDSVVDEEDPENVNALY 321

Query: 597 RETQIGTPNYMAPEALVAMNYTQSSDNQHEGNKWKVGRPSDMWSCGCIIYQMIYGKPPYG 656
             + IGTP Y APE L+   YTQ+ D       W        +S GC++Y M+ GKPPY 
Sbjct: 322 --SIIGTPEYCAPEILLGRAYTQNCD-------W--------YSLGCLLYDMLVGKPPY- 363

Query: 657 SFQGQNRLLAI-------MNPDVKIPFPEYTSNNEKIPKSAIELMKACLYRNPDKRWTVD 709
              G N  + I         P  KIPF  Y S   K      +++ A L R   KRW VD
Sbjct: 364 --TGSNHKVIINKIQQNKQGP--KIPF--YLSEGMK------DILNALLKRETSKRWNVD 411

Query: 710 KVLSST 715
           K  + T
Sbjct: 412 KYWTKT 417

>SAKL0H11638g Chr8 complement(994049..994946,995016..995032) [915
           bp, 304 aa] {ON} highly similar to uniprot|P17157
           Saccharomyces cerevisiae YPL031C PHO85 Cyclin-dependent
           kinase with ten cyclin partners involved in
           environmental stress response in phosphate-rich
           conditions Pho85p-Pho80p complex phosphorylates Pho4p
           which in turn represses PHO5
          Length = 304

 Score = 95.5 bits (236), Expect = 9e-21,   Method: Compositional matrix adjust.
 Identities = 82/319 (25%), Positives = 145/319 (45%), Gaps = 54/319 (16%)

Query: 436 VNDSQYEKIELLGRGGSSRVYKVKGSGNKIY-ALKRXXXXXXXXXXXXGFKGEIELLEKL 494
            + SQ++++E LG G  + VYK       +Y ALK               + EI L+++L
Sbjct: 2   ASSSQFKQLEKLGNGTYATVYKGLNKTTGVYVALKEVKLDSEEGTPSTAIR-EISLMKEL 60

Query: 495 KDQRRVIQLLDYEMGDGLLYLIMECGDHDLSQILNQRS--NMP--LDFNFVRFYTKEMLL 550
           K +  +++L D    +  L L+ E  D+DL + ++ R+  N P  L    V+++  ++L 
Sbjct: 61  KHEN-IVRLYDVIHTENKLTLVFEFMDNDLKKYMDSRAVGNTPQGLALPLVKYFEWQLLQ 119

Query: 551 CIKVVHDAGIVHSDLKPANFVLV-KGILKIIDFGIANA--VPEHTVNIYRETQIGTPNYM 607
            +   H+  I+H DLKP N ++  KG LK+ DFG+A A  +P +T +    +++ T  Y 
Sbjct: 120 GVAFCHENRILHRDLKPQNLLINNKGQLKLGDFGLARAFGIPVNTFS----SEVVTLWYR 175

Query: 608 APEALVAMNYTQSSDNQHEGNKWKVGRPSDMWSCGCIIYQMIYGKPPYGSFQGQNRLLAI 667
           AP+ L+      +S               D+WSCGCI+ +MI GKP +     + +L  I
Sbjct: 176 APDVLMGSRTYSTS--------------IDIWSCGCILVEMITGKPLFPGTSDEEQLKLI 221

Query: 668 M--------------------NPDVKIPFPE------YTSNNEKIPKSAIELMKACLYRN 701
                                NP+  I  P+       +   E +  + ++L+   L  N
Sbjct: 222 FETMGTPTERTWPGISSLPKYNPNFPIHLPKDLRAFLQSQTRESLDNNVVDLLHGLLQLN 281

Query: 702 PDKRWTVDKVLSSTFLQPF 720
           P+ R +  + L+  +   +
Sbjct: 282 PEMRLSAKQALNHPWFAEY 300

>Skud_7.337 Chr7 (562750..563856) [1107 bp, 368 aa] {ON} YGR040W
           (REAL)
          Length = 368

 Score = 96.7 bits (239), Expect = 9e-21,   Method: Compositional matrix adjust.
 Identities = 89/321 (27%), Positives = 150/321 (46%), Gaps = 49/321 (15%)

Query: 439 SQYEKIELLGRGGSSRVYKV--KGSGNKIYALKRXXXXXXXXXXXXGFKGEIELLEKLKD 496
           SQY+ ++L+G G    V     K SG K+ A+K+              + EI+LL    +
Sbjct: 11  SQYKLVDLIGEGAYGTVCSAIHKPSGIKV-AIKKIQPFSKKLFVTRTIR-EIKLLRYFHE 68

Query: 497 QRRVIQLLDYEMGDGL-----LYLIMECGDHDLSQILNQRSN--MPLDFNFVRFYTKEML 549
              +I +LD      +     +YL+ E  + DL +++N ++N    L  + ++++T ++L
Sbjct: 69  HENIISILDKVRPVSIDKLNAVYLVEELMETDLQKVINNQNNGSSTLSDDHIQYFTYQIL 128

Query: 550 LCIKVVHDAGIVHSDLKPANFVLVKGI-LKIIDFGIANAVPEHTVNIYRETQIG------ 602
             +K +H A ++H D+KP+N +L     LK+ DFG+A  +   + +  RET +G      
Sbjct: 129 RALKSIHSAQVIHRDIKPSNLLLNSNCDLKVCDFGLARCLASSSDS--RETLVGFMTEYV 186

Query: 603 -TPNYMAPEALVAMN-YTQSSDNQHEGNKWKVGRPSDMWSCGCIIYQMIYGKPPYGSFQG 660
            T  Y APE ++    YT +                D+WSCGCI+ +M+ GKP +     
Sbjct: 187 ATRWYRAPEIMLTFQEYTTA---------------MDIWSCGCILAEMVSGKPLFPGRDY 231

Query: 661 QNRLLAIMNPDVKIPFPEYTSNNEKIPKSAIELMKACLYRNPDKRWTVDKVLSSTFLQPF 720
            ++L  I+     +  P +   N+   K A E + A L   P   W  D V S T L P 
Sbjct: 232 HHQLWLILE---VLGTPTFEDFNQIKSKRAKEYI-ANLPMRPPLSW--DTVWSRTDLNPD 285

Query: 721 MISGSIMEDLIKNAVRYGSEK 741
           MI      DL+   +++  +K
Sbjct: 286 MI------DLLNKMLQFNPDK 300

>ZYRO0A12826g Chr1 (1014651..1015751) [1101 bp, 366 aa] {ON} highly
           similar to uniprot|P14681 Saccharomyces cerevisiae
           YGR040W KSS1 Mitogen-activated protein kinase (MAPK)
           involved in signal transduction pathways that control
           filamentous growth and pheromone response
          Length = 366

 Score = 96.7 bits (239), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 68/245 (27%), Positives = 116/245 (47%), Gaps = 33/245 (13%)

Query: 439 SQYEKIELLGRGGSSRVYKVKGSGNKIY-ALKRXXXXXXXXXXXXGFKGEIELLEKLKDQ 497
           SQY+ + L+G G    V         IY A+K+              + EI+LL    D 
Sbjct: 11  SQYQLVALIGEGAYGTVCSAIHKPTGIYVAIKKIQPFSKNMFVTRTLR-EIKLLSYFHDH 69

Query: 498 RRVIQLLDYEMGDGL-----LYLIMECGDHDLSQILNQRSNMPLDFNFVRFYTKEMLLCI 552
             +I +LD      +     +YL+ E  + DL +I++  S  PL  + ++++T ++L  +
Sbjct: 70  ENIISILDKVRPTSIDKMNAVYLVQELMETDLQRIISNISTNPLSDDHIQYFTYQILRAL 129

Query: 553 KVVHDAGIVHSDLKPANFVLVKGI-LKIIDFGIANAVPEHTVNIYRETQIG-------TP 604
           K +H A ++H DLKP+N +L     LK+ DFG++  +   + +  RET +G       T 
Sbjct: 130 KSIHSAQVIHRDLKPSNLLLNSNCDLKVCDFGLSRCLASSSDS--RETLVGFMTEYVATR 187

Query: 605 NYMAPEALVAMN-YTQSSDNQHEGNKWKVGRPSDMWSCGCIIYQMIYGKPPYGSFQGQNR 663
            Y APE ++    YT +                D+WSCGCI+ +++ GKP +      ++
Sbjct: 188 WYRAPEIMLTFQEYTTA---------------MDIWSCGCILAELVSGKPLFPGRDYHHQ 232

Query: 664 LLAIM 668
           L  I+
Sbjct: 233 LWLIL 237

>KAFR0H01530 Chr8 complement(283589..284509) [921 bp, 306 aa] {ON}
           Anc_8.482 YPL031C
          Length = 306

 Score = 95.1 bits (235), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 84/318 (26%), Positives = 144/318 (45%), Gaps = 54/318 (16%)

Query: 437 NDSQYEKIELLGRGGSSRVYK-VKGSGNKIYALKRXXXXXXXXXXXXGFKGEIELLEKLK 495
           + SQ++++E LG G  + VYK +  +  +  ALK               + EI L+++LK
Sbjct: 3   SGSQFKQLEKLGNGTYATVYKGLNKTTGEFVALKEVKLDSEEGTPSTAIR-EISLMKELK 61

Query: 496 DQRRVIQLLDYEMGDGLLYLIMECGDHDLSQILNQRS--NMP--LDFNFVRFYTKEMLLC 551
            +  +++L D    +  L L+ E  D DL + ++ R+  N P  L+ + V+++  ++L  
Sbjct: 62  HEN-IVRLYDVIHTENKLTLVFEYMDKDLKKYMDSRTVGNAPVGLELHLVKYFQWQLLEG 120

Query: 552 IKVVHDAGIVHSDLKPANFVL-VKGILKIIDFGIANA--VPEHTVNIYRETQIGTPNYMA 608
           +   H+  I+H DLKP N ++  KG LKI DFG+A A  +P +T +    +++ T  Y A
Sbjct: 121 LAFCHENKILHRDLKPQNLLINKKGQLKIGDFGLARAFGIPVNTFS----SEVVTLWYRA 176

Query: 609 PEALVAMNYTQSSDNQHEGNKWKVGRPSDMWSCGCIIYQMIYGKPPYGSFQGQNRLLAIM 668
           P+ L+      +S               D+WSCGCI+ +MI GKP +     + +L  I 
Sbjct: 177 PDVLMGSRTYSTS--------------IDIWSCGCILAEMITGKPLFPGTNEEEQLKLIF 222

Query: 669 N----------------PDVKIPFPEYTSNNEK----------IPKSAIELMKACLYRNP 702
                            P     FP++   N K          +  + I L+   L  NP
Sbjct: 223 ETMGTPNEQSWPGISSLPKYNPGFPQHLPKNLKSILQAHCASDLDDTLIALLHGLLQLNP 282

Query: 703 DKRWTVDKVLSSTFLQPF 720
           D R +  + L   +   +
Sbjct: 283 DMRLSAKQALHHPWFAEY 300

>Kpol_1007.17 s1007 (32671..32687,32861..33767) [924 bp, 307 aa]
           {ON} (32671..32687,32861..33767) [924 nt, 308 aa]
          Length = 307

 Score = 95.1 bits (235), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 86/311 (27%), Positives = 143/311 (45%), Gaps = 56/311 (18%)

Query: 437 NDSQYEKIELLGRGGSSRVYKVKGSGNKIY-ALKRXXXXXXXXXXXXGFKGEIELLEKLK 495
           + SQ++++E LG G  + VYK       +Y ALK               + EI L+++LK
Sbjct: 3   SSSQFKQLEKLGNGTYATVYKGLNKTTGVYVALKEVKLDSEEGTPSTAIR-EISLMKELK 61

Query: 496 DQRRVIQLLDYEMGDGLLYLIMECGDHDLSQILNQRS--NMP--LDFNFVRFYTKEMLLC 551
               +++L D    +  L L+ E  D DL + ++ R+  N P  L+ + V+++  ++   
Sbjct: 62  -HDNIVRLYDVIHTENKLTLVFEYMDKDLKKYMDSRTTGNSPQGLELSLVKYFQWQLFEG 120

Query: 552 IKVVHDAGIVHSDLKPANFVLV-KGILKIIDFGIANA--VPEHTVNIYRETQIGTPNYMA 608
           I   H+  I+H DLKP N ++  KG LK+ DFG+A A  +P +T +    +++ T  Y A
Sbjct: 121 ISFCHENKILHRDLKPQNLLINNKGQLKLGDFGLARAFGIPVNTFS----SEVVTLWYRA 176

Query: 609 PEALVAMNYTQSSDNQHEGNKWKVGRPSDMWSCGCIIYQMIYGKPPYGSFQGQNRLLAIM 668
           P+ L+      +S               DMWSCGCI+ +M+ GKP +     + +L  I 
Sbjct: 177 PDVLMGSRSYSTS--------------IDMWSCGCILAEMLTGKPLFPGTNDEEQLKLIF 222

Query: 669 N----------PDVKIPFPEYTSN-NEKIPKS----------------AIELMKACLYRN 701
           +          P V    P+Y SN + ++PK                  I+L+   L  N
Sbjct: 223 DMMGTPTESTWPTVTT-LPKYNSNFSIQVPKDLKKLLQPFTKEQLDDIVIDLLNGLLQLN 281

Query: 702 PDKRWTVDKVL 712
           P  R +  + L
Sbjct: 282 PSMRLSAKQAL 292

>Kpol_2002.46 s2002 (95107..98478) [3372 bp, 1123 aa] {ON}
           (95107..98478) [3372 nt, 1124 aa]
          Length = 1123

 Score = 99.8 bits (247), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 68/242 (28%), Positives = 125/242 (51%), Gaps = 30/242 (12%)

Query: 483 GFKGEIELLEKLKDQRRVIQLLDYEMGDGLLYLIMECGDH-DLSQILNQRSNMPLDFNFV 541
           G + EI ++ KL +   V++L D    +  LY+++E  +  +L  +L ++  +P +   +
Sbjct: 75  GIEREI-IIMKLLNHPNVLRLYDVWETNNNLYMVLEYAEKGELFNLLVEKGPLP-ENEAI 132

Query: 542 RFYTKEMLLCIKVVHDAGIVHSDLKPANFVLVKGI-LKIIDFGIANAVPEHTVNIYRETQ 600
           RF+ +++++ +   H  GIVH DLKP N +L   + +KI DFG+A      T +   ET 
Sbjct: 133 RFF-RQIIIGMSYCHALGIVHRDLKPENILLDHKLNIKIADFGMAAL---ETEDKLLETS 188

Query: 601 IGTPNYMAPEALVAMNYTQSSDNQHEGNKWKVGRPSDMWSCGCIIYQMIYGKPPYGSFQG 660
            G+P+Y APE +  + Y               G  +D+WSCG I++ ++ G+ P+    G
Sbjct: 189 CGSPHYAAPEIVSGLPYH--------------GLETDVWSCGVILFALLTGRLPFDEEDG 234

Query: 661 --QNRLLAIMNPDVKIPFPEYTSNNEKIPKSAIELMKACLYRNPDKRWTVDKVLSSTFLQ 718
             +N LL +   + ++P       +++I K A +L+   L  +P+KR    ++L    LQ
Sbjct: 235 NIRNLLLKVQKGEFEMP------GDDEISKEAQDLLYKILVVDPEKRIKSREILKHPLLQ 288

Query: 719 PF 720
            +
Sbjct: 289 KY 290

>TBLA0I01800 Chr9 complement(401728..403617) [1890 bp, 629 aa] {ON}
           Anc_3.229 YBR028C
          Length = 629

 Score = 98.6 bits (244), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 75/249 (30%), Positives = 106/249 (42%), Gaps = 61/249 (24%)

Query: 488 IELLEKLKDQRRVIQLLDYEMGDGLLYLIMECGDHDLSQILNQRSNMPLDFNFVRFYTKE 547
           ++L    +D  ++  LL Y  G  L Y + E G               LD + V FY  E
Sbjct: 243 VKLFYSFRDDSKLYLLLQYIPGGELFYHLKEQG--------------TLDEDTVAFYAAE 288

Query: 548 MLLCIKVVHDAGIVHSDLKPANFVL-VKGILKIIDFGI-----------------ANAVP 589
           +   +K +H+ GIV+ DLKP N +L  KG L + DFG+                 A  + 
Sbjct: 289 ISCALKFLHEKGIVYRDLKPENCLLNEKGHLVLTDFGLSKKSLSESRTPSAVDLKAKLIS 348

Query: 590 EHTVNIYRETQ--------IGTPNYMAPEALVAMNYTQSSDNQHEGNKWKVGRPSDMWSC 641
               +I  E +        IGTP Y APE L+   YTQ+ D       W        +S 
Sbjct: 349 NEDYSIVSEEEDVVALHSIIGTPEYCAPEILMGQPYTQNCD-------W--------YSL 393

Query: 642 GCIIYQMIYGKPPYGSFQGQNRLLAIMNPDVKIPFPEYTSNNEKIPKSAIELMKACLYRN 701
           GC+IY M+ GKPP+     +  L  I    V    P Y S+  K      +++ A L ++
Sbjct: 394 GCLIYDMLVGKPPFTGNNHKVILNKIQKEKVGPKIPYYLSDGMK------DMLGALLKKD 447

Query: 702 PDKRWTVDK 710
             KRW VDK
Sbjct: 448 NSKRWNVDK 456

>CAGL0L11550g Chr12 (1232015..1235233) [3219 bp, 1072 aa] {ON}
           similar to uniprot|P38692 Saccharomyces cerevisiae
           YHR102w NRK1 ser/thr protein kinase
          Length = 1072

 Score = 99.0 bits (245), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 79/299 (26%), Positives = 142/299 (47%), Gaps = 34/299 (11%)

Query: 439 SQYEKIELLGRGGSSRVYK---VKGSGNKIYALKRXXXXXXXXXXXXGFKGEIELLEKLK 495
           S +++ E++GRG    VYK   VK    ++YA+K               + EI+ L  LK
Sbjct: 14  STFKRTEVIGRGKFGIVYKGYHVKT--KQVYAIK-VLNLDSSEDEVEDVQREIQFLASLK 70

Query: 496 DQRRVIQLLDYEMGDGLLYLIME-CGDHDLSQILNQRSNMPLDFNFVRFYTKEMLLCIKV 554
               + +     +    L++IME C    L  +L       +D  ++    +E+L+ +KV
Sbjct: 71  QIPNITRYYGSYLRGTSLWIIMEYCAGGSLRSLLRPGK---IDEKYIGVIMRELLVALKV 127

Query: 555 VHDAGIVHSDLKPANFVLV-KGILKIIDFGIANAVPEHTVNIYRETQIGTPNYMAPEALV 613
           +H   ++H D+K AN ++  +G +K+ DFG+A  +  +  ++ R+T  GTP +MAPE ++
Sbjct: 128 IHKDNVIHRDIKAANVLITNEGQVKLCDFGVAAQL--NQTSLRRQTMAGTPYWMAPEVIM 185

Query: 614 AMNYTQSSDNQHEGNKWKVGRPSDMWSCGCIIYQMIYGKPPYGSFQGQNRLLAIMNPDVK 673
              Y  +          KV    D+WS G   Y++  G PPY   +     L  M   +K
Sbjct: 186 EGVYYDT----------KV----DIWSLGITAYEIATGNPPYCDVEA----LRAMQLIIK 227

Query: 674 IPFPEYTSNNEKIPKSAIELMKACLYRNPDKRWTVDKVLSSTFLQPFMIS-GSIMEDLI 731
              P     N   P+   E +  CL  +P +R + +++L + F++    +  +I+++LI
Sbjct: 228 SKPPRLEERN-YTPQLK-EFIALCLDEDPQERLSAEELLKTKFIKTHKATPTTILKELI 284

>TDEL0D02650 Chr4 complement(505536..506636) [1101 bp, 366 aa] {ON}
           Anc_4.184 YGR040W
          Length = 366

 Score = 95.9 bits (237), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 67/245 (27%), Positives = 116/245 (47%), Gaps = 33/245 (13%)

Query: 439 SQYEKIELLGRGGSSRVYKVKGSGNKIY-ALKRXXXXXXXXXXXXGFKGEIELLEKLKDQ 497
           SQY+ + L+G G    V         I+ A+K+              + EI+LL    D 
Sbjct: 11  SQYQLLALVGEGAYGTVCSAIHKPTGIHVAIKKIQPFSKTMFVTRTLR-EIKLLRYFHDH 69

Query: 498 RRVIQLLDYEMGDGL-----LYLIMECGDHDLSQILNQRSNMPLDFNFVRFYTKEMLLCI 552
             +I +LD      +     +YL+ E  + DL +I+N  +  PL  + ++++T ++L  +
Sbjct: 70  ENIISILDMIRPTTIDKMNAVYLVQELMETDLQRIINSHAANPLSDDHIQYFTYQILRAL 129

Query: 553 KVVHDAGIVHSDLKPANFVLVKGI-LKIIDFGIANAVPEHTVNIYRETQIG-------TP 604
           K +H A ++H DLKP+N +L     LK+ DFG++  +   + +  RET +G       T 
Sbjct: 130 KSIHSAQVIHRDLKPSNLLLNSNCDLKVCDFGLSRCLASSSDS--RETLVGFMTEYVATR 187

Query: 605 NYMAPEALVAM-NYTQSSDNQHEGNKWKVGRPSDMWSCGCIIYQMIYGKPPYGSFQGQNR 663
            Y APE ++    YT +                D+WSCGCI+ +++ GKP +      ++
Sbjct: 188 WYRAPEIMLTFREYTTA---------------MDIWSCGCILAELVSGKPLFPGRDYHHQ 232

Query: 664 LLAIM 668
           L  I+
Sbjct: 233 LWLIL 237

>Kpol_1023.26 s1023 (51805..54024) [2220 bp, 739 aa] {ON}
           (51805..54024) [2220 nt, 740 aa]
          Length = 739

 Score = 98.6 bits (244), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 81/305 (26%), Positives = 144/305 (47%), Gaps = 29/305 (9%)

Query: 432 SMITVNDSQYEKIELLGRGGSSRVYKVKGSGNKIYALKRXXXXXXXXXXXXG-FKGEIEL 490
           S+I      Y +   LG GG +R +++K    K++A K                  EI++
Sbjct: 89  SLIKSKGKDYYRGHFLGEGGFARCFQMKDDDGKVFAAKTVAKISIKSEKARNKLLSEIQI 148

Query: 491 LEKLKDQRRVIQLLDYEMGDGLLYLIME-CGDHDLSQILNQRSNMPLDFNFVRFYTKEML 549
            + ++ Q  ++  +D    D  +Y+++E C +  L  +L +R    L    VRF+T ++ 
Sbjct: 149 HKNMRHQN-IVHFIDCFEDDINVYILLEICPNGSLMDLLKRRK--ILTEPEVRFFTTQIC 205

Query: 550 LCIKVVHDAGIVHSDLKPANFVLVKGI-LKIIDFGIANAVPEHTVNIYRETQIGTPNYMA 608
             +  +H   I+H DLK  N    K   LKI DFG+A  +  +  N  + T  GTPNY+A
Sbjct: 206 GALDHMHSRNIIHRDLKLGNIFFDKDFNLKIGDFGLAAII--NNENERKYTICGTPNYIA 263

Query: 609 PEALVAMNYTQSSDNQHEGNKWKVGRPSDMWSCGCIIYQMIYGKPPYGSFQGQNRLLAIM 668
           PE ++          +  G+ ++V    D+WS G +I+ MI GKPP+ + +       I 
Sbjct: 264 PEVIMG--------GKQIGHSFEV----DIWSLGVMIFAMITGKPPFQAKEVSTIYDRIK 311

Query: 669 NPDVKIPFPEYTSNNEKIPKSAIELMKACLYRNPDKRWTVDKVLSSTFLQ---PFMISGS 725
           + +   P  +Y S + K      +L++  L  NP +R T+ ++L+  + +   P  +   
Sbjct: 312 HCNYSFPTDKYVSKDVK------KLIQDILSMNPMERPTIQEILNYNWFKGNFPPCMPID 365

Query: 726 IMEDL 730
           +M D+
Sbjct: 366 VMNDI 370

>NCAS0H01940 Chr8 (374913..377960) [3048 bp, 1015 aa] {ON} Anc_5.406
          Length = 1015

 Score = 99.0 bits (245), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 78/298 (26%), Positives = 139/298 (46%), Gaps = 30/298 (10%)

Query: 438 DSQYEKIELLGRGGSSRVYKVKGSGNK-IYALKRXXXXXXXXXXXXGFKGEIELLEKLKD 496
           +S + + E++GRG    VYK      K IYA+K               + E++ L  LK 
Sbjct: 34  NSMFRRTEVIGRGKFGIVYKGYHVRTKQIYAIK-VLNLDSDEDEVEDVQREVQFLSSLKQ 92

Query: 497 QRRVIQLLDYEMGDGLLYLIME-CGDHDLSQILNQRSNMPLDFNFVRFYTKEMLLCIKVV 555
              + +     + D  L++IME C    L  +L       +D  ++    +E+L+ +K +
Sbjct: 93  IPNITRYYGSYLKDTSLWIIMEYCAGGSLRSLLRPGK---IDEKYIGVIMRELLVALKYI 149

Query: 556 HDAGIVHSDLKPANFVLV-KGILKIIDFGIANAVPEHTVNIYRETQIGTPNYMAPEALVA 614
           H   ++H D+K AN ++  +G +K+ DFG+A  + + T  + R+T  GTP +MAPE ++ 
Sbjct: 150 HKDNVIHRDIKAANVLITNEGSVKLCDFGVAAQLNQST--LRRQTMAGTPYWMAPEVIME 207

Query: 615 MNYTQSSDNQHEGNKWKVGRPSDMWSCGCIIYQMIYGKPPYGSFQGQNRLLAIMNPDVKI 674
             Y  +          KV    D+WS G   Y++  G PPY   +    +  I     K 
Sbjct: 208 GVYYDT----------KV----DIWSLGITAYEIATGNPPYCEVEALRAMQLITK--SKP 251

Query: 675 PFPEYTSNNEKIPKSAIELMKACLYRNPDKRWTVDKVLSSTFLQPFMISG-SIMEDLI 731
           P  E  S    +     E +  CL  +P +R + +++  + F++   ++  SI+++LI
Sbjct: 252 PRLESRSYTPLLK----EFIALCLDEDPKERLSAEELSKTKFIKAHKLTPVSILKELI 305

>TPHA0H01630 Chr8 (371333..374443) [3111 bp, 1036 aa] {ON} Anc_5.406
           YHR102W
          Length = 1036

 Score = 98.6 bits (244), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 80/350 (22%), Positives = 157/350 (44%), Gaps = 49/350 (14%)

Query: 389 ITNENENKKIQEVFYHRPAPKPPVTKKVEIVEPAKSASSSNNRSMITVNDSQYEKIELLG 448
           + N N NK  +E F          T  V  + P  + + S +  +     S + + E++G
Sbjct: 7   VNNPNTNK--EETFLQ-------TTDNVTTIAPKHTLAQSQDSDVC----SSFRRTEVIG 53

Query: 449 RGGSSRVYK---VKGSGNKIYALKRXXXXXXXXXXXXGFKGEIELLEKLKDQRRVIQLLD 505
           RG    VYK   VK    ++YA+K               + E++ L  LK    +I+   
Sbjct: 54  RGKFGVVYKGYHVKTQ--QVYAIK-VLNLDSESDEVEDVQREVQFLSSLKQFPNIIRYFG 110

Query: 506 YEMGDGLLYLIME-CGDHDLSQILNQRSNMPLDFNFVRFYTKEMLLCIKVVHDAGIVHSD 564
             + D  L++IM+ C    +  +L       +D  ++    +E+L+ ++ +H   ++H D
Sbjct: 111 SYLKDTNLWIIMDYCAGGSIRTLLRPGK---IDEKYIGIIMREILIALQYIHKDNVIHRD 167

Query: 565 LKPANFVLV-KGILKIIDFGIANAVPEHTVNIYRETQIGTPNYMAPEALVAMNYTQSSDN 623
           +K AN ++  +G +K+ DFG+A  +  +   + R+T  GTP +MAPE ++   Y  +   
Sbjct: 168 IKAANVLVTNEGKVKLCDFGVAAQL--NQTKLRRQTMAGTPYWMAPEVIMEGAYYDTK-- 223

Query: 624 QHEGNKWKVGRPSDMWSCGCIIYQMIYGKPPYGSFQGQNRL-LAIMNPDVKIPFPEYTSN 682
                       +D+WS G   Y++  G PPY   +    + L   +   ++    Y++ 
Sbjct: 224 ------------ADIWSLGITAYEIATGNPPYCEIEALRAMQLITKSKPARLEGRSYST- 270

Query: 683 NEKIPKSAIELMKACLYRNPDKRWTVDKVLSSTFLQP-FMISGSIMEDLI 731
                 S  E +  CL  +P +R + +++  + F++    +  +I+++LI
Sbjct: 271 ------SLKEFIALCLDEDPKERLSAEELQKTKFIKSQRAVPTTILKELI 314

>NCAS0B08600 Chr2 (1649375..1652728) [3354 bp, 1117 aa] {ON}
           Anc_5.591 YDR466W
          Length = 1117

 Score = 99.0 bits (245), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 71/242 (29%), Positives = 123/242 (50%), Gaps = 30/242 (12%)

Query: 483 GFKGEIELLEKLKDQRRVIQLLDYEMGDGLLYLIMECGDH-DLSQILNQRSNMPLDFNFV 541
           G + EI ++ KL     V+ L D    +  LY+I+E  +  +L  +L ++  +P +   V
Sbjct: 80  GIEREI-IIMKLLRHANVLSLYDVWETNSNLYMILEYAEKGELFNLLVEKGPLP-EKEAV 137

Query: 542 RFYTKEMLLCIKVVHDAGIVHSDLKPANFVL-VKGILKIIDFGIANAVPEHTVNIYRETQ 600
           RF+ +++++ I   H  GIVH DLKP N +L  K  +KI DFG+A      T +   ET 
Sbjct: 138 RFF-RQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAAL---ETEDKLLETS 193

Query: 601 IGTPNYMAPEALVAMNYTQSSDNQHEGNKWKVGRPSDMWSCGCIIYQMIYGKPPYGSFQG 660
            G+P+Y APE +  + Y               G  SD+WSCG I++ ++ G+ P+    G
Sbjct: 194 CGSPHYAAPEIVSGIPYH--------------GFESDVWSCGVILFALLTGRLPFDEEDG 239

Query: 661 --QNRLLAIMNPDVKIPFPEYTSNNEKIPKSAIELMKACLYRNPDKRWTVDKVLSSTFLQ 718
             +N LL + +   ++P      +++++ + A +L+   L  +P KR    ++L    LQ
Sbjct: 240 NIRNLLLKVQSGQFEMP------DDDEMSRDAQDLISRILTVDPTKRIKTREILKHPLLQ 293

Query: 719 PF 720
            +
Sbjct: 294 KY 295

>KNAG0B04320 Chr2 complement(821265..824348) [3084 bp, 1027 aa] {ON}
           Anc_5.406 YHR102W
          Length = 1027

 Score = 98.6 bits (244), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 79/298 (26%), Positives = 140/298 (46%), Gaps = 30/298 (10%)

Query: 438 DSQYEKIELLGRGGSSRVYKVKGSGNK-IYALKRXXXXXXXXXXXXGFKGEIELLEKLKD 496
           ++ + + E++G+G    VYK      K +YA+K               + EI+ L  LK 
Sbjct: 38  NAAFRRTEVIGKGKFGVVYKGYNLRTKHVYAIK-VLNLDSDEDEVEDVQREIQFLASLKQ 96

Query: 497 QRRVIQLLDYEMGDGLLYLIME-CGDHDLSQILNQRSNMPLDFNFVRFYTKEMLLCIKVV 555
              V +     + +  L++IME C    L  +L       +D  ++    +E+L+ +K +
Sbjct: 97  LPNVTRYYGSYLKNTSLWIIMEYCAGGSLRSLLRPGK---IDEKYIGVIMRELLVALKFI 153

Query: 556 HDAGIVHSDLKPANFVLV-KGILKIIDFGIANAVPEHTVNIYRETQIGTPNYMAPEALVA 614
           H   I+H D+K AN ++  +G +K+ DFG+A  + + T  + R+T  GTP +MAPE ++ 
Sbjct: 154 HKDNIIHRDIKAANVLITNEGGVKLCDFGVAAQLNQRT--LRRQTMAGTPYWMAPEVIME 211

Query: 615 MNYTQSSDNQHEGNKWKVGRPSDMWSCGCIIYQMIYGKPPYGSFQGQNRLLAIMNPDVKI 674
             Y  +          KV    D+WS G   Y++  G PPY   +    +  I     K 
Sbjct: 212 GVYYDT----------KV----DIWSLGITAYEISTGNPPYCDVEALRAMQLIT--KSKP 255

Query: 675 PFPEYTSNNEKIPKSAIELMKACLYRNPDKRWTVDKVLSSTFLQPFMISGSI-MEDLI 731
           P  E  +    I     E +  CL  +P++R + D++L S F++    + +I +++LI
Sbjct: 256 PRLEGRNYTPLIK----EFIALCLDEDPNERLSADELLKSKFIKAHKTTPTIVLKELI 309

>NDAI0G05470 Chr7 (1340175..1344842) [4668 bp, 1555 aa] {ON} Anc_1.271
          Length = 1555

 Score = 99.0 bits (245), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 100/375 (26%), Positives = 164/375 (43%), Gaps = 63/375 (16%)

Query: 370  ADNILQQDNKRLK--RSLDDV--ITNENENKKIQEVFYHRPAPKPPVTKKVEIVEPAKSA 425
            +D I+   N +LK  R    +  I +E   K+ + +   R   K   T+ VE+ E     
Sbjct: 1179 SDGIISSTNSKLKLPRRTKTIRTIAHEASEKRKKSIKLKRQNTKMWGTRMVEVTE----- 1233

Query: 426  SSSNNRSMITVNDSQ----------YEKIELLGRGGSSRVY-KVKGSGNKIYALKR---- 470
                 + M+++N S+          + K E++G+G    VY  +  +  ++ A+K+    
Sbjct: 1234 -----KQMVSINKSKNSKGEYKEFAWMKGEMIGKGSFGAVYLCLNVTTGEMMAVKQVEVP 1288

Query: 471  --XXXXXXXXXXXXGFKGEIELLEKLKDQRRVIQLLDYEMGDGLLYLIME--CGDHDLSQ 526
                            K E+  L+ L D   ++Q L +E  D +  L +E   G    S 
Sbjct: 1289 KYSSQDEAIMSTVDAIKSEVSTLKDL-DHLNIVQYLGFENKDNIYSLFLEYVAGGSVGSL 1347

Query: 527  I-LNQRSNMPLDFNFVRFYTKEMLLCIKVVHDAGIVHSDLKPANFVLVK-GILKIIDFGI 584
            I +  R + PL    +R    ++L  +  +H  GI+H D+K  N +L + G+ KI DFGI
Sbjct: 1348 IRIYGRFDEPL----IRHLNIQVLRGLAYLHARGILHRDMKADNLLLDQDGVCKISDFGI 1403

Query: 585  ANAVPEHTVNIYRETQI---GTPNYMAPEALVAMNYTQSSDNQHEGNKWKVGRPSDMWSC 641
            +      + +IY  + +   GT  +MAPE +          +  +G   KV    D+WS 
Sbjct: 1404 S----RKSKDIYSNSDMTMRGTVFWMAPEMV----------DTKQGYSAKV----DIWSL 1445

Query: 642  GCIIYQMIYGKPPYGSFQGQNRLLAIMNPDVKIPFPEYTSNNEKIPKSAIELMKACLYRN 701
            GCI+ +M  GK P+ +F+    +  I       P PE T     I     E + AC   +
Sbjct: 1446 GCIVLEMFAGKRPWSNFEVVAAMFKIGKSKSAPPIPEDTL--PLISAEGREFLDACFEID 1503

Query: 702  PDKRWTVDKVLSSTF 716
            PDKR T D++L  TF
Sbjct: 1504 PDKRPTADELLYHTF 1518

>SAKL0G01848g Chr7 (154547..157204) [2658 bp, 885 aa] {ON} weakly
           similar to uniprot|P38692 Saccharomyces cerevisiae
           YHR102W KIC1 Protein kinase of the PAK/Ste20 kinase
           family required for cell integrity possibly through
           regulating 1 6-beta-glucan levels in the wall physically
           interacts with Cdc31p (centrin) which is a component of
           the spindle pole body
          Length = 885

 Score = 98.6 bits (244), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 82/322 (25%), Positives = 139/322 (43%), Gaps = 34/322 (10%)

Query: 413 TKKVEIVEPAKSASSSNNRSMITVNDSQYEKIELLGRGGSSRVYKVKGSGNKIYALKRXX 472
           TKK  +     +++ SNN S I      Y++ E++GRG    VYK      K     +  
Sbjct: 4   TKKSGVSTANGTSAPSNNVSSI------YKRTEVIGRGKFGVVYKGYHIRTKQICAIKVL 57

Query: 473 XXXXXXXXXXGFKGEIELLEKLKDQRRVIQLLDYEMGDGLLYLIME-CGDHDLSQILNQR 531
                       + EI+ L  LK    +       + D  L++IME C    L  +L   
Sbjct: 58  NLDTSEDEVEDVQKEIQFLSSLKQVPNITHYYGSYLYDTKLWIIMEYCAGGSLRTLLRPG 117

Query: 532 SNMPLDFNFVRFYTKEMLLCIKVVHDAGIVHSDLKPANFVLVK-GILKIIDFGIANAVPE 590
               +D  ++    +E+L+ +  +H   ++H D+K AN ++   G +K+ DFG+A  + +
Sbjct: 118 K---IDEKYIGVIMRELLVALLYIHKDNVIHRDIKAANVLITNDGRVKLCDFGVAAQLTQ 174

Query: 591 HTVNIYRETQIGTPNYMAPEALVAMNYTQSSDNQHEGNKWKVGRPSDMWSCGCIIYQMIY 650
              N+ R+T  GTP +MAPE ++   Y  +          KV    D+WS G   Y++  
Sbjct: 175 S--NVRRQTMAGTPYWMAPEVIMEGVYYDT----------KV----DIWSLGITTYEITT 218

Query: 651 GKPPYGSFQGQNRLLAIMNPDVKIPFPEYTSNNEKIPKSAIELMKACLYRNPDKRWTVDK 710
           G PPY   +    +  I         P      +  P    E +  CL  +P +R   + 
Sbjct: 219 GNPPYCDVEALRAMQLITKSK-----PPRLEGRQYSPLLK-EFIALCLDEDPKERLAAED 272

Query: 711 VLSSTFLQPFMIS-GSIMEDLI 731
           +L + F++    S  SI+++LI
Sbjct: 273 LLKTRFIKTHKSSPTSILKELI 294

>YBR028C Chr2 complement(294425..296002) [1578 bp, 525 aa] {ON}
           YPK3An AGC kinase phosphorylated by cAMP-dependent
           protein kinase (PKA) in a TORC1-dependent manner
          Length = 525

 Score = 97.1 bits (240), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 78/246 (31%), Positives = 111/246 (45%), Gaps = 62/246 (25%)

Query: 488 IELLEKLKDQRRVIQLLDYEMGDGLLYLIMECGDHDLSQILNQRSNMPLDFNFVRFYTKE 547
           ++L     D  ++  LL Y  G  L Y + E G               LD   V FY  E
Sbjct: 215 VKLFYSFHDNSKLYLLLQYIPGGELFYHLKEHGT--------------LDETTVSFYAAE 260

Query: 548 MLLCIKVVHDAGIVHSDLKPANFVL-VKGILKIIDFGIA------NAV----PEHTVNIY 596
           +   ++ +H  G+V+ DLKP N +L  +G L + DFG++      +AV    PE+   +Y
Sbjct: 261 ISCALRFLHTKGVVYRDLKPENCLLNQRGHLVLTDFGLSKKSANDSAVDEEDPENVNALY 320

Query: 597 RETQIGTPNYMAPEALVAMNYTQSSDNQHEGNKWKVGRPSDMWSCGCIIYQMIYGKPPYG 656
             + IGTP Y APE L+   Y+Q+ D       W        +S GC++Y M+ GKPPY 
Sbjct: 321 --SIIGTPEYCAPEILLGKAYSQNCD-------W--------YSLGCLLYDMLVGKPPY- 362

Query: 657 SFQGQNRLLAI-------MNPDVKIPFPEYTSNNEKIPKSAIELMKACLYRNPDKRWTVD 709
              G N  + I         P  KIPF  Y S   K      +++ A L +   KRW VD
Sbjct: 363 --TGSNHKVIINKIQQNKQGP--KIPF--YLSEGMK------DILNALLKKETAKRWNVD 410

Query: 710 KVLSST 715
           K  + T
Sbjct: 411 KYWAKT 416

>Skud_2.141 Chr2 complement(264097..265677) [1581 bp, 526 aa] {ON}
           YBR028C (REAL)
          Length = 526

 Score = 97.1 bits (240), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 77/244 (31%), Positives = 107/244 (43%), Gaps = 62/244 (25%)

Query: 488 IELLEKLKDQRRVIQLLDYEMGDGLLYLIMECGDHDLSQILNQRSNMPLDFNFVRFYTKE 547
           ++L     D  ++  LL Y  G  L Y + E G               LD   V FY  E
Sbjct: 216 VKLFYSFHDNSKLYLLLQYIPGGELFYHLKEHGT--------------LDETTVSFYAAE 261

Query: 548 MLLCIKVVHDAGIVHSDLKPANFVL-VKGILKIIDFGIANAV----------PEHTVNIY 596
           +   +K +H  G+V+ DLKP N +L  +G L + DFG++             PE+   +Y
Sbjct: 262 ISCALKFLHSKGVVYRDLKPENCLLNQRGHLVLTDFGLSKKSAHDSMADEEDPENVKALY 321

Query: 597 RETQIGTPNYMAPEALVAMNYTQSSDNQHEGNKWKVGRPSDMWSCGCIIYQMIYGKPPYG 656
             + IGTP Y APE L+   YTQ+ D       W        +S GC++Y M+ GKPPY 
Sbjct: 322 --SIIGTPEYCAPEILLGKAYTQNCD-------W--------YSLGCLLYDMLVGKPPY- 363

Query: 657 SFQGQNRLLAI-------MNPDVKIPFPEYTSNNEKIPKSAIELMKACLYRNPDKRWTVD 709
              G N  + I         P  KIPF  Y S   K      +++ A L +   KRW VD
Sbjct: 364 --TGNNHKVIINKIQQNKQGP--KIPF--YLSEGMK------DILNALLKKETSKRWNVD 411

Query: 710 KVLS 713
           K  +
Sbjct: 412 KYWA 415

>Kpol_499.3 s499 complement(6075..7199) [1125 bp, 374 aa] {ON}
           complement(6075..7199) [1125 nt, 375 aa]
          Length = 374

 Score = 95.1 bits (235), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 66/246 (26%), Positives = 119/246 (48%), Gaps = 33/246 (13%)

Query: 439 SQYEKIELLGRGGSSRVYKV--KGSGNKIYALKRXXXXXXXXXXXXGFKGEIELLEKLKD 496
           S Y+ ++L+G G    V     K SG K+ A+K+              + E++LL+   +
Sbjct: 11  SHYQLVDLIGEGAYGTVCSAVHKPSGTKV-AIKKIQPFGKTMFVTRTLR-ELKLLKYFHN 68

Query: 497 QRRVIQLLDYEMGDGL-----LYLIMECGDHDLSQIL--NQRSNMPLDFNFVRFYTKEML 549
              +I +LD      +     +Y++ E  + DL +++  N R N PL  + ++++T ++L
Sbjct: 69  HENIISILDKVRPISIDNLNAVYIVQELMETDLQKVIVNNNRKNTPLSDDHIQYFTYQVL 128

Query: 550 LCIKVVHDAGIVHSDLKPANFVLVKGI-LKIIDFGIANAVP-----EHTVNIYRETQIGT 603
             +K +H A ++H DLKP+N +L     LKI DFG++  +      + T+  +    + T
Sbjct: 129 RALKSIHSAKVIHRDLKPSNLLLNSNCDLKICDFGLSRCLASSSDSKETLVGFMTEYVAT 188

Query: 604 PNYMAPEALVAMN-YTQSSDNQHEGNKWKVGRPSDMWSCGCIIYQMIYGKPPYGSFQGQN 662
             Y APE ++    YT +                D+WSCGCI+ +M+ GKP +      +
Sbjct: 189 RWYRAPEIMLTFQEYTTA---------------MDIWSCGCILAEMVSGKPLFPGRDYHH 233

Query: 663 RLLAIM 668
           +L  I+
Sbjct: 234 QLWLIL 239

>Smik_3.54 Chr3 (80309..83407) [3099 bp, 1032 aa] {ON} YCL024W
           (REAL)
          Length = 1032

 Score = 97.8 bits (242), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 70/235 (29%), Positives = 113/235 (48%), Gaps = 29/235 (12%)

Query: 490 LLEKLKDQRRVIQLLDYEMGDGLLYLIMECGDH-DLSQILNQRSNMPLDFNFVRFYTKEM 548
           ++ KL     V+ L D    D  LYLI+E  +  +L  +L  R  +P +   ++ + K++
Sbjct: 79  VIMKLLSHPNVLSLYDVWETDNNLYLILEYAEKGELFNLLVDRGPLP-EREAIKCF-KQI 136

Query: 549 LLCIKVVHDAGIVHSDLKPANFVLVKGI-LKIIDFGIANAVPEHTVNIYRETQIGTPNYM 607
           ++ I   H  GIVH DLKP N +L     +KI DFG+A      T     ET  G+P+Y 
Sbjct: 137 IIAISYCHALGIVHRDLKPENLLLDNSYNIKIADFGMAAL---QTDAGMLETSCGSPHYA 193

Query: 608 APEALVAMNYTQSSDNQHEGNKWKVGRPSDMWSCGCIIYQMIYGKPPYGSFQGQNR--LL 665
           APE +  + Y               G  SD+WSCG I++ ++ G+ P+    G  R  LL
Sbjct: 194 APEIVSGLPYE--------------GFASDVWSCGVILFALLTGRLPFDEENGNVRDLLL 239

Query: 666 AIMNPDVKIPFPEYTSNNEKIPKSAIELMKACLYRNPDKRWTVDKVLSSTFLQPF 720
            +     ++P      NN +I   A +L++  L  +P +R  +  +LS   L+ +
Sbjct: 240 KVQKGQFEMP------NNAEISGDAQDLIRRILVVDPTQRIKIRDILSHPLLKKY 288

>Suva_2.666 Chr2 complement(1183839..1186133) [2295 bp, 764 aa] {ON}
           YDR490C (REAL)
          Length = 764

 Score = 97.4 bits (241), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 70/253 (27%), Positives = 125/253 (49%), Gaps = 39/253 (15%)

Query: 491 LEKLKDQRRVIQLLDYEMGDGLLYLIMECGDH-DLSQILNQRSNMPLDFNFVRFYTKEML 549
           L+KL   + +I+L      +  LY ++E   H D   ++ +  +  L+    R+Y  +++
Sbjct: 176 LQKLNGTKGIIRLFFTFQDEASLYFLLEYAPHGDFLALIKKYGS--LNEQCARYYASQII 233

Query: 550 LCIKVVHDAGIVHSDLKPANFVLVKGI-LKIIDFGIANAVPEHT-----------VNIYR 597
             +  +H  GI+H D+KP N +L K + +K+ DFG A  +PE             +N   
Sbjct: 234 DAVDSLHTIGIIHRDIKPENILLDKDMKVKLTDFGTAKILPEEPSNDADGKPCFDLNARS 293

Query: 598 ETQIGTPNYMAPEALVAMNYTQSSDNQHEGNKWKVGRPSDMWSCGCIIYQMIYGKPPYGS 657
           ++ +GT  Y++PE L+  +YT S                D+W+ GCI++QM+ GKPP   
Sbjct: 294 KSFVGTAEYVSPE-LLNDSYTDSR--------------CDIWAFGCILFQMVAGKPP--- 335

Query: 658 FQGQNRLLAIMNPDVKIPFPEYTSNNEKIPKSAIELMKACLYRNPDKRWTVDKVLSSTFL 717
           F+  N  L      +KI +  +T+   +I K   +L+K  L + P+ R T++++ +  F 
Sbjct: 336 FKASNEYLTFQKV-MKIQY-AFTAGFPQIIK---DLVKKLLVKEPNDRLTIEQIKAHIFF 390

Query: 718 QPFMI-SGSIMED 729
           Q      GS+ +D
Sbjct: 391 QTVNFDDGSVWDD 403

>Smik_4.767 Chr4 complement(1353354..1355630) [2277 bp, 758 aa] {ON}
           YDR490C (REAL)
          Length = 758

 Score = 97.4 bits (241), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 71/247 (28%), Positives = 119/247 (48%), Gaps = 49/247 (19%)

Query: 483 GFKGEIELLEKLKDQRRVIQLLDYEMGDGLLYLIMECGDHDLSQILNQRSNMPLDFNFVR 542
           G KG I L    +D+  +  LL+Y      L LI + G   L++I              R
Sbjct: 182 GTKGIIRLFFTFQDEASLYFLLEYAPHGDFLGLIKKYGS--LNEIC------------AR 227

Query: 543 FYTKEMLLCIKVVHDAGIVHSDLKPANFVLVKGI-LKIIDFGIANAVPEHTVN------- 594
           +Y  +++  +  +H  GI+H D+KP N +L K + +K+ DFG A  +PE   N       
Sbjct: 228 YYASQIIDAVDSLHSIGIIHRDIKPENILLDKDMKVKLTDFGTAKILPEQPSNAADGKPC 287

Query: 595 --IYRETQ--IGTPNYMAPEALVAMNYTQSSDNQHEGNKWKVGRPSDMWSCGCIIYQMIY 650
             +Y +++  +GT  Y++PE L+  +YT S                D+W+ GCI+YQM+ 
Sbjct: 288 FDLYAKSKSFVGTAEYVSPE-LLNDSYTDSR--------------CDIWAFGCILYQMLA 332

Query: 651 GKPPYGSFQGQNRLLAIMNPDVKIPFPEYTSNNEKIPKSAIELMKACLYRNPDKRWTVDK 710
           GKPP   F+  N  L      +KI +  +T+     P+   +L+K  L R+P+ R  +++
Sbjct: 333 GKPP---FKAANEYLTFQKV-MKIQY-AFTAG---FPQIVKDLVKKLLVRDPNDRLAIEQ 384

Query: 711 VLSSTFL 717
           + +  F 
Sbjct: 385 IKAHVFF 391

>Skud_4.783 Chr4 complement(1382552..1385959) [3408 bp, 1135 aa]
           {ON} YDR507C (REAL)
          Length = 1135

 Score = 97.8 bits (242), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 69/242 (28%), Positives = 122/242 (50%), Gaps = 30/242 (12%)

Query: 483 GFKGEIELLEKLKDQRRVIQLLDYEMGDGLLYLIMECGDH-DLSQILNQRSNMPLDFNFV 541
           G + EI ++ KL +   V++L D    +  LYL++E  +  +L  +L +R  +P +   +
Sbjct: 77  GIEREI-IIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLP-ENEAI 134

Query: 542 RFYTKEMLLCIKVVHDAGIVHSDLKPANFVL-VKGILKIIDFGIANAVPEHTVNIYRETQ 600
           RF+ +++++ +   H  GIVH DLKP N +L  K  +KI DFG+A    E  +    ET 
Sbjct: 135 RFF-RQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEGKL---LETS 190

Query: 601 IGTPNYMAPEALVAMNYTQSSDNQHEGNKWKVGRPSDMWSCGCIIYQMIYGKPPYGSFQG 660
            G+P+Y APE +  + Y               G  SD+WSCG I++ ++ G+ P+    G
Sbjct: 191 CGSPHYAAPEIVSGIPYQ--------------GFASDVWSCGVILFALLTGRLPFDEEDG 236

Query: 661 QNR--LLAIMNPDVKIPFPEYTSNNEKIPKSAIELMKACLYRNPDKRWTVDKVLSSTFLQ 718
             R  LL +     ++P      +++++ + A +L+   L  +P +R     +L    LQ
Sbjct: 237 NIRTLLLKVQKGQFELP------SDDEVSREAQDLICKILTVDPKRRIKARDILKHPLLQ 290

Query: 719 PF 720
            +
Sbjct: 291 KY 292

>KAFR0D04100 Chr4 complement(809681..813034) [3354 bp, 1117 aa] {ON}
           Anc_1.52 YDR507C
          Length = 1117

 Score = 97.8 bits (242), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 71/243 (29%), Positives = 125/243 (51%), Gaps = 32/243 (13%)

Query: 483 GFKGEIELLEKLKDQRRVIQLLDYEMGDGLLYLIMECGDH-DLSQILNQRSNMPL-DFNF 540
           G + EI ++ KL +   V++L D    +  LY+++E  +  +L  +L ++   PL +   
Sbjct: 73  GIEREI-IIMKLLNHPNVLRLYDVWETNSNLYMVLEYAEKGELFNLLVEKG--PLQEQEA 129

Query: 541 VRFYTKEMLLCIKVVHDAGIVHSDLKPANFVL-VKGILKIIDFGIANAVPEHTVNIYRET 599
           +RF+ +++++ I   H  GIVH DLKP N +L  K  +KI DFG+A      T +   ET
Sbjct: 130 IRFF-RQIIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAAL---ETEDKLLET 185

Query: 600 QIGTPNYMAPEALVAMNYTQSSDNQHEGNKWKVGRPSDMWSCGCIIYQMIYGKPPYGSFQ 659
             G+P+Y APE +  + Y               G  SD+WSCG I++ ++ G+ P+    
Sbjct: 186 SCGSPHYAAPEIVSGIPYH--------------GFASDVWSCGVILFALLTGRLPFDEED 231

Query: 660 G--QNRLLAIMNPDVKIPFPEYTSNNEKIPKSAIELMKACLYRNPDKRWTVDKVLSSTFL 717
           G  +N LL + + + ++P      ++++I   A +L+   L  +P+KR     +L    L
Sbjct: 232 GNIRNLLLKVQSGEFEMP------SDDEISHEAQDLLAKILTVDPEKRIRARDILKHPLL 285

Query: 718 QPF 720
           Q +
Sbjct: 286 QKY 288

>Kpol_1031.10 s1031 (25064..28447) [3384 bp, 1127 aa] {ON}
           (25064..28447) [3384 nt, 1128 aa]
          Length = 1127

 Score = 97.8 bits (242), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 77/298 (25%), Positives = 141/298 (47%), Gaps = 32/298 (10%)

Query: 439 SQYEKIELLGRGGSSRVYKVKGSGNK-IYALKRXXXXXXXXXXXXGFKGEIELLEKLKDQ 497
           S  ++ E++GRG    VYK      K +YA+K               + EI+ L  LK  
Sbjct: 42  SSIKRTEVIGRGKFGVVYKGYHLKTKHVYAIK-VLNLDSDSDEVEDVQREIQFLASLKQV 100

Query: 498 RRVIQLLDYEMGDGLLYLIME-CGDHDLSQILNQRSNMPLDFNFVRFYTKEMLLCIKVVH 556
             + +     + D  L++IME C    L  +L  R  M +D  ++    +E+L  ++ +H
Sbjct: 101 PNITRYYGSYLQDTNLWIIMEYCAGGSLRTLL--RPGM-IDEKYIGVIMRELLTALQCIH 157

Query: 557 DAGIVHSDLKPANFVLV-KGILKIIDFGIANAVPEHTVNIYRETQIGTPNYMAPEALVAM 615
              ++H D+K AN ++  +G +K+ DFG+A  +  +  ++ R+T  GTP +MAPE ++  
Sbjct: 158 KDNVIHRDIKAANVLITNEGKVKLCDFGVAAQL--NQTSLRRQTMAGTPYWMAPEVIMEG 215

Query: 616 NYTQSSDNQHEGNKWKVGRPSDMWSCGCIIYQMIYGKPPYGSFQGQNRL-LAIMNPDVKI 674
            Y  +          KV    D+WS G   Y++  G PPY   +    + L   +   ++
Sbjct: 216 VYYDT----------KV----DIWSLGITAYEIATGNPPYCEIEALRAMQLITKSKPARL 261

Query: 675 PFPEYTSNNEKIPKSAIELMKACLYRNPDKRWTVDKVLSSTFLQPFMIS-GSIMEDLI 731
              +Y+S  +       E +  CL  +P +R + +++  S F++    S  +I+++LI
Sbjct: 262 EGRQYSSGLK-------EFIALCLDEDPKERLSAEELQKSKFIKAHKSSPTAILKELI 312

>KLLA0C06138g Chr3 (540409..542535) [2127 bp, 708 aa] {ON} similar
           to uniprot|P32562 Saccharomyces cerevisiae YMR001C
          Length = 708

 Score = 97.1 bits (240), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 66/227 (29%), Positives = 110/227 (48%), Gaps = 21/227 (9%)

Query: 432 SMITVNDSQYEKIELLGRGGSSRVYKVKGSGNKIYALKRXXXXX-XXXXXXXGFKGEIEL 490
           S+I      Y +   LG GG +R +++K    K++A K                  EI++
Sbjct: 81  SLIKTRGRDYHRGHFLGEGGFARCFQMKDDKGKVFAAKTVAKLSIKSEKTRRKLLSEIQI 140

Query: 491 LEKLKDQRRVIQLLDYEMGDGLLYLIME-CGDHDLSQILNQRSNMPLDFNFVRFYTKEML 549
            + +K    ++Q  D    D  +Y+++E C +  + ++L QR +  L    VRF   +++
Sbjct: 141 HKSMK-HPNIVQFTDCFEDDTNVYILLEICPNGSVMELLRQRKH--LTEPEVRFCMIQII 197

Query: 550 LCIKVVHDAGIVHSDLKPANFVLVKGI-LKIIDFGIANAVPEHTVNIYRETQIGTPNYMA 608
             I+ +H   ++H DLK  N    K   LKI DFG+A  +       Y  T  GTPNY+A
Sbjct: 198 GAIRYMHSRRVIHRDLKLGNIFFDKEYNLKIGDFGLAAVLANDKERKY--TICGTPNYIA 255

Query: 609 PEALVAMNYTQSSDNQHEGNKWKVGRPSDMWSCGCIIYQMIYGKPPY 655
           PE L           +H G+ ++V    D+WS G ++Y +++GKPP+
Sbjct: 256 PEVLTG---------KHTGHSYEV----DIWSIGVMLYALLFGKPPF 289

>Kpol_463.8 s463 complement(18696..23039) [4344 bp, 1447 aa] {ON}
            complement(18696..23039) [4344 nt, 1448 aa]
          Length = 1447

 Score = 97.8 bits (242), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 81/293 (27%), Positives = 135/293 (46%), Gaps = 37/293 (12%)

Query: 437  NDSQYEKIELLGRGGSSRVY-KVKGSGNKIYALKRXX------XXXXXXXXXXGFKGEIE 489
            N+  + K E++G+G    V+  +  +  ++ A+K+                    + E+ 
Sbjct: 1136 NEFAWMKGEMIGKGSFGAVFLAMNITTGEMMAVKQVEVPKYGLQNETVVNTVDALRLEVS 1195

Query: 490  LLEKLKDQRRVIQLLDYEMGDGLLYLIME--CGDHDLSQILNQRSNMPLDFNFVRFYTKE 547
             L+ L D   ++Q L +E  +G+  L +E   G    S I   R     D   +R  T +
Sbjct: 1196 TLKDL-DHLNIVQYLGFEAKNGIYSLFLEYVAGGSVGSLI---RMYGRFDDILIRHLTIQ 1251

Query: 548  MLLCIKVVHDAGIVHSDLKPANFVLVK-GILKIIDFGIANAVPEHTVNIYRETQI---GT 603
            +L  +  +H  GI+H D+K  N +L + G+ KI DFGI+      + +IY  +++   GT
Sbjct: 1252 VLQGLSYLHSRGILHRDMKADNLLLDQDGVCKISDFGIS----RKSNDIYSNSEMTMKGT 1307

Query: 604  PNYMAPEALVAMNYTQSSDNQHEGNKWKVGRPSDMWSCGCIIYQMIYGKPPYGSFQGQNR 663
              +MAPE +          +  +G   KV    D+WS GCI+ +M  GK P+ +F+    
Sbjct: 1308 VFWMAPEMV----------DTKQGYSAKV----DIWSLGCIVLEMFAGKRPWSNFEVVAA 1353

Query: 664  LLAIMNPDVKIPFPEYTSNNEKIPKSAIELMKACLYRNPDKRWTVDKVLSSTF 716
            +  I       P PE T     I ++A E +  C   +P+KR T DK+LS  F
Sbjct: 1354 MFKIGQAKSAPPIPEDTL--PLISENAKEFLDCCFEIDPEKRPTADKLLSHPF 1404

>TDEL0D03950 Chr4 (720229..721710) [1482 bp, 493 aa] {ON} Anc_3.229
           YBR028C
          Length = 493

 Score = 96.3 bits (238), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 105/423 (24%), Positives = 181/423 (42%), Gaps = 80/423 (18%)

Query: 339 IHNIHKEISRNKDSDSEKRGVLRNISINANHADNILQQDNKRLKRSLDDVITNENENKKI 398
           I ++ +++ R K SDSE   + +      +  D++       L    + +   +   ++ 
Sbjct: 2   IFHLDEDLGRLKLSDSEDSSLRQGPIAIFDERDDV-----DHLTVRTEPIPFKDGRTRRR 56

Query: 399 QEVFYHRPAPKPPVTKKVEIVEPAKSASSSNNRSMITVNDS---------QYEKIELLGR 449
             V    P   PP T++V I   +   +S +    I+ ND           +  + +LG+
Sbjct: 57  SSVLEKFPVSTPPCTRRVSITAASNPFTSGSLDLGISPNDGGTGLTRSLRDFRPVRVLGK 116

Query: 450 GGSSRVYKVKG-SGNKIYALKRXXXX----XXXXXXXXGFKGEIELLEKLKDQRRVIQLL 504
           G   +V  V+    +K+YA+K+                G K   +L+E+   +R ++  L
Sbjct: 117 GAYGKVVLVEDEQTSKLYAMKQLQKADIIITKDSEELNGDKNVSKLIERTFAERTILSEL 176

Query: 505 D--------YEMGD-GLLYLIMEC--GDHDLSQILNQRSNMPLDFNFVRFYTKEMLLCIK 553
           +        Y   D   LYLI++   G      +  Q +   LD + V FY  E+   +K
Sbjct: 177 EHPNIVKLFYSFHDNSKLYLILQYIPGGELFFHLKEQGT---LDEDTVAFYAAEISCALK 233

Query: 554 VVHDAGIVHSDLKPANFVLVK-GILKIIDFGIA-----------------NAVPEHTVNI 595
            +H  GIV+ DLKP N +L + G L + DFG++                 + + E   ++
Sbjct: 234 FLHSKGIVYRDLKPENCLLDQHGHLVLTDFGLSKKSVVQRDNPLSSSTEGDLLGEEVTSL 293

Query: 596 YRETQIGTPNYMAPEALVAMNYTQSSDNQHEGNKWKVGRPSDMWSCGCIIYQMIYGKPPY 655
           +  + IGTP Y APE L  + YT++ D       W        +S GC++Y M+ GKPP+
Sbjct: 294 H--SIIGTPEYCAPEILQGIPYTKNCD-------W--------YSLGCLMYDMMTGKPPH 336

Query: 656 GSFQGQNR--LLAIMNPDVKIP-FPEYTSNNEKIPKSAIELMKACLYRNPDKRWTVDKVL 712
               G N   +L  +  D + P  P Y S+  K      +++ A L +   KRW VD+  
Sbjct: 337 ---TGANHKVILNKIQKDKQGPKIPYYLSDGMK------DMLSALLKKEHTKRWDVDQYW 387

Query: 713 SST 715
            +T
Sbjct: 388 KNT 390

>TBLA0C02940 Chr3 complement(706091..711022) [4932 bp, 1643 aa] {ON}
            Anc_1.271 YJL095W
          Length = 1643

 Score = 97.8 bits (242), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 92/354 (25%), Positives = 157/354 (44%), Gaps = 36/354 (10%)

Query: 378  NKRLKRSLD-DVITNENENKKIQEVFYHRPAPKPPVTKKVEIVEPAKSASSSNNRSMITV 436
            N+RLKR+     I +E   K+ + V   R   K   TK VEI +    + + +       
Sbjct: 1274 NRRLKRTKTIRTIAHEANEKRRKSVKLKRQNTKMWGTKVVEITKKTNVSINKSKNDRGEY 1333

Query: 437  NDSQYEKIELLGRGGSSRVY-KVKGSGNKIYALKRX------XXXXXXXXXXXGFKGEIE 489
             +  + K EL+G+G    VY  +  +  ++ A+K+                    + E+ 
Sbjct: 1334 KEFAWVKGELIGKGSFGSVYLSLNVTTGEMMAVKQVEVPEFGSQNEAIVSTVEALRSEVT 1393

Query: 490  LLEKLKDQRRVIQLLDYEMGDGLLYLIME-CGDHDLSQILNQRSNMPLDFNFVRFYTKEM 548
            LL+ L D   ++Q L +E  + +  L +E      +  ++  R     D + +R  T ++
Sbjct: 1394 LLKDL-DHINIVQYLGFEKKNNIYSLFLEYVAGGSIGSLI--RMYGRFDESLIRHSTTQI 1450

Query: 549  LLCIKVVHDAGIVHSDLKPANFVL-VKGILKIIDFGIANAVPEHTVNIYRETQI---GTP 604
            L  +  +H  GI+H D+K  N +L  +GI KI DFGI+      + +IY  +++   GT 
Sbjct: 1451 LAGLSYLHSKGILHRDMKADNILLDGEGICKISDFGIS----RKSKDIYSNSEMTMRGTV 1506

Query: 605  NYMAPEALVAMNYTQSSDNQHEGNKWKVGRPSDMWSCGCIIYQMIYGKPPYGSFQGQNRL 664
             +MAPE +          +  +G   KV    D+WS GCII +M  GK P+ + +    +
Sbjct: 1507 FWMAPEMV----------DTKQGYSAKV----DIWSLGCIILEMFAGKRPWSNLEVVAAM 1552

Query: 665  LAIMNPDVKIPFPEYTSNNEKIPKSAIELMKACLYRNPDKRWTVDKVLSSTFLQ 718
              I       P PE T     I +   + +  C   +P+KR T +++L   F Q
Sbjct: 1553 FKIGQSKSAPPIPEDTL--PLISQDGRDFLDDCFKIDPEKRPTAEQMLDHLFSQ 1604

>KLTH0D03454g Chr4 (327039..331340) [4302 bp, 1433 aa] {ON} similar to
            uniprot|Q01389 Saccharomyces cerevisiae YJL095W BCK1
            Mitogen-activated protein (MAP) kinase kinase kinase
            acting in the protein kinase C signaling pathway which
            controls cell integrity upon activation by Pkc1p
            phosphorylates downstream kinases Mkk1p and Mkk2p
          Length = 1433

 Score = 97.8 bits (242), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 86/318 (27%), Positives = 142/318 (44%), Gaps = 37/318 (11%)

Query: 413  TKKVEIVEPAKSASSSNNRSMITVNDSQYEKIELLGRGGSSRVY-KVKGSGNKIYALKRX 471
            T+ VE+ +    A + +  S     +  + K E++G+G    VY  +  +  ++ A+K+ 
Sbjct: 1118 TRVVEVTDKKTVAINKSKNSNGEYKEFAWIKGEIIGKGSFGSVYLGLNVTTGEMMAVKQV 1177

Query: 472  ------XXXXXXXXXXXGFKGEIELLEKLKDQRRVIQLLDYEMGDGLLYLIME--CGDHD 523
                               K E+  L+ L D   ++Q L +E  + +  L +E   G   
Sbjct: 1178 EVPRYGSQDETTLSVLEALKSEVSTLKDL-DHVNIVQYLGFENKNHVYSLFLEYVAGGSV 1236

Query: 524  LSQILNQRSNMPLDFNFVRFYTKEMLLCIKVVHDAGIVHSDLKPANFVL-VKGILKIIDF 582
             S I   R     D + +RF   ++L  +  +H  GI+H D+K  N +L V GI KI DF
Sbjct: 1237 GSLI---RLFGRFDEDLIRFLAVQVLRGLAYLHSKGILHRDMKADNLLLDVDGICKISDF 1293

Query: 583  GIANAVPEHTVNIYRETQI---GTPNYMAPEALVAMNYTQSSDNQHEGNKWKVGRPSDMW 639
            GI+    + + NIY  + +   GT  +MAPE +          +  +G   KV    D+W
Sbjct: 1294 GIS----KKSNNIYSNSDMTMRGTVFWMAPEMV----------DTKQGYSAKV----DIW 1335

Query: 640  SCGCIIYQMIYGKPPYGSFQGQNRLLAIMNPDVKIPFPEYTSNNEKIPKSAIELMKACLY 699
            S GC++ +M  GK P+ +F+    +  I       P PE T   + +   A   + AC  
Sbjct: 1336 SLGCVVLEMFAGKRPWSNFEVVAAMFKIGKFKSAPPIPEDT--QKLLSAEAKSFLDACFE 1393

Query: 700  RNPDKRWTVDKVLSSTFL 717
             +P+KR T D +LS  F 
Sbjct: 1394 IDPEKRPTADDLLSHPFC 1411

>Smik_6.125 Chr6 (201071..202177) [1107 bp, 368 aa] {ON} YGR040W
           (REAL)
          Length = 368

 Score = 94.4 bits (233), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 89/321 (27%), Positives = 149/321 (46%), Gaps = 49/321 (15%)

Query: 439 SQYEKIELLGRGGSSRVYKV--KGSGNKIYALKRXXXXXXXXXXXXGFKGEIELLEKLKD 496
           SQY+ ++L+G G    V     K SG K+ A+K+              + EI+LL    +
Sbjct: 11  SQYKLVDLIGEGAYGTVCSAIHKPSGIKV-AIKKIQPFSKKLFVTRTIR-EIKLLRYFHE 68

Query: 497 QRRVIQLLDYEMGDGL-----LYLIMECGDHDLSQILNQR--SNMPLDFNFVRFYTKEML 549
              +I +LD      +     +YL+ E  + DL +++N +   +  L  + V+++T ++L
Sbjct: 69  HENIISILDKVRPVSIDKLNAVYLVEELMETDLQKVINNQNSGSSTLSDDHVQYFTYQIL 128

Query: 550 LCIKVVHDAGIVHSDLKPANFVLVKGI-LKIIDFGIANAVPEHTVNIYRETQIG------ 602
             +K +H A ++H D+KP+N +L     LK+ DFG+A  +   + +  RET +G      
Sbjct: 129 RALKSIHSAQVIHRDIKPSNLLLNSNCDLKVCDFGLARCLASSSDS--RETLVGFMTEYV 186

Query: 603 -TPNYMAPEALVAMN-YTQSSDNQHEGNKWKVGRPSDMWSCGCIIYQMIYGKPPYGSFQG 660
            T  Y APE ++    YT +                D+WSCGCI+ +MI GKP +     
Sbjct: 187 ATRWYRAPEIMLTFQEYTTA---------------MDIWSCGCILAEMISGKPLFPGRDY 231

Query: 661 QNRLLAIMNPDVKIPFPEYTSNNEKIPKSAIELMKACLYRNPDKRWTVDKVLSSTFLQPF 720
            ++L  I+     +  P +   N+   K A E + A L   P   W  + V S T L P 
Sbjct: 232 HHQLWLILE---VLGTPSFEDFNQIKSKRAKEYI-ANLPMRPPLPW--ETVCSKTGLNPD 285

Query: 721 MISGSIMEDLIKNAVRYGSEK 741
           MI      DL+   +++  +K
Sbjct: 286 MI------DLLNKMLQFNPDK 300

>Kpol_1028.16 s1028 complement(45186..47825) [2640 bp, 879 aa] {ON}
           complement(45186..47825) [2640 nt, 880 aa]
          Length = 879

 Score = 97.1 bits (240), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 80/306 (26%), Positives = 131/306 (42%), Gaps = 45/306 (14%)

Query: 423 KSASSSNNRSMITVNDSQYEKIELLGRGGSSRVYKVK-GSGNKIYALK-RXXXXXXXXXX 480
           ++ S SN    I V+ + +EKI LLG+G   +VY VK    N++YALK            
Sbjct: 463 RAKSFSNKFQDIIVSPNSFEKIRLLGQGDVGKVYLVKEKKSNRLYALKIFSKAEMIKRKK 522

Query: 481 XXGFKGEIELLEKLKDQRRVIQLLDYEMGDGLLYLIME-CGDHDLSQILNQRSNMPLDFN 539
                 E E+L    D   ++ L      +  LYL ME C   +  + L  R    +  +
Sbjct: 523 IKRILAEQEIL-ATSDHPFIVNLYHSFQSEDYLYLCMEYCMGGEFFRALQTRKTKCISED 581

Query: 540 FVRFYTKEMLLCIKVVHDAGIVHSDLKPANFVLVK-GILKIIDFGI---ANAVPEHTVNI 595
             RFY  E++  ++ +H  G ++ DLKP N +L K G + + DF +   A    +  V  
Sbjct: 582 DSRFYASEVVAALEYLHLMGFIYRDLKPENILLHKSGHIMLSDFDLSIQAKDAKDPVVKK 641

Query: 596 YRETQ----------------IGTPNYMAPEALVAMNYTQSSDNQHEGNKWKVGRPSDMW 639
           + ++                 +GT  Y+APE +    +T + D       W        W
Sbjct: 642 FAQSTVVDTKVCSDGFRTNSFVGTEEYIAPEVIRGNGHTAAVD-------W--------W 686

Query: 640 SCGCIIYQMIYGKPPYGSFQGQNRLLAIMNPDVKIPFPEYTSNNEKIPKSAIELMKACLY 699
           + G +IY+M++G  P+           ++  DV  P      NN +I ++  +L+K  L 
Sbjct: 687 TLGILIYEMLFGFTPFKGDNTNETFCNVLKNDVNFP------NNNEISRTCKDLIKKLLA 740

Query: 700 RNPDKR 705
           +N  KR
Sbjct: 741 KNEAKR 746

>TDEL0C06490 Chr3 complement(1191461..1194922) [3462 bp, 1153 aa]
           {ON} Anc_1.52 YDR507C
          Length = 1153

 Score = 97.1 bits (240), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 70/242 (28%), Positives = 122/242 (50%), Gaps = 30/242 (12%)

Query: 483 GFKGEIELLEKLKDQRRVIQLLDYEMGDGLLYLIMECGDH-DLSQILNQRSNMPLDFNFV 541
           G + EI ++ KL +   V++L D    +  LY+++E     +L  +L +R  +P +   +
Sbjct: 78  GIEREI-IIMKLLNHPNVLRLYDVWETNSNLYMVLEYAQKGELFNLLVERGPLP-EKEAI 135

Query: 542 RFYTKEMLLCIKVVHDAGIVHSDLKPANFVLV-KGILKIIDFGIANAVPEHTVNIYRETQ 600
           RF+ +++++ I   H  GIVH DLKP N +L  K  +KI DFG+A      T +   ET 
Sbjct: 136 RFF-RQIVIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAAL---ETEDKLLETS 191

Query: 601 IGTPNYMAPEALVAMNYTQSSDNQHEGNKWKVGRPSDMWSCGCIIYQMIYGKPPYGSFQG 660
            G+P+Y APE +  + Y               G  SD+WSCG I++ ++ G+ P+    G
Sbjct: 192 CGSPHYAAPEIVSGIPYH--------------GFASDVWSCGVILFALLTGRLPFDDEDG 237

Query: 661 --QNRLLAIMNPDVKIPFPEYTSNNEKIPKSAIELMKACLYRNPDKRWTVDKVLSSTFLQ 718
             +N LL + +   ++P       +++I   A +L+   L  +P++R     +L    LQ
Sbjct: 238 NIRNLLLQVQSGRYEMP------GDDEISPDAQDLIARILTVDPEQRIKARDILKHPLLQ 291

Query: 719 PF 720
            +
Sbjct: 292 KY 293

>KAFR0K00700 Chr11 complement(153981..158126) [4146 bp, 1381 aa] {ON}
            Anc_7.86 YAL017W
          Length = 1381

 Score = 97.1 bits (240), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 72/239 (30%), Positives = 120/239 (50%), Gaps = 39/239 (16%)

Query: 486  GEIELLEKL--KDQRRVIQLLDYEMGDGLLYLIM----ECGDHDLSQILNQRSNMPLDFN 539
             EI+++  L  K    +++LLD+   D   Y+      E G  DL  ++   SNM  +F 
Sbjct: 1173 SEIQIMATLNKKPHENILRLLDFFEDDEYYYIETPVHGETGSIDLFDLIEFTSNMT-EFE 1231

Query: 540  FVRFYTKEMLLCIKVVHDAGIVHSDLKPANFVLV-KGILKIIDFGIANAVPEHTVNIYRE 598
             ++   K+++  +K +HD GIVH D+K  N ++  KG +KIIDFG A  V     +++  
Sbjct: 1232 -IKLLFKQVVSGVKHLHDQGIVHRDIKDENIIVDNKGFIKIIDFGSAAYVKSGPFDVF-- 1288

Query: 599  TQIGTPNYMAPEALVAMNYTQSSDNQHEGNKWKVGRPSDMWSCGCIIYQMIYGKPPYGSF 658
              +GT +Y APE L              GN ++ G+P D+W+ G ++Y +++ + P+ + 
Sbjct: 1289 --VGTIDYAAPEVL-------------GGNPYE-GKPQDIWALGILLYTIVFKENPFYNI 1332

Query: 659  QGQNRLLAIMNPDVKIPFPEYTSNNEKIPKSAIELMKACLYRNPDKRWTVDKVLSSTFL 717
                    I+  D+K   P      E I +  IEL+K  L RN  KR T+D + +  +L
Sbjct: 1333 D------EILEGDLKFNDP------ENISQDCIELIKLILNRNVFKRPTIDDIYNDKWL 1379

>TPHA0E03640 Chr5 complement(769962..773375) [3414 bp, 1137 aa] {ON}
           Anc_1.52 YDR507C
          Length = 1137

 Score = 97.1 bits (240), Expect = 8e-20,   Method: Compositional matrix adjust.
 Identities = 70/243 (28%), Positives = 123/243 (50%), Gaps = 32/243 (13%)

Query: 483 GFKGEIELLEKLKDQRRVIQLLDYEMGDGLLYLIMECGDH-DLSQILNQRSNMPLDFN-F 540
           G + EI ++ KL +   V++L D    +  LY+++E  +  +L  +L ++   PL  N  
Sbjct: 89  GIEREI-IIMKLLNHTNVLRLYDVWETNNNLYMVLEYAEKGELFNLLVEKG--PLAENEA 145

Query: 541 VRFYTKEMLLCIKVVHDAGIVHSDLKPANFVLV-KGILKIIDFGIANAVPEHTVNIYRET 599
           VRF+ +++++ +   H  GIVH DLKP N +L  K  +KI DFG+A    E  +    ET
Sbjct: 146 VRFF-RQIIIGMSYCHALGIVHRDLKPENILLDHKSNIKIADFGMAALETEDKL---LET 201

Query: 600 QIGTPNYMAPEALVAMNYTQSSDNQHEGNKWKVGRPSDMWSCGCIIYQMIYGKPPYGSFQ 659
             G+P+Y APE +  + Y               G  +D+WSCG I++ ++ G+ P+    
Sbjct: 202 SCGSPHYAAPEIVSGLPYN--------------GLETDIWSCGVILFALLTGRLPFDEED 247

Query: 660 G--QNRLLAIMNPDVKIPFPEYTSNNEKIPKSAIELMKACLYRNPDKRWTVDKVLSSTFL 717
           G  +N LL +   + ++P       ++++   A +L+   L  NP +R    ++L    L
Sbjct: 248 GNIRNLLLKVQKGEFEMP------GSDELSLEAQDLIGKILTVNPKQRIKTREILKHPLL 301

Query: 718 QPF 720
           Q +
Sbjct: 302 QKY 304

>NDAI0D04050 Chr4 (952438..953538) [1101 bp, 366 aa] {ON} Anc_4.184
          Length = 366

 Score = 93.6 bits (231), Expect = 8e-20,   Method: Compositional matrix adjust.
 Identities = 81/324 (25%), Positives = 144/324 (44%), Gaps = 61/324 (18%)

Query: 439 SQYEKIELLGRGGSSRVYKV--KGSGNKIYALKRXXXXXXXXXXXXGFKGEIELLEKLKD 496
           SQY+ ++L+G G    V     K SG K+ A+K+              + EI+LL    +
Sbjct: 11  SQYQLVDLIGEGAYGTVCSAIHKPSGVKV-AIKKIQPFSKAMFVTRTLR-EIKLLTYFHN 68

Query: 497 QRRVIQLLDYEMGDGL-----LYLIMECGDHDLSQILNQRSNMPLDFNFVRFYTKEMLLC 551
              +I +LD      +     +YL+ E  + DL +I+   +N PL  + ++++T ++L  
Sbjct: 69  HENIISILDKVKPISVNKLNAVYLVQELMETDLQKIIMNSNNNPLSDDHIQYFTYQILRA 128

Query: 552 IKVVHDAGIVHSDLKPANFVLVKGI-LKIIDFGIANAVPEHTVNIYRETQIG-------T 603
           +K +H A ++H DLKP+N +L     LK+ DFG++  +   + +  RET +G       T
Sbjct: 129 LKAIHSAQVIHRDLKPSNLLLNSNCDLKVCDFGLSRCLTSSSDS--RETLVGFMTEYVAT 186

Query: 604 PNYMAPEALVAMN-YTQSSDNQHEGNKWKVGRPSDMWSCGCIIYQMIYGKPPYGSFQGQN 662
             Y APE ++    YT +                D+WS GCI+ +M+ G+P +      +
Sbjct: 187 RWYRAPEIMLTFQEYTTA---------------MDIWSVGCILAEMVSGRPLFPGRDYHH 231

Query: 663 RLLAIM------------------------NPDVKIPFPEYTSNNEK--IPKSAIELMKA 696
           +L  I+                        N  ++ P P     N +  +    ++L+  
Sbjct: 232 QLWLILEVLGTPSLEDFAQIKSKRAKEYISNLPMRSPMPWVNVLNTQRNLNPDMLDLLTK 291

Query: 697 CLYRNPDKRWTVDKVLSSTFLQPF 720
            L  NP+KR T  + L+  +L  +
Sbjct: 292 MLLFNPNKRITAAEALNHPYLATY 315

>ABL034W Chr2 (333432..337709) [4278 bp, 1425 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YKL101W (HSL1)
          Length = 1425

 Score = 97.1 bits (240), Expect = 8e-20,   Method: Compositional matrix adjust.
 Identities = 88/326 (26%), Positives = 139/326 (42%), Gaps = 50/326 (15%)

Query: 447 LGRGGSSRVYKVKG-SGNKIYALK------RXXXXXXXXXXXXGFKGEIELLEKLKDQRR 499
           LG+G S RV   K     K+ A+K                   G + EI ++ KL     
Sbjct: 67  LGKGSSGRVRLAKNMQSGKLAAIKIVPKRNVRHNQKQVTALPYGIEREI-IIMKLITHPN 125

Query: 500 VIQLLDYEMGDGLLYLIME-CGDHDLSQILNQRSNMPLDFNFVRFYTKEMLLCIKVVHDA 558
           ++ L +       LYL++E     +L   L  R  +P        Y K+++  +   H+ 
Sbjct: 126 IMALYEVWENKSELYLVLEYVEGGELFDYLIARGKLPEQEAI--HYFKQIVQGVSYCHNF 183

Query: 559 GIVHSDLKPANFVLVKG--ILKIIDFGIANAVPEHTVNIYRETQIGTPNYMAPEALVAMN 616
            I H DLKP N +L K    +KI DFG+A      T N   ET  G+P+Y +PE ++   
Sbjct: 184 NICHRDLKPENLLLDKKNKTVKIADFGMAAL---ETTNRLLETSCGSPHYASPEIVMGQK 240

Query: 617 YTQSSDNQHEGNKWKVGRPSDMWSCGCIIYQMIYGKPPYGSFQGQNRLLAIMNPDVKIPF 676
           Y               G PSD+WSCG I++ ++ G  P+     +  LL + +   ++P 
Sbjct: 241 YH--------------GSPSDVWSCGIILFALLTGHLPFNDDNVRKLLLKVQHGRYQMP- 285

Query: 677 PEYTSNNEKIPKSAIELMKACLYRNPDKRWTVDKVLSSTFLQPFMISGSIMEDLIKNAVR 736
                    + K A +L+   L  +P+KR TVDK+L    L  +   G       K  + 
Sbjct: 286 -------SNVSKEAKDLISKILVVDPEKRITVDKILEHPLLVKYDNPG-------KGGLA 331

Query: 737 YGSEKPQ-----ISHDDLNDVVETVL 757
              EKP+     +    ++D+ ET+L
Sbjct: 332 CPLEKPEERPKVLDIHSIDDIDETIL 357

>TBLA0B01630 Chr2 (360963..364850) [3888 bp, 1295 aa] {ON} Anc_3.177
           YAR019C
          Length = 1295

 Score = 96.7 bits (239), Expect = 9e-20,   Method: Compositional matrix adjust.
 Identities = 80/287 (27%), Positives = 134/287 (46%), Gaps = 33/287 (11%)

Query: 436 VNDSQYEKIELLGRGGSSRVYK-VKGSGNKIYALKRXXXXXXXXXXXXGFKGEIELLEKL 494
           V  +QY  I ++G+G    VYK V    N++ A+K+                EI LL+ L
Sbjct: 74  VTKAQYGLINVIGKGSFGVVYKAVNRQTNQVIAIKQVNYDNDEELN--DIMSEINLLKNL 131

Query: 495 KDQRRVIQLLDYEMGDGLLYLIME-CGDHDLSQILNQRSNMPLDFNFVRFYTKEMLLCIK 553
            + + +++   +      LY+++E C    L  +++    +P      + Y  + L  + 
Sbjct: 132 -NHKHIVKYHGFMQKSDTLYILLEYCAHGSLKNLISSSKGIPEKD--AQQYIIQTLYGLV 188

Query: 554 VVHDAGIVHSDLKPANFVLVK-GILKIIDFGIANAVPEHTVNIYRETQIGTPNYMAPEAL 612
            +H  G++H D+K AN +L K   +K+ DFG++  V   T+ +   T  G+ N+MAPE L
Sbjct: 189 YLHAQGVIHRDIKAANILLDKDNTVKLADFGVSTRVGNATMAM---TLAGSLNWMAPEIL 245

Query: 613 VAMNYTQSSDNQHEGNKWKVGRPSDMWSCGCIIYQMIYGKPPYGSFQGQNRLLAIMNPDV 672
                         GNK      SD+WS G  + ++I G PP+ +    N   AI N D 
Sbjct: 246 --------------GNK-GASTLSDIWSLGATVVELITGNPPFHNLVDINIYYAIEN-DN 289

Query: 673 KIPFPEYTSNNEKIPKSAIELMKACLYRNPDKRWTVDKVLSSTFLQP 719
            IP PE         ++AI+ +  C  +N  +R T  ++L+  +LQP
Sbjct: 290 YIP-PE-----GAFSETAIDFLNLCFKKNMYRRPTAQQLLNHKWLQP 330

>TPHA0H02630 Chr8 complement(614048..618151) [4104 bp, 1367 aa] {ON}
            Anc_7.86 YAL017W
          Length = 1367

 Score = 96.7 bits (239), Expect = 9e-20,   Method: Compositional matrix adjust.
 Identities = 68/239 (28%), Positives = 121/239 (50%), Gaps = 39/239 (16%)

Query: 487  EIELLEKLKD--QRRVIQLLDYEMGDGLLY----LIMECGDHDLSQILNQRSNMPLDFNF 540
            EI+++  L       ++QLLD+   D   Y    L  E G  DL  ++  +SNM    + 
Sbjct: 1160 EIQIMTTLNKSPHENIMQLLDFFEDDDYYYIETPLHGETGCIDLFDLIEFKSNMTE--SE 1217

Query: 541  VRFYTKEMLLCIKVVHDAGIVHSDLKPANFVL-VKGILKIIDFGIANAVPEHTVNIYRET 599
             R    +++L IK +HD+ IVH D+K  N ++  KG +K+IDFG A  V     +++   
Sbjct: 1218 ARLIFIQVVLGIKHLHDSNIVHRDVKDENVIVDAKGFVKLIDFGSAAYVNSGPFDVF--- 1274

Query: 600  QIGTPNYMAPEALVAMNYTQSSDNQHEGNKWKVGRPSDMWSCGCIIYQMIYGKPPYGSFQ 659
             +GT +Y APE L    Y              +G+P D+W+ G ++Y +++ + P+ +  
Sbjct: 1275 -VGTIDYAAPEVLSGEPY--------------LGKPQDIWAIGILLYTIMFKENPFYNID 1319

Query: 660  GQNRLLAIMNPDVKIPFPEYTSNNEKIPKSAIELMKACLYRNPDKRWTVDKVLSSTFLQ 718
                   I+  ++KI      +N     +  I+L+K  L +NP+KR T+D++++  +L+
Sbjct: 1320 ------EILEAELKI------NNTSDASQDCIDLIKRILTKNPNKRPTIDEIVNDKWLK 1366

>Kpol_1037.52 s1037 complement(128841..130379) [1539 bp, 512 aa]
           {ON} complement(128841..130379) [1539 nt, 513 aa]
          Length = 512

 Score = 95.1 bits (235), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 70/241 (29%), Positives = 104/241 (43%), Gaps = 48/241 (19%)

Query: 488 IELLEKLKDQRRVIQLLDYEMGDGLLYLIMECGDHDLSQILNQRSNMPLDFNFVRFYTKE 547
           ++L     D+ ++  LL Y  G  L + + E G               L  + V FYT E
Sbjct: 201 VKLFYAFHDESKLYLLLQYIPGGELFFHLKEHG--------------TLQEDTVAFYTAE 246

Query: 548 MLLCIKVVHDAGIVHSDLKPANFVL-VKGILKIIDFGIANAVPEHTVNIYRETQ------ 600
           +   +K +H  GIV+ DLKP N +L  +G L + DFG++    E   ++  + +      
Sbjct: 247 ISCALKFLHSKGIVYRDLKPENCLLNERGHLVLTDFGLSKIAVEQNEDVGEDHEAEGENI 306

Query: 601 ------IGTPNYMAPEALVAMNYTQSSDNQHEGNKWKVGRPSDMWSCGCIIYQMIYGKPP 654
                 IGTP Y APE L  + Y+Q+ D       W        +S GC+IY M+ GKPP
Sbjct: 307 TELYSIIGTPEYCAPEILQGLPYSQNCD-------W--------YSLGCLIYDMLIGKPP 351

Query: 655 YGSFQGQNRLLAIMNPDVKIPFPEYTSNNEKIPKSAIELMKACLYRNPDKRWTVDKVLSS 714
           Y     +  L  I         P Y S+  K      +++ A L +   KRW VD+    
Sbjct: 352 YTGVNHKIILNKIQKDKQGPKLPYYLSDGMK------DVLGALLKKESKKRWDVDQYWKE 405

Query: 715 T 715
           T
Sbjct: 406 T 406

>Suva_2.157 Chr2 complement(275484..277064) [1581 bp, 526 aa] {ON}
           YBR028C (REAL)
          Length = 526

 Score = 95.1 bits (235), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 78/245 (31%), Positives = 104/245 (42%), Gaps = 60/245 (24%)

Query: 488 IELLEKLKDQRRVIQLLDYEMGDGLLYLIMECGDHDLSQILNQRSNMPLDFNFVRFYTKE 547
           ++L     D  ++  LL Y  G  L Y + E G               LD   V FY  E
Sbjct: 216 VKLFYSFHDNSKLYLLLQYIPGGELFYHLKEHGT--------------LDETTVSFYAAE 261

Query: 548 MLLCIKVVHDAGIVHSDLKPANFVLVK-GILKIIDFGI---------ANAVPEHTVNIYR 597
           +   ++ +H  G+V+ DLKP N +L + G L + DFG+         AN      VN   
Sbjct: 262 ISCALRFLHTKGVVYRDLKPENCLLNQNGHLVLTDFGLSKKSADDSMANEEDPENVNTLH 321

Query: 598 ETQIGTPNYMAPEALVAMNYTQSSDNQHEGNKWKVGRPSDMWSCGCIIYQMIYGKPPYGS 657
              IGTP Y APE L    YTQ+ D       W        +S GC++Y M+ GKPPY  
Sbjct: 322 SI-IGTPEYCAPEILSGQAYTQNCD-------W--------YSLGCLLYDMLVGKPPY-- 363

Query: 658 FQGQNRLLAI-------MNPDVKIPFPEYTSNNEKIPKSAIELMKACLYRNPDKRWTVDK 710
             G N  + I         P  KIPF  Y S   K      +++ A L +   KRW VDK
Sbjct: 364 -TGNNHKVIINKIQQNKQGP--KIPF--YLSEGMK------DMLNALLKKETSKRWNVDK 412

Query: 711 VLSST 715
             + T
Sbjct: 413 YWAKT 417

>ACL104C Chr3 complement(157357..160200) [2844 bp, 947 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YHR102W
           (KIC1)
          Length = 947

 Score = 96.3 bits (238), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 82/305 (26%), Positives = 142/305 (46%), Gaps = 31/305 (10%)

Query: 441 YEKIELLGRGGSSRVYKVKGSGNK-IYALKRXXXXXXXXXXXXGFKGEIELLEKLKDQRR 499
           +++ E++GRG    VYK   +  K +YA+K               + EI+ L  LK    
Sbjct: 25  FKRTEVIGRGKFGVVYKAYHAKTKQVYAVK-VLNLDCPEDEVEDVQKEIQFLASLKQVPN 83

Query: 500 VIQLLDYEMGDGLLYLIME-CGDHDLSQILNQRSNMPLDFNFVRFYTKEMLLCIKVVHDA 558
           + +     + D  L++IME C    L  +L       +D  ++    +++L+ +  +H  
Sbjct: 84  ITRYYGSYLYDTKLWVIMEYCAGGSLRTLLRPGK---IDEKYLGVIVRKLLIALVYIHKD 140

Query: 559 GIVHSDLKPANFVLV-KGILKIIDFGIANAVPEHTVNIYRETQIGTPNYMAPEALVAMNY 617
            ++H D+K AN ++  +G +K+ DFG+A  +     N  R+T  GTP +MAPE ++   Y
Sbjct: 141 NVIHRDIKAANVLITNEGHVKLCDFGVAAQL--TAANHKRQTMAGTPYWMAPEVIMEGVY 198

Query: 618 TQSSDNQHEGNKWKVGRPSDMWSCGCIIYQMIYGKPPYGSFQGQNRLLAIMNPDVKIPFP 677
             +               +D+WS G   Y++  G PPY   +    +  I     K P  
Sbjct: 199 YNTK--------------ADIWSLGITAYEIATGNPPYCDVEALRAMQLITK--SKPPRL 242

Query: 678 EYTSNNEKIPKSAIELMKACLYRNPDKRWTVDKVLSSTFLQPFM-ISGSIMEDLIKNAVR 736
           E   N   + K  I L   CL  +P++R T + +LSS F++     S +I+++LI   + 
Sbjct: 243 E-GRNYSPLLKEFIAL---CLDEDPEERPTAEDLLSSKFVKAHKGSSATILKELISRYLL 298

Query: 737 YGSEK 741
           + SEK
Sbjct: 299 F-SEK 302

>Kwal_26.7355 s26 (326867..331207) [4341 bp, 1446 aa] {ON} YJL095W
            (BCK1) - MEKK serine/threonine kinase [contig 48] FULL
          Length = 1446

 Score = 96.3 bits (238), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 75/246 (30%), Positives = 114/246 (46%), Gaps = 34/246 (13%)

Query: 483  GFKGEIELLEKLKDQRRVIQLLDYEMGDGLLYLIME--CGDHDLSQILNQRSNMPLDFNF 540
              + E+  L+ L D   ++Q L +E  + +  L +E   G    S I   R     D N 
Sbjct: 1195 ALRSEVATLKDL-DHTNIVQYLGFENKNYVYSLFLEYVAGGSVGSLI---RLYGKFDENL 1250

Query: 541  VRFYTKEMLLCIKVVHDAGIVHSDLKPANFVL-VKGILKIIDFGIANAVPEHTVNIYRET 599
            +RF   ++L  +  +H   I+H D+K  N +L V GI KI DFGI+    + + NIY  +
Sbjct: 1251 IRFLAVQVLRGLSYLHSKKILHRDMKADNLLLDVDGICKISDFGIS----KKSNNIYSNS 1306

Query: 600  QI---GTPNYMAPEALVAMNYTQSSDNQHEGNKWKVGRPSDMWSCGCIIYQMIYGKPPYG 656
             +   GT  +MAPE +          +  +G   KV    D+WS GC++ +M  GK P+ 
Sbjct: 1307 DMTMRGTVFWMAPEMV----------DTKQGYSAKV----DIWSLGCVVLEMFAGKRPWS 1352

Query: 657  SFQGQNRLLAIMNPDVKIPFPEYTSNNEKIPKSAIELMKACLYRNPDKRWTVDKVLSSTF 716
            + +    +  I       P PE T   + I     E + AC   NP+KR T D++LS   
Sbjct: 1353 NLEVVAAMFKIGKFKSAPPIPEDT--QKIISAEGKEFLDACFEINPEKRPTADELLS--- 1407

Query: 717  LQPFMI 722
              PF I
Sbjct: 1408 -HPFCI 1412

>TPHA0I00920 Chr9 (204753..209057) [4305 bp, 1434 aa] {ON} Anc_1.271
            YJL095W
          Length = 1434

 Score = 96.3 bits (238), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 83/325 (25%), Positives = 147/325 (45%), Gaps = 40/325 (12%)

Query: 437  NDSQYEKIELLGRGGSSRVY-KVKGSGNKIYALKR------XXXXXXXXXXXXGFKGEIE 489
            N+  + K E++G+G    V+  +  +  ++ A+K+                    K E+ 
Sbjct: 1131 NEFAWMKGEMIGKGSFGAVFLSLNITTGEMMAVKQIEVPSYGSQSETMLNTVEAMKSEVS 1190

Query: 490  LLEKLKDQRRVIQLLDYEMGDGLLYLIME--CGDHDLSQILNQRSNMPLDFNFVRFYTKE 547
             L+ L D   ++Q L +EM   +  L +E   G    S I   R     D   +R  T +
Sbjct: 1191 TLKDL-DHLNIVQYLGFEMKHNIYSLFLEYVAGGSVGSLI---RMYGRFDDKLIRHLTNQ 1246

Query: 548  MLLCIKVVHDAGIVHSDLKPANFVLVK-GILKIIDFGIANAVPEHTVNIYRETQI---GT 603
            +L  +  +H  GI+H D+K  N +L + GI KI DFGI+    + + +IY  +++   GT
Sbjct: 1247 VLEGLSYLHSQGILHRDMKADNLLLDQDGICKISDFGIS----KKSEDIYSNSEMTMRGT 1302

Query: 604  PNYMAPEALVAMNYTQSSDNQHEGNKWKVGRPSDMWSCGCIIYQMIYGKPPYGSFQGQNR 663
              +MAPE +          +  +G   KV    D+WS GC++ +M  GK P+ +F+    
Sbjct: 1303 VFWMAPEMV----------DTKQGYNAKV----DIWSLGCVVLEMFAGKRPWSNFEVVTA 1348

Query: 664  LLAIMNPDVKIPFPEYTSNNEKIPKSAIELMKACLYRNPDKRWTVDKVLSSTFL---QPF 720
            +  I       P PE T   + I  +A   +  C + +P +R T  ++L   F      F
Sbjct: 1349 MYKIGQSKSAPPIPEDT--KDLISPTAKNFLNQCFHIDPKERPTAGQLLEHPFCYNDDSF 1406

Query: 721  MISGSIMEDLIKNAVRYGSEKPQIS 745
            + + + + + IK+  +  S K +I+
Sbjct: 1407 IFNKTKLAEFIKSNDKINSTKLRIT 1431

>Kwal_55.21545 s55 complement(882294..884891) [2598 bp, 865 aa] {ON}
           YHR102W (KIC1) - PAK/Ste20 kinase family [contig 128]
           FULL
          Length = 865

 Score = 95.9 bits (237), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 77/310 (24%), Positives = 139/310 (44%), Gaps = 28/310 (9%)

Query: 425 ASSSNNRSMITVNDSQYEKIELLGRGGSSRVYKVKGSGNKIYALKRXXXXXXXXXXXXGF 484
           +S +NN S  +   + +++ E++GRG    VYK   +  K     +              
Sbjct: 3   SSKANNGSSRSSVSTLFKRTEVIGRGKFGVVYKGYYTKTKQVCAIKVLNLDSADDEVEDV 62

Query: 485 KGEIELLEKLKDQRRVIQLLDYEMGDGLLYLIME-CGDHDLSQILNQRSNMPLDFNFVRF 543
           + EI+ L  LK    +       + D  L++IME C    L  +L       +   ++  
Sbjct: 63  QKEIQFLSSLKQVPNITHYYGSYLNDTKLWVIMEYCAGGSLRTLLRPGK---IGEQYIGV 119

Query: 544 YTKEMLLCIKVVHDAGIVHSDLKPANFVLVK-GILKIIDFGIANAVPEHTVNIYRETQIG 602
             +E+L  +  +H  G++H D+K AN ++   G +K+ DFG+A  + +    I R+T  G
Sbjct: 120 IMRELLTALMHIHKDGVIHRDIKAANVLITNDGHIKLCDFGVAAQLSQ--TKIRRQTMAG 177

Query: 603 TPNYMAPEALVAMNYTQSSDNQHEGNKWKVGRPSDMWSCGCIIYQMIYGKPPYGSFQGQN 662
           TP +MAPE ++   Y  +          KV    D+WS G   Y++  G PPY   +   
Sbjct: 178 TPYWMAPEVIMEGVYYDT----------KV----DIWSLGITAYEIATGNPPYCEVEALR 223

Query: 663 RLLAIMNPDVKIPFPEYTSNNEKIPKSAIELMKACLYRNPDKRWTVDKVLSSTFLQPFM- 721
            +  I     K P  E   ++  +     E++  CL  +P +R + + +L + F++    
Sbjct: 224 AMQLITK--SKPPRLEGRQHSSALK----EIIALCLDEDPKERPSAEDLLKTKFIKLHKN 277

Query: 722 ISGSIMEDLI 731
           +  SI+++LI
Sbjct: 278 VPVSILKELI 287

>YGR040W Chr7 (575398..576504) [1107 bp, 368 aa] {ON}
           KSS1Mitogen-activated protein kinase (MAPK) involved in
           signal transduction pathways that control filamentous
           growth and pheromone response; the KSS1 gene is
           nonfunctional in S288C strains and functional in W303
           strains
          Length = 368

 Score = 92.8 bits (229), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 88/321 (27%), Positives = 150/321 (46%), Gaps = 49/321 (15%)

Query: 439 SQYEKIELLGRGGSSRVYKV--KGSGNKIYALKRXXXXXXXXXXXXGFKGEIELLEKLKD 496
           SQY+ ++L+G G    V     K SG K+ A+K+              + EI+LL    +
Sbjct: 11  SQYKLVDLIGEGAYGTVCSAIHKPSGIKV-AIKKIQPFSKKLFVTRTIR-EIKLLRYFHE 68

Query: 497 QRRVIQLLDYEMGDGL-----LYLIMECGDHDLSQILNQRSN--MPLDFNFVRFYTKEML 549
              +I +LD      +     +YL+ E  + DL +++N +++    L  + V+++T ++L
Sbjct: 69  HENIISILDKVRPVSIDKLNAVYLVEELMETDLQKVINNQNSGFSTLSDDHVQYFTYQIL 128

Query: 550 LCIKVVHDAGIVHSDLKPANFVLVKGI-LKIIDFGIANAVPEHTVNIYRETQIG------ 602
             +K +H A ++H D+KP+N +L     LK+ DFG+A  +   + +  RET +G      
Sbjct: 129 RALKSIHSAQVIHRDIKPSNLLLNSNCDLKVCDFGLARCLASSSDS--RETLVGFMTEYV 186

Query: 603 -TPNYMAPEALVAMN-YTQSSDNQHEGNKWKVGRPSDMWSCGCIIYQMIYGKPPYGSFQG 660
            T  Y APE ++    YT +                D+WSCGCI+ +M+ GKP +     
Sbjct: 187 ATRWYRAPEIMLTFQEYTTA---------------MDIWSCGCILAEMVSGKPLFPGRDY 231

Query: 661 QNRLLAIMNPDVKIPFPEYTSNNEKIPKSAIELMKACLYRNPDKRWTVDKVLSSTFLQPF 720
            ++L  I+     +  P +   N+   K A E + A L   P   W  + V S T L P 
Sbjct: 232 HHQLWLILE---VLGTPSFEDFNQIKSKRAKEYI-ANLPMRPPLPW--ETVWSKTDLNPD 285

Query: 721 MISGSIMEDLIKNAVRYGSEK 741
           MI      DL+   +++  +K
Sbjct: 286 MI------DLLDKMLQFNPDK 300

>KLTH0G17512g Chr7 complement(1518329..1519426) [1098 bp, 365 aa]
           {ON} highly similar to uniprot|P14681 Saccharomyces
           cerevisiae YGR040W KSS1 Mitogen-activated protein kinase
           (MAPK) involved in signal transduction pathways that
           control filamentous growth and pheromone response
          Length = 365

 Score = 92.8 bits (229), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 83/319 (26%), Positives = 142/319 (44%), Gaps = 59/319 (18%)

Query: 439 SQYEKIELLGRGGSSRVYKV--KGSGNKIYALKRXXXXXXXXXXXXGFKGEIELLEKLKD 496
           S Y+ +EL+G G    V     K SG K+ A+K+              + E++LL+    
Sbjct: 11  SCYQLVELVGEGAYGTVCSAVHKPSGTKV-AIKKIQPFAKQMFVTRTLR-ELKLLKLFHS 68

Query: 497 QRRVIQLLDYEMGDGL-----LYLIMECGDHDLSQILNQRSNMPLDFNFVRFYTKEMLLC 551
              +I +LD      +     +YL+ E  + DL ++++   +  L  + ++++T ++L  
Sbjct: 69  HENIISVLDVVRPTSMDKFQAVYLVQELMETDLHKVISGGGS-SLSDDHIQYFTYQILRA 127

Query: 552 IKVVHDAGIVHSDLKPANFVLVKGI-LKIIDFGIANAVPEHT-----VNIYRETQIGTPN 605
           +K +H A ++H D+KP+N +L     LK+ DFG+A  +   T     +  +    + T  
Sbjct: 128 LKAIHSAQVIHRDIKPSNLLLNSNCDLKVCDFGLARCLASSTHSRQNLVGFMTEYVATRW 187

Query: 606 YMAPEALVAM-NYTQSSDNQHEGNKWKVGRPSDMWSCGCIIYQMIYGKPPYGSFQGQNRL 664
           Y APE ++    YT +                D+WSCGCI+ +MI GKP +      ++L
Sbjct: 188 YRAPEIMLTFQQYTTA---------------MDIWSCGCILAEMITGKPLFPGRDYHHQL 232

Query: 665 LAIMNPDVKIP------------FPEYTSN---NEKIP-----------KSAIELMKACL 698
             I+   V  P              EY +N    +K+P             AI+L+   L
Sbjct: 233 WLILEA-VGTPSYEDFENINSKRAKEYIANLPLRQKLPWQVVLQTQEVNPDAIDLLDRML 291

Query: 699 YRNPDKRWTVDKVLSSTFL 717
             NPDKR +  + LS  +L
Sbjct: 292 TFNPDKRISAVEALSHPYL 310

>TDEL0E02180 Chr5 complement(408232..411195) [2964 bp, 987 aa] {ON}
           Anc_5.406 YHR102W
          Length = 987

 Score = 95.5 bits (236), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 74/283 (26%), Positives = 129/283 (45%), Gaps = 29/283 (10%)

Query: 439 SQYEKIELLGRGGSSRVYKVKGSGNK-IYALKRXXXXXXXXXXXXGFKGEIELLEKLKDQ 497
           S +++ E++GRG    VYK   S  K ++A+K               + E++ L  +K  
Sbjct: 24  SIFKRTEIIGRGKFGVVYKGYHSRTKQVFAIK-VLNLDSDEDEVEDVQREVQFLASMKQV 82

Query: 498 RRVIQLLDYEMGDGLLYLIME-CGDHDLSQILNQRSNMPLDFNFVRFYTKEMLLCIKVVH 556
             + Q     + D  L++I+E C    L  +L       +D  ++    +E+L+ +K +H
Sbjct: 83  PNITQYYGSYLKDTTLWIIIEYCAGGSLRTLLRPGK---IDEKYIGVIMRELLIALKFIH 139

Query: 557 DAGIVHSDLKPANFVLVK-GILKIIDFGIANAVPEHTVNIYRETQIGTPNYMAPEALVAM 615
              ++H DLK AN ++   G +K+ DFG+A  +  +  N  R T  GTP +MAPE ++  
Sbjct: 140 RDNVIHRDLKAANVLITNDGQVKLCDFGVAAQL--NQSNSRRHTMAGTPYWMAPEVIMEG 197

Query: 616 NYTQSSDNQHEGNKWKVGRPSDMWSCGCIIYQMIYGKPPYGSFQGQNRLLAIMNPDVKIP 675
            Y  +          KV    D+WS G   Y+   G PPY   +    +  I     K P
Sbjct: 198 VYYDT----------KV----DIWSLGITTYEAATGNPPYCEVEALRAMQLITK--SKPP 241

Query: 676 FPEYTSNNEKIPKSAIELMKACLYRNPDKRWTVDKVLSSTFLQ 718
             E  S +  +     E +  CL  +P +R + +++L + F++
Sbjct: 242 RLEGRSYSPLL----KEFIALCLDEDPKERLSAEELLKTKFIK 280

>AFR696C Chr6 complement(1722130..1725558) [3429 bp, 1142 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR507C
           (GIN4) and YCL024W (KCC4)
          Length = 1142

 Score = 95.9 bits (237), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 72/242 (29%), Positives = 121/242 (50%), Gaps = 30/242 (12%)

Query: 483 GFKGEIELLEKLKDQRRVIQLLDYEMGDGLLYLIMECGDH-DLSQILNQRSNMPLDFNFV 541
           G + EI ++ KL +   V++L D       LY+++E  +  +L  +L QR  +P +   V
Sbjct: 74  GIEREI-IIMKLLNHPNVLRLYDVWETAQDLYMVLEYVEKGELFNLLVQRGPLP-ENEAV 131

Query: 542 RFYTKEMLLCIKVVHDAGIVHSDLKPANFVL-VKGILKIIDFGIANAVPEHTVNIYRETQ 600
           RF+ +++++ I   H  GIVH DLKP N +L  K  +K+ DFG+A      + +   ET 
Sbjct: 132 RFF-RQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMAAL---ESKDKLLETS 187

Query: 601 IGTPNYMAPEALVAMNYTQSSDNQHEGNKWKVGRPSDMWSCGCIIYQMIYGKPPYGSFQG 660
            G+P+Y APE +  + Y               G  SD+WSCG I+Y ++ G+ P+    G
Sbjct: 188 CGSPHYAAPEIVSGLPYH--------------GFESDVWSCGVILYALLTGRLPFDEEDG 233

Query: 661 --QNRLLAIMNPDVKIPFPEYTSNNEKIPKSAIELMKACLYRNPDKRWTVDKVLSSTFLQ 718
             +N LL + +   +IP        ++I   A +L+   L   P++R    ++L    LQ
Sbjct: 234 NIRNLLLKVQSGKYEIP------GEDEISPEARDLIVQILTVEPEQRIKTREILKHPLLQ 287

Query: 719 PF 720
            +
Sbjct: 288 KY 289

>NCAS0A05370 Chr1 complement(1061671..1066197) [4527 bp, 1508 aa] {ON}
            
          Length = 1508

 Score = 95.9 bits (237), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 88/323 (27%), Positives = 146/323 (45%), Gaps = 54/323 (16%)

Query: 425  ASSSNNRSMITVNDSQYEKIELLGRGGSSRVY-KVKGSGNKIYALK--RXXXXXXXXXXX 481
            ASS +N S+      +++K + +G G    VY  V     ++ A+K  +           
Sbjct: 1198 ASSVSNVSI------RWQKRKFVGGGTFGEVYSAVNLDTGEVLAVKEIKIQDSKSMEKIF 1251

Query: 482  XGFKGEIELLEKLKDQRRVIQLLDYEMGDGLLYLIME-CGDHDLSQILNQRSNMPLDFNF 540
               K E+ +LE L     ++Q    E+    + + ME C    L+ +L        D   
Sbjct: 1252 PSIKEEMNVLEMLS-HPNIVQYYGVEVHRDRVNIFMEYCEGGSLASLLEH--GRIEDEMV 1308

Query: 541  VRFYTKEMLLCIKVVHDAGIVHSDLKPANFVL-VKGILKIIDFGIANAVPEH-TVNIYRE 598
             + YT ++L  +  +H++GIVH D+KP N +L   GI+K +DFG A  + ++ T  + RE
Sbjct: 1309 TQVYTLQLLEGLAYLHESGIVHRDIKPENILLDFNGIIKYVDFGAARKIAKNGTRVVTRE 1368

Query: 599  TQ-------------------IGTPNYMAPEALVAMNYTQSSDNQHEGNKWKVGRPSDMW 639
                                 IGTP YMAPEA+     T S    H G         D+W
Sbjct: 1369 MPDENDDENGKVVGRNNFNDIIGTPMYMAPEAI-----TGSPKKGHLG-------ADDIW 1416

Query: 640  SCGCIIYQMIYGKPPYGSFQGQNRLLAIMNPDVKIPFPEYTSNNEKIPKSAIELMKACLY 699
            + GC++ +MI GK P+ +   +    AIM        P+  +N+E  P + +  +K CL 
Sbjct: 1417 ALGCVVLEMITGKRPWANLDNE---WAIMYHVAAGQIPQLPTNDEVSP-AGMHFLKRCLK 1472

Query: 700  RNPDKRWTVDKVLSSTFLQPFMI 722
            +NP +R +  ++L    + P++I
Sbjct: 1473 QNPAQRASAVELL----MDPWII 1491

>Kwal_56.22788 s56 complement(281404..282951) [1548 bp, 515 aa] {ON}
           YBR028C - Hypothetical ORF [contig 184] FULL
          Length = 515

 Score = 94.4 bits (233), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 94/347 (27%), Positives = 150/347 (43%), Gaps = 67/347 (19%)

Query: 410 PPVTKKVEIV--EPAKSASSSNNRSMITVNDSQ-------YEKIELLGRGGSSRVYKVKG 460
           PP T+++ +   EP  S S  ++    +V D         +  + +LGRG   +V  VK 
Sbjct: 85  PPNTRRITLSTEEPQGSNSERSSYCAPSVFDKHGTRTLEDFAPVRVLGRGAYGKVLLVKD 144

Query: 461 S-GNKIYALKRXXXXXXXXXXXXGFKGEIE-----LLEKLKDQRRVIQLLDYEMGDGLLY 514
           S  +++YA+K+              +G+ +      LE+   +R ++  L++     L Y
Sbjct: 145 SHTSRLYAMKQLKKAEILIHDGSSEEGQPDSNLEKRLERTFAERTILSQLEHPNIVKLFY 204

Query: 515 LIMECGDHDLSQIL----------NQRSNMPLDFNFVRFYTKEMLLCIKVVHDAGIVHSD 564
              +   H L  IL          + +    LD + V FY  E+   ++ +H  G+V+ D
Sbjct: 205 SFHD--HHKLYLILQFIPGGELFYHLKEQGTLDEDTVAFYAAEISCALRFLHKRGVVYRD 262

Query: 565 LKPANFVL-VKGILKIIDFGIA------NAVPEHTVN---------IYRETQIGTPNYMA 608
           LKP N +L  +G L + DFG++      ++     VN             + IGTP Y A
Sbjct: 263 LKPENCLLDERGHLVLTDFGLSKVSASDDSADGGDVNTNGHEGESVCTLHSIIGTPEYCA 322

Query: 609 PEALVAMNYTQSSDNQHEGNKWKVGRPSDMWSCGCIIYQMIYGKPPYGSFQGQNRLLAIM 668
           PE L    YTQ+ D       W        +S GC+I+ M+ GKPPY     +  L  I+
Sbjct: 323 PEILEGKPYTQNCD-------W--------YSLGCLIFDMLIGKPPYTGVNHKVILNKIL 367

Query: 669 NPDVKIP-FPEYTSNNEKIPKSAIELMKACLYRNPDKRWTVDKVLSS 714
               KIP  P Y S   K      + + A L ++  KRW VDK  ++
Sbjct: 368 KD--KIPKIPSYLSEGMK------DFLAALLKKDVTKRWDVDKFWNT 406

>TPHA0M01840 Chr13 complement(380953..385818) [4866 bp, 1621 aa] {ON}
            Anc_6.341 YNR031C
          Length = 1621

 Score = 95.9 bits (237), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 83/319 (26%), Positives = 139/319 (43%), Gaps = 51/319 (15%)

Query: 425  ASSSNNRSMITVNDSQYEKIELLGRGGSSRVYKVKGSGN-KIYALK--RXXXXXXXXXXX 481
            ASS +N S+      +++K + +G G    V+     GN +I A+K  +           
Sbjct: 1297 ASSMSNVSI------KWQKRQFVGSGTFGTVFSAVNLGNGEILAVKEIKIQDAKAMKKVF 1350

Query: 482  XGFKGEIELLEKLKDQRRVIQLLDYEMGDGLLYLIME-CGDHDLSQILNQRSNMPLDFNF 540
               K E+ +LE L +   ++Q    E+    + L ME C    L+ +L        D   
Sbjct: 1351 PLIKDEMSVLEML-NHPNIVQYYGIEVHRDKVNLFMEFCEGGSLAGLLEH--GRIEDEMV 1407

Query: 541  VRFYTKEMLLCIKVVHDAGIVHSDLKPANFVL-VKGILKIIDFGIANAVPEHTVNIYRET 599
             + Y+ E+L  +  +H +GIVH D+KP N +L   GI+K +DFG A  + E+   +  + 
Sbjct: 1408 TQMYSLELLEGLVYLHQSGIVHRDIKPENILLDFNGIIKFVDFGAARKIAENNTKVEGQN 1467

Query: 600  Q---------------------IGTPNYMAPEALVAMNYTQSSDNQHEGNKWKVGRPSDM 638
                                  +GTP YMAPE +     T S+     G         D+
Sbjct: 1468 DSISDNEGTIEDATSSKGVHNIVGTPMYMAPETI-----TGSAVKGQFG-------ADDV 1515

Query: 639  WSCGCIIYQMIYGKPPYGSFQGQNRLLAIMNPDVKIPFPEYTSNNEKIPKSAIELMKACL 698
            WS GC+I +MI GK P+     +  ++  +      PFP    N  ++ K+    +K  +
Sbjct: 1516 WSLGCVILEMITGKRPWAHLDNEWAIMYHVAAGHIPPFP----NKNELSKAGFTFLKRAI 1571

Query: 699  YRNPDKRWTVDKVLSSTFL 717
             + PDKR T  ++L+  ++
Sbjct: 1572 VQKPDKRATAVELLTHPWI 1590

>NDAI0E03170 Chr5 complement(677441..678392,678524..678543) [972 bp,
           323 aa] {ON} Anc_8.482
          Length = 323

 Score = 91.7 bits (226), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 73/238 (30%), Positives = 122/238 (51%), Gaps = 33/238 (13%)

Query: 434 ITVNDSQYEKIELLGRGGSSRVYK-VKGSGNKIYALKRXXXXXXXXXXXXGFKGEIELLE 492
           ++ + SQ++++E LG G  + VYK +  S     ALK               + EI L++
Sbjct: 1   MSSSSSQFKQLEKLGNGTYATVYKGLNKSTGAFVALKEVKLDSEEGTPSTAIR-EISLMK 59

Query: 493 KLKDQRRVIQLLDYEMGDGLLYLIMECGDHDLSQILNQRS--NMP--LDFNFVRFYTKEM 548
           +LK +  +++L D    +  L L+ E  D+DL + ++ +S  N P  L+ N V+++  ++
Sbjct: 60  ELKHEN-IVRLYDVIHTENKLTLVFEYMDNDLKKYMDSQSTGNTPRGLELNLVKYFQWQL 118

Query: 549 LLCIKVVHDAGIVHSDLKPANFVL-VKGILKIIDFGIANA--VPEHTVNIYRETQIGTPN 605
              +   H+  I+H DLKP N ++  KG LK+ DFG+A A  +P +T +    +++ T  
Sbjct: 119 FEGLAFCHENKILHRDLKPQNLLINKKGQLKLGDFGLARAFGIPVNTFS----SEVVTLW 174

Query: 606 YMAPEALV-AMNYTQSSDNQHEGNKWKVGRPSDMWSCGCIIYQMIYGKPPYGSFQGQN 662
           Y AP+ L+ +  YT S D               +WSCGCI+ +MI GK     F G N
Sbjct: 175 YRAPDVLMGSRTYTTSID---------------IWSCGCILAEMITGK---ALFPGTN 214

>CAGL0C03509g Chr3 complement(350846..353533) [2688 bp, 895 aa] {ON}
           similar to uniprot|P53739 Saccharomyces cerevisiae
           YNR047w or uniprot|P25341 Saccharomyces cerevisiae
           YCR091w KIN82
          Length = 895

 Score = 95.1 bits (235), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 87/321 (27%), Positives = 138/321 (42%), Gaps = 50/321 (15%)

Query: 413 TKKVEIVEPAKSA-----SSSNNRSMITVNDSQYEKIELLGRGGSSRVYKVKGS-GNKIY 466
           TK  EI EP +S+     S SN    ITV    +EKI LLG+G   +VY VK    N++Y
Sbjct: 464 TKLEEIKEPRRSSRLRNKSFSNKFQDITVGPQSFEKIRLLGQGDVGKVYLVKEKRTNRLY 523

Query: 467 ALK-RXXXXXXXXXXXXGFKGEIELLEKLKDQRRVIQLLDYEMGDGLLYLIME-CGDHDL 524
           ALK                  E E+L    +   V+ L      +  LYL ME C   + 
Sbjct: 524 ALKIFSKSEMIKRKKIKRILAEQEIL-ATSNHPFVVTLYHSFQSEDYLYLCMEYCMGGEF 582

Query: 525 SQILNQRSNMPLDFNFVRFYTKEMLLCIKVVHDAGIVHSDLKPANFVLVK-GILKIIDFG 583
            + L  R +  +     +FY  E+   ++ +H  G ++ DLKP N +L + G + + DF 
Sbjct: 583 FRALQTRKSKCISEEDAKFYASEVTAALEYLHLLGFIYRDLKPENILLHQSGHIMLSDFD 642

Query: 584 IANAVPEHTVNIYR--------ETQI-----------GTPNYMAPEALVAMNYTQSSDNQ 624
           ++    +  V + +        +T+I           GT  Y+APE +    +T + D  
Sbjct: 643 LSIQAKDAKVPVVKGNAQSTVVDTKICSDGFRTNSFVGTEEYIAPEVIRGNGHTAAVD-- 700

Query: 625 HEGNKWKVGRPSDMWSCGCIIYQMIYGKPPYGSFQGQNRLLAIMNPDVKIPFPEYTSNNE 684
                W        W+ G +IY+M++G  P+           I+  DV  P      NN 
Sbjct: 701 -----W--------WTLGILIYEMLFGFTPFKGENTNETFSNILKKDVTFP------NNN 741

Query: 685 KIPKSAIELMKACLYRNPDKR 705
           ++ ++  +L+K  L +N  KR
Sbjct: 742 EVSRNCKDLIKKLLIKNESKR 762

>KAFR0A01420 Chr1 (276454..280650) [4197 bp, 1398 aa] {ON} Anc_1.271
            YJL095W
          Length = 1398

 Score = 95.5 bits (236), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 95/380 (25%), Positives = 164/380 (43%), Gaps = 40/380 (10%)

Query: 388  VITNENENKKIQEVFYHRPAPKPPVTKKVEIVEPAKSASSSNNRSMITVNDSQYEKIELL 447
             I +E    + Q +   R   K   T+ VE+ E    A + +  S     +  + K E++
Sbjct: 1043 TIAHEASEARKQSIKLKRQNTKMWGTRMVEVTEKQLVAINKSKNSRGEYKEFAWMKGEMI 1102

Query: 448  GRGGSSRVY-KVKGSGNKIYALKRXXXXXXXX------XXXXGFKGEIELLEKLKDQRRV 500
            G+G    VY  +  +  ++ A+K+                    + E+  L+ L D   +
Sbjct: 1103 GKGSFGAVYLCLNVTTGEMMAVKQVEVPKYSSQDENIISTVEALRSEVSTLKDL-DHLNI 1161

Query: 501  IQLLDYEMGDGLLYLIME--CGDHDLSQILNQRSNMPLDFNFVRFYTKEMLLCIKVVHDA 558
            +Q L +E  D +  L +E   G    S I   R     D   +R  T ++L  +  +H  
Sbjct: 1162 VQYLGFENKDNIYSLFLEYVAGGSVGSLI---RMYGRFDEAMIRHLTIQVLRGLSYLHSR 1218

Query: 559  GIVHSDLKPANFVLVK-GILKIIDFGIANAVPEHTVNIYRETQI---GTPNYMAPEALVA 614
            GI+H D+K  N +L + G+ KI DFGI+      + +IY  + +   GT  +MAPE +  
Sbjct: 1219 GILHRDMKADNLLLDQDGVCKISDFGIS----RKSNDIYSNSDMTMRGTVFWMAPEMV-- 1272

Query: 615  MNYTQSSDNQHEGNKWKVGRPSDMWSCGCIIYQMIYGKPPYGSFQGQNRLLAIMNPDVKI 674
                    +  +G   KV    D+WS GC++ +M  GK P+ + +    +  I       
Sbjct: 1273 --------DTKQGYSAKV----DIWSLGCVVLEMFAGKRPWSNLEVVAAMFKIGKSKSAP 1320

Query: 675  PFPEYTSNNEKIPKSAIELMKACLYRNPDKRWTVDKVLSSTFLQ---PFMISGSIMEDLI 731
            P PE T     I +   + + +C   +P+ R T DK+LS  F +    F    + +   I
Sbjct: 1321 PIPEDTL--PLISQDGRQFLDSCFEIDPESRPTADKLLSHAFSKVYPSFNFKSTELCKFI 1378

Query: 732  KNAVRYGSEKPQISHDDLND 751
            K+  +  S K +++  D+ND
Sbjct: 1379 KSNDKINSSKLRVASKDVND 1398

>SAKL0C08844g Chr3 (811712..813307) [1596 bp, 531 aa] {ON} similar
           to uniprot|P38070 Saccharomyces cerevisiae YBR028C
           Hypothetical ORF
          Length = 531

 Score = 94.0 bits (232), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 77/248 (31%), Positives = 106/248 (42%), Gaps = 52/248 (20%)

Query: 488 IELLEKLKDQRRVIQLLDYEMGDGLLYLIMECGDHDLSQILNQRSNMPLDFNFVRFYTKE 547
           ++L     D  R+  +L Y  G  L Y + E G               LD   V FY  E
Sbjct: 214 VKLFYSFHDSHRLYLVLQYIPGGELFYHLKEQGT--------------LDEQTVSFYAAE 259

Query: 548 MLLCIKVVHDAGIVHSDLKPANFVL-VKGILKIIDFGIA-NAVPEHTVNIYRETQ----- 600
           +   +K +HD GIV+ DLKP N +L  KG L + DFG++  +V E        T+     
Sbjct: 260 ISCALKFLHDRGIVYRDLKPENCLLNDKGHLVLTDFGLSKKSVGEAGSPAATATETNHDG 319

Query: 601 ---------IGTPNYMAPEALVAMNYTQSSDNQHEGNKWKVGRPSDMWSCGCIIYQMIYG 651
                    IGTP Y APE L  + YTQ  D       W        +S GC++Y M+ G
Sbjct: 320 EPVTALYSIIGTPEYCAPEILQGVPYTQICD-------W--------YSLGCLVYDMLIG 364

Query: 652 KPPYGSFQGQNRLLAIMNPDVKIPFPEYTSNNEKIPKSAIELMKACLYRNPDKRWTVDKV 711
           KPPY     +  L  I+  D     P Y S+  K      + + A L ++  KRW VD+ 
Sbjct: 365 KPPYTGANHKVILHKIVK-DKTPKIPMYLSDGMK------DFLGALLKKDVGKRWDVDRY 417

Query: 712 LSSTFLQP 719
            S    +P
Sbjct: 418 WSEDGPRP 425

>Smik_3.189 Chr3 (273885..276044) [2160 bp, 719 aa] {ON} YCR091W
           (REAL)
          Length = 719

 Score = 94.7 bits (234), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 93/365 (25%), Positives = 156/365 (42%), Gaps = 52/365 (14%)

Query: 366 NANHADNILQQDNKRLKRSLDDVITNENENKKIQEVFYHRPAPKPPVTKKVEIVEPAKS- 424
           N +  D +      RL+R+  +    E +N+ + E +      +PP     +I+EP +S 
Sbjct: 248 NGSKMDQVPTDTTPRLRRAASEPFNTE-KNELLHENYI--ALKQPPNLG--DIIEPKRSH 302

Query: 425 ----ASSSNNRSMITVNDSQYEKIELLGRGGSSRVYKVKG-SGNKIYALKRXXXXXXXXX 479
                S SN    ITV    +EKI LLG+G   +VY V+    N+I+ALK          
Sbjct: 303 RLRTKSFSNKFQDITVEPRSFEKIRLLGQGDVGKVYLVRERDTNQIFALKVLSKHEMIKR 362

Query: 480 XXXG-FKGEIELLEKLKDQRRVIQLLDYEMGDGLLYLIME-CGDHDLSQILNQRSNMPLD 537
                   E E+L    D   ++ L      +  LYL ME C   +  + L  R +  + 
Sbjct: 363 KKIKRVLTEQEILAT-SDHPFIVTLYHSFQTEDYLYLCMEYCMGGEFFRALQTRKSKCIA 421

Query: 538 FNFVRFYTKEMLLCIKVVHDAGIVHSDLKPANFVLVK-GILKIIDF-----GIANAVPEH 591
               +FY  E++  ++ +H  G ++ DLKP N +L + G + + DF      I +  P  
Sbjct: 422 EEDAKFYASEVVAALEYLHLLGFIYRDLKPENILLHQSGHVMLSDFDLSIQAIGSKNPTM 481

Query: 592 TVNIYRETQI-----------GTPNYMAPEALVAMNYTQSSDNQHEGNKWKVGRPSDMWS 640
             + Y +T+I           GT  Y+APE +    +T + D       W        W+
Sbjct: 482 KDSTYLDTKICSDGFRTNSFVGTEEYLAPEVIRGNGHTAAVD-------W--------WT 526

Query: 641 CGCIIYQMIYGKPPYGSFQGQNRLLAIMNPDVKIPFPEYTSNNEKIPKSAIELMKACLYR 700
            G ++Y+M++G  P+           I+  D K P      + +++ K+  +L+K  L +
Sbjct: 527 LGILVYEMLFGCTPFKGVNSNETFSNILAKDAKFP------HGKEVSKNCKDLIKKLLNK 580

Query: 701 NPDKR 705
           N  KR
Sbjct: 581 NETKR 585

>NCAS0C04940 Chr3 (1006185..1009535) [3351 bp, 1116 aa] {ON}
           Anc_3.92
          Length = 1116

 Score = 95.1 bits (235), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 78/284 (27%), Positives = 134/284 (47%), Gaps = 35/284 (12%)

Query: 445 ELLGRGGSSRV-YKVKGSGNKIYALKRXXXXXXXXXXXXGFKG-EIELLEKLKDQRRVIQ 502
           E+LG G  S V         K YA+K              +   E   L++L + R +I+
Sbjct: 178 EMLGDGAYSTVMLATSNDSGKKYAVKVLNKEYLIRQKKVKYVNIEKLALQRLNNSRSIIR 237

Query: 503 LLDYEMGDGLLYLIMECG-DHDLSQILNQRSNMPLDFNFVRFYTKEMLLCIKVVHDAGIV 561
           L      +  LY ++E   + DL  ++ +  +  L+     +Y  +++  IK +H  GI+
Sbjct: 238 LFFTFQDEASLYFLLEYAPNGDLLSLMKKFGS--LNEECCCYYGAQIIDAIKFMHSKGII 295

Query: 562 HSDLKPANFVLVKGI-LKIIDFGIA----NAVPEHTVNIYRETQ--IGTPNYMAPEALVA 614
           H D+KP N +L K + +KI DFG A    N  P  + ++   ++  +GT  Y++PE L+ 
Sbjct: 296 HRDIKPENILLDKDMKVKITDFGTAKILDNKPPGTSYDLLTRSKSFVGTAEYVSPE-LLN 354

Query: 615 MNYTQSSDNQHEGNKWKVGRPSDMWSCGCIIYQMIYGKPPYGSFQGQNRLLAIMNPDVKI 674
            NYT +               SD+W+ GCI++QMI GKPP   F+  N  L      +K+
Sbjct: 355 DNYTDAR--------------SDIWAFGCIVFQMIAGKPP---FKATNEYLTFQKV-MKV 396

Query: 675 PFPEYTSNNEKIPKSAIELMKACLYRNPDKRWTVDKVLSSTFLQ 718
            +  +T+     P    +L+K  L + P++R T++ +    F +
Sbjct: 397 QY-AFTAG---FPTVVRDLVKRILIKAPEQRLTIEAIEKHHFFR 436

>NDAI0F04520 Chr6 complement(1098426..1099895) [1470 bp, 489 aa]
           {ON} Anc_1.24
          Length = 489

 Score = 93.6 bits (231), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 83/315 (26%), Positives = 148/315 (46%), Gaps = 35/315 (11%)

Query: 441 YEKIELLGRGGSSRVYKV--KGSGNKIYALKRXXXXXXXXXXXXGFKGEIELLEKLKDQR 498
           Y   + +GRG    VYK   K +G +I A+K                 EI  L +LK   
Sbjct: 21  YSIQDCVGRGNFGDVYKAIDKLTG-EIVAIKVVNLESSDEDIEL-IAQEIFFLAELKSPY 78

Query: 499 RVIQLLDYEMGDGLLYLIME-CGDHDLSQILNQRSNMPLDFNFVRFYTKEMLLCIKVVHD 557
            +   +   + D  ++++ME CG    S ++    N  L  + V F TK +L  ++ +H+
Sbjct: 79  -ITNYITTMLEDVSMWIVMEYCGGGSCSDLIRYHYNEGLHEDKVAFITKNVLRGLQYLHE 137

Query: 558 AGIVHSDLKPANFVLV-KGILKIIDFGIANAVPEHTVNIYRETQIGTPNYMAPEALVAMN 616
              +H D+K AN +L   G++K+ DFG++  +        R T +GTP +MAPE +    
Sbjct: 138 QRKIHRDVKAANVLLTDDGLVKLADFGVSGQLRS---TAKRNTFVGTPYWMAPEII---- 190

Query: 617 YTQSSDNQHEGNKWKVGRPSDMWSCGCIIYQMIYGKPPYGSFQGQNRLLAIMNPDVKIPF 676
               S++ H  N+      +D+WS G  +Y+++ G PPY  +     +  I   +++   
Sbjct: 191 ----SNSSHGYNE-----KADIWSLGITVYELLKGCPPYAKYDAGKVMRNIPKKNLQDCM 241

Query: 677 PEYTSNNEKIPKSAIELMKACLYRNPDKRWTVDKVLSSTFLQPFMIS---GSIMEDLIKN 733
             ++        +A   + ACL ++PD+R T  ++L   F++   I+     +ME  IK 
Sbjct: 242 VSFSD-------AAKLFISACLIKDPDERPTATELLQQPFVKNIKITDLRNEVME--IKR 292

Query: 734 AVRYGSEKPQISHDD 748
             + G++ P+ S D+
Sbjct: 293 TRKEGNKVPKYSLDN 307

>KNAG0B01780 Chr2 (326438..331180) [4743 bp, 1580 aa] {ON} Anc_1.271
            YJL095W
          Length = 1580

 Score = 95.1 bits (235), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 83/326 (25%), Positives = 143/326 (43%), Gaps = 55/326 (16%)

Query: 413  TKKVEIVEPAKSASSSNNRSMITVNDSQ----------YEKIELLGRGGSSRVY-KVKGS 461
            T+ VE+ E          + M+++N S+          + K E++G+G    VY  +  +
Sbjct: 1247 TRMVEVTE----------KHMVSINKSKNSRGEYKEFAWMKGEMIGKGSFGAVYLCLNLT 1296

Query: 462  GNKIYALKRXXXXXXXXX------XXXGFKGEIELLEKLKDQRRVIQLLDYEMGDGLLYL 515
              ++ A+K+                    + E+  L+ L D   ++Q L +E    +  L
Sbjct: 1297 TGEMMAVKQVEVPKYSAQDQNILDTVEALRSEVSTLKDL-DHLNIVQYLGFENDHDIYSL 1355

Query: 516  IME-CGDHDLSQILNQRSNMPLDFNFVRFYTKEMLLCIKVVHDAGIVHSDLKPANFVL-V 573
             +E  G   +  ++  R     D   +RF T ++L  +  +H  GI+H D+K  N +L +
Sbjct: 1356 FLEYVGGGSVGSLI--RLYGRFDEALIRFLTVQVLEGLAYLHSKGILHRDMKADNLLLDL 1413

Query: 574  KGILKIIDFGIANAVPEHTVNIYRETQI---GTPNYMAPEALVAMNYTQSSDNQHEGNKW 630
             G+ KI DFGI+      + +IY  + +   GT  +MAPE +          +  +G   
Sbjct: 1414 DGVCKISDFGIS----RKSKDIYSNSDMTMRGTVFWMAPEMV----------DTKQGYSA 1459

Query: 631  KVGRPSDMWSCGCIIYQMIYGKPPYGSFQGQNRLLAIMNPDVKIPFPEYTSNNEKIPKSA 690
            KV    D+WS GC++ +M  GK P+ + +    +  I       P PE T     I +  
Sbjct: 1460 KV----DIWSLGCVVLEMFAGKRPWSNLEVVAAMFKIGKNKSAPPIPEDTL--PLISQDG 1513

Query: 691  IELMKACLYRNPDKRWTVDKVLSSTF 716
             + + AC   +PD R T DK+LS  F
Sbjct: 1514 RQFLNACFEIDPDLRPTADKLLSHPF 1539

>AER264C Chr5 complement(1120017..1124468) [4452 bp, 1483 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YCR073C
            (SSK22) and YNR031C (SSK2)
          Length = 1483

 Score = 94.7 bits (234), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 81/316 (25%), Positives = 147/316 (46%), Gaps = 42/316 (13%)

Query: 425  ASSSNNRSMITVNDS------QYEKIELLGRGGSSRVY-KVKGSGNKIYALK--RXXXXX 475
            A+  +N+ ++T+  S      +++K   +G G    VY  V      I A+K  +     
Sbjct: 1169 ATDKDNQYLLTLASSLSNVSIKWQKRSFIGGGSFGSVYSAVNLDTGDILAVKEIKFNDRK 1228

Query: 476  XXXXXXXGFKGEIELLEKLKDQRRVIQLLDYEMGDGLLYLIME-CGDHDLSQILNQRSNM 534
                     + E+ +LE L +   V+Q    E+    + + ME C    L+ +L      
Sbjct: 1229 TIKQVFPSIRDEMTVLEML-NHPNVVQYYGVEVHRDRVNIFMEYCEGGSLASLLAH--GR 1285

Query: 535  PLDFNFVRFYTKEMLLCIKVVHDAGIVHSDLKPANFVL-VKGILKIIDFGIANAVPEHT- 592
              D    + Y+ +ML  +  +H++G+ H D+KP N +L   GI+K +DFG A  +  +  
Sbjct: 1286 IEDEMVTQVYSLQMLEGLAYLHESGVDHRDIKPENILLDFNGIIKYVDFGAAKVLASNGS 1345

Query: 593  --VNIYR----ETQIGTPNYMAPEALVAMNYTQSSDNQHEGNKWKVGRPSDMWSCGCIIY 646
              +N+ +    E  IGTP YM+PEA+    Y +   +             D+WS GC+I 
Sbjct: 1346 KKLNLEQHMEGEKMIGTPMYMSPEAISGTGYGKFGSD-------------DIWSLGCVIL 1392

Query: 647  QMIYGKPPYGSFQGQNRLLAIMNPDVKIPFPEYTSNNEKIPKSAIELMKACLYRNPDKRW 706
            +M+ G+ P+ +   Q    AI+        P + S NE + ++ I+ +  CL ++P++R 
Sbjct: 1393 EMVTGRRPWANLDNQ---WAIIYQVAAGQIPMFPSKNE-MSQAGIKFLSRCLIQDPNQRS 1448

Query: 707  TVDKVLSSTFLQPFMI 722
            T  ++L    + P++I
Sbjct: 1449 TAVELL----MDPWII 1460

>YCR091W Chr3 (274404..276566) [2163 bp, 720 aa] {ON}  KIN82Putative
           serine/threonine protein kinase implicated in the
           regulation of phospholipid asymmetry through the
           activation of phospholipid translocases (flippases)
           Lem3p-Dnf1p/Dnf2p; similar to Fpk1p
          Length = 720

 Score = 94.0 bits (232), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 100/401 (24%), Positives = 167/401 (41%), Gaps = 58/401 (14%)

Query: 336 NSPIHNIHKEISRNKDSDSEKRGVLRNISINA------NHADNILQQDNKRLKRSLDDVI 389
           N  + N H++IS N  +       L N  I++         D I      RL+R+  +  
Sbjct: 213 NEELQNFHRKISENGSASPLANLSLSNSPIDSPRKNSETRKDQIPMNITPRLRRAASEPF 272

Query: 390 TNENENKKIQEVFYHRPAPKPPVTKKVEIVEPAKS-----ASSSNNRSMITVNDSQYEKI 444
               +    ++    +   +PP     +IVEP +S      S  N    ITV    +EKI
Sbjct: 273 NTAKDGLMREDYIALK---QPPSLG--DIVEPRRSRRLRTKSFGNKFQDITVEPQSFEKI 327

Query: 445 ELLGRGGSSRVYKVKG-SGNKIYALK-RXXXXXXXXXXXXGFKGEIELLEKLKDQRRVIQ 502
            LLG+G   +VY V+    N+I+ALK                  E E+L    D   ++ 
Sbjct: 328 RLLGQGDVGKVYLVRERDTNQIFALKVLNKHEMIKRKKIKRVLTEQEILAT-SDHPFIVT 386

Query: 503 LLDYEMGDGLLYLIME-CGDHDLSQILNQRSNMPLDFNFVRFYTKEMLLCIKVVHDAGIV 561
           L         LYL ME C   +  + L  R +  +     +FY  E++  ++ +H  G +
Sbjct: 387 LYHSFQTKDYLYLCMEYCMGGEFFRALQTRKSKCIAEEDAKFYASEVVAALEYLHLLGFI 446

Query: 562 HSDLKPANFVLVK-GILKIIDFGIA-----NAVPEHTVNIYRETQI-----------GTP 604
           + DLKP N +L + G + + DF ++     +  P    + Y +T+I           GT 
Sbjct: 447 YRDLKPENILLHQSGHVMLSDFDLSIQATGSKKPTMKDSTYLDTKICSDGFRTNSFVGTE 506

Query: 605 NYMAPEALVAMNYTQSSDNQHEGNKWKVGRPSDMWSCGCIIYQMIYGKPPYGSFQGQNRL 664
            Y+APE +    +T + D       W        W+ G +IY+M++G  P+         
Sbjct: 507 EYLAPEVIRGNGHTAAVD-------W--------WTLGILIYEMLFGCTPFKGDNSNETF 551

Query: 665 LAIMNPDVKIPFPEYTSNNEKIPKSAIELMKACLYRNPDKR 705
             I+  DVK P      +++++ K+  +L+K  L +N  KR
Sbjct: 552 SNILTKDVKFP------HDKEVSKNCKDLIKKLLNKNEAKR 586

>Skud_3.165 Chr3 (258916..261066) [2151 bp, 716 aa] {ON} YCR091W
           (REAL)
          Length = 716

 Score = 94.0 bits (232), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 83/314 (26%), Positives = 137/314 (43%), Gaps = 47/314 (14%)

Query: 417 EIVEPAKS-----ASSSNNRSMITVNDSQYEKIELLGRGGSSRVYKVKG-SGNKIYALK- 469
           +I+EP +S      S SN    ITV    +EKI LLG+G   +VY V+    N+I+ALK 
Sbjct: 291 DIIEPRRSRRLRAKSFSNKFQDITVEPQSFEKIRLLGQGDVGKVYLVRERDTNQIFALKV 350

Query: 470 RXXXXXXXXXXXXGFKGEIELLEKLKDQRRVIQLLDYEMGDGLLYLIME-CGDHDLSQIL 528
                            E E+L    D   ++ L      +  LYL ME C   +  + L
Sbjct: 351 LSKHEMIKRKKIKRVLTEQEIL-ATSDHPFIVTLYHSFQTEDFLYLCMEYCMGGEFFRAL 409

Query: 529 NQRSNMPLDFNFVRFYTKEMLLCIKVVHDAGIVHSDLKPANFVLVK-GILKIIDFGIANA 587
             R +  +     +FY  E++  ++ +H  G ++ DLKP N +L + G + + DF ++  
Sbjct: 410 QTRKSKRITEEDAKFYASEVVAALEYLHLLGFIYRDLKPENILLHQSGHVMLSDFDLSIQ 469

Query: 588 V-----PEHTVNIYRETQI-----------GTPNYMAPEALVAMNYTQSSDNQHEGNKWK 631
                 P    + Y +T++           GT  Y+APE +    +T + D       W 
Sbjct: 470 ATGSRDPTMKDSTYLDTKVCSDGFRTNSFVGTEEYLAPEVIRGNGHTAAVD-------W- 521

Query: 632 VGRPSDMWSCGCIIYQMIYGKPPYGSFQGQNRLLAIMNPDVKIPFPEYTSNNEKIPKSAI 691
                  W+ G ++Y+M++G  P+           I+  DVK P      ++++I K   
Sbjct: 522 -------WTLGILVYEMLFGCTPFKGDNSNETFSKILTEDVKFP------HDKEISKHCK 568

Query: 692 ELMKACLYRNPDKR 705
           +L+K  L +N  KR
Sbjct: 569 DLIKRLLNKNESKR 582

>ACL191C Chr3 complement(26475..27572) [1098 bp, 365 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGR040W
           (KSS1)
          Length = 365

 Score = 91.3 bits (225), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 84/324 (25%), Positives = 147/324 (45%), Gaps = 63/324 (19%)

Query: 439 SQYEKIELLGRGGSSRVYKV--KGSGNKIYALKRXXXXXXXXXXXXGFKGEIELLEKLKD 496
           S Y+ ++L+G G    V     K +G K+ A+K+              + E++LL+    
Sbjct: 11  SHYKLVDLIGEGAYGIVCSAIHKPTGTKV-AIKKIQPFTRPMFVTRTLR-ELKLLKFFHS 68

Query: 497 QRRVIQLLD------YEMGDGLLYLIMECGDHDLSQILNQRSNMPLDFNFVRFYTKEMLL 550
              +I +LD      Y+  + + YL+ E  + DL +I++Q ++   D + ++++T ++L 
Sbjct: 69  HENIISVLDIVRPTSYQDFEAV-YLVQELMETDLQRIISQPNSFLSD-DHIQYFTYQILR 126

Query: 551 CIKVVHDAGIVHSDLKPANFVLVKGI-LKIIDFGIANAVP------EHTVNIYRETQIGT 603
            +K +H A ++H DLKP+N +L     LK+ DFG++  +       E+ V    E  + T
Sbjct: 127 ALKSLHSAQVIHRDLKPSNLLLNSSCDLKLCDFGLSRCLASSDRSRENMVGFMTE-YVAT 185

Query: 604 PNYMAPEALVAMN-YTQSSDNQHEGNKWKVGRPSDMWSCGCIIYQMIYGKPPYGSFQGQN 662
             Y APE +++   YT +                D+WSCGCI+ +MI GKP +      +
Sbjct: 186 RWYRAPEIMLSFQEYTTA---------------MDIWSCGCILAEMISGKPLFPGRDYHH 230

Query: 663 RLLAIM----NPDV----------------------KIPFPEYTSNNEKIPKSAIELMKA 696
           +L  I+     P                        KIP+    S N+  P  A++L+  
Sbjct: 231 QLWIILEILGTPSFEDFEQIKSKRAKAYIANLPMRPKIPWNVALSTNDINPL-AMDLLDK 289

Query: 697 CLYRNPDKRWTVDKVLSSTFLQPF 720
            L  NPDKR +    L   +L+ +
Sbjct: 290 MLTFNPDKRISAADALKHPYLETY 313

>CAGL0I07513g Chr9 (722045..725275) [3231 bp, 1076 aa] {ON} similar
           to uniprot|Q12236 Saccharomyces cerevisiae YOL100w PKH2
          Length = 1076

 Score = 94.4 bits (233), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 76/294 (25%), Positives = 133/294 (45%), Gaps = 45/294 (15%)

Query: 436 VNDSQYEKIELLGRGGSSRVYKVKGSGNKIYALKRXXXXXXXXXXXXGFKGEIELLEKLK 495
           V D  Y  + L     S + Y VK   NK Y +K+                E   L++L 
Sbjct: 188 VGDGAYSTVMLATAKDSGKKYAVK-VLNKEYLIKQKKVKYVNI--------EKNALQRLN 238

Query: 496 DQRRVIQLLDYEMGDGLLYLIMECG-DHDLSQILNQRSNMPLDFNFVRFYTKEMLLCIKV 554
           + R +++L      +  LY ++E   + D   ++ +  ++  D    R+Y+ +++  IK 
Sbjct: 239 NSRGIVKLFFTFQDESSLYFLLEYAPNGDFLSVMKKYGSLSEDC--TRYYSAQIIDGIKY 296

Query: 555 VHDAGIVHSDLKPANFVLVKGI-LKIIDFGIANAV---------PEHTVNIYRETQIGTP 604
           +H  GI+H D+KP N +L K + +KI DFG A  +         PE  +    ++ +GT 
Sbjct: 297 LHSKGIIHRDIKPENILLDKDMKVKITDFGTAKILEPKNEDEDNPEFNLLTRSKSFVGTA 356

Query: 605 NYMAPEALVAMNYTQSSDNQHEGNKWKVGRPSDMWSCGCIIYQMIYGKPPYGSFQGQNRL 664
            Y++PE L               N   V    D+W+ GC+++QMI GKPP   F+  N  
Sbjct: 357 EYVSPELL---------------NDSYVDARCDIWAFGCMVFQMIAGKPP---FKATNEY 398

Query: 665 LAIMNPDVKIPFPEYTSNNEKIPKSAIELMKACLYRNPDKRWTVDKVLSSTFLQ 718
           L      +K+ +  +T+     P    +L+K  L + P++R T+ ++    F +
Sbjct: 399 LTFQKV-MKVQY-AFTAG---FPVVVRDLVKRILLKVPEQRLTIPQIEKHHFYK 447

>KAFR0E01040 Chr5 complement(214744..216252) [1509 bp, 502 aa] {ON}
           Anc_3.229 YBR028C
          Length = 502

 Score = 92.8 bits (229), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 92/310 (29%), Positives = 140/310 (45%), Gaps = 67/310 (21%)

Query: 441 YEKIELLGRGGSSRVYKVKGS-GNKIYALKRXXXXXXXXXXX---------XGFKGEIE- 489
           ++ I +LG+G  S+V  VK    NK+YA+K+                       +  IE 
Sbjct: 114 FKPIRVLGKGAYSKVVLVKDHHSNKLYAMKQLKKAEILINEKEVREDSEDPTTLQKRIER 173

Query: 490 ------LLEKLKDQRRVIQLLDYEMGD-GLLYLIME-CGDHDLSQILNQRSNMPLDFNFV 541
                 +L KL +   V++L  Y   D   LYLI++     +L   L +R    LD + V
Sbjct: 174 TFAERIILSKL-EHPNVVKLF-YSFHDHSKLYLILQYIPGGELFFHLKERGT--LDEDTV 229

Query: 542 RFYTKEMLLCIKVVHDAGIVHSDLKPANFVLV-KGILKIIDFGIANAV------------ 588
            FY  E+ + +K +HD GIV+ DLKP N +L  +G L + DFG++               
Sbjct: 230 AFYAAEISVALKFLHDNGIVYRDLKPENCLLSQRGHLVLTDFGLSKEAVDNVSDNESTEL 289

Query: 589 --PEHTVNIYRETQIGTPNYMAPEALVAMNYTQSSDNQHEGNKWKVGRPSDMWSCGCIIY 646
             PE    ++  + IGTP Y APE L  + Y ++ D       W        +S GC+++
Sbjct: 290 NSPEDIYTLH--SIIGTPEYAAPEILQGLPYNKNCD-------W--------YSLGCLLF 332

Query: 647 QMIYGKPPYGSFQGQNR--LLAIMNPDVKIP-FPEYTSNNEKIPKSAIELMKACLYRNPD 703
            M+ GKPPY    G N   +L  +  D + P  P Y S+  K      +++   L ++  
Sbjct: 333 DMLVGKPPY---TGTNHKVILNKIQKDKQGPRIPFYLSDGMK------DMLNWLLKKDKT 383

Query: 704 KRWTVDKVLS 713
           KRW VDK  S
Sbjct: 384 KRWDVDKYWS 393

>KLLA0C01650g Chr3 (128119..131457) [3339 bp, 1112 aa] {ON} similar
           to uniprot|Q12263 Saccharomyces cerevisiae YDR507C
          Length = 1112

 Score = 94.4 bits (233), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 69/242 (28%), Positives = 123/242 (50%), Gaps = 30/242 (12%)

Query: 483 GFKGEIELLEKLKDQRRVIQLLDYEMGDGLLYLIMECGDH-DLSQILNQRSNMPLDFNFV 541
           G + EI ++ KL +   V++L D       LY+++E  +  +L  +L +R  +P +   V
Sbjct: 72  GIEREI-IIMKLLNHPNVLRLYDVWETSKDLYMVLEYVEKGELFNLLVERGPLP-ENEAV 129

Query: 542 RFYTKEMLLCIKVVHDAGIVHSDLKPANFVL-VKGILKIIDFGIANAVPEHTVNIYRETQ 600
           RF+ +++++ I   H  GIVH DLKP N +L  K  +K+ DFG+A      + +   ET 
Sbjct: 130 RFF-RQIIIGISYCHALGIVHRDLKPENLLLDHKFNVKLADFGMAAL---ESKDKLLETS 185

Query: 601 IGTPNYMAPEALVAMNYTQSSDNQHEGNKWKVGRPSDMWSCGCIIYQMIYGKPPYGSFQG 660
            G+P+Y APE +  + Y               G  SD+WSCG I+Y ++ G+ P+    G
Sbjct: 186 CGSPHYAAPEIVSGLPYH--------------GFESDVWSCGVILYALLTGRLPFDEEDG 231

Query: 661 --QNRLLAIMNPDVKIPFPEYTSNNEKIPKSAIELMKACLYRNPDKRWTVDKVLSSTFLQ 718
             +N LL + +   ++P       +++I   A +L+   L  +P++R    ++L    L+
Sbjct: 232 NIRNLLLKVQSGKFEMP------GDDEISSEAQDLIARILTVDPEQRIKTREILKHPLLR 285

Query: 719 PF 720
            +
Sbjct: 286 KY 287

>TDEL0D01400 Chr4 (269367..273656) [4290 bp, 1429 aa] {ON} Anc_1.271
            YJL095W
          Length = 1429

 Score = 94.4 bits (233), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 98/384 (25%), Positives = 169/384 (44%), Gaps = 60/384 (15%)

Query: 388  VITNENENKKIQEVFYHRPAPKPPVTKKVEIVEPAKSASSSNNRSMITVNDS-----QYE 442
             I +E    + Q V   R   K   TK VE+ +          + M+++N++     QY+
Sbjct: 1071 TIAHEASEARKQSVKLGRQNTKMWGTKTVEVTD----------KRMVSINNTKNSRGQYK 1120

Query: 443  -----KIELLGRGGSSRVY-KVKGSGNKIYALKRXXXXXXXXX------XXXGFKGEIEL 490
                 K E++G+G    VY  +  +  ++ A+K+                    + E+  
Sbjct: 1121 EFAWIKGEMIGKGSFGAVYLCLNVTTGEMMAVKQVEVPKYGSQNEQIIHTVEALRAEMST 1180

Query: 491  LEKLKDQRRVIQLLDYEMGDGLLYLIME--CGDHDLSQILNQRSNMPLDFNFVRFYTKEM 548
            L+ L D   ++Q L +E  D +  L +E   G    S I   R     D   ++  T ++
Sbjct: 1181 LKNL-DHLNIVQYLGFEAKDHMNSLFLEYVAGGSVGSLI---RMYGRFDEVMIKHLTTQV 1236

Query: 549  LLCIKVVHDAGIVHSDLKPANFVL-VKGILKIIDFGIANAVPEHTVNIYRETQI---GTP 604
            L  +  +H  GI+H D+K  N +L  +G+ KI DFGI+      + +IY  +++   GT 
Sbjct: 1237 LRGLSYLHSRGILHRDMKADNLLLDQEGVCKISDFGIS----RKSKDIYSNSEMTMRGTV 1292

Query: 605  NYMAPEALVAMNYTQSSDNQHEGNKWKVGRPSDMWSCGCIIYQMIYGKPPYGSFQGQNRL 664
             +MAPE +          +  +G   KV    D+WS GC++ +M  GK P+ + +    +
Sbjct: 1293 FWMAPEMV----------DTAQGYSAKV----DIWSMGCVVLEMFAGKRPWSNLEVVAAM 1338

Query: 665  LAIMNPDVKIPFPEYTSNNEKIPKSAIELMKACLYRNPDKRWTVDKVLSSTFL---QPFM 721
              I       P PE T     I +S  + + AC   +P+ R T DK LS  F+   + F 
Sbjct: 1339 FKIGKSKSAPPIPEDTL--PLISQSGRDFIDACFQIDPEARPTADKQLSHPFILEKENFD 1396

Query: 722  ISGSIMEDLIKNAVRYGSEKPQIS 745
               + + +LIK+  +  S K ++S
Sbjct: 1397 FKSTKLAELIKSNDKVNSTKLRVS 1420

>NCAS0A05570 Chr1 (1093653..1096409) [2757 bp, 918 aa] {ON}
           Anc_6.371
          Length = 918

 Score = 94.0 bits (232), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 86/325 (26%), Positives = 135/325 (41%), Gaps = 51/325 (15%)

Query: 409 KPPVTKKVEIVEPAKS-----ASSSNNRSMITVNDSQYEKIELLGRGGSSRVYKVK-GSG 462
           +PP    VE  EP +S      S SN    ITV    +EKI+LLG+G   +VY V+    
Sbjct: 483 EPPRIPAVE-EEPKRSRRLRNKSFSNKFKDITVGPQSFEKIKLLGQGDVGKVYLVREKKT 541

Query: 463 NKIYALK-RXXXXXXXXXXXXGFKGEIELLEKLKDQRRVIQLLDYEMGDGLLYLIME-CG 520
           N++YALK                  E E+L    +   V+ L      +  LY  ME C 
Sbjct: 542 NRLYALKIFSKSEMIKRKKIKRILAEQEIL-ATSNHPFVVTLYHSFQSEDYLYFCMEYCM 600

Query: 521 DHDLSQILNQRSNMPLDFNFVRFYTKEMLLCIKVVHDAGIVHSDLKPANFVLVK-GILKI 579
             +  + L  R    +  +  RFY  E+   ++ +H  G ++ DLKP N +L K G + +
Sbjct: 601 GGEFFRALQTRRTKCISEDDARFYASEVTAALEYLHLLGFIYRDLKPENILLHKSGHIML 660

Query: 580 IDFGIANAVPEHTVNIYRETQ-------------------IGTPNYMAPEALVAMNYTQS 620
            DF ++    +  V + + +                    +GT  Y+APE +    +T +
Sbjct: 661 SDFDLSVQAKDAKVPVMKGSAESTVVDTKICSDGFRTNSFVGTEEYIAPEVIRGNGHTAA 720

Query: 621 SDNQHEGNKWKVGRPSDMWSCGCIIYQMIYGKPPYGSFQGQNRLLAIMNPDVKIPFPEYT 680
            D       W        W+ G +IY+M++G  P+           I+  DV  P     
Sbjct: 721 VD-------W--------WTLGILIYEMLFGFTPFKGSSSNETFSNILKNDVSFP----- 760

Query: 681 SNNEKIPKSAIELMKACLYRNPDKR 705
            NN  I ++  +L+K  L +N  KR
Sbjct: 761 -NNNDISRNCKDLIKKLLCKNEAKR 784

>Suva_7.325 Chr7 (550760..551866) [1107 bp, 368 aa] {ON} YGR040W
           (REAL)
          Length = 368

 Score = 91.3 bits (225), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 86/321 (26%), Positives = 149/321 (46%), Gaps = 49/321 (15%)

Query: 439 SQYEKIELLGRGGSSRVYKV--KGSGNKIYALKRXXXXXXXXXXXXGFKGEIELLEKLKD 496
           SQY+ ++L+G G    V     K SG K+ A+K+              + EI+LL    +
Sbjct: 11  SQYKLVDLIGEGAYGTVCSAIHKPSGIKV-AIKKIQPFSKKLFVTRTIR-EIKLLRYFHE 68

Query: 497 QRRVIQLLDYEMGDGL-----LYLIMECGDHDLSQILNQR--SNMPLDFNFVRFYTKEML 549
              +I +LD      +     +YL+ E  + DL +++N +   +  L  + ++++T ++L
Sbjct: 69  HENIISILDKVRPVSIDKLNAVYLVEELMETDLQKVINNQNSGSSTLSDDHIQYFTYQIL 128

Query: 550 LCIKVVHDAGIVHSDLKPANFVLVKGI-LKIIDFGIANAVPEHTVNIYRETQIG------ 602
             +K +H A ++H D+KP+N +L     LK+ DFG+A  +   + +  RET +G      
Sbjct: 129 RALKSIHSAQVIHRDIKPSNLLLNSNCDLKVCDFGLARCLASSSDS--RETLVGFMTEYV 186

Query: 603 -TPNYMAPEALVAMN-YTQSSDNQHEGNKWKVGRPSDMWSCGCIIYQMIYGKPPYGSFQG 660
            T  Y APE ++    YT +                D+WSCGCI+ +M+ GKP +     
Sbjct: 187 ATRWYRAPEIMLTFQEYTTA---------------MDIWSCGCILAEMLSGKPLFPGRDY 231

Query: 661 QNRLLAIMNPDVKIPFPEYTSNNEKIPKSAIELMKACLYRNPDKRWTVDKVLSSTFLQPF 720
            ++L  I+     +  P +   N+   K A E + A L   P   W  + V + T L P 
Sbjct: 232 HHQLWLILE---VLGTPSFEDFNQIKSKRAKEYI-ANLPMRPPLPW--ENVWAKTDLNPD 285

Query: 721 MISGSIMEDLIKNAVRYGSEK 741
           MI      DL+   +++  +K
Sbjct: 286 MI------DLLNKMLQFNPDK 300

>NCAS0A10290 Chr1 complement(2051582..2053111) [1530 bp, 509 aa]
           {ON} Anc_3.229
          Length = 509

 Score = 92.4 bits (228), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 74/246 (30%), Positives = 110/246 (44%), Gaps = 57/246 (23%)

Query: 488 IELLEKLKDQRRVIQLLDYEMGDGLLYLIMECGDHDLSQILNQRSNMPLDFNFVRFYTKE 547
           ++L     D  ++  LL Y  G  L + + E G               LD + V FY  E
Sbjct: 198 VKLFYSFHDNSKLYLLLQYIPGGELFFHLKEQGT--------------LDEDTVAFYAAE 243

Query: 548 MLLCIKVVHDAGIVHSDLKPANFVL-VKGILKIIDFGIA-------NAVPEHTVNIYRET 599
           +   +K +HD GIV+ DLKP N +L  KG L + DFG++       +A P    ++   +
Sbjct: 244 ISCALKFLHDKGIVYRDLKPENCLLNDKGHLVLTDFGLSKKSVTQNSANPSEVTSLNEPS 303

Query: 600 Q--------IGTPNYMAPEALVAMNYTQSSDNQHEGNKWKVGRPSDMWSCGCIIYQMIYG 651
           +        IGTP Y APE L  + Y ++ D       W        +S GC+IY M+ G
Sbjct: 304 EDLSTLHSIIGTPEYCAPEILQGLPYNKNCD-------W--------YSLGCLIYDMLSG 348

Query: 652 KPPYGSFQGQNR--LLAIMNPDVKIP-FPEYTSNNEKIPKSAIELMKACLYRNPDKRWTV 708
           KPPY    G N   +L  +  D + P  P Y S   K      +++   L ++  KRW V
Sbjct: 349 KPPY---TGANHKVILNKIQKDKQGPKIPYYLSEGMK------DMLNWLLKKDQSKRWDV 399

Query: 709 DKVLSS 714
           DK  ++
Sbjct: 400 DKYWAA 405

>ZYRO0F17402g Chr6 complement(1445685..1449254) [3570 bp, 1189 aa]
           {ON} similar to uniprot|Q12263 Saccharomyces cerevisiae
           YDR507C
          Length = 1189

 Score = 94.0 bits (232), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 68/242 (28%), Positives = 120/242 (49%), Gaps = 30/242 (12%)

Query: 483 GFKGEIELLEKLKDQRRVIQLLDYEMGDGLLYLIMECGDH-DLSQILNQRSNMPLDFNFV 541
           G + EI ++ KL +   V++L D    +  LY+++E  +  +L  +L +  N PL  N  
Sbjct: 78  GIEREI-IIMKLLNHPNVLRLYDVWETNPSLYMVLEYAEKGELFNLLVE--NGPLPENEA 134

Query: 542 RFYTKEMLLCIKVVHDAGIVHSDLKPANFVLVKGI-LKIIDFGIANAVPEHTVNIYRETQ 600
             + +++++ +   H  GIVH DLKP N +L   + +KI DFG+A      T +   ET 
Sbjct: 135 VCFFRQIIIGVSYCHALGIVHRDLKPENLLLDHDLNIKIADFGMAAL---ETEDKLLETS 191

Query: 601 IGTPNYMAPEALVAMNYTQSSDNQHEGNKWKVGRPSDMWSCGCIIYQMIYGKPPYGSFQG 660
            G+P+Y APE +  + Y               G  SD+WSCG I + ++ G+ P+    G
Sbjct: 192 CGSPHYAAPEIVSGIPYH--------------GFASDIWSCGVIFFALLTGRLPFDEEDG 237

Query: 661 --QNRLLAIMNPDVKIPFPEYTSNNEKIPKSAIELMKACLYRNPDKRWTVDKVLSSTFLQ 718
             +N LL + +   ++P      ++++I   A +L+   L  +P+ R    ++L    LQ
Sbjct: 238 NIRNLLLKVQSGKFEMP------DDDEISPEAQDLLAKILTVDPECRIKPREILKHPLLQ 291

Query: 719 PF 720
            +
Sbjct: 292 KY 293

>KNAG0K00680 Chr11 (120919..124206) [3288 bp, 1095 aa] {ON} Anc_3.92
           YDR490C
          Length = 1095

 Score = 93.6 bits (231), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 89/349 (25%), Positives = 147/349 (42%), Gaps = 72/349 (20%)

Query: 435 TVNDSQYEKIELLGRGGSSRVYKVKGSGNKIYALKRXXXXXXXXXXXXGFKGEIELLEKL 494
           T+ D  Y  + L     S R Y VK   NK Y +++                E   L+++
Sbjct: 152 TIGDGAYSTVVLATSKDSGRKYAVK-MLNKEYLIRQKKVKYVNI--------EKNALQRV 202

Query: 495 KDQRRVIQLLDYEMGDGLLYLIMECG-DHDLSQILNQRSNMPLDFNFVRFYTKEMLLCIK 553
            D   V++L      +  LY ++E   + D   ++ +  +  L+ +  ++Y+ +++  I 
Sbjct: 203 NDSPMVVRLFFTFQDEASLYFLLEFAPNGDFLSLMKKFGS--LNEDAAKYYSAQIIDAIG 260

Query: 554 VVHDAGIVHSDLKPANFVLVKGI-LKIIDFGIANAV------------PEHTVNIYRETQ 600
            +H  GIVH D+KP N +L K   +KI DFG A  +            PE+ +    ++ 
Sbjct: 261 FLHSRGIVHRDMKPENILLDKNWKIKITDFGTAKILEKTAQQEAGGSGPEYNLLTRSKSF 320

Query: 601 IGTPNYMAPEALVAMNYTQSSDNQHEGNKWKVGRPSDMWSCGCIIYQMIYGKPPYGSFQG 660
           +GT  Y++PE L               N   V    D+W+ GCI+YQM+ GKPP   F+ 
Sbjct: 321 VGTAEYVSPELL---------------NDSFVDYRCDIWAFGCIVYQMLAGKPP---FKA 362

Query: 661 QNRLLAIMNPDVKIPFPEYTSNNEKIPKSAIELMKACLYRNPDKRWTVDKVLSSTF---- 716
            N  L      +K+ +  +T+     P    +L+K  L ++ DKR TV ++    F    
Sbjct: 363 TNEYLTFQKV-MKVQY-AFTAG---FPLVIRDLVKRILVKDLDKRLTVQQIQRHHFFKGV 417

Query: 717 --------------LQPFMISGSIME------DLIKNAVRYGSEKPQIS 745
                         L PF I+   M+      D+ K    YG+ K   S
Sbjct: 418 NFKDGSVWSARVPELSPFKINAKSMQPVAALKDIYKKPTHYGAPKKTAS 466

>KLTH0F16676g Chr6 complement(1351362..1353998) [2637 bp, 878 aa]
           {ON} weakly similar to uniprot|P38692 Saccharomyces
           cerevisiae YHR102W KIC1 Protein kinase of the PAK/Ste20
           kinase family required for cell integrity possibly
           through regulating 1 6-beta-glucan levels in the wall
           physically interacts with Cdc31p (centrin) which is a
           component of the spindle pole body
          Length = 878

 Score = 93.6 bits (231), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 75/297 (25%), Positives = 138/297 (46%), Gaps = 34/297 (11%)

Query: 441 YEKIELLGRGGSSRVYK---VKGSGNKIYALKRXXXXXXXXXXXXGFKGEIELLEKLKDQ 497
           +++ E++GRG    VYK   +K   N++ A+K               + E++ L  LK  
Sbjct: 19  FKRTEVIGRGKFGIVYKGYYIKT--NRVCAIK-VLNLDSADDEVEDVQKEVQFLSSLKQV 75

Query: 498 RRVIQLLDYEMGDGLLYLIME-CGDHDLSQILNQRSNMPLDFNFVRFYTKEMLLCIKVVH 556
             +       + +  L++IME C    L  +L       +   ++    +E+L+ +  +H
Sbjct: 76  PNITHYYGSYLNNTELWVIMEYCAGGSLRTLLRPGK---IGEQYIGVIMRELLIALMHIH 132

Query: 557 DAGIVHSDLKPANFVLVK-GILKIIDFGIANAVPEHTVNIYRETQIGTPNYMAPEALVAM 615
             G++H D+K AN ++   G +K+ DFG+A  + +    I R+T  GTP +MAPE ++  
Sbjct: 133 KDGVIHRDIKAANVLITNDGHIKLCDFGVAAQLSQ--TKIRRQTMAGTPYWMAPEVIMEG 190

Query: 616 NYTQSSDNQHEGNKWKVGRPSDMWSCGCIIYQMIYGKPPYGSFQGQNRLLAIMNPDVKIP 675
            Y  +          KV    D+WS G   Y++  G PPY   +    +  I     K P
Sbjct: 191 VYYDT----------KV----DIWSLGITAYEIATGNPPYCDVEALRAMQLITK--SKPP 234

Query: 676 FPEYTSNNEKIPKSAIELMKACLYRNPDKRWTVDKVLSSTFLQPFM-ISGSIMEDLI 731
             E   ++  +     E +  CL  +P +R + +++L + F++    +S SI+++LI
Sbjct: 235 RLEGRQHSSAL----KEFIALCLDEDPKERPSAEELLKTKFIRLHKNVSASILKELI 287

>ZYRO0G15290g Chr7 complement(1237119..1241582) [4464 bp, 1487 aa]
            {ON} similar to uniprot|Q01389 Saccharomyces cerevisiae
            YJL095W BCK1 Mitogen-activated protein (MAP) kinase
            kinase kinase acting in the protein kinase C signaling
            pathway which controls cell integrity upon activation by
            Pkc1p phosphorylates downstream kinases Mkk1p and Mkk2p
          Length = 1487

 Score = 93.6 bits (231), Expect = 9e-19,   Method: Compositional matrix adjust.
 Identities = 75/277 (27%), Positives = 131/277 (47%), Gaps = 34/277 (12%)

Query: 483  GFKGEIELLEKLKDQRRVIQLLDYEMGDGLLYLIME--CGDHDLSQILNQRSNMPLDFNF 540
              + E+  L+ L D   ++Q L +E+ D +  L +E   G    S I   R     D   
Sbjct: 1231 ALRAEVSTLKDL-DHLNIVQYLGFEVKDSIYSLFLEYVAGGSVGSLI---RMYGKFDEKL 1286

Query: 541  VRFYTKEMLLCIKVVHDAGIVHSDLKPANFVLVK-GILKIIDFGIANAVPEHTVNIYRET 599
            ++  T ++L  +  +H  GI+H D+K  N +L + G+ KI DFGI+      + +IY  +
Sbjct: 1287 IKHLTIQVLRGLSYLHSRGILHRDMKADNLLLDQDGVCKISDFGIS----RKSKDIYSNS 1342

Query: 600  QI---GTPNYMAPEALVAMNYTQSSDNQHEGNKWKVGRPSDMWSCGCIIYQMIYGKPPYG 656
            ++   GT  +MAPE +          +  +G   KV    D+WS GC++ +M  GK P+ 
Sbjct: 1343 EMTMRGTVFWMAPEMV----------DTKQGYSAKV----DIWSLGCVVLEMFAGKRPWS 1388

Query: 657  SFQGQNRLLAIMNPDVKIPFPEYTSNNEKIPKSAIELMKACLYRNPDKRWTVDKVLSSTF 716
            + +    +  I       P P+ T     I +S  + +  C   +P++R T DK+LS  F
Sbjct: 1389 NLEVVAAMFKIGKSKSAPPIPDDTL--PLISQSGRDFLDQCFKIDPEERPTADKLLSHQF 1446

Query: 717  LQ---PFMISGSIMEDLIKNAVRYGSEKPQI-SHDDL 749
            L+    +    + + + IK+  +  S K ++ SHD +
Sbjct: 1447 LKVSSKYDFKSTKLAEFIKSNDKLNSTKLRVGSHDKV 1483

>KLLA0A02497g Chr1 (218592..219680) [1089 bp, 362 aa] {ON} highly
           similar to uniprot|P14681 Saccharomyces cerevisiae
           YGR040W KSS1 Mitogen-activated protein kinase (MAPK)
           involved in signal transduction pathways that control
           filamentous growth and pheromone response
          Length = 362

 Score = 90.5 bits (223), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 80/320 (25%), Positives = 142/320 (44%), Gaps = 58/320 (18%)

Query: 439 SQYEKIELLGRGGSSRVY-KVKGSGNKIYALKRXXXXXXXXXXXXGFKGEIELLEKLKDQ 497
           S Y+ ++L+G G    V   +    N   A+K+              + E++LL+     
Sbjct: 11  SHYQLVDLVGEGAYGTVCSAIHKPTNTKVAIKKIQPFSRSMFVTRTLR-ELKLLKFFHSH 69

Query: 498 RRVIQLLDYEMGDGL-----LYLIMECGDHDLSQILNQRSNMPLDFNFVRFYTKEMLLCI 552
             +I +LD            +YL+ E  + DL +I+NQ++   L  + ++++  ++L  +
Sbjct: 70  ENIISVLDIVRPTSWHKFEAVYLVQELMETDLQKIINQQN---LSEDHIQYFVYQILRAL 126

Query: 553 KVVHDAGIVHSDLKPANFVLVKGI-LKIIDFGIANAVP------EHTVNIYRETQIGTPN 605
           K +H A ++H DLKP+N +L     LK+ DFG+A  +       E+ V    E  + T  
Sbjct: 127 KSLHSAQVIHRDLKPSNLLLNSNCDLKVCDFGLARCLASSDQSRENMVGFMTEY-VATRW 185

Query: 606 YMAPEALVAMN-YTQSSDNQHEGNKWKVGRPSDMWSCGCIIYQMIYGKPPYGSFQGQNRL 664
           Y APE +++   YT + D               +WSCGCI+ +MI GKP +      ++L
Sbjct: 186 YRAPEIMLSFQEYTTAMD---------------IWSCGCILAEMIMGKPLFPGKDYHHQL 230

Query: 665 LAIM----NPDV----------------KIP----FPEYTSNNEKIPKSAIELMKACLYR 700
             I+    +P +                ++P     P     N+++   AI+L+   L  
Sbjct: 231 WIILEVLGSPTLEDFEQIKSKRAKEYISQLPMKKGIPWANVLNKEVNPLAIDLLSKMLTF 290

Query: 701 NPDKRWTVDKVLSSTFLQPF 720
           NPDKR +  + L   +L  +
Sbjct: 291 NPDKRISAVEALEHPYLATY 310

>SAKL0D05522g Chr4 (437018..441442) [4425 bp, 1474 aa] {ON} similar to
            uniprot|O60030 Kluyveromyces lactis BCK1 MAP kinase
            kinase kinase and some similarites with YJL095W
            uniprot|Q01389 Saccharomyces cerevisiae YJL095W BCK1
            Mitogen- activated protein (MAP) kinase kinase kinase
            acting in the protein kinase C signaling pathway which
            controls cell integrity upon activation by Pkc1p
            phosphorylates downstream kinases Mkk1p and Mkk2p
          Length = 1474

 Score = 93.6 bits (231), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 83/325 (25%), Positives = 143/325 (44%), Gaps = 40/325 (12%)

Query: 441  YEKIELLGRGGSSRVY-KVKGSGNKIYALKRX------XXXXXXXXXXXGFKGEIELLEK 493
            + K E++G+G    VY  +  +  ++ A+K+                    + E+  L+ 
Sbjct: 1174 WIKGEMIGKGSFGAVYLGLNVTTGEMMAVKQVEVPKFGSQDEATISVVEALRSEVSTLKN 1233

Query: 494  LKDQRRVIQLLDYEMGDGLLYLIME--CGDHDLSQILNQRSNMPLDFNFVRFYTKEMLLC 551
            L D   ++Q L +E  + +  L +E   G    S I   R     D + +RF T ++L  
Sbjct: 1234 L-DHLNIVQYLGFENKNSIYSLFLEYVAGGSVGSLI---RLYGRFDESLIRFLTVQVLRG 1289

Query: 552  IKVVHDAGIVHSDLKPANFVL-VKGILKIIDFGIANAVPEHTVNIYRETQI---GTPNYM 607
            +  +H  GI+H D+K  N +L + G+ KI DFGI+      + +IY  + +   GT  +M
Sbjct: 1290 LSYLHSRGILHRDMKADNLLLDLDGVCKISDFGIS----RKSNDIYCNSDMTMRGTVFWM 1345

Query: 608  APEALVAMNYTQSSDNQHEGNKWKVGRPSDMWSCGCIIYQMIYGKPPYGSFQGQNRLLAI 667
            APE +          +  +G   KV    D+WS GC++ +M  GK P+ + +    +  I
Sbjct: 1346 APEMV----------DTKQGYSAKV----DIWSLGCVVLEMFAGKRPWSNLEVVAAMFKI 1391

Query: 668  MNPDVKIPFPEYTSNNEKIPKSAIELMKACLYRNPDKRWTVDKVLSSTFLQ---PFMISG 724
                   P PE T     I K   E + AC   +P++R T D +L   F +    F    
Sbjct: 1392 GKSKTAPPIPEDTL--PLISKEGREFLDACFEIDPERRPTADTLLRHRFCEVEKSFDFKK 1449

Query: 725  SIMEDLIKNAVRYGSEKPQISHDDL 749
            + + D IK+  +    K ++   D+
Sbjct: 1450 TQVADFIKSNDKLNYSKLRVGSQDI 1474

>YAL017W Chr1 (120225..124295) [4071 bp, 1356 aa] {ON}  PSK1One of two
            (see also PSK2) PAS domain containing S/T protein
            kinases; coordinately regulates protein synthesis and
            carbohydrate metabolism and storage in response to a
            unknown metabolite that reflects nutritional status
          Length = 1356

 Score = 93.2 bits (230), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 69/232 (29%), Positives = 119/232 (51%), Gaps = 39/232 (16%)

Query: 487  EIELLEKL--KDQRRVIQLLDYEMGDGLLYLIM----ECGDHDLSQILNQRSNMPLDFNF 540
            EI+++  L  K    +++LLD+   D   Y+      E G  DL  ++  ++NM  +F  
Sbjct: 1149 EIQIMATLNKKPHENILRLLDFFEDDDYYYIETPVHGETGCIDLFDLIEFKTNM-TEFE- 1206

Query: 541  VRFYTKEMLLCIKVVHDAGIVHSDLKPANFVL-VKGILKIIDFGIANAVPEHTVNIYRET 599
             +   K+++  IK +HD GIVH D+K  N ++  KG +KIIDFG A  V     +++   
Sbjct: 1207 AKLIFKQVVAGIKHLHDQGIVHRDIKDENVIVDSKGFVKIIDFGSAAYVKSGPFDVF--- 1263

Query: 600  QIGTPNYMAPEALVAMNYTQSSDNQHEGNKWKVGRPSDMWSCGCIIYQMIYGKPPYGSFQ 659
             +GT +Y APE L              GN ++ G+P D+W+ G ++Y +++ + P+ +  
Sbjct: 1264 -VGTIDYAAPEVL-------------GGNPYE-GQPQDIWAIGILLYTVVFKENPFYNID 1308

Query: 660  GQNRLLAIMNPDVKIPFPEYTSNNEKIPKSAIELMKACLYRNPDKRWTVDKV 711
                   I+  D+K       +N E++ +  IEL+K+ L R   KR T+D +
Sbjct: 1309 ------EILEGDLKF------NNAEEVSEDCIELIKSILNRCVPKRPTIDDI 1348

>KLTH0C08932g Chr3 (749308..750867) [1560 bp, 519 aa] {ON} similar
           to uniprot|P38070 Saccharomyces cerevisiae YBR028C
           Hypothetical ORF
          Length = 519

 Score = 91.7 bits (226), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 96/367 (26%), Positives = 147/367 (40%), Gaps = 100/367 (27%)

Query: 410 PPVTKKVEI-VEPAKSASSSNNRSMITVNDSQ---------YEKIELLGRGGSSRVYKVK 459
           PP T++  +  +  K  + SNN S  + +  Q         ++ I +LGRG   +V  V+
Sbjct: 83  PPNTRRFALSTQEQKDGNDSNNSSYCSPSVLQKHGMRSLEDFKPIRVLGRGAYGKVLLVR 142

Query: 460 GS-GNKIYALKRXXXXXXXXXXXXGFKGE-----------------------------IE 489
            S  +++YA+K+                E                             ++
Sbjct: 143 DSHTHRLYAMKQLKKAEILIHEDKSSDTEETKDDALEKRLERTFAERIILSQLEHPNIVK 202

Query: 490 LLEKLKDQRRVIQLLDYEMGDGLLYLIMECGDHDLSQILNQRSNMPLDFNFVRFYTKEML 549
           L     D  ++  +L +  G  L Y + E G               LD N V FY  E+ 
Sbjct: 203 LFYSFHDHHKLYLVLQFIPGGELFYHLKEQG--------------TLDENTVTFYAAEIS 248

Query: 550 LCIKVVHDAGIVHSDLKPANFVL-VKGILKIIDFGIA-----------------NAVPEH 591
             +K +H+ GIV+ DLKP N +L  +G L + DFG++                 +A+  H
Sbjct: 249 CALKFLHERGIVYRDLKPENCLLDERGHLVLTDFGLSKKSAADSDTPERSDIDGDALNSH 308

Query: 592 T---VN-IYRETQIGTPNYMAPEALVAMNYTQSSDNQHEGNKWKVGRPSDMWSCGCIIYQ 647
           +   VN +Y  + IGTP Y APE L    YTQ+ D       W        +S GC+++ 
Sbjct: 309 SGEPVNKLY--SIIGTPEYCAPEILEGKPYTQNCD-------W--------YSLGCLVFD 351

Query: 648 MIYGKPPYGSFQGQNRLLAIMNPDVKIPFPEYTSNNEKIPKSAIELMKACLYRNPDKRWT 707
           M+ GKPPY     +  L  I+  D     P Y S   K      + + A L ++  KRW 
Sbjct: 352 MLIGKPPYTGVNHKVILGKILK-DKTPKIPSYLSEGMK------DYLGALLKKDVTKRWD 404

Query: 708 VDKVLSS 714
           VDK   S
Sbjct: 405 VDKFWDS 411

>NDAI0K02390 Chr11 (537260..539920) [2661 bp, 886 aa] {ON} Anc_6.371
          Length = 886

 Score = 92.8 bits (229), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 79/306 (25%), Positives = 132/306 (43%), Gaps = 45/306 (14%)

Query: 423 KSASSSNNRSMITVNDSQYEKIELLGRGGSSRVYKVK-GSGNKIYALK-RXXXXXXXXXX 480
           ++ S SN    ITV+   +EKI+LLGRG   +VY VK  + N++YALK            
Sbjct: 459 RTKSFSNKFKDITVSPQSFEKIKLLGRGDVGKVYLVKEKNTNRLYALKIFSKAEMIKRKK 518

Query: 481 XXGFKGEIELLEKLKDQRRVIQLLDYEMGDGLLYLIME-CGDHDLSQILNQRSNMPLDFN 539
                 E E+L    +   ++ L      +  +Y  ME C   +  + L  R    +   
Sbjct: 519 IKRVLAEQEIL-ATSNHPFIVTLYHSFQTEDYVYFCMEYCMGGEFFRALQTRKTKCICEE 577

Query: 540 FVRFYTKEMLLCIKVVHDAGIVHSDLKPANFVLVK-GILKIIDFGIANAVPEHTVNIYR- 597
             +FY  E+   ++ +H  G ++ DLKP N +L K G + + DF ++    +  + + + 
Sbjct: 578 DAKFYASEVTAALEYLHLLGFIYRDLKPENILLHKSGHIMLSDFDLSVQAKDAKIPVMKG 637

Query: 598 -------ETQI-----------GTPNYMAPEALVAMNYTQSSDNQHEGNKWKVGRPSDMW 639
                  +T+I           GT  Y+APE +    +T + D       W        W
Sbjct: 638 MDESTIIDTKIVSDGFRTNSFVGTEEYIAPEVIRGNGHTAAVD-------W--------W 682

Query: 640 SCGCIIYQMIYGKPPYGSFQGQNRLLAIMNPDVKIPFPEYTSNNEKIPKSAIELMKACLY 699
           + G +IY+M++G  P+           I+  DV  P      NN  I ++  +L+K  L 
Sbjct: 683 TLGILIYEMLFGMTPFKGSNSNETFSNILKNDVSFP------NNNDISRNCKDLIKKLLC 736

Query: 700 RNPDKR 705
           +N +KR
Sbjct: 737 KNENKR 742

>CAGL0J11638g Chr10 complement(1130744..1132984) [2241 bp, 746 aa]
           {ON} highly similar to uniprot|P32562 Saccharomyces
           cerevisiae YMR001c CDC5 involved in regulation of DNA
           replication
          Length = 746

 Score = 92.4 bits (228), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 72/290 (24%), Positives = 133/290 (45%), Gaps = 27/290 (9%)

Query: 432 SMITVNDSQYEKIELLGRGGSSRVYKVKGSGNKIYALKRXXX-XXXXXXXXXGFKGEIEL 490
           S+I      Y + + LG GG +R +++K    KI+A K                  EI+ 
Sbjct: 72  SLIKTRGRDYHRGQFLGEGGFARCFQIKDDSGKIFAAKTVAKISIKSEKTRKKLLSEIQ- 130

Query: 491 LEKLKDQRRVIQLLDYEMGDGLLYLIME-CGDHDLSQILNQRSNMPLDFNFVRFYTKEML 549
           + K      ++Q +D    +  +Y+++E C +  L +++ +R  +      VRF+  ++ 
Sbjct: 131 IHKSMSHTNIVQFIDCFEDNVNVYILLEICPNGSLMELIKKRKTITEP--EVRFFMTQIC 188

Query: 550 LCIKVVHDAGIVHSDLKPANFVLVKGI-LKIIDFGIANAVPEHTVNIYRETQIGTPNYMA 608
             I+ +H   ++H DLK  N    +   LKI DFG+A  +       +  T  GTPNY+A
Sbjct: 189 GGIQYMHSNRVIHRDLKLGNIFFDEHYNLKIGDFGLAAVLANDRERKF--TICGTPNYIA 246

Query: 609 PEALVAMNYTQSSDNQHEGNKWKVGRPSDMWSCGCIIYQMIYGKPPYGSFQGQNRLLAIM 668
           PE L+          +H G+ ++V    D+WS G ++Y ++ GKPP+ +         I 
Sbjct: 247 PEVLMG---------KHSGHSYEV----DIWSIGVMLYALLIGKPPFQAKDVNTIYERIK 293

Query: 669 NPDVKIPFPEYTSNNEKIPKSAIELMKACLYRNPDKRWTVDKVLSSTFLQ 718
             +   P       ++KI + A  L+   L  NP +R ++ +++   + +
Sbjct: 294 QRNFAYP------KDKKISQDAKYLIDDILSLNPMERPSIQEIMDYVWFR 337

>TDEL0A07860 Chr1 (1365985..1368498) [2514 bp, 837 aa] {ON}
           Anc_6.371 YCR091W
          Length = 837

 Score = 92.8 bits (229), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 85/323 (26%), Positives = 137/323 (42%), Gaps = 50/323 (15%)

Query: 411 PVTKKVEIVEPAKS-----ASSSNNRSMITVNDSQYEKIELLGRGGSSRVYKVK-GSGNK 464
           P+ K  ++ EP +S      S SN    ITV    +EK+ LLG+G   +VY VK    N+
Sbjct: 404 PLEKLPDLEEPKRSRRLRNKSFSNKFRDITVGPQSFEKVRLLGQGDVGKVYLVKEKRTNR 463

Query: 465 IYALK-RXXXXXXXXXXXXGFKGEIELLEKLKDQRRVIQLLDYEMGDGLLYLIME-CGDH 522
           +YALK                  E E+L    +   ++ L      +  LYL ME C   
Sbjct: 464 LYALKIFSKAEMIKRKKIKRILAEQEIL-ATSNHPFIVTLYHSFQSEDYLYLCMEYCMGG 522

Query: 523 DLSQILNQRSNMPLDFNFVRFYTKEMLLCIKVVHDAGIVHSDLKPANFVLVK-GILKIID 581
           +  + L  R    +  +  RFY  E+   ++ +H  G ++ DLKP N +L K G + + D
Sbjct: 523 EFFRALQTRKTKCISEDDARFYASEVTAALEYLHLMGCIYRDLKPENILLHKSGHIMLSD 582

Query: 582 FGIA-------NAVPEHTV-----------NIYRETQ-IGTPNYMAPEALVAMNYTQSSD 622
           F ++       N V + +            N +R    +GT  Y+APE +    +T + D
Sbjct: 583 FDLSIQAKDAKNPVVKGSAQSTLVDTKICSNGFRTNSFVGTEEYIAPEVIRGNGHTAAVD 642

Query: 623 NQHEGNKWKVGRPSDMWSCGCIIYQMIYGKPPYGSFQGQNRLLAIMNPDVKIPFPEYTSN 682
                  W        W+ G + Y+M++G  P+           I+  +V  P      N
Sbjct: 643 -------W--------WTLGILTYEMLFGFTPFKGDNTNETFCNILKSEVTFP------N 681

Query: 683 NEKIPKSAIELMKACLYRNPDKR 705
           N +I ++  +L+K  L +N  KR
Sbjct: 682 NNEISRACKDLIKKLLTKNESKR 704

>Ecym_2499 Chr2 complement(976395..981020) [4626 bp, 1541 aa] {ON}
            similar to Ashbya gossypii AER264C
          Length = 1541

 Score = 93.2 bits (230), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 83/358 (23%), Positives = 158/358 (44%), Gaps = 52/358 (14%)

Query: 386  DDVITNENENKKIQEV--FYHRPAPKPPVTKKVEIVEPAKSASSSNNRSMITVNDSQY-- 441
            +DV++  N   +++ +     R   + P+ K ++       A+   N+ ++++  S Y  
Sbjct: 1188 EDVVSEFNSKMRLEAIKELEGRITKRRPIGKVLD-------ATDKENQYLLSLASSLYNV 1240

Query: 442  ----EKIELLGRGGSSRVY-KVKGSGNKIYALK--RXXXXXXXXXXXXGFKGEIELLEKL 494
                +K   +G G    VY  V      I A+K  R              K E+ +LE L
Sbjct: 1241 SIRWQKRSFIGGGSFGSVYSAVNLDTGDILAVKEIRFHDRKSMRQVFPSIKDEMTVLEML 1300

Query: 495  KDQRRVIQLLDYEMGDGLLYLIME-CGDHDLSQILNQRSNMPLDFNFVRFYTKEMLLCIK 553
             +   ++Q    E+    + + ME C    L+ +L        D    + Y+ ++L  + 
Sbjct: 1301 -NHPNIVQYYGVEVHRDRVNIFMEYCEGGSLASLLEH--GRIEDEMVTQVYSLQLLEGLA 1357

Query: 554  VVHDAGIVHSDLKPANFVL-VKGILKIIDFGIANAVPEHTVNIYRE--------TQIGTP 604
             +H++G+ H D+KP N +L   GI+K +DFG A  +  +   +  E          IGTP
Sbjct: 1358 YLHESGVHHRDIKPENILLDFNGIIKYVDFGAAKLIATNGSKVLTEDNGRDSTDKMIGTP 1417

Query: 605  NYMAPEALVAMNYTQSSDNQHEGNKWKVGRPSDMWSCGCIIYQMIYGKPPYGSFQGQNRL 664
             YM+PE++ A  Y +   +             D+WS GC++ +M+ G+ P+ +   Q   
Sbjct: 1418 MYMSPESISASGYGKFGSD-------------DIWSLGCVVLEMVTGRRPWANLDNQ--- 1461

Query: 665  LAIMNPDVKIPFPEYTSNNEKIPKSAIELMKACLYRNPDKRWTVDKVLSSTFLQPFMI 722
             AIM        P + + +E  P + I+ +  CL ++P+ R +  ++L    + P+++
Sbjct: 1462 WAIMYQVAAGQIPSFPTKHEMSP-TGIKFLSRCLIQDPNMRSSAVELL----MDPWIV 1514

>Ecym_1058 Chr1 (105835..109329) [3495 bp, 1164 aa] {ON} similar to
           Ashbya gossypii AFR696C
          Length = 1164

 Score = 92.8 bits (229), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 69/242 (28%), Positives = 121/242 (50%), Gaps = 30/242 (12%)

Query: 483 GFKGEIELLEKLKDQRRVIQLLDYEMGDGLLYLIMECGDH-DLSQILNQRSNMPLDFNFV 541
           G + EI ++ KL +   V++L D       LY+++E  +  +L  +L +R  +P +   V
Sbjct: 75  GIEREITIM-KLLNHPNVLRLYDVWETSTDLYMVLEYVEKGELFNLLIERGPLP-ENEAV 132

Query: 542 RFYTKEMLLCIKVVHDAGIVHSDLKPANFVL-VKGILKIIDFGIANAVPEHTVNIYRETQ 600
           RF+ +++++ I   H  GIVH DLKP N +L  K  +K+ DFG+A      + +   ET 
Sbjct: 133 RFF-RQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMAAL---ESKDKLLETS 188

Query: 601 IGTPNYMAPEALVAMNYTQSSDNQHEGNKWKVGRPSDMWSCGCIIYQMIYGKPPYGSFQG 660
            G+P+Y APE +  + Y               G  SD+WSCG I+Y ++ G+ P+    G
Sbjct: 189 CGSPHYAAPEIVSGLPYH--------------GFESDVWSCGVILYALLTGRLPFDEDDG 234

Query: 661 QNR--LLAIMNPDVKIPFPEYTSNNEKIPKSAIELMKACLYRNPDKRWTVDKVLSSTFLQ 718
             R  LL + + + ++P      + ++I   A +L+   L  +P  R    ++L    L+
Sbjct: 235 NIRKLLLKVQSGEFEMP------DKDEISIEAQDLIAKILTVDPSGRIKTREILKHPLLK 288

Query: 719 PF 720
            +
Sbjct: 289 KY 290

>NDAI0A03870 Chr1 (867910..870597) [2688 bp, 895 aa] {ON} Anc_2.496
          Length = 895

 Score = 92.8 bits (229), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 77/300 (25%), Positives = 137/300 (45%), Gaps = 35/300 (11%)

Query: 440 QYEKIELLGRGGSSRVYKVKGSGNKI-YALKRXXXXXXXXXXXXGFKGEIELLEKLKDQR 498
           +Y  +  +GRGGS+ VY     G  +  A+K+                EI +++K     
Sbjct: 612 KYANLVKIGRGGSALVYTAYEVGTNLSVAIKQINLEKQPRKQL--ILNEIIVMKK-SQHP 668

Query: 499 RVIQLLDYEMGDGLLYLIMECGDHDLSQILNQRSNMPLDFNFVRFYTKEMLLCIKVVHDA 558
            ++  +D  + DG L++IME    +   + +  +   L    +    +E+L  +  +H  
Sbjct: 669 NIVNFIDSYLVDGKLWVIMEY--MEAGSLTDVVTRCILREGQIGAVCREVLKGLVFLHSK 726

Query: 559 GIVHSDLKPANFVL-VKGILKIIDFGIANAVPEHTVNIYRETQIGTPNYMAPEALVAMNY 617
           G++H D+K  N +L + G +K+ DFG    +  + +++ R T +GTP +MAPE +   +Y
Sbjct: 727 GVIHRDIKSDNVLLSMDGDIKLTDFGFCAQL--NDIHLKRNTMVGTPYWMAPEIVEKKHY 784

Query: 618 TQSSDNQHEGNKWKVGRPSDMWSCGCIIYQMIYGKPPYGSFQGQNRLLAIM---NPDVKI 674
                        KV    D+WS G +I +MI G+PPY +      L  I     P +K 
Sbjct: 785 CP-----------KV----DIWSLGVMIIEMIEGEPPYLNEPPLRALYLIATNGTPKLKD 829

Query: 675 PFPEYTSNNEKIPKSAIELMKACLYRNPDKRWTVDKVLSSTFLQPFMISGSIMEDLIKNA 734
           P        EK+ ++  E +  CL+ +P+ R T  ++L+  F+         +  L+K A
Sbjct: 830 P--------EKLSETLSEFINCCLFVDPELRKTAAELLNHRFITEIAGPNKSLSHLVKLA 881

>NCAS0A09470 Chr1 complement(1883183..1887730) [4548 bp, 1515 aa] {ON}
            
          Length = 1515

 Score = 92.8 bits (229), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 104/407 (25%), Positives = 177/407 (43%), Gaps = 56/407 (13%)

Query: 326  NIDTSNNSSFNSPIHNIHKEISRNKDSDSEKRGVLRNISINANHADNILQQDNKRLKRSL 385
            N DT  +S+  SPI +    +S +  +D+ K   LRN         N+L     +L R  
Sbjct: 1112 NSDTPRSSAPTSPIAHSKPTLSESP-TDTLKNPSLRN---------NVL-----KLPRRT 1156

Query: 386  DDV--ITNENENKKIQEVFYHRPAPKPPVTKKVEIVEPAKSASSSNNRSMITVNDSQYEK 443
              +  I +E   K+ + +   R   K   T+ VE+ E    + + +  S     +  + K
Sbjct: 1157 KTIRTIAHEASEKRKKSIKLKRQNTKMWGTRTVEVTEKQLVSINKSRNSKGEYKEFAWMK 1216

Query: 444  IELLGRGGSSRVY-KVKGSGNKIYALKR------XXXXXXXXXXXXGFKGEIELLEKLKD 496
             E++G+G    VY  +  +  ++ A+K+                    + E+  L+ L D
Sbjct: 1217 GEMIGKGSFGAVYLCLNVTTGEMMAVKQVEVPKYSSQDEAIISTVEALRSEVSTLKDL-D 1275

Query: 497  QRRVIQLLDYEMGDGLLYLIME--CGDHDLSQI-LNQRSNMPLDFNFVRFYTKEMLLCIK 553
               ++Q L +E  D +  L +E   G    S I +  R + PL    +R    ++L  + 
Sbjct: 1276 HLNIVQYLGFENKDNIYSLFLEYVAGGSVGSLIRMYGRFDEPL----IRHLNTQVLRGLA 1331

Query: 554  VVHDAGIVHSDLKPANFVLVK-GILKIIDFGIANAVPEHTVNIYRETQI---GTPNYMAP 609
             +H  GI+H D+K  N +L + G+ KI DFGI+      + +IY  + +   GT  +MAP
Sbjct: 1332 YLHSRGILHRDMKADNLLLDQDGVCKISDFGIS----RKSKDIYSNSDMTMRGTVFWMAP 1387

Query: 610  EALVAMNYTQSSDNQHEGNKWKVGRPSDMWSCGCIIYQMIYGKPPYGSFQGQNRLLAIMN 669
            E +          +  +G   KV    D+WS GCI+ +M  GK P+ +++    +  I  
Sbjct: 1388 EMV----------DTKQGYSAKV----DIWSLGCIVLEMFAGKRPWSNYEVVAAMFKIGK 1433

Query: 670  PDVKIPFPEYTSNNEKIPKSAIELMKACLYRNPDKRWTVDKVLSSTF 716
                 P P  T     I ++  + + AC   +PD R T D +LS  F
Sbjct: 1434 SKSAPPIPPDTL--PLISQNGRDFLDACFEIDPDNRPTADNLLSHPF 1478

>Kwal_23.6325 s23 complement(1533223..1537851) [4629 bp, 1542 aa] {ON}
            YNR031C (SSK2) - A MAP kinase kinase kinase; activator of
            Pbs2p [contig 17] FULL
          Length = 1542

 Score = 92.8 bits (229), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 85/313 (27%), Positives = 143/313 (45%), Gaps = 45/313 (14%)

Query: 425  ASSSNNRSMITVNDSQYEKIELLGRGGSSRVY-KVKGSGNKIYALK--RXXXXXXXXXXX 481
            ASS +N S+      +++K + +G G    V+  V     +I A+K  +           
Sbjct: 1239 ASSLSNVSI------RWQKRQFVGGGAFGTVFSAVNLDTGEILAVKEIKIQDRKSMKQVF 1292

Query: 482  XGFKGEIELLEKLKDQRRVIQLLDYEMGDGLLYLIME-CGDHDLSQILNQRSNMPLDFNF 540
               K E+ +LE L +   V+Q    E+    + L ME C    L+Q+L        D   
Sbjct: 1293 PAIKEEMSVLEML-NHPNVVQYYGVEVHRDKVNLFMEYCEGGSLAQLLEH--GRIEDEMV 1349

Query: 541  VRFYTKEMLLCIKVVHDAGIVHSDLKPANFVL-VKGILKIIDFGIANAVPEHTV---NIY 596
             + Y  +ML  +  +H + +VH D+KP N +L   G++K +DFG A ++  +     N+ 
Sbjct: 1350 TQIYALQMLEGLAYLHQSSVVHRDIKPENILLDFNGVIKYVDFGAARSLAANGTKAPNVG 1409

Query: 597  RE-------TQIGTPNYMAPEALVAMNYTQSSDNQHEGNKWKVGRPSDMWSCGCIIYQMI 649
             E       + +GTP YM+PE++                K K G   D+WS GC+I +M+
Sbjct: 1410 AEGKADGVNSMMGTPMYMSPESITG------------AKKGKFG-SGDIWSLGCVILEMV 1456

Query: 650  YGKPPYGSFQGQNRLLAIMNPDVKIPFPEYTSNNEKIPKSAIELMKACLYRNPDKRWTVD 709
             G+ P+ +   +    AIM        P+  +  E  P+  I+ +  CL ++P+KR T  
Sbjct: 1457 TGRRPWFNLDNE---WAIMYHVAAGHVPQLPTKEELSPQ-GIDFLLRCLKQDPNKRSTAM 1512

Query: 710  KVLSSTFLQPFMI 722
            ++L    L P+MI
Sbjct: 1513 ELL----LHPWMI 1521

>Ecym_6344 Chr6 complement(664647..668840) [4194 bp, 1397 aa] {ON}
            similar to Ashbya gossypii AFR092W
          Length = 1397

 Score = 92.8 bits (229), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 79/311 (25%), Positives = 136/311 (43%), Gaps = 45/311 (14%)

Query: 430  NRSMITVNDSQ----------YEKIELLGRGGSSRVY-KVKGSGNKIYALKRX------X 472
            ++ M+++N S+          + K E++G+G    VY  +  +  ++ A+K+        
Sbjct: 1077 DKRMVSINKSKNSKGEYREFAWIKGEIIGKGSFGAVYLGLNVTTGEMMAVKQVEVPKFGS 1136

Query: 473  XXXXXXXXXXGFKGEIELLEKLKDQRRVIQLLDYEMGDGLLYLIME-CGDHDLSQILNQR 531
                          E+  L+ L D   ++Q L +E  +G+  L +E      +  ++   
Sbjct: 1137 QDQITVTNVEALISEVSTLKNL-DHLNIVQYLGFENKNGIYSLFLEYVAGGSVGSLIRLY 1195

Query: 532  SNMPLDFNFVRFYTKEMLLCIKVVHDAGIVHSDLKPANFVLVK-GILKIIDFGIANAVPE 590
             +   D   +RF TK++L  +  +H  GI+H D+K  N +L   G+ KI D GI+     
Sbjct: 1196 GH--FDEQLIRFLTKQVLEGLAYLHRRGILHRDMKADNLLLDNNGVCKISDLGIS----R 1249

Query: 591  HTVNIYRETQI---GTPNYMAPEALVAMNYTQSSDNQHEGNKWKVGRPSDMWSCGCIIYQ 647
             + NIY   ++   GT  +MAPE +          +  +G   KV    D+WS GC++ +
Sbjct: 1250 KSNNIYSNAEMTMRGTVFWMAPEMV----------DTTQGYSAKV----DIWSLGCVVLE 1295

Query: 648  MIYGKPPYGSFQGQNRLLAIMNPDVKIPFPEYTSNNEKIPKSAIELMKACLYRNPDKRWT 707
            M  GK P+ + +    +  I       P PE T     I K     +  C   +P+KR T
Sbjct: 1296 MFAGKRPWSNLEVVAAMFQIGKSKTAPPIPEKTL--PLISKDGRVFIDDCFKIDPEKRPT 1353

Query: 708  VDKVLSSTFLQ 718
             D +LS  F Q
Sbjct: 1354 ADTLLSHPFCQ 1364

>Smik_1.50 Chr1 (103132..107205) [4074 bp, 1357 aa] {ON} YAL017W
            (REAL)
          Length = 1357

 Score = 92.4 bits (228), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 70/238 (29%), Positives = 121/238 (50%), Gaps = 39/238 (16%)

Query: 487  EIELLEKL--KDQRRVIQLLDYEMGDGLLYLIM----ECGDHDLSQILNQRSNMPLDFNF 540
            EI+++  L  K    +++LLD+   D   Y+      E G  DL  ++  ++NM  +F  
Sbjct: 1150 EIQIMATLNKKPHENILRLLDFFEDDDYYYIETPVHGETGCIDLFDLIEFKTNM-TEFE- 1207

Query: 541  VRFYTKEMLLCIKVVHDAGIVHSDLKPANFVL-VKGILKIIDFGIANAVPEHTVNIYRET 599
             +   K+++  IK +HD GIVH D+K  N ++  KG +KIIDFG A  V     +++   
Sbjct: 1208 AKLIFKQVVAGIKHLHDQGIVHRDIKDENVIVDSKGFVKIIDFGSAAYVKSGPFDVF--- 1264

Query: 600  QIGTPNYMAPEALVAMNYTQSSDNQHEGNKWKVGRPSDMWSCGCIIYQMIYGKPPYGSFQ 659
             +GT +Y APE L              GN ++ G+P D+W+ G ++Y +++ + P+ +  
Sbjct: 1265 -VGTIDYAAPEVL-------------GGNPYE-GQPQDIWAIGILLYTVVFKENPFYNID 1309

Query: 660  GQNRLLAIMNPDVKIPFPEYTSNNEKIPKSAIELMKACLYRNPDKRWTVDKVLSSTFL 717
                   I+  D+K       +N E + +  IEL+K+ L R   KR T+D + +  +L
Sbjct: 1310 ------EILEGDLKF------NNAEGVSEDCIELIKSILNRCVPKRPTIDDINNDKWL 1355

>Kwal_14.1416 s14 (315842..316939) [1098 bp, 365 aa] {ON} YGR040W
           (KSS1) - MAP protein kinase homolog involved in
           pheromone signal transduction [contig 242] FULL
          Length = 365

 Score = 89.7 bits (221), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 80/319 (25%), Positives = 141/319 (44%), Gaps = 59/319 (18%)

Query: 439 SQYEKIELLGRGGSSRVYKV--KGSGNKIYALKRXXXXXXXXXXXXGFKGEIELLEKLKD 496
           S Y+ +EL+G G    V     K SG K+ A+K+              + E++LL+    
Sbjct: 11  SCYQLVELVGEGAYGTVCSAVHKPSGTKV-AIKKIQPFSKEMFVTRTLR-ELKLLKLFHS 68

Query: 497 QRRVIQLLDYEMGDGL-----LYLIMECGDHDLSQILNQRSNMPLDFNFVRFYTKEMLLC 551
              +I +LD      +     +YL+ E  + DL ++++      L  + ++++T ++L  
Sbjct: 69  HENIISVLDVVRPTSMDKFQAVYLVQELMETDLHKVISS-GGASLSDDHIQYFTYQILRA 127

Query: 552 IKVVHDAGIVHSDLKPANFVLVKGI-LKIIDFGIANAVPEHT-----VNIYRETQIGTPN 605
           +K +H A ++H D+KP+N +L     LK+ DFG+A  +   T     +  +    + T  
Sbjct: 128 LKAIHSAQVIHRDIKPSNLLLNSNCDLKVCDFGLARCLISSTHSRQNLVGFMTEYVATRW 187

Query: 606 YMAPEALVAM-NYTQSSDNQHEGNKWKVGRPSDMWSCGCIIYQMIYGKPPYGSFQGQNRL 664
           Y APE ++    YT +                D+WSCGCI+ +MI GKP +      ++L
Sbjct: 188 YRAPEIMLTFQQYTVA---------------MDIWSCGCILAEMITGKPLFPGRDYHHQL 232

Query: 665 LAIMNPDVKIP------------FPEYTSN---NEKIP-----------KSAIELMKACL 698
             I+   +  P              EY +N    +K+P             A++L+   L
Sbjct: 233 WLILEA-LGTPSYEDFENINSKRAKEYIANLPLRQKLPWQVVLQKQDINPQAVDLLDKML 291

Query: 699 YRNPDKRWTVDKVLSSTFL 717
             NPDKR +  + L+  +L
Sbjct: 292 TFNPDKRISAAEALAHPYL 310

>Ecym_3547 Chr3 complement(1034494..1036107) [1614 bp, 537 aa] {ON}
           similar to Ashbya gossypii AEL083W
          Length = 537

 Score = 91.3 bits (225), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 87/315 (27%), Positives = 128/315 (40%), Gaps = 86/315 (27%)

Query: 441 YEKIELLGRGGSSRVYKVKGS-GNKIYALKRXXXXXXXXXXXXGF--------------K 485
           ++ I +LG+G   +V  VK    NK+YA+K+            G               K
Sbjct: 146 FKPIRVLGKGAYGKVLLVKDQLTNKLYAIKQLKKAEILITQQEGIDEYADEDNTINTTIK 205

Query: 486 GEIE-------------------LLEKLKDQRRVIQLLDYEMGDGLLYLIMECGDHDLSQ 526
             +E                   L     D  R+  LL Y  G  L Y + E G      
Sbjct: 206 KRVERTFAERSILSQLEHPNIVKLFYSFHDHHRLYLLLQYIPGGELFYHLKEQGT----- 260

Query: 527 ILNQRSNMPLDFNFVRFYTKEMLLCIKVVHDAGIVHSDLKPANFVL-VKGILKIIDFGIA 585
                    LD   V FY  E+   +K +H  GIV+ DLKP N +L  +G L + DFG++
Sbjct: 261 ---------LDETTVAFYAAELSCALKFLHGKGIVYRDLKPENCLLNERGHLVLTDFGLS 311

Query: 586 NAV---PEHTVN------IYRETQIGTPNYMAPEALVAMNYTQSSDNQHEGNKWKVGRPS 636
                 P++ ++      +Y  + IGTP Y APE L  + YTQ+ D       W      
Sbjct: 312 KKSVHQPDYPISGESVNELY--SIIGTPEYCAPEILEGLPYTQNCD-------W------ 356

Query: 637 DMWSCGCIIYQMIYGKPPYGSFQGQNR--LLAIMNPDVKIPFPEYTSNNEKIPKSAIELM 694
             +S G + Y M+ GKPP   F G N   +L+ +  +  +  P Y S+  K      + +
Sbjct: 357 --YSLGSLAYDMLIGKPP---FTGINHKVILSKIQREKSVKLPSYLSDGMK------DYL 405

Query: 695 KACLYRNPDKRWTVD 709
            A L ++  KRW VD
Sbjct: 406 NALLKKDTLKRWDVD 420

>KLTH0A06776g Chr1 complement(562932..567503) [4572 bp, 1523 aa] {ON}
            similar to uniprot|P53599 Saccharomyces cerevisiae
            YNR031C SSK2 Suppressor of Sensor Kinase (SLN1) A MAP
            kinase kinase kinase activator of Pbs2p
          Length = 1523

 Score = 92.4 bits (228), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 86/313 (27%), Positives = 141/313 (45%), Gaps = 45/313 (14%)

Query: 425  ASSSNNRSMITVNDSQYEKIELLGRGGSSRVY-KVKGSGNKIYALK--RXXXXXXXXXXX 481
            ASS +N S+      +++K   +G G    V+  V     +I A+K  +           
Sbjct: 1223 ASSLSNVSI------RWQKRHFIGGGAFGTVFSAVNLDTGEILAVKEIKIQDRNTMKQVF 1276

Query: 482  XGFKGEIELLEKLKDQRRVIQLLDYEMGDGLLYLIME-CGDHDLSQILNQRSNMPLDFNF 540
               K E+ +LE L +   V+Q    E+    + L ME C    L+Q+L        D   
Sbjct: 1277 PAIKEEMSVLEML-NHPNVVQYYGVEVHRDKVNLFMEYCEGGSLAQLLEH--GRIEDEMV 1333

Query: 541  VRFYTKEMLLCIKVVHDAGIVHSDLKPANFVL-VKGILKIIDFGIANAVPEHTVNIYRE- 598
             + Y  +ML  +  +H + +VH D+KP N +L   G++K +DFG A ++  +   +    
Sbjct: 1334 TQVYALQMLEGLAYLHQSSVVHRDIKPENILLDFNGVIKYVDFGAARSLAANGTKVANNG 1393

Query: 599  ---------TQIGTPNYMAPEALVAMNYTQSSDNQHEGNKWKVGRPSDMWSCGCIIYQMI 649
                     + +GTP YM+PE++                K K G  SD+WS GC+I +M 
Sbjct: 1394 SEGKTDGVNSMMGTPMYMSPESVTG------------AKKGKFGS-SDIWSLGCVILEMA 1440

Query: 650  YGKPPYGSFQGQNRLLAIMNPDVKIPFPEYTSNNEKIPKSAIELMKACLYRNPDKRWTVD 709
             G+ P+ +   +    AIM        P+  S +E  P+    L+K CL ++PDKR T  
Sbjct: 1441 TGRRPWFNLDNE---WAIMYHVAAGHVPQLPSRDEISPQGTDFLLK-CLKQDPDKRATAM 1496

Query: 710  KVLSSTFLQPFMI 722
            ++L    + P+MI
Sbjct: 1497 ELL----VHPWMI 1505

>Skud_3.39 Chr3 (66201..69254) [3054 bp, 1017 aa] {ON} YCL024W
           (REAL)
          Length = 1017

 Score = 92.0 bits (227), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 66/233 (28%), Positives = 108/233 (46%), Gaps = 25/233 (10%)

Query: 490 LLEKLKDQRRVIQLLDYEMGDGLLYLIMECGDH-DLSQILNQRSNMPLDFNFVRFYTKEM 548
           ++ KL     V+ L D    +  LYLI+E  +  +L  +L  R  +P       F  +++
Sbjct: 79  VIMKLLSHPNVLGLYDVWETNNNLYLILEYAEKGELFNLLVDRGALPEREAMKCF--RQI 136

Query: 549 LLCIKVVHDAGIVHSDLKPANFVLVKGI-LKIIDFGIANAVPEHTVNIYRETQIGTPNYM 607
           ++ +   H  GIVH DLKP N +L     +K+ DFG+A      T     ET  G+P+Y 
Sbjct: 137 IIAVSYCHALGIVHRDLKPENLLLDSDYNIKVADFGMAAL---QTDAALLETSCGSPHYA 193

Query: 608 APEALVAMNYTQSSDNQHEGNKWKVGRPSDMWSCGCIIYQMIYGKPPYGSFQGQNRLLAI 667
           APE +  + Y               G  SD+WSCG I++ ++ G+ P+    G  R L +
Sbjct: 194 APEIVSGLPYE--------------GFSSDVWSCGVILFALLTGRLPFDEENGNIRTLLL 239

Query: 668 MNPDVKIPFPEYTSNNEKIPKSAIELMKACLYRNPDKRWTVDKVLSSTFLQPF 720
                +   P+ T    +I K A +L+   L  +P +R  +  +LS   L+ +
Sbjct: 240 KVQRGQFEMPDDT----EISKDAQDLISKILVVDPAQRIKIRDILSHPLLKRY 288

>ZYRO0A03894g Chr1 (307915..309273) [1359 bp, 452 aa] {ON} similar
           to uniprot|P38070 Saccharomyces cerevisiae YBR028C
           Hypothetical ORF
          Length = 452

 Score = 90.5 bits (223), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 70/233 (30%), Positives = 100/233 (42%), Gaps = 47/233 (20%)

Query: 488 IELLEKLKDQRRVIQLLDYEMGDGLLYLIMECGDHDLSQILNQRSNMPLDFNFVRFYTKE 547
           ++L     D  R+  LL Y  G  L Y + E G               LD +   FY  E
Sbjct: 148 VKLFYTFHDNSRLYLLLQYIPGGELFYHLKERGT--------------LDEDTAAFYAAE 193

Query: 548 MLLCIKVVHDAGIVHSDLKPANFVL-VKGILKIIDFGIAN---------AVPEHTVNIYR 597
           +   +K +H+ GIV+ DLKP N +L   G L + DFG++          + PE    ++ 
Sbjct: 194 ISCALKFLHEKGIVYRDLKPENCLLDADGHLVLTDFGLSKKSVDDNNSLSAPEDVSVLH- 252

Query: 598 ETQIGTPNYMAPEALVAMNYTQSSDNQHEGNKWKVGRPSDMWSCGCIIYQMIYGKPPYGS 657
            + IGTP Y APE L    YT               R  D +S GC++Y M+ GKPPY  
Sbjct: 253 -SIIGTPEYCAPEILKGEPYT---------------RNCDWYSLGCLVYDMLVGKPPYTG 296

Query: 658 FQGQNRLLAIMNPDVKIPFPEYTSNNEKIPKSAIELMKACLYRNPDKRWTVDK 710
              +  L  I         P Y S+  K      + + A L ++ +KRW VD+
Sbjct: 297 VNHKVILNKIQKEKQGPRLPYYLSDGMK------DWLGALLKKDCNKRWDVDR 343

>NDAI0E02110 Chr5 complement(430989..433700) [2712 bp, 903 aa] {ON} 
          Length = 903

 Score = 92.0 bits (227), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 84/316 (26%), Positives = 146/316 (46%), Gaps = 22/316 (6%)

Query: 445 ELLGRGGSSRVYK-VKGSGNKIYALKRXXXXXXXXXXXXGFKGEIELLEKLKDQRRVIQL 503
           E++G+G  + V K V+ S  K +A+K             G   E+E+L++L D  R+++L
Sbjct: 206 EVVGQGAFATVKKAVERSTGKTFAVKIISKRKVMGSNMDGVSRELEVLQRL-DHPRIVRL 264

Query: 504 LDYEMGDGLLYLIME-CGDHDLSQILNQRSNMPLDFNFVRFYTKEMLLCIKVVHDAGIVH 562
             +       Y++ME     DL   +     +  D    R  ++++L  IK +H  GI H
Sbjct: 265 KGFYEDHENYYMLMEFVSGGDLMDFVAAHGAVGEDAG--REISRQILEAIKYIHSMGISH 322

Query: 563 SDLKPANFVLVKG---ILKIIDFGIANAVPEHTVNIYRETQIGTPNYMAPEALVAMN--- 616
            DLKP N ++ +    ++KI DFG+A      T   + +T  GT  Y+APE +   N   
Sbjct: 323 RDLKPDNILIEQDDPVLVKITDFGLAKVQDNGT---FMKTFCGTLAYVAPEIISGKNDGE 379

Query: 617 YTQSSDNQHEGNKWKVGRPSDMWSCGCIIYQMIYGKPPY-GSFQGQNRLLAIMNPDVKIP 675
             +++D   E N++      DMWS GC++Y ++ G  P+ GS Q Q     +     +  
Sbjct: 380 LRENADANSERNEY--SSLVDMWSMGCLVYVILTGHLPFSGSTQKQ-----LYKQISRGS 432

Query: 676 FPEYTSNNEKIPKSAIELMKACLYRNPDKRWTVDKVLSSTFLQPFMISGSIMEDLIKNAV 735
           + E    + +I   A + + + L   P+ R T +K L   +++    S S +++   N+V
Sbjct: 433 YHEGPLKDFRISDEARDFIDSLLQVKPNDRLTAEKALEHPWIKMAQFSQSFVKNNSVNSV 492

Query: 736 RYGSEKPQISHDDLND 751
               +K       L D
Sbjct: 493 NETDDKDSCFQVSLTD 508

>AGL242C Chr7 complement(246896..247790,247838..247854) [912 bp, 303
           aa] {ON} Syntenic homolog of Saccharomyces cerevisiae
           YPL031C (PHO85); 1-intron
          Length = 303

 Score = 88.2 bits (217), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 81/323 (25%), Positives = 145/323 (44%), Gaps = 56/323 (17%)

Query: 433 MITVNDSQYEKIELLGRGGSSRVYKVKGSGNKIY-ALKRXXXXXXXXXXXXGFKGEIELL 491
           M + +  +++++E LG G  + VYK       +Y ALK               + EI L+
Sbjct: 1   MTSTSHIRFKQLERLGNGTYATVYKGLNKTTGLYVALKEVKLDSEEGTPSTAIR-EISLM 59

Query: 492 EKLKDQRRVIQLLDYEMGDGLLYLIMECGDHDLSQILNQRSN--MP--LDFNFVRFYTKE 547
           ++LK +  +++L D    +  L L+ E  D+DL + ++ R +  MP  L+ + V+++  +
Sbjct: 60  KELKHEN-IVRLYDVIHTENKLTLVFEFMDNDLKKFMDSRLDREMPRGLELSLVKYFQWQ 118

Query: 548 MLLCIKVVHDAGIVHSDLKPANFVLV-KGILKIIDFGIANA--VPEHTVNIYRETQIGTP 604
           +L  +   H+  I+H DLKP N ++  KG LK+ DFG+A A  +P +T +    +++ T 
Sbjct: 119 LLQGVAFCHENRILHRDLKPQNLLINNKGQLKLGDFGLARAFGIPVNTFS----SEVVTL 174

Query: 605 NYMAPEALVAMNYTQSSDNQHEGNKWKVGRPSDMWSCGCIIYQMIYGKPPYGSFQGQNRL 664
            Y AP+ L+      +S               D+WSCGCI+ +MI GK  +       +L
Sbjct: 175 WYRAPDVLMGSRTYCTS--------------IDIWSCGCILAEMIMGKALFPGTNDDEQL 220

Query: 665 LAIM--------------------NPDVKIPFPE-------YTSNNEKIPKSAIELMKAC 697
             I                     NP + + +P          +  E+I    + L++  
Sbjct: 221 KLIFETMGTPTEQTWVGVSQLPKYNPQIPL-YPNKDIKQLLQATTKEQISDVLVNLIQGL 279

Query: 698 LYRNPDKRWTVDKVLSSTFLQPF 720
           L  NP  R +  + LS    + +
Sbjct: 280 LQLNPSMRLSAQQALSHPLFEEY 302

>TBLA0F00240 Chr6 complement(45510..49256) [3747 bp, 1248 aa] {ON}
            Anc_6.371 YCR091W
          Length = 1248

 Score = 92.0 bits (227), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 78/306 (25%), Positives = 130/306 (42%), Gaps = 45/306 (14%)

Query: 423  KSASSSNNRSMITVNDSQYEKIELLGRGGSSRVYKVK-GSGNKIYALK-RXXXXXXXXXX 480
            ++ S SN    ITV  + +EKI LLG+G   +VY VK  S +++YALK            
Sbjct: 834  RTKSFSNKFKDITVGPTSFEKIRLLGQGDVGKVYLVKEKSTSRLYALKIFNKSQMIKRKK 893

Query: 481  XXGFKGEIELLEKLKDQRRVIQLLDYEMGDGLLYLIME-CGDHDLSQILNQRSNMPLDFN 539
                  E E+L    +   ++ L      +  LYL +E C   +  + L  R +  +  +
Sbjct: 894  IKRVLAEQEILAS-SNHPFIVTLYHSFQSEDYLYLCIEYCMGGEFFRALQTRRSKCISED 952

Query: 540  FVRFYTKEMLLCIKVVHDAGIVHSDLKPANFVLVKG---ILKIIDFGIANAVPEHTV--- 593
              RFY  E+   ++ +H  G ++ DLKP N +L K    +L   D  I + V ++ V   
Sbjct: 953  AARFYASEVTAALEYLHLMGYIYRDLKPENILLHKSGHIMLSDFDLSIQSKVAKNPVVKK 1012

Query: 594  --------------NIYRETQIGTPNYMAPEALVAMNYTQSSDNQHEGNKWKVGRPSDMW 639
                               + +GT  Y+APE +    +T + D       W        W
Sbjct: 1013 FNQSSLVDTKICSEGFRTNSFVGTEEYIAPEVIRGNGHTAAVD-------W--------W 1057

Query: 640  SCGCIIYQMIYGKPPYGSFQGQNRLLAIMNPDVKIPFPEYTSNNEKIPKSAIELMKACLY 699
            + G +IY+M++G  P+           I+  +V  P      NN  I ++  +++K  L 
Sbjct: 1058 TLGILIYEMLFGFTPFKGDSTNETFSNILKNEVSFP------NNNDITRNCKDVIKKLLT 1111

Query: 700  RNPDKR 705
            +N +KR
Sbjct: 1112 KNENKR 1117

>KLLA0F14190g Chr6 (1311121..1315137) [4017 bp, 1338 aa] {ON}
            uniprot|O60030 Kluyveromyces lactis BCK1 MAP kinase
            kinase kinase
          Length = 1338

 Score = 92.0 bits (227), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 89/353 (25%), Positives = 153/353 (43%), Gaps = 40/353 (11%)

Query: 413  TKKVEIVEPAKSASSSNNRSMITVNDSQYEKIELLGRGGSSRVY-KVKGSGNKIYALKR- 470
            TK VEI +    + + +  S     +  + K E++G+G    VY  +  +  ++ A+K+ 
Sbjct: 1010 TKVVEITDKRTISINKSRNSRGEYKEFAWIKGEIIGKGSFGAVYLALNVTTGEMLAVKQV 1069

Query: 471  -----XXXXXXXXXXXXGFKGEIELLEKLKDQRRVIQLLDYEMGDGLLYLIME--CGDHD 523
                               K E+  L+ L +   ++Q L +E  +G+  L +E   G   
Sbjct: 1070 TVPEFSSQDESAISMVEALKSEVSTLKDL-NHVNIVQYLGFEEKNGIYSLFLEYVAGGSV 1128

Query: 524  LSQILNQRSNMPLDFNFVRFYTKEMLLCIKVVHDAGIVHSDLKPANFVLVK-GILKIIDF 582
             S I   R     D   +R  TK++L  +  +H  GI+H D+K  N +L   G+ KI DF
Sbjct: 1129 GSLI---RMYGRFDDQLIRHLTKQVLEGLAYLHSKGILHRDMKADNLLLDNDGVCKISDF 1185

Query: 583  GIANAVPEHTVNIYRETQI---GTPNYMAPEALVAMNYTQSSDNQHEGNKWKVGRPSDMW 639
            GI+      + NIY  + +   GT  +MAPE +         D  H G   KV    D+W
Sbjct: 1186 GIS----RKSNNIYSNSDMTMRGTVFWMAPEMV---------DTAH-GYSAKV----DIW 1227

Query: 640  SCGCIIYQMIYGKPPYGSFQGQNRLLAIMNPDVKIPFPEYTSNNEKIPKSAIELMKACLY 699
            S GC++ +M  GK P+ +F+    +  I       P P+ T   + +  +    +  C  
Sbjct: 1228 SLGCVVLEMFAGKRPWSNFEVVAAMFQIGKSKTAPPIPDDT--KDLVSPAGQSFLDQCFE 1285

Query: 700  RNPDKRWTVDKVLSSTFLQ---PFMISGSIMEDLIKNAVRYGSEKPQISHDDL 749
             +P+ R T D ++   F +    F    + +   IK+  +  S + +IS  +L
Sbjct: 1286 IDPEMRPTADSLVGHPFCKTSSSFDFPKTKLAQFIKSNDKLNSSRLRISSQEL 1338

>NDAI0I00250 Chr9 (42174..44867) [2694 bp, 897 aa] {ON} Anc_3.177
           YAR019C
          Length = 897

 Score = 91.7 bits (226), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 82/329 (24%), Positives = 139/329 (42%), Gaps = 53/329 (16%)

Query: 408 PKPPVTKKVEIVEPAKSASSSNNRSMITVNDSQYEKIELLGRGGSSRVYKVK-GSGNKIY 466
           P+P ++   +  E  ++ S SN     TV+   ++KI+LLG+G   +VY VK  S N +Y
Sbjct: 459 PRPRISSSPKRSERLRNKSFSNKFQDSTVSPQSFQKIKLLGQGDVGKVYLVKEKSTNALY 518

Query: 467 ALK-RXXXXXXXXXXXXGFKGEIELLEKLKDQRRVIQLLDYEMGDGLLYLIME-CGDHDL 524
           A+K                  E E+L    +   ++ L      +  LYL ME C   + 
Sbjct: 519 AMKIYNKNDMLKRKKIKRVITEQEILA-TSNHPFIVTLYHSFQSEDYLYLCMEYCMGGEF 577

Query: 525 SQILNQRSNMPLDFNFVRFYTKEMLLCIKVVHDAGIVHSDLKPANFVLVK-GILKIIDFG 583
            + L  R +  +D +  +FY  E++  ++ +H  G ++ DLKP N +L K G + + DF 
Sbjct: 578 FRALQTRESKCIDEDAAQFYASEVIAALEYLHLLGFIYRDLKPENILLHKSGHIMLSDFD 637

Query: 584 IANAVPE----------------HTVNIYRETQI-----------GTPNYMAPEALVAMN 616
           ++    +                   N+  +T+I           GT  Y+APE +    
Sbjct: 638 LSIQAKDSKNPTFMKNGILSTNNSNSNLIIDTKICSDGFRTNSFVGTEEYIAPEVIRGNG 697

Query: 617 YTQSSDNQHEGNKWKVGRPSDMWSCGCIIYQMIYGKPPYGSFQGQNRLLAIMNPDVKIPF 676
           +T + D       W        W+ G +IY+M++GK P+           I++ D   P 
Sbjct: 698 HTVAVD-------W--------WTLGILIYEMLFGKTPFKGKNTNETFANILSHDFTFP- 741

Query: 677 PEYTSNNEKIPKSAIELMKACLYRNPDKR 705
                N   I ++   L+K  L +N  KR
Sbjct: 742 -----NTNNISRNCKNLIKKLLIKNETKR 765

>ZYRO0A06446g Chr1 complement(513126..515957) [2832 bp, 943 aa] {ON}
           weakly similar to uniprot|P38692 Saccharomyces
           cerevisiae YHR102W KIC1 Protein kinase of the PAK/Ste20
           kinase family required for cell integrity possibly
           through regulating 1 6-beta-glucan levels in the wall
           physically interacts with Cdc31p (centrin) which is a
           component of the spindle pole body
          Length = 943

 Score = 91.7 bits (226), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 72/297 (24%), Positives = 135/297 (45%), Gaps = 30/297 (10%)

Query: 439 SQYEKIELLGRGGSSRVYKVKGSGNK-IYALKRXXXXXXXXXXXXGFKGEIELLEKLKDQ 497
           S +++ E++G G    VYK   +  K +YA+K               + E++ L  +K  
Sbjct: 27  SVFKRTEVIGTGKFGVVYKGHHARTKQVYAIK-VLNLDSDEDEVEDVQREVQFLASMKQT 85

Query: 498 RRVIQLLDYEMGDGLLYLIME-CGDHDLSQILNQRSNMPLDFNFVRFYTKEMLLCIKVVH 556
             +       + D  L++I+E C    L  +L       +D  ++    +E+L+ +K +H
Sbjct: 86  PNITHYYGSYLKDTTLWIIIEYCAGGSLRTLLRPGK---IDEKYIGIIMREVLIALKYIH 142

Query: 557 DAGIVHSDLKPANFVLV-KGILKIIDFGIANAVPEHTVNIYRETQIGTPNYMAPEALVAM 615
              ++H D+K AN ++  +G +K+ DFG+A  + + +  + R+T  GTP +MAPE ++  
Sbjct: 143 KDNVIHRDIKAANVLITNEGHVKLCDFGVAAQLNQSS--LKRQTMAGTPYWMAPEVIM-- 198

Query: 616 NYTQSSDNQHEGNKWKVGRPSDMWSCGCIIYQMIYGKPPYGSFQGQNRLLAIMNPDVKIP 675
                     EG  +      D+WS G   Y++  G PPY   +    +  I     K P
Sbjct: 199 ----------EGVSYDTK--VDIWSLGITTYEIATGNPPYCDVEALRAMQLITK--SKPP 244

Query: 676 FPEYTSNNEKIPKSAIELMKACLYRNPDKRWTVDKVLSSTFLQPF-MISGSIMEDLI 731
             E    +  +     E +  CL  +P +R + D +L S  ++     S +++++LI
Sbjct: 245 RLEGRHYSPML----KEFIALCLDEDPKERLSADDLLKSKLIKHHRTASTTVLKELI 297

>TBLA0D02230 Chr4 (557816..561280) [3465 bp, 1154 aa] {ON} Anc_8.141
           YGL180W
          Length = 1154

 Score = 91.7 bits (226), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 67/238 (28%), Positives = 103/238 (43%), Gaps = 64/238 (26%)

Query: 487 EIELLEKLKDQRRVIQLLDYEMGDGLLYLIME-CGDHDLSQILNQRS----NMPL----- 536
           EI +L+KL + + ++ L+D +       LIME C   DL+ ++ +R+    N PL     
Sbjct: 181 EISILKKL-NHKHIVNLIDCQRNKNDFLLIMEYCSLGDLTFLIKKRNELIINHPLLNQIF 239

Query: 537 -------------DFNFVRFYTKEMLLCIKVVHDAGIVHSDLKPANFVL----------- 572
                        +  FV  Y +++   +K +    ++H D+KP N +L           
Sbjct: 240 QKFPSPNPDCNGLNIAFVLNYLQQLASALKFLRSRNLIHRDIKPQNLLLSTPYTDYHDQQ 299

Query: 573 -----------VKGILKIIDFGIANAVPEHTVNIYRETQIGTPNYMAPEALVAMNYTQSS 621
                         ILKI DFG A  +P  ++    ET  G+P YMAPE L         
Sbjct: 300 TFKKLGYIGISCLPILKIADFGFARFLPNTSL---AETLCGSPLYMAPEIL--------- 347

Query: 622 DNQHEGNKWKVGRPSDMWSCGCIIYQMIYGKPPYGSFQGQNRLLAIMNPDVKIPFPEY 679
                 N  K    +D+WS G ++Y+M+YGKPP+ +      L  I   +  IPFP Y
Sbjct: 348 ------NYQKYNAKADLWSVGTVLYEMVYGKPPFKANNHLELLKKIKRTNDNIPFPSY 399

>NDAI0K02100 Chr11 complement(469575..472304) [2730 bp, 909 aa] {ON}
           Anc_2.496
          Length = 909

 Score = 91.7 bits (226), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 78/299 (26%), Positives = 130/299 (43%), Gaps = 35/299 (11%)

Query: 441 YEKIELLGRGGSSRVYKVKG-SGNKIYALKRXXXXXXXXXXXXGFKGEIELLEKLKDQRR 499
           Y  +  +G+G S  VY     S N+  A+K+                EI L+ K      
Sbjct: 627 YTNLVKIGQGASGGVYIANDVSTNESIAIKQMNLEKQPKKEL--IINEI-LVMKGSKHPN 683

Query: 500 VIQLLDYEMGDGLLYLIMECGDHDLSQILNQRSNMPLDFNFVRFYTKEMLLCIKVVHDAG 559
           ++  +D  + DG L++IME  +     + +  ++  L    +    +E L  ++ +H  G
Sbjct: 684 IVNFIDSYLLDGDLWVIMEYMEG--GSLTDVVTHCILTEGQIGAVCRETLSGLQFLHSKG 741

Query: 560 IVHSDLKPANFVL-VKGILKIIDFGIANAVPEHTVNIYRETQIGTPNYMAPEALVAMNYT 618
           ++H D+K  N +L + G +K+ DFG    V E T  + R T +GTP +MAPE +    Y 
Sbjct: 742 VLHRDIKSDNILLSINGNIKLTDFGFCAQVNETT--LKRTTMVGTPYWMAPEVVSRKEY- 798

Query: 619 QSSDNQHEGNKWKVGRPSDMWSCGCIIYQMIYGKPPYGSFQGQNRLLAIM---NPDVKIP 675
                         G   D+WS G +I +MI G+PPY +      L  I     P++K  
Sbjct: 799 --------------GPKVDIWSLGIMIIEMIEGEPPYLNETPLRALYLIATNGTPELK-- 842

Query: 676 FPEYTSNNEKIPKSAIELMKACLYRNPDKRWTVDKVLSSTFLQPFMISGSIMEDLIKNA 734
                   EK+       +  CL  NPD+R +  ++L   F+  +  +   +  L+K A
Sbjct: 843 ------EREKLSDVLKHFLDWCLSVNPDQRASATELLEDVFITEYADANESLAPLVKLA 895

>KNAG0C02440 Chr3 complement(475652..476857) [1206 bp, 401 aa] {ON}
           Anc_1.182 YJL164C
          Length = 401

 Score = 89.4 bits (220), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 70/256 (27%), Positives = 112/256 (43%), Gaps = 51/256 (19%)

Query: 435 TVNDSQYEKIELLGRGGSSRVYKVKGSGN-KIYALKRXXXXXXXXXXXXGFKGE------ 487
           T+ND  ++ +  LG G   RV+ ++ + N + YALK                 +      
Sbjct: 87  TLND--FKILRTLGTGSFGRVHLIRSNHNGRFYALKVLKKQTIVKLKQVEHTNDERLMLS 144

Query: 488 -------IELLEKLKDQRRVIQLLDYEMGDGLLYLIMECGDHDLSQILNQRSNMPLDFNF 540
                  + +    +D ++V  ++DY  G  L  L+ +          +QR   P+    
Sbjct: 145 VVSHPFLVRMWGTFQDSQQVFMVMDYIEGGELFSLLRK----------SQRFPTPV---- 190

Query: 541 VRFYTKEMLLCIKVVHDAGIVHSDLKPANFVLVK-GILKIIDFGIANAVPEHTVNIYRET 599
            +FY  E+ L ++ +H+  I++ DLKP N +L K G +KI DFG A  VP+ T      T
Sbjct: 191 AKFYAAEVCLALEYLHNLDIIYRDLKPENILLDKNGHIKITDFGFAKYVPDVTY-----T 245

Query: 600 QIGTPNYMAPEALVAMNYTQSSDNQHEGNKWKVGRPSDMWSCGCIIYQMIYGKPPYGSFQ 659
             GTP+Y+APE +    Y +S D       W        WS G +IY+M+ G  P+    
Sbjct: 246 LCGTPDYIAPEVMSTKPYNKSVD-------W--------WSFGVLIYEMLAGHTPFYDSN 290

Query: 660 GQNRLLAIMNPDVKIP 675
                  I+N  +K P
Sbjct: 291 AMKTYENILNAKLKFP 306

>TPHA0G03200 Chr7 (683296..687900) [4605 bp, 1534 aa] {ON} Anc_2.479
           YKL101W
          Length = 1534

 Score = 92.0 bits (227), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 66/241 (27%), Positives = 111/241 (46%), Gaps = 31/241 (12%)

Query: 483 GFKGEIELLEKLKDQRRVIQLLDYEMGDGLLYLIMECGDH-DLSQILNQRSNMPLDFNFV 541
           G + EI ++ KL     V+ L +       LYL++E  D  +L   L  +  +  +   V
Sbjct: 206 GIEREIVIM-KLVSHPNVMALYEVWENKNELYLVLEYVDGGELFDYLVSKGKLT-ELEAV 263

Query: 542 RFYTKEMLLCIKVVHDAGIVHSDLKPANFVLVKG--ILKIIDFGIANAVPEHTVNIYRET 599
           R++ K+++  ++  H   I H DLKP N +L K   ++KI DFG+A        N   +T
Sbjct: 264 RYF-KQIIRGVQYCHSFNICHRDLKPENLLLDKKRKLIKIADFGMAAL---QVSNTLLKT 319

Query: 600 QIGTPNYMAPEALVAMNYTQSSDNQHEGNKWKVGRPSDMWSCGCIIYQMIYGKPPYGSFQ 659
             G+P+Y +PE ++   Y               G PSD+WSCG I++ ++ G  P+    
Sbjct: 320 SCGSPHYASPEIVMGKTYN--------------GGPSDVWSCGIILFALLTGHLPFNDDS 365

Query: 660 GQNRLLAIMNPDVKIPFPEYTSNNEKIPKSAIELMKACLYRNPDKRWTVDKVLSSTFLQP 719
            +  L+ + N   +   P Y S      K A +L+   L  NP  R T +++L    +  
Sbjct: 366 IKKLLIKVQNG--RYQMPNYLS------KDAKDLISRILLVNPKARLTTEQILEHPLITK 417

Query: 720 F 720
           +
Sbjct: 418 Y 418

>TPHA0M02080 Chr13 (426966..429635) [2670 bp, 889 aa] {ON} Anc_6.371
           YCR091W
          Length = 889

 Score = 91.3 bits (225), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 78/306 (25%), Positives = 133/306 (43%), Gaps = 45/306 (14%)

Query: 423 KSASSSNNRSMITVNDSQYEKIELLGRGGSSRVYKVK-GSGNKIYALK-RXXXXXXXXXX 480
           ++ S SN    I V+   +EKI LLG+G   +VY V+  + +++YALK            
Sbjct: 469 RAKSFSNKFQDIVVSPQAFEKIRLLGQGDVGKVYLVREKASSRLYALKIFSKAEMIKRKK 528

Query: 481 XXGFKGEIELLEKLKDQRRVIQLLDYEMGDGLLYLIME-CGDHDLSQILNQRSNMPLDFN 539
                 E E+L    +   ++ L      +  LYL ME C   +  + L  R    +  +
Sbjct: 529 IKRVLVEQEILAT-SEHPFIVNLYHSFQSEDYLYLCMEYCMGGEFFRALQTRKTKCISED 587

Query: 540 FVRFYTKEMLLCIKVVHDAGIVHSDLKPANFVLVK-GILKIIDFGIA------------- 585
             RFY  E++  ++ +H  G ++ DLKP N +L K G + + DF ++             
Sbjct: 588 DARFYAAEVVAALEYLHLMGFIYRDLKPENILLHKSGHIMLSDFDLSIQTTSSKEPVVKK 647

Query: 586 ---NAVPEHTV---NIYRETQIGTPNYMAPEALVAMNYTQSSDNQHEGNKWKVGRPSDMW 639
              +AV +  +        + +GT  Y+APE +    +T + D       W        W
Sbjct: 648 LAQSAVVDTKICSDGFRTNSFVGTEEYIAPEVIRGNGHTAAVD-------W--------W 692

Query: 640 SCGCIIYQMIYGKPPYGSFQGQNRLLAIMNPDVKIPFPEYTSNNEKIPKSAIELMKACLY 699
           + G +IY+M++G  P+      +    I+  DV  P      NN +I ++  +L+K  L 
Sbjct: 693 TLGILIYEMLFGFTPFKGDNTNDTFCNILKDDVTFP------NNNEISRNCKDLIKKLLT 746

Query: 700 RNPDKR 705
           +N  KR
Sbjct: 747 KNELKR 752

>KLLA0F07623g Chr6 (720246..723935) [3690 bp, 1229 aa] {ON} similar to
            uniprot|P31374 Saccharomyces cerevisiae YAL017W PSK1 One
            of two (see also PSK2) PAS domain containing S/T protein
            kinases coordinately regulates protein synthesis and
            carbohydrate metabolism and storage in response to a
            unknown metabolite that reflects nutritional status
          Length = 1229

 Score = 91.7 bits (226), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 66/239 (27%), Positives = 118/239 (49%), Gaps = 39/239 (16%)

Query: 487  EIELLEKL--KDQRRVIQLLDYEMGDGLLYLIME----CGDHDLSQILNQRSNMPLDFNF 540
            EI+++  L  K    ++++LD+   D   YL  E     G  DL  ++  ++NM  +F  
Sbjct: 1022 EIQIMVTLNRKPHENILRILDFFEDDDYYYLETEMHGETGSIDLFDLIELKTNMT-EFE- 1079

Query: 541  VRFYTKEMLLCIKVVHDAGIVHSDLKPANFVLV-KGILKIIDFGIANAVPEHTVNIYRET 599
             +   K++   IK +HD GIVH D+K  N ++  KG +K+IDFG A  V     +++   
Sbjct: 1080 AKLLFKQVASGIKHLHDNGIVHRDIKDENVIVDNKGFVKLIDFGSAAYVKSGPFDVF--- 1136

Query: 600  QIGTPNYMAPEALVAMNYTQSSDNQHEGNKWKVGRPSDMWSCGCIIYQMIYGKPPYGSFQ 659
             +GT +Y APE L    Y               G+P D+W+ G ++Y +IY + P+ +  
Sbjct: 1137 -VGTIDYAAPEVLGGEPYE--------------GKPQDIWAIGVLLYTIIYKENPFYNID 1181

Query: 660  GQNRLLAIMNPDVKIPFPEYTSNNEKIPKSAIELMKACLYRNPDKRWTVDKVLSSTFLQ 718
                   I++ D++I       +  ++    + L++  L R+  KR T+D ++  ++LQ
Sbjct: 1182 ------EILDGDLRI------QSTHEVSAECVALIRKILNRSVSKRPTIDDIMEDSWLQ 1228

>Skud_1.44 Chr1 (95573..99643) [4071 bp, 1356 aa] {ON} YAL017W (REAL)
          Length = 1356

 Score = 91.7 bits (226), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 68/232 (29%), Positives = 118/232 (50%), Gaps = 39/232 (16%)

Query: 487  EIELLEKL--KDQRRVIQLLDYEMGDGLLYLIM----ECGDHDLSQILNQRSNMPLDFNF 540
            EI+++  L  K    +++LLD+   D   Y+      E G  DL  ++  ++NM  +F  
Sbjct: 1149 EIQIMATLNKKPHENILRLLDFFEDDDYYYIETPVHGETGCIDLFDLIEFKTNM-TEFE- 1206

Query: 541  VRFYTKEMLLCIKVVHDAGIVHSDLKPANFVL-VKGILKIIDFGIANAVPEHTVNIYRET 599
             +   K+++  IK +HD GIVH D+K  N ++  KG +KIIDFG A  V     +++   
Sbjct: 1207 AKLIFKQVVAGIKHLHDQGIVHRDIKDENVIVDSKGFVKIIDFGSAAYVKSGPFDVF--- 1263

Query: 600  QIGTPNYMAPEALVAMNYTQSSDNQHEGNKWKVGRPSDMWSCGCIIYQMIYGKPPYGSFQ 659
             +GT +Y APE L              GN ++ G+P D+W+ G ++Y +++ + P+ +  
Sbjct: 1264 -VGTIDYAAPEVL-------------GGNPYE-GQPQDIWAIGILLYTVVFKENPFYNID 1308

Query: 660  GQNRLLAIMNPDVKIPFPEYTSNNEKIPKSAIELMKACLYRNPDKRWTVDKV 711
                   I+  D+K       +N E++ +  IEL+K+ L R    R T+D +
Sbjct: 1309 ------EILEGDLKF------NNAEEVSEDCIELIKSILNRRVPNRPTIDDI 1348

>KLTH0F01672g Chr6 (127277..130771) [3495 bp, 1164 aa] {ON} similar
           to uniprot|Q12263 Saccharomyces cerevisiae YDR507C
          Length = 1164

 Score = 91.7 bits (226), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 70/242 (28%), Positives = 119/242 (49%), Gaps = 30/242 (12%)

Query: 483 GFKGEIELLEKLKDQRRVIQLLDYEMGDGLLYLIMECGDH-DLSQILNQRSNMPLDFNFV 541
           G + EI ++ KL +   V++L D    +  LY+++E  +  +L  +L  R  +P +   V
Sbjct: 83  GIEREI-IIMKLLNHPNVLRLYDVWETNSSLYMVLEYVEKGELFNLLVDRGPLP-ENEAV 140

Query: 542 RFYTKEMLLCIKVVHDAGIVHSDLKPANFVLV-KGILKIIDFGIANAVPEHTVNIYRETQ 600
           RF+ +++++ I   H  GIVH DLKP N +L  K  +KI DFG+A      + +   ET 
Sbjct: 141 RFF-RQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAAL---ESKDKLLETS 196

Query: 601 IGTPNYMAPEALVAMNYTQSSDNQHEGNKWKVGRPSDMWSCGCIIYQMIYGKPPYGSFQG 660
            G+P+Y APE +  + Y               G  SD+WSCG I++ ++ G+ P+    G
Sbjct: 197 CGSPHYAAPEIVSGLPYH--------------GFESDVWSCGIILFALLTGRLPFDEEDG 242

Query: 661 --QNRLLAIMNPDVKIPFPEYTSNNEKIPKSAIELMKACLYRNPDKRWTVDKVLSSTFLQ 718
             +N LL + +   ++P      +  +I   A +L+   L  +P  R     +L    LQ
Sbjct: 243 NIRNLLLKVQSGKFEMP------DTNEISGEAQDLIAKILTVDPAARIKSRGILKHPLLQ 296

Query: 719 PF 720
            +
Sbjct: 297 KY 298

>TDEL0A06220 Chr1 (1088622..1091006) [2385 bp, 794 aa] {ON}
           Anc_8.676 YPL153C
          Length = 794

 Score = 91.3 bits (225), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 81/299 (27%), Positives = 142/299 (47%), Gaps = 23/299 (7%)

Query: 425 ASSSNNRSMITVNDSQYEKIELLGRGGSSRVYK-VKGSGNKIYALKRXXXXXXXXXXXXG 483
           +SS+NNR+ + ++ S   K E++G+G  + V K V+ S  K +A K             G
Sbjct: 179 SSSTNNRTGVFMDFSI--KDEVVGQGAFATVKKAVERSTGKTFAAK-IISKRKVMGNMDG 235

Query: 484 FKGEIELLEKLKDQRRVIQLLDYEMGDGLLYLIME-CGDHDLSQILNQRSNMPLDFNFVR 542
              E+E+L KL +  ++++L  +   D   YL+ME     DL   +    ++  D    R
Sbjct: 236 VTRELEVLRKL-NHPKIVRLKGFYEDDEFYYLLMEFVSGGDLMDFVAAHGSVGEDAG--R 292

Query: 543 FYTKEMLLCIKVVHDAGIVHSDLKPANFVLVKG---ILKIIDFGIANAVPEHTVNIYRET 599
             T+++L  +K +H  GI H DLKP N ++ +    ++KI DFG+A      T   + +T
Sbjct: 293 EITRQVLEGVKYIHSQGISHRDLKPDNILIEQDDPVLVKITDFGLAKVQGNGT---FMKT 349

Query: 600 QIGTPNYMAPEALVAMNYTQSSDNQHEGNKWKVGRPSDMWSCGCIIYQMIYGKPPYGSFQ 659
             GT  Y+APE +      + ++ ++E +        DMWS GC++Y ++ G  P+    
Sbjct: 350 FCGTLAYVAPEVIAGKANAEENEKRNEYSSL-----VDMWSMGCLVYVILTGHLPFSGST 404

Query: 660 GQNRLLAIMNPDVKIPFPEYTSNNEKIPKSAIELMKACLYRNPDKRWTVDKVLSSTFLQ 718
            +     I N      + E    + +I   A + + + L  NP+ R T  K L   +++
Sbjct: 405 QEQLYKQIKNGS----YHEGPLKDFRISDEARDFIDSLLQVNPNARPTAKKALEHPWIK 459

>CAGL0K08514g Chr11 complement(854143..858612) [4470 bp, 1489 aa]
           {ON} similar to uniprot|P34244 Saccharomyces cerevisiae
           YKL101w serine/threonine-protein kinase
          Length = 1489

 Score = 91.3 bits (225), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 68/242 (28%), Positives = 117/242 (48%), Gaps = 33/242 (13%)

Query: 483 GFKGEIELLEKLKDQRRVIQLLDYEMGDGLLYLIMECGDH-DLSQILNQRSNMPLDFNFV 541
           G + EI ++ KL     V+ LL+       LYL++E  D  +L   L  +  +  +   V
Sbjct: 172 GIEREIVIM-KLISHPNVMGLLEVWENKSELYLVLEYVDGGELFDYLVSKGKLS-EPEAV 229

Query: 542 RFYTKEMLLCIKVVHDAGIVHSDLKPANFVLVKG--ILKIIDFGIAN-AVPEHTVNIYRE 598
            ++T +++  +   H   I H DLKP N +L K   ++KI DFG+A   +P    N   E
Sbjct: 230 HYFT-QIIQGVSYCHSFNICHRDLKPENLLLDKKNKVIKIADFGMAALELP----NKLLE 284

Query: 599 TQIGTPNYMAPEALVAMNYTQSSDNQHEGNKWKVGRPSDMWSCGCIIYQMIYGKPPYGSF 658
           T  G+P+Y +PE ++   Y               G PSD+WSCG I++ ++ G  P+   
Sbjct: 285 TSCGSPHYASPEIVMGKPYH--------------GGPSDVWSCGIILFALLTGHLPFNDD 330

Query: 659 QGQNRLLAIMNPDVKIPFPEYTSNNEKIPKSAIELMKACLYRNPDKRWTVDKVLSSTFLQ 718
             +  LL +     +   P Y +N+ K      +L+   L  NP+KR T++++L+   ++
Sbjct: 331 NIKKLLLKVQ--AGRFQLPPYLTNDAK------DLITRILVTNPEKRLTINEILNHPLIK 382

Query: 719 PF 720
            +
Sbjct: 383 KY 384

>KAFR0C00930 Chr3 complement(186877..189687) [2811 bp, 936 aa] {ON}
           Anc_3.177 YAR019C
          Length = 936

 Score = 90.9 bits (224), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 87/329 (26%), Positives = 145/329 (44%), Gaps = 37/329 (11%)

Query: 425 ASSSNNRSMITVNDSQYEKIELLGRGGSSRVYK-VKGSGNKIYALKRXXXXXXXXXXXXG 483
           A  +N RS    N   Y+  +++G+G    VYK +     ++ A+K              
Sbjct: 16  AQQTNERS---TNSVSYQLKQVIGKGSYGIVYKAINRRTEQVVAIKELYYNNDTELQ--D 70

Query: 484 FKGEIELLEKLKDQRRVIQLLDYEMGDGLLYLIMECGDH-DLSQILNQRSNMPLDFNFVR 542
              EI+LL+ L D   +I+   +      LY+I+E   H  L  ++ QR    L+    R
Sbjct: 71  IMVEIDLLKNL-DHVNIIKYHGFIQKLSNLYIILEFASHGSLKNLMMQRPEKHLNEKETR 129

Query: 543 FYTKEMLLCIKVVHDAGIVHSDLKPANFVL-VKGILKIIDFGIANAVPEHTVNIYRETQI 601
            Y K+ +  +  +H+ G++H D+K AN +L     +K+ DFG++ +V    +     T  
Sbjct: 130 IYIKQTINGLVYLHEQGVIHRDIKAANLLLDASNTIKLADFGVSTSVANSAM-----TLA 184

Query: 602 GTPNYMAPEALVAMNYTQSSDNQHEGNKWKVGRPSDMWSCGCIIYQMIYGKPPYGSFQGQ 661
           G+ N+MAPE +               NK      SD+WS G  I +++ G PP+      
Sbjct: 185 GSLNWMAPEIIT--------------NK-GASTLSDIWSLGATIIELLTGNPPFHKLMDI 229

Query: 662 NRLLAIMNPDVKIPFPEYTSNNEKIPKSAIELMKACLYRNPDKRWTVDKVLSSTFLQPFM 721
           N   AI N DV +P PE  S N +       ++  C  +N  KR +   +L   +L+   
Sbjct: 230 NIYYAIEN-DVFLP-PENLSTNCQ------NILNLCFQKNMFKRPSAVSLLKHPWLKDIT 281

Query: 722 ISGSIMEDLIKNAVRYGSEKPQISHDDLN 750
            S  + E+L   + ++   +     DDLN
Sbjct: 282 QSTQLPENLDFKSAKFLQFREDFEKDDLN 310

>TBLA0A08430 Chr1 complement(2075682..2076773) [1092 bp, 363 aa]
           {ON} Anc_4.184 YGR040W
          Length = 363

 Score = 88.2 bits (217), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 80/320 (25%), Positives = 138/320 (43%), Gaps = 57/320 (17%)

Query: 439 SQYEKIELLGRGGSSRVYKVKG--SGNKIYALKRXXXXXXXXXXXXGFKGEIELLEKLKD 496
           + Y+ ++L+G G    V       +G  + A+KR              + EI+LL+   D
Sbjct: 11  AHYQLLDLVGEGAYGTVCSACHLPTGTTV-AIKRIQPFSKPLFVTRTLR-EIKLLKYFND 68

Query: 497 QRRVIQLLDYEMGDGL-----LYLIMECGDHDLSQILNQRSNMPLDFNFVRFYTKEMLLC 551
              +I +LD    + +     +YL+ E  + DL +I+    N  L ++ ++++  ++L  
Sbjct: 69  HENIISILDQVKPNSIETFNSVYLVQELMETDLQKII---VNQKLSYDHIQYFIYQILRA 125

Query: 552 IKVVHDAGIVHSDLKPANFVLVKGI-LKIIDFGIANAVP-----EHTVNIYRETQIGTPN 605
           +K +H A ++H DLKP+N +L     LK+ DFG++  +      + T+  +    + T  
Sbjct: 126 LKSIHSAQVIHRDLKPSNLLLNSNCDLKVCDFGLSRCLASSDNSKDTLVGFMTEYVATRW 185

Query: 606 YMAPEALVAMNYTQSSDNQHEGNKWKVGRPSDMWSCGCIIYQMIYGKP--PYGSFQGQNR 663
           Y APE ++                 K     D+WSCGCI+ +MI GKP  P   +  Q  
Sbjct: 186 YRAPEIMLTFQ--------------KYTTAMDIWSCGCILAEMISGKPLFPGRDYHHQIW 231

Query: 664 L-LAIMNPDVKIPFPEYTSN-----------NEKIPKSA-----------IELMKACLYR 700
           L L ++       F + TSN             K+P              I+L+   L  
Sbjct: 232 LILEVLGTPSNDDFDDITSNRAKEYIENLPFKSKLPYEVALGRDDMDPLLIDLLDKMLTF 291

Query: 701 NPDKRWTVDKVLSSTFLQPF 720
           NP KR +  + LS  +L  +
Sbjct: 292 NPHKRISAKEALSHPYLATY 311

>KLLA0B11946g Chr2 complement(1048033..1049352) [1320 bp, 439 aa]
           {ON} similar to uniprot|P41808 Saccharomyces cerevisiae
           YPR054W SMK1 Mitogen-activated protein kinase required
           for spore morphogenesis that is expressed as a middle
           sporulation-specific gene
          Length = 439

 Score = 89.4 bits (220), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 94/394 (23%), Positives = 168/394 (42%), Gaps = 75/394 (19%)

Query: 366 NANHADNILQQDNKRLKRSLDDVITNENENKKIQEVFYHRPAPKPPVTKKVEIVEPAKSA 425
           NA    N+  +  K+LK+ LD  + +  ++ ++ +   +      P+  K  I  PA   
Sbjct: 13  NARQMPNV-SRATKKLKKLLDPYVDHMKQSYELDQ---NNHIYVDPILTKRSIYSPA--- 65

Query: 426 SSSNNRSMITVNDSQYEKIELLGRGGSSRVYKVKGSGNKIY----ALKRXXXXXXXXXXX 481
               N S+      +YE +++LG+G    V      GN  +    A+K+           
Sbjct: 66  ----NFSV----PGRYEILQVLGKGSYGTVVSAVDKGNPTHEVQLAIKKVTSIFTREILL 117

Query: 482 XGFKGEIELLEKLKDQRRVIQLLDYEMGD----GLLYLIMECGDHDLSQILNQRSNMPLD 537
                E++ +   K  R ++ L+D E+ +      LY   E  D+DL+++++  SN+   
Sbjct: 118 KRAIRELKFMSYFKGHRNIVSLIDLEIVNEEPYSGLYCYQELVDYDLARVIH--SNVLFS 175

Query: 538 FNFVRFYTKEMLLCIKVVHDAGIVHSDLKPANFVL-VKGILKIIDFGIANAV-PEHTV-- 593
              ++ +  ++L  +K +H A ++H DLKP N +  + G +KI DFG+A  + P  TV  
Sbjct: 176 EFHIKHFLYQILCGMKYIHSADVIHRDLKPGNILCSITGEIKICDFGLARGISPSFTVAG 235

Query: 594 --NIYRETQIGTPNYMAPEALVAMNYTQSSDNQHEGNKWKVGRPSDMWSCGCIIYQMIYG 651
             + +    + T  Y APE +++                +  +  DMW+ GCI+ +  YG
Sbjct: 236 GISNHITNYVATRWYRAPELILSHK--------------RYSKSVDMWAVGCILAEF-YG 280

Query: 652 KPPYGSFQGQNRLLAIMNPD----------------------VKIPFPEY--TSNNEKIP 687
           + P   F G + L  +M                              P+Y  T   E  P
Sbjct: 281 RKP--VFMGNDSLHQVMEIQKILGTPKQIVIRTYGSSRCYDIFSTSKPQYKKTPWCEIFP 338

Query: 688 KS---AIELMKACLYRNPDKRWTVDKVLSSTFLQ 718
            +   A++LM+  +  NP+ R TV++ L   FLQ
Sbjct: 339 YASSEAVDLMERLIDWNPEARLTVEEALDHPFLQ 372

>CAGL0B04301g Chr2 (420544..422172) [1629 bp, 542 aa] {ON} similar
           to uniprot|P38070 Saccharomyces cerevisiae YBR028c
          Length = 542

 Score = 90.1 bits (222), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 71/241 (29%), Positives = 107/241 (44%), Gaps = 52/241 (21%)

Query: 488 IELLEKLKDQRRVIQLLDYEMGDGLLYLIMECGDHDLSQILNQRSNMPLDFNFVRFYTKE 547
           ++L     D  ++  LL Y  G  L + + E G               L+ + V FY  E
Sbjct: 233 VKLFYSFHDTSKLYLLLQYIPGGELFFHLKEHGT--------------LEEDTVAFYAAE 278

Query: 548 MLLCIKVVHDAGIVHSDLKPANFVLVK-GILKIIDFGI----ANAVPEHTVNIYRETQ-- 600
           +   +K +H  G+V+ DLKP N +L + G L + DFG+    A+   +  +    E +  
Sbjct: 279 ISCALKFLHSKGVVYRDLKPENCLLNQNGHLVLTDFGLSKSSASNASQEDLGAGNEGEDV 338

Query: 601 ------IGTPNYMAPEALVAMNYTQSSDNQHEGNKWKVGRPSDMWSCGCIIYQMIYGKPP 654
                 IGTP Y APE L+   YT + D       W        +S GC++Y M+ GKPP
Sbjct: 339 NELHSIIGTPEYCAPEILLGQPYTANCD-------W--------YSLGCLLYDMLTGKPP 383

Query: 655 YGSFQGQNRLLA--IMNPDVKIPFPEYTSNNEKIPKSAIELMKACLYRNPDKRWTVDKVL 712
           Y      ++++A  I N       P Y S+  K      +++ A L  +P KRW VDK  
Sbjct: 384 YTG--ANHKVIANKIKNDKQGPKIPYYLSDGMK------DVLGALLKSDPKKRWDVDKYW 435

Query: 713 S 713
           S
Sbjct: 436 S 436

>AEL083W Chr5 (470964..472574) [1611 bp, 536 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YBR028C
          Length = 536

 Score = 89.7 bits (221), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 73/235 (31%), Positives = 102/235 (43%), Gaps = 52/235 (22%)

Query: 488 IELLEKLKDQRRVIQLLDYEMGDGLLYLIMECGDHDLSQILNQRSNMPLDFNFVRFYTKE 547
           ++L     D  ++  +L Y  G  L Y + E G               LD   V FY  E
Sbjct: 227 VKLFYSFHDHHKLYLVLQYIPGGELFYHLKEQGT--------------LDEVTVSFYAAE 272

Query: 548 MLLCIKVVHDAGIVHSDLKPANFVL-VKGILKIIDFGIAN---------AVPEHTVNIYR 597
           +   +K +H  GIV+ DLKP N +L  KG L + DFG++             E    +Y 
Sbjct: 273 ISCALKFLHSKGIVYRDLKPENCLLDDKGHLVLTDFGLSKRGVNQADSPLGGEQVEELY- 331

Query: 598 ETQIGTPNYMAPEALVAMNYTQSSDNQHEGNKWKVGRPSDMWSCGCIIYQMIYGKPPYGS 657
            + IGTP Y APE L    YTQ+ D       W        +S G + Y M+ GKPP   
Sbjct: 332 -SIIGTPEYCAPEILCGQPYTQNCD-------W--------YSLGSLTYDMLIGKPP--- 372

Query: 658 FQGQNR--LLAIMNPDVKIPFPEYTSNNEKIPKSAIELMKACLYRNPDKRWTVDK 710
           F G N   +L+ +  D  I  P Y S+  K      + + A L ++  KRW VD+
Sbjct: 373 FTGANHKVILSKIKQDKGIKIPHYLSDGMK------DYLNALLKKDIGKRWDVDR 421

>YNR047W Chr14 (708523..711204) [2682 bp, 893 aa] {ON}  FPK1Ser/Thr
           protein kinase that regulates the putative phospholipid
           translocases Lem3p-Dnf1p/Dnf2p; phosphorylates and
           inhibits upstream inhibitory kinase, Ypk1p; localizes to
           the cytoplasm, early endosome/TGN compartments, and
           plasma membrane
          Length = 893

 Score = 90.9 bits (224), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 83/342 (24%), Positives = 138/342 (40%), Gaps = 50/342 (14%)

Query: 408 PKPPVTKKVEIVEPAKS-----ASSSNNRSMITVNDSQYEKIELLGRGGSSRVYKVK-GS 461
           P+ P  K  +  EP +S      S SN    I V    +EKI LLG+G   +V+ V+   
Sbjct: 458 PQEPSPKISDFPEPRRSRRLRTKSFSNKFQDIMVGPQSFEKIRLLGQGDVGKVFLVREKK 517

Query: 462 GNKIYALK-RXXXXXXXXXXXXGFKGEIELLEKLKDQRRVIQLLDYEMGDGLLYLIME-C 519
            N++YALK                  E E+L    +   ++ L      +  LYL ME C
Sbjct: 518 TNRVYALKVLSKDEMIKRNKIKRVLTEQEIL-ATSNHPFIVTLYHSFQSEDYLYLCMEYC 576

Query: 520 GDHDLSQILNQRSNMPLDFNFVRFYTKEMLLCIKVVHDAGIVHSDLKPANFVLVK-GILK 578
              +  + L  R    +  +  RFY  E+   ++ +H  G ++ DLKP N +L + G + 
Sbjct: 577 MGGEFFRALQTRKTKCICEDDARFYASEVTAALEYLHLLGFIYRDLKPENILLHQSGHIM 636

Query: 579 IIDFGIANAVPEHTVNIYRETQ-------------------IGTPNYMAPEALVAMNYTQ 619
           + DF ++    +  V + + +                    +GT  Y+APE +    +T 
Sbjct: 637 LSDFDLSIQAKDSKVPVVKGSAQSTLVDTKICSDGFRTNSFVGTEEYIAPEVIRGNGHTA 696

Query: 620 SSDNQHEGNKWKVGRPSDMWSCGCIIYQMIYGKPPYGSFQGQNRLLAIMNPDVKIPFPEY 679
           + D       W        W+ G +IY+M++G  P+           I+  +V  P    
Sbjct: 697 AVD-------W--------WTLGILIYEMLFGFTPFKGDNTNETFTNILKNEVSFP---- 737

Query: 680 TSNNEKIPKSAIELMKACLYRNPDKRWTVDKVLSSTFLQPFM 721
             NN +I ++  +L+K  L +N  KR       +     PF 
Sbjct: 738 --NNNEISRTCKDLIKKLLTKNESKRLGCKMGAADVKKHPFF 777

>Smik_11.62 Chr11 complement(120153..121346) [1194 bp, 397 aa] {ON}
           YKL166C (REAL)
          Length = 397

 Score = 88.6 bits (218), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 69/252 (27%), Positives = 110/252 (43%), Gaps = 49/252 (19%)

Query: 439 SQYEKIELLGRGGSSRVYKVKGSGN-KIYALKRXXXXXXXXXXXXGFKGE---------- 487
           S ++ +  LG G   RV+ ++ + N + YALK                 +          
Sbjct: 85  SDFQILRTLGTGSFGRVHLIRSNHNGRFYALKTLKKHTVVKLKQVEHTNDERRMLSIVSH 144

Query: 488 ---IELLEKLKDQRRVIQLLDYEMGDGLLYLIMECGDHDLSQILNQRSNMPLDFNFVRFY 544
              I +    +D ++V  ++DY  G  L  L+ +          +QR   P+     +FY
Sbjct: 145 PFIIRMWGTFQDSQQVFMVMDYVEGGELFSLLRK----------SQRFPNPV----AKFY 190

Query: 545 TKEMLLCIKVVHDAGIVHSDLKPANFVLVK-GILKIIDFGIANAVPEHTVNIYRETQIGT 603
             E+ L ++ +H   I++ DLKP N +L K G +KI DFG A  VP+ T      T  GT
Sbjct: 191 AAEVCLALEYLHSKDIIYRDLKPENILLDKNGHIKITDFGFAKYVPDVTY-----TLCGT 245

Query: 604 PNYMAPEALVAMNYTQSSDNQHEGNKWKVGRPSDMWSCGCIIYQMIYGKPPYGSFQGQNR 663
           P+Y+APE +    Y +S D       W        WS G +IY+M+ G  P+ +      
Sbjct: 246 PDYIAPEVVSTKPYNKSVD-------W--------WSFGVLIYEMLAGYTPFYNSNTMKT 290

Query: 664 LLAIMNPDVKIP 675
              I+N ++K P
Sbjct: 291 YENILNAELKFP 302

>KLLA0F11143g Chr6 complement(1026129..1028570) [2442 bp, 813 aa]
           {ON} similar to uniprot|P22216 Saccharomyces cerevisiae
           YPL153C RAD53 Protein kinase required for cell-cycle
           arrest in response to DNA damage activated by trans
           autophosphorylation when interacting with
           hyperphosphorylated Rad9p
          Length = 813

 Score = 90.5 bits (223), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 82/307 (26%), Positives = 144/307 (46%), Gaps = 30/307 (9%)

Query: 425 ASSSNNRSMITVNDSQYEKIE--------LLGRGGSSRVYK-VKGSGNKIYALKRXXXXX 475
           ASSS ++  I++  ++ + I         ++G+G  + V K V+ S  K +A+K      
Sbjct: 168 ASSSKSKYQISMGHTELKGIHKYYSISDSIVGQGAFATVKKAVERSTGKTFAVK-IIHKR 226

Query: 476 XXXXXXXGFKGEIELLEKLKDQRRVIQLLDYEMGDGLLYLIME-CGDHDLSQILNQRSNM 534
                  G K E+++L+KL +  R+++L D+   +   Y++ME     DL   +     +
Sbjct: 227 KVMDKFDGVKRELDVLQKL-NHPRIVKLKDFFEDNDNYYMLMEFVSGGDLMDFVAAHGTV 285

Query: 535 PLDFNFVRFYTKEMLLCIKVVHDAGIVHSDLKPANFVLVKG---ILKIIDFGIANAVPEH 591
             D    R  T+++L  +K +HD GI H DLKP N ++ +    ++KI DFG+A      
Sbjct: 286 GEDAG--REITRQVLEAVKYMHDQGISHRDLKPDNIMIEQDDPVLIKITDFGLAKV---Q 340

Query: 592 TVNIYRETQIGTPNYMAPEALVAMNYTQSSDNQHEGNKWKVGRPSDMWSCGCIIYQMIYG 651
             N +  T  GT  Y+APE +   N       + + N+       DMWS GC++Y ++ G
Sbjct: 341 NQNTFLNTFCGTLAYVAPEVIDGKNA------EDKTNRDLYSSLVDMWSIGCLVYVILTG 394

Query: 652 KPPYGSFQGQNRLLAIMNPDVKIPFPEYTSNNEKIPKSAIELMKACLYRNPDKRWTVDKV 711
             P+ S Q QN L   +    +  + E    + +I + A   +   L  +P +R    K 
Sbjct: 395 HLPF-SGQSQNELFKQIK---RGSYHEGPLKDYRISEEARNFIDCLLNVDPKERMNAGKA 450

Query: 712 LSSTFLQ 718
           L   +++
Sbjct: 451 LQHPWMK 457

>KLTH0C09548g Chr3 (792218..795199) [2982 bp, 993 aa] {ON} similar
           to uniprot|Q12236 YOL100W Saccharomyces cerevisiae
           YOL100W PKH2 Serine/threonine protein kinase involved in
           sphingolipid-mediated signaling pathway that controls
           endocytosis
          Length = 993

 Score = 90.9 bits (224), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 93/346 (26%), Positives = 161/346 (46%), Gaps = 45/346 (13%)

Query: 384 SLDDVITNENENKKIQEVFYHRPAPKPPVTKKVEIVEPAKSASSSNNRSMITVNDSQYEK 443
           S+ ++  NE   ++ QE +  R A K  + K  E+V P    ++   R +I      ++ 
Sbjct: 114 SIKEMTMNEAMRRR-QEEWAERGAAK--IVK--EVVNPETGVTA---RHVIKKGIKDFKF 165

Query: 444 IELLGRGGSSRVYKVKG--SGNKIYALKRXXXXXXXXXXXXGFKG-EIELLEKLKDQRRV 500
            E+LG G  S V   +   SG K YA+K              +   E   L++L D R +
Sbjct: 166 GEVLGDGSYSTVMLARSIDSGKK-YAVKVLNKEYLIRQKKVKYVNIEKNTLQRLNDGRGI 224

Query: 501 IQLLDYEMGDGLLYLIMECG-DHDLSQILNQRSNMPLDFNFVRFYTKEMLLCIKVVHDAG 559
           I+L      +  LY ++E   + D   ++ +  ++  D +   +Y+ ++L  I  +H  G
Sbjct: 225 IKLYFTFQDEASLYFLLEYAPNGDFLSVIKKYGSLNQDCSV--YYSAQILDAIDYLHQKG 282

Query: 560 IVHSDLKPANFVLVKGI-LKIIDFGIANAVPE----HTVNIYRETQ--IGTPNYMAPEAL 612
           ++H D+KP N +L K + +K+ DFG A  V +     T N+   ++  +GT  Y++PE L
Sbjct: 283 VIHRDIKPENILLDKDMKVKLTDFGTAKLVEKDETTQTYNLLERSKSFVGTAEYVSPE-L 341

Query: 613 VAMNYTQSSDNQHEGNKWKVGRPSDMWSCGCIIYQMIYGKPPYGSFQGQNRLLAIMNPDV 672
           +  NY              V    D+W+ GCI++QMI GKPP   F+  N  L      +
Sbjct: 342 LNDNY--------------VDYKCDIWAFGCILFQMIAGKPP---FKATNEYLTFQK-VM 383

Query: 673 KIPFPEYTSNNEKIPKSAIELMKACLYRNPDKRWTVDKVLSSTFLQ 718
           K+ +  +T+     P    +L+K  L +NP++R    +V    F +
Sbjct: 384 KVQY-AFTAG---FPLIIRDLIKQILVKNPEQRLDTLQVKKHHFFK 425

>Suva_1.50 Chr1 (96474..100556) [4083 bp, 1360 aa] {ON} YAL017W (REAL)
          Length = 1360

 Score = 90.9 bits (224), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 68/238 (28%), Positives = 119/238 (50%), Gaps = 39/238 (16%)

Query: 487  EIELLEKLKD--QRRVIQLLDYEMGDGLLYLIM----ECGDHDLSQILNQRSNMPLDFNF 540
            EI+++  L       +++LLD+   D   Y+      E G  DL  ++  ++NM      
Sbjct: 1153 EIQIMATLNKTPHENILRLLDFFEDDDYYYIETPVHGETGCIDLFDLIEFKTNMTE--CE 1210

Query: 541  VRFYTKEMLLCIKVVHDAGIVHSDLKPANFVL-VKGILKIIDFGIANAVPEHTVNIYRET 599
             +   K+++  IK +HD GIVH D+K  N ++  KG +KIIDFG A  V     +++   
Sbjct: 1211 AKLIVKQVVAGIKHLHDQGIVHRDIKDENVIVDSKGFVKIIDFGSAAYVKSGPFDVF--- 1267

Query: 600  QIGTPNYMAPEALVAMNYTQSSDNQHEGNKWKVGRPSDMWSCGCIIYQMIYGKPPYGSFQ 659
             +GT +Y APE L              GN ++ G+P D+W+ G ++Y +++ + P+ +  
Sbjct: 1268 -VGTIDYAAPEVL-------------GGNPYE-GKPQDIWAIGILLYTVVFKENPFYNID 1312

Query: 660  GQNRLLAIMNPDVKIPFPEYTSNNEKIPKSAIELMKACLYRNPDKRWTVDKVLSSTFL 717
                   I+  D+K       +N E++ +  IEL+K+ L R   KR T+D + +  +L
Sbjct: 1313 ------EILEGDLKF------NNAEEVSEDCIELIKSILNRCVPKRPTIDDINNGKWL 1358

>NDAI0I00340 Chr9 (65047..70557) [5511 bp, 1836 aa] {ON} Anc_6.341
          Length = 1836

 Score = 90.9 bits (224), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 83/323 (25%), Positives = 139/323 (43%), Gaps = 54/323 (16%)

Query: 425  ASSSNNRSMITVNDSQYEKIELLGRGGSSRVYKVKGSGN-KIYALK--RXXXXXXXXXXX 481
            ASS +N SM      +++K   +G G    V+      N +I A+K  R           
Sbjct: 1519 ASSMSNLSM------RWQKRNFIGGGTFGTVFSAVNLDNGEILAVKEIRIQDSTTMKKIF 1572

Query: 482  XGFKGEIELLEKLKDQRRVIQLLDYEMGDGLLYLIME-CGDHDLSQILNQRSNMPLDFNF 540
               K E+ +LE L +   ++Q    E+    + + ME C    L+ +L        D   
Sbjct: 1573 PLIKEEMTVLEML-NHPNIVQYYGVEVHRDKVNIFMEYCEGGSLASLLEH--GRIEDEMV 1629

Query: 541  VRFYTKEMLLCIKVVHDAGIVHSDLKPANFVL-VKGILKIIDFGIANAVPEHTVNIYR-- 597
             + YT E+L  +  +H AG+VH D+KP N +L   GI+K +DFG A  + ++   I    
Sbjct: 1630 TQIYTLELLEGLAYLHQAGVVHRDIKPENILLDFNGIIKYVDFGAARKIAKNGTRIPNLN 1689

Query: 598  ------------------ETQIGTPNYMAPEALVAMNYTQSSDNQHEGNKWKVGRPSDMW 639
                                 +GTP YMAPE++              GN  K G   D+W
Sbjct: 1690 KKNGAEPEVEEDADGGKVHDMMGTPMYMAPESITG-----------PGNTGKFGS-DDIW 1737

Query: 640  SCGCIIYQMIYGKPPYGSFQGQNRLLAIMNPDVKIPFPEYTSNNEKIPKSAIELMKACLY 699
            S GC++ +M+ G+ P+ +   +    AIM        P+  + +E  P +    ++ CL 
Sbjct: 1738 SLGCVVLEMVTGRRPWANLDNE---WAIMYHVAAGHTPQLPNADEVTP-AGRAFLQRCLV 1793

Query: 700  RNPDKRWTVDKVLSSTFLQPFMI 722
            ++P  R T  ++L    + P+++
Sbjct: 1794 QDPKSRATAVELL----IDPWIV 1812

>TPHA0A04170 Chr1 (937692..939233) [1542 bp, 513 aa] {ON} Anc_3.229
           YBR028C
          Length = 513

 Score = 89.4 bits (220), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 69/232 (29%), Positives = 102/232 (43%), Gaps = 46/232 (19%)

Query: 488 IELLEKLKDQRRVIQLLDYEMGDGLLYLIMECGDHDLSQILNQRSNMPLDFNFVRFYTKE 547
           ++L     D  ++  +L Y  G  L + + E G       LN+        + V FY  E
Sbjct: 203 VKLFYAFHDHSKLYLILQYIPGGELFFHLKEQG------TLNE--------DVVAFYGAE 248

Query: 548 MLLCIKVVHDAGIVHSDLKPANFVL-VKGILKIIDFGIAN--------AVPEHTVNIYRE 598
           +   +K +H+ GIV+ DLKP N +L   G L + DFG++            E    +Y  
Sbjct: 249 ISCALKFLHEKGIVYRDLKPENCLLNYTGHLVLTDFGLSKKGVKKEIPGADEDVAELY-- 306

Query: 599 TQIGTPNYMAPEALVAMNYTQSSDNQHEGNKWKVGRPSDMWSCGCIIYQMIYGKPPYGSF 658
           + IGTP Y APE L  + YTQ+ D       W        +S GC+IY M+ GKPP+   
Sbjct: 307 SIIGTPEYCAPEILEGLPYTQNCD-------W--------YSLGCLIYDMLVGKPPFVGA 351

Query: 659 QGQNRLLAIMNPDVKIPFPEYTSNNEKIPKSAIELMKACLYRNPDKRWTVDK 710
             +  L  I         P Y S+  K      +++   L ++  KRW VDK
Sbjct: 352 NHKIILNKIKKDKTGAKIPYYLSDGMK------DILCWLLKKDCSKRWDVDK 397

>Skud_10.119 Chr10 (215299..219744) [4446 bp, 1481 aa] {ON} YJL095W
            (REAL)
          Length = 1481

 Score = 90.9 bits (224), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 85/324 (26%), Positives = 142/324 (43%), Gaps = 40/324 (12%)

Query: 441  YEKIELLGRGGSSRVY-KVKGSGNKIYALKRXXXXXXXXX------XXXGFKGEIELLEK 493
            + K E++G+G    VY  +  +  ++ A+K+                    + E+  L+ 
Sbjct: 1178 WMKGEMIGKGSFGAVYLCLNVTTGEMMAVKQVEVPKYSSQNEAILGTVEALRSEVSTLKD 1237

Query: 494  LKDQRRVIQLLDYEMGDGLLYLIME--CGDHDLSQILNQRSNMPLDFNFVRFYTKEMLLC 551
            L D   ++Q L +E  + +  L +E   G    S I   R     D + +R  T ++L  
Sbjct: 1238 L-DHLNIVQYLGFENKNNIYSLFLEYVAGGSVGSLI---RMYGRFDESLIRHLTTQVLKG 1293

Query: 552  IKVVHDAGIVHSDLKPANFVLVK-GILKIIDFGIANAVPEHTVNIYRETQI---GTPNYM 607
            +  +H  GI+H D+K  N +L + GI KI DFGI+      + +IY  + +   GT  +M
Sbjct: 1294 LAYLHSKGILHRDMKADNLLLDQDGICKISDFGIS----RKSKDIYSNSDMTMRGTVFWM 1349

Query: 608  APEALVAMNYTQSSDNQHEGNKWKVGRPSDMWSCGCIIYQMIYGKPPYGSFQGQNRLLAI 667
            APE +          +  +G   KV    D+WS GCI+ +M  GK P+ + +    +  I
Sbjct: 1350 APEMV----------DTKQGYSAKV----DIWSLGCIVLEMFAGKRPWSNLEVVAAMFKI 1395

Query: 668  MNPDVKIPFPEYTSNNEKIPKSAIELMKACLYRNPDKRWTVDKVLSSTFLQ---PFMISG 724
                   P PE T     I +     + AC   NP++R T  ++LS  F Q    F    
Sbjct: 1396 GKSKSAPPIPEDTL--PLISQVGRSFLDACFEINPEERPTATELLSHQFSQVDTTFDFKS 1453

Query: 725  SIMEDLIKNAVRYGSEKPQISHDD 748
            + +   IK+  R  S K +I+  +
Sbjct: 1454 TRLAKFIKSNDRLNSSKLRITSQE 1477

>Smik_16.296 Chr16 (542962..544128) [1167 bp, 388 aa] {ON} YPR054W
           (REAL)
          Length = 388

 Score = 88.2 bits (217), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 83/318 (26%), Positives = 144/318 (45%), Gaps = 59/318 (18%)

Query: 441 YEKIELLGRGGSSRVYKVKGSGN----KIYALKRXXXXXXXXXXXXGFKGEIELLEKLKD 496
           YE I+ LG+G    V  VK  G     KI A+K+                E++ +   K 
Sbjct: 38  YEIIQFLGKGAYGTVCSVKFKGQNPPAKI-AVKKISNIFNKEILLKRAIRELKFMNFFKG 96

Query: 497 QRRVIQLLDYEMG-----DGLLYLIMECGDHDLSQILNQRSNMPLDFNFVRFYTKEMLLC 551
            + ++ L+D E+      DGL Y   E  D+DL+++++  S++ L    ++++  ++L  
Sbjct: 97  HKNIVNLIDLEIVTSSPYDGL-YCYQELIDYDLAKVIH--SSVQLSEFHIKYFLYQILCG 153

Query: 552 IKVVHDAGIVHSDLKPANFVL-VKGILKIIDFGIANAVPEHTVNIYRETQ------IGTP 604
           +K +H A ++H DLKP N +  + G LKI DFG+A  +       +   Q      + T 
Sbjct: 154 LKYIHSADVIHRDLKPGNILCTLNGCLKICDFGLARGIHAGFFQCHSTIQPHITNYVATR 213

Query: 605 NYMAPEALVAMNYTQSSDNQHEGNKWKVGRPSDMWSCGCIIYQMIYGKPPYGSFQGQNRL 664
            Y APE L++        NQ         +  D+W+ GCI+ +    KP +      +++
Sbjct: 214 WYRAPELLLS--------NQ------PYNKSVDIWAVGCILAEFYARKPVFMGRDSMHQI 259

Query: 665 LAIM------NPDVKIPFPEY-------TSNN---EKIPKS---------AIELMKACLY 699
             I+      + D+ I F          +SNN   +KIP S         AI+L+++ L+
Sbjct: 260 FEIIKVLGTPDKDLLIKFGTIKAWNLGKSSNNPVYKKIPWSNIFPFASHEAIDLIESLLH 319

Query: 700 RNPDKRWTVDKVLSSTFL 717
            +   R  V++ +S  FL
Sbjct: 320 WDSTHRLNVEQAISHPFL 337

>SAKL0H06534g Chr8 complement(575439..577853) [2415 bp, 804 aa] {ON}
           similar to uniprot|P22216 Saccharomyces cerevisiae
           YPL153C RAD53 Protein kinase required for cell-cycle
           arrest in response to DNA damage activated by trans
           autophosphorylation when interacting with
           hyperphosphorylated Rad9p
          Length = 804

 Score = 90.1 bits (222), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 82/290 (28%), Positives = 133/290 (45%), Gaps = 23/290 (7%)

Query: 443 KIELLGRGGSSRVYK-VKGSGNKIYALKRXXXXXXXXXXXXGFKGEIELLEKLKDQRRVI 501
           K E++G+G  + V K V+    K +A+K             G   E+E+L +L +  R++
Sbjct: 190 KDEVVGQGAFAIVKKAVERKTGKTFAVK-IISKRKVMGNIDGVTRELEVLRRL-NHPRIV 247

Query: 502 QLLDYEMGDGLLYLIME-CGDHDLSQILNQRSNMPLDFNFVRFYTKEMLLCIKVVHDAGI 560
           +L  +   D   YL+ME     DL   +    ++  D    R  TK++L  +K +H  GI
Sbjct: 248 RLKGFYEDDESYYLLMEFVSGGDLMDFVAAHGSVGEDAG--REITKQVLEAVKYIHGMGI 305

Query: 561 VHSDLKPANFVLVKG---ILKIIDFGIANAVPEHTVNIYRETQIGTPNYMAPEALVAMNY 617
            H DLKP N ++ +    ++KI DFG+A      T   + +T  GT  Y+APE +   N 
Sbjct: 306 SHRDLKPDNILIEQDDPVMVKITDFGLAKIQGNGT---FMKTFCGTLAYVAPEVISGKNS 362

Query: 618 TQSSDNQHEGNKWKVGRPSDMWSCGCIIYQMIYGKPPY-GSFQGQNRLLAIMNPDVKIPF 676
              S N++     K     DMWS GC++Y ++ G  P+ GS Q Q     +     +  +
Sbjct: 363 EDKSQNKN-----KYSSLVDMWSIGCLVYVILTGHLPFSGSTQDQ-----LYKQISRGSY 412

Query: 677 PEYTSNNEKIPKSAIELMKACLYRNPDKRWTVDKVLSSTFLQPFMISGSI 726
            E    + +I   A   + + L  NP  R T +K L   +++      SI
Sbjct: 413 HEGPLKDFRISDEARNFIDSLLQVNPKDRLTAEKALDHPWIKIGYTGSSI 462

>KLLA0F13552g Chr6 complement(1252906..1256709) [3804 bp, 1267 aa]
           {ON} weakly similar to uniprot|P34244 Saccharomyces
           cerevisiae YKL101W HSL1 Nim1p-related protein kinase
           that regulates the morphogenesis and septin checkpoints
           associates with the assembled septin filament required
           along with Hsl7p for bud neck recruitment
           phosphorylation and degradation of Swe1p
          Length = 1267

 Score = 90.5 bits (223), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 89/344 (25%), Positives = 148/344 (43%), Gaps = 52/344 (15%)

Query: 391 NENENKKIQEVFYHRPAPKPPVTKKVEIVEPAKSASSSNN------RSMITVNDSQYEKI 444
           NE+ N+ +Q V           TK++  +  A S ++ NN      R+  TV   +  K 
Sbjct: 27  NEHLNRVVQSV--------TDATKRLSQISTASSNANVNNTKTSKRRNRDTVGPWKLGKT 78

Query: 445 ELLGRGGSSRVYKVKG-SGNKIYALK----RXXXXXXXXXXXXGFKGEIELLEKLKDQRR 499
             LG+G S RV   K     K+ A+K    +            G + EI ++ KL     
Sbjct: 79  --LGKGSSGRVRLAKNMETGKLSAIKIVPKKFVKSNQIKQLPYGIEREI-IIMKLISHPN 135

Query: 500 VIQLLDYEMGDGLLYLIME-CGDHDLSQILNQRSNMPLDFNFVRFYTKEMLLCIKVVHDA 558
           V+ L +       LYL++E     +L   L  +  +P        Y K+++  +   H  
Sbjct: 136 VMGLYEVWENKSELYLVLEYVEGGELFDYLVSKGKLPESEAI--HYFKQIVQAVAYCHGF 193

Query: 559 GIVHSDLKPANFVL--VKGILKIIDFGIANAVPEHTVNIYRETQIGTPNYMAPEALVAMN 616
            I H DLKP N +L   K  +KI DFG+A      T +   ET  G+P+Y +PE ++   
Sbjct: 194 NICHRDLKPENLLLDKKKRSIKIADFGMAAL---ETSDKLLETSCGSPHYASPEIVLGRK 250

Query: 617 YTQSSDNQHEGNKWKVGRPSDMWSCGCIIYQMIYGKPPYGSFQGQNRLLAIMNPDVKIPF 676
           Y               G PSD+WSCG I++ ++ G  P+     +  LL + +   ++P 
Sbjct: 251 YH--------------GSPSDVWSCGIILFALLTGHLPFNDDNVKKLLLKVQSGKYQMP- 295

Query: 677 PEYTSNNEKIPKSAIELMKACLYRNPDKRWTVDKVLSSTFLQPF 720
                  + +   A +L+   L  +P++R T+D++L    L  +
Sbjct: 296 -------QWLSVEAKDLISRILVVDPNRRITIDQILQHELLTKY 332

>KNAG0J01290 Chr10 complement(230493..232019) [1527 bp, 508 aa] {ON}
           
          Length = 508

 Score = 89.0 bits (219), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 70/239 (29%), Positives = 108/239 (45%), Gaps = 49/239 (20%)

Query: 488 IELLEKLKDQRRVIQLLDYEMGDGLLYLIMECGDHDLSQILNQRSNMPLDFNFVRFYTKE 547
           ++L     D  ++  +L Y  G  L + + E G               LD + V FY  E
Sbjct: 203 VKLFYSFHDVSKLYLILQYVPGGELFFHLKEHG--------------TLDEDTVSFYAAE 248

Query: 548 MLLCIKVVHDAGIVHSDLKPANFVL-VKGILKIIDFGIA------NAVPEHTVNIYR-ET 599
           +   +K +HD GIV+ DLKP N +L  +G L + DFG++      N +     +++   +
Sbjct: 249 ISCALKFLHDKGIVYRDLKPENCLLNDRGHLVLTDFGLSKKSLEDNDMSNQVDDVFTLHS 308

Query: 600 QIGTPNYMAPEALVAMNYTQSSDNQHEGNKWKVGRPSDMWSCGCIIYQMIYGKPPYGSFQ 659
            IGTP Y APE L  + Y ++ D       W        +S GC+++ M+ GKPPY    
Sbjct: 309 IIGTPEYAAPEILQGLPYNKNCD-------W--------YSLGCLLFDMLVGKPPY---T 350

Query: 660 GQNRLLAI--MNPDVKIP-FPEYTSNNEKIPKSAIELMKACLYRNPDKRWTVDKVLSST 715
           G N  + I  +  D   P  P Y S   K      +++   L ++  KRW VDK  + T
Sbjct: 351 GTNHKVIINKIQKDKNGPKIPYYLSEGMK------DMLNWLLKKDKLKRWQVDKYWAET 403

>Kpol_1040.20 s1040 (57057..60950) [3894 bp, 1297 aa] {ON}
            (57057..60950) [3894 nt, 1298 aa]
          Length = 1297

 Score = 90.5 bits (223), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 68/239 (28%), Positives = 118/239 (49%), Gaps = 39/239 (16%)

Query: 487  EIELLEKLKDQRR--VIQLLDYEMGDGLLYLIM----ECGDHDLSQILNQRSNMPLDFNF 540
            EI+++  L       +++LLD+   D   Y+      E G  DL  ++  ++NM      
Sbjct: 1090 EIQIMSTLNKHPHDNILRLLDFFEDDDYYYIETPMHGETGCIDLFDLIEFKTNMSEVETK 1149

Query: 541  VRFYTKEMLLCIKVVHDAGIVHSDLKPANFVL-VKGILKIIDFGIANAVPEHTVNIYRET 599
            + F   +++  IK +HD GIVH D+K  N ++  +G +K+IDFG A  V     +++   
Sbjct: 1150 LIFM--QVVSSIKFLHDQGIVHRDIKDENVIVDSQGFIKLIDFGSAAYVKSGPFDVF--- 1204

Query: 600  QIGTPNYMAPEALVAMNYTQSSDNQHEGNKWKVGRPSDMWSCGCIIYQMIYGKPPYGSFQ 659
             +GT +Y APE L              G +  VG+P D+W+ G ++Y +I+ + P+ +  
Sbjct: 1205 -VGTIDYAAPEVL--------------GGEPYVGKPQDIWAIGILLYTIIFKENPFYNID 1249

Query: 660  GQNRLLAIMNPDVKIPFPEYTSNNEKIPKSAIELMKACLYRNPDKRWTVDKVLSSTFLQ 718
                   I+  ++K  F   T   E      ++L+K  L RNP KR T+D++ +  +LQ
Sbjct: 1250 ------EILEAELK--FNTSTGACE----DCVDLIKRILTRNPTKRPTIDEIYNDKWLQ 1296

>Kwal_26.7788 s26 (511530..515333) [3804 bp, 1267 aa] {ON} YKL101W
           (HSL1) - Putative protein kinase homologous to S. pombe
           cdr1/nim1 [contig 55] FULL
          Length = 1267

 Score = 90.1 bits (222), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 75/279 (26%), Positives = 122/279 (43%), Gaps = 32/279 (11%)

Query: 447 LGRGGSSRVYKVKG-SGNKIYALKRXXXXXXXXXXXXGFKGEIELL-EKLKDQRRVIQLL 504
           LG+G S RV   K     K+ A+K              +  E E++  KL     V+ L 
Sbjct: 64  LGKGSSGRVRLAKNMETGKLAAIKIVPKTKSSRTGSLPYGIEREIIIMKLISHPNVMGLY 123

Query: 505 DYEMGDGLLYLIMECGDH-DLSQILNQRSNMPLDFNFVRFYTKEMLLCIKVVHDAGIVHS 563
           +       L+L++E  D  +L   L  R  +P        Y ++++      H   I H 
Sbjct: 124 EVWENKLELFLVLEYVDGGELFDYLVSRGRLPEKEAI--HYFRQIIEGTAYCHGFNICHR 181

Query: 564 DLKPANFVLVKG--ILKIIDFGIANAVPEHTVNIYRETQIGTPNYMAPEALVAMNYTQSS 621
           DLKP N +L K    +KI DFG+A      T N   ET  G+P+Y +PE ++  NY    
Sbjct: 182 DLKPENLLLDKKNKRIKIADFGMAAL---QTSNKLLETSCGSPHYASPEIVMGKNYN--- 235

Query: 622 DNQHEGNKWKVGRPSDMWSCGCIIYQMIYGKPPYGSFQGQNRLLAIMNPDVKIPFPEYTS 681
                      G PSD+WSCG I++ ++ G  P+     +  LL +     ++P      
Sbjct: 236 -----------GGPSDVWSCGIILFALLTGHLPFNDDNIKRLLLKVQAGKYQMP------ 278

Query: 682 NNEKIPKSAIELMKACLYRNPDKRWTVDKVLSSTFLQPF 720
             + +   A +L+   L  +PDKR +++++L+   L  +
Sbjct: 279 --QSVSSGAQDLISRILVVDPDKRISINEILAHPLLAKY 315

>KLLA0C04191g Chr3 (384198..386591) [2394 bp, 797 aa] {ON} weakly
           similar to uniprot|P27636 Saccharomyces cerevisiae
           YAR019C CDC15 Protein kinase of the Mitotic Exit Network
           that is localized to the spindle pole bodies at late
           anaphase promotes mitotic exit by directly switching on
           the kinase activity of Dbf2p
          Length = 797

 Score = 89.7 bits (221), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 74/287 (25%), Positives = 130/287 (45%), Gaps = 37/287 (12%)

Query: 435 TVNDSQYEKIELLGRGGSSRVYK-VKGSGNKIYALKRXXXXXXXXXXXXGFKGEIELLEK 493
           ++    Y   +++GRG    VY+ VK   NK  A+K+                EI+LL+ 
Sbjct: 4   SIAHGTYALKQVIGRGAYGVVYRAVKRGTNKPCAIKQIEFEDESELNEHML--EIDLLKN 61

Query: 494 LKDQRRVIQLLDYEMGDGLLYLIME-CGDHDLSQILNQRSNMPLDFNFVRFYTKEMLLCI 552
           L+ Q  +++   +      LY+I+E C    L  IL      PL  +    Y  + L  +
Sbjct: 62  LRHQN-IVEYRGFIQKAHELYIILEYCARGSLRDILKHG---PLLEDDTVNYVTQTLYGL 117

Query: 553 KVVHDAGIVHSDLKPANFVLVK-GILKIIDFGIANAVPEHTVNIYRETQIGTPNYMAPEA 611
           + +H+ G++H D+K AN +L + GI+K+ DFG++       +N    T  G+PN+MAPE 
Sbjct: 118 QYLHEQGVIHRDIKAANLLLTEEGIVKLADFGVST-----RINRMAMTYAGSPNWMAPEV 172

Query: 612 LVAMNYTQSSDNQHEGNKWKVGRPSDMWSCGCIIYQMIYGKPPYGSFQGQNRLLAIMNPD 671
           +                       SD+WS G  + +++ G PP+ +   ++   AI+N +
Sbjct: 173 MTGQG---------------ASTVSDIWSLGATVVELLTGNPPFHNLVNESACYAIVNEE 217

Query: 672 VKIPFPEYTSNNEKIPKSAIELMKACLYRNPDKRWTVDKVLSSTFLQ 718
                P  T + E       + +  C  +N  KR T  ++L+  +L+
Sbjct: 218 Y---IPPLTLSAE-----CKDFLSRCFQKNMFKRATAQELLAHIWLK 256

>TPHA0F02430 Chr6 complement(535865..538261) [2397 bp, 798 aa] {ON}
           Anc_6.31 YMR001C
          Length = 798

 Score = 89.7 bits (221), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 76/291 (26%), Positives = 133/291 (45%), Gaps = 29/291 (9%)

Query: 432 SMITVNDSQYEKIELLGRGGSSRVYKVKGSGNKIYALKRXXXXXXXXXXXXGFK--GEIE 489
           S+I  N  +Y + E LG GG +R + +K      +A K              FK   EI+
Sbjct: 84  SVIKDNSKKYFRRECLGEGGFARCFHIKDDVGISFACK-IVSKKSIKTERTKFKLLSEIQ 142

Query: 490 LLEKLKDQRRVIQLLDYEMGDGLLYLIME-CGDHDLSQILNQRSNMPLDFNFVRFYTKEM 548
           + + L+    +++ +D    +  +Y+++E C +  L  +L +R    L    V+F T ++
Sbjct: 143 IHQNLR-YSHIVKFMDCFEDELNVYILLELCPNGSLMDLLKKRK--ILTEAEVKFMTTQV 199

Query: 549 LLCIKVVHDAGIVHSDLKPANFVLVKGI-LKIIDFGIANAVPEHTVNIYRETQIGTPNYM 607
              I  +H   I+H DLK  N    K   +KI DFG+A  +    V+  + T  GTPNY+
Sbjct: 200 CGAINYMHSNNIIHRDLKLGNVFFDKNFNIKIGDFGLAATLS--NVSEKKYTMCGTPNYI 257

Query: 608 APEALVAMNYTQSSDNQHEGNKWKVGRPSDMWSCGCIIYQMIYGKPPYGSFQGQNRLLAI 667
           APE +++     S +             +D+WS G +IY M+ GKPP+ +         I
Sbjct: 258 APEVILSKQIGHSFE-------------ADIWSLGIMIYAMVLGKPPFQAKDVTTIYEKI 304

Query: 668 MNPDVKIPFPEYTSNNEKIPKSAIELMKACLYRNPDKRWTVDKVLSSTFLQ 718
                + P  +Y +N+ K+      L++  L  +P +R  +  +L   + +
Sbjct: 305 KLCQYEFPPDKYITNDVKV------LIQDLLVLDPSQRPRIMDILKYNWFK 349

>Ecym_1030 Chr1 (56043..57365) [1323 bp, 440 aa] {ON} similar to
           Ashbya gossypii AFR724C
          Length = 440

 Score = 88.2 bits (217), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 72/286 (25%), Positives = 128/286 (44%), Gaps = 36/286 (12%)

Query: 440 QYEKIELLGRGGSSRVYKVKG-SGNKIYALKRXXXXXXXXXXXXGFKGEIELLEKLKD-- 496
           QYE ++ +GRG    VYK +  + N+I A+K                 EI  L +L+   
Sbjct: 19  QYEILQCIGRGNFGDVYKARYLATNEIVAIKVVNLEDTDEPIDL-LAQEIFFLSELRSPY 77

Query: 497 --QRRVIQLLDYEMGDGLLYLIME-CGDHDLSQILNQRSNMPLDFNFVRFYTKEMLLCIK 553
               +   L+D  M     +++ME CG    +++L       L  +   F   E+L+ + 
Sbjct: 78  ITNYKTAFLVDVSM-----WIVMEYCGGGSCAELLKYTPEHKLTEDQCAFIVSEVLVGLD 132

Query: 554 VVHDAGIVHSDLKPANFVLVK-GILKIIDFGIANAVPEHTVNIYRETQIGTPNYMAPEAL 612
            +H    +H D+K AN +L   G +K+ DFG++    +  V   R+T +GTP +MAPE +
Sbjct: 133 YLHSQRKIHRDIKSANILLTDNGHVKLGDFGVSG---QMMVTRKRDTFVGTPFWMAPEVI 189

Query: 613 VAMNYTQSSDNQHEGNKWKVGRPSDMWSCGCIIYQMIYGKPPYGSFQGQNRLLAIMNPDV 672
                        + NK      +D+WS G  + +++ G PP   +     L+A      
Sbjct: 190 -------------DRNKKGYNEMADIWSLGITVIELLMGHPPLDKYDAMKALMA------ 230

Query: 673 KIPFPEYTSNNEKIPKSAIELMKACLYRNPDKRWTVDKVLSSTFLQ 718
            IP  +    +++    A + +  CL ++P +R T  ++L   F++
Sbjct: 231 -IPKRDPPKLDKRFSSHAKDFVAQCLIKDPSQRPTASELLKHRFVK 275

>TBLA0A01630 Chr1 complement(385348..386386,386496..386512) [1056
           bp, 351 aa] {ON} Anc_8.490 YPL042C
          Length = 351

 Score = 87.4 bits (215), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 86/339 (25%), Positives = 142/339 (41%), Gaps = 87/339 (25%)

Query: 439 SQYEKIELLGRGGSSRVYKVKGSGNKIY-ALKRXXXXXXXXXXXXGFKGEIELLEKLKDQ 497
           SQ++++E LG G  + VYK       +Y ALK               + EI L+++LK  
Sbjct: 5   SQFKQLEKLGNGTYATVYKGLNKTTGVYVALKEVKLDSEEGTPSTAIR-EISLMKELK-H 62

Query: 498 RRVIQLLDYEMGDGLLYLIMECGDHDLSQILNQRS------------------------- 532
             +++L D    +  L L+ E  D DL + ++ RS                         
Sbjct: 63  NNIVRLYDVIHTENKLTLVFEYMDKDLKKFMDARSLAHANQLNANANQNINSGNPMGNNG 122

Query: 533 -------NMPLDFNFVRFYTKEMLLCIKVVHDAGIVHSDLKPANFVLV-KGILKIIDFGI 584
                   + L+ N V+++  ++L  +   H+  I+H DLKP N ++  KG LK+ DFG+
Sbjct: 123 NSNSKTQPIGLELNLVKYFQWQLLEGVAYCHENKILHRDLKPQNLLIDNKGQLKLGDFGL 182

Query: 585 ANA--VPEHTVNIYRETQIGTPNYMAPEALV-AMNYTQSSDNQHEGNKWKVGRPSDMWSC 641
           A A  +P +T +    +++ T  Y AP+ L+ + NY+ S D               MWSC
Sbjct: 183 ARAFGIPVNTFS----SEVVTLWYRAPDVLMGSRNYSTSID---------------MWSC 223

Query: 642 GCIIYQMIYGKPPYGSFQGQNRLLAIMN----------PDVKIPFPEYTS---------- 681
           GCI+ +MI GKP +     + +L  I            P +    P+Y+           
Sbjct: 224 GCILAEMIAGKPLFPGTNDEEQLKLIFELIGSPNEQNWPGIT-SLPKYSQTVIQPSQPKN 282

Query: 682 --------NNEKIPKSAIELMKACLYRNPDKRWTVDKVL 712
                     E +  + I+L+   L  NPD R +  + L
Sbjct: 283 LKHVLQPYTKELLDDNVIDLLNGLLQLNPDMRLSAQQAL 321

>NDAI0G04290 Chr7 complement(1030530..1033871) [3342 bp, 1113 aa]
           {ON} Anc_3.92
          Length = 1113

 Score = 90.1 bits (222), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 83/315 (26%), Positives = 144/315 (45%), Gaps = 43/315 (13%)

Query: 417 EIVEPAKSASSSNNRSMITVNDSQYEKIELLGRGGSSRVYKVKG--SGNKIYALKRXXXX 474
           EIV+P    ++   + +I      ++  E++G G  S V       SG K YA+K     
Sbjct: 149 EIVDPETGQTT---KQVIKKGIKDFKFGEMIGDGAYSTVLLATSIDSGKK-YAVKVLNKE 204

Query: 475 XXXXXXXXGFKG-EIELLEKLKDQRRVIQLLDYEMGDGLLYLIMECG-DHDLSQILNQRS 532
                    +   E   L++L + R +I+L      +  LY ++E   + D   ++ +  
Sbjct: 205 YLIRQKKVKYVNIEKIALQRLNNSRSIIRLFFTFQDEASLYFLLEYAPNGDFLSVMKKYG 264

Query: 533 NMPLDFNFVRFYTKEMLLCIKVVHDAGIVHSDLKPANFVLVKGI-LKIIDFGIANAVPEH 591
           +  L+     +Y  ++L  I  +H  GI+H D+KP N ++ K + +KI DFG A  + E 
Sbjct: 265 S--LNEECACYYGAQILDAIGFMHTRGIIHRDIKPENILMDKDMKVKITDFGTAKILDEK 322

Query: 592 T---------VNIYRETQIGTPNYMAPEALVAMNYTQSSDNQHEGNKWKVGRPSDMWSCG 642
           T         +    ++ +GT  Y++PE L+  NY+ S                D+W+ G
Sbjct: 323 TNGNNKTSYELLTRSKSFVGTAEYVSPE-LLNDNYSDSR--------------CDIWAFG 367

Query: 643 CIIYQMIYGKPPYGSFQGQNRLLAIMNPDVKIPFPEYTSNNEKIPKSAIELMKACLYRNP 702
           CI+YQMI GKPP   F+  N  L      +K+ +  +T+     P    +L+K  L + P
Sbjct: 368 CILYQMIAGKPP---FKATNEYLTFQKV-MKVQY-AFTAG---FPTIIRDLIKRILLKVP 419

Query: 703 DKRWTVDKVLSSTFL 717
           ++R T+ ++ S  F 
Sbjct: 420 EQRLTIGQIKSHLFF 434

>YPR054W Chr16 (666280..667446) [1167 bp, 388 aa] {ON}  SMK1Middle
           sporulation-specific mitogen-activated protein kinase
           (MAPK) required for production of the outer spore wall
           layers; negatively regulates activity of the glucan
           synthase subunit Gsc2p
          Length = 388

 Score = 87.8 bits (216), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 80/317 (25%), Positives = 140/317 (44%), Gaps = 57/317 (17%)

Query: 441 YEKIELLGRGGSSRVYKVKGSGNKI---YALKRXXXXXXXXXXXXGFKGEIELLEKLKDQ 497
           YE I+ LG+G    V  VK  G       A+K+                E++ +   K  
Sbjct: 38  YEIIQFLGKGAYGTVCSVKFKGRSPAARIAVKKISNIFNKEILLKRAIRELKFMNFFKGH 97

Query: 498 RRVIQLLDYEMG-----DGLLYLIMECGDHDLSQILNQRSNMPLDFNFVRFYTKEMLLCI 552
           + ++ L+D E+      DGL Y   E  D+DL+++++  S++ L    ++++  ++L  +
Sbjct: 98  KNIVNLIDLEIVTSSPYDGL-YCYQELIDYDLAKVIH--SSVQLSEFHIKYFLYQILCGL 154

Query: 553 KVVHDAGIVHSDLKPANFVL-VKGILKIIDFGIANAV------PEHTVNIYRETQIGTPN 605
           K +H A ++H DLKP N +  + G LKI DFG+A  +         TV  +    + T  
Sbjct: 155 KYIHSADVIHRDLKPGNILCTLNGCLKICDFGLARGIHAGFFKCHSTVQPHITNYVATRW 214

Query: 606 YMAPEALVAMNYTQSSDNQHEGNKWKVGRPSDMWSCGCIIYQMIYGKPPYGSFQGQNRLL 665
           Y APE L++        NQ         +  D+W+ GCI+ +    KP +      +++ 
Sbjct: 215 YRAPELLLS--------NQ------PYSKSVDIWAVGCILAEFYARKPVFMGRDSMHQIF 260

Query: 666 AIM------NPDVKIPFPEYTSNN----------EKIPKS---------AIELMKACLYR 700
            I+      + D+ I F    + N          +KIP S         AI L+++ L+ 
Sbjct: 261 EIIKVLGTPDKDILIKFGTIKAWNLGKNSNNPVYKKIPWSNIFPFASHEAINLIESLLHW 320

Query: 701 NPDKRWTVDKVLSSTFL 717
           +   R  V++ +S  FL
Sbjct: 321 DSTHRLNVEQAISHPFL 337

>YOL100W Chr15 (129237..132482) [3246 bp, 1081 aa] {ON}
           PKH2Serine/threonine protein kinase involved in
           sphingolipid-mediated signaling pathway that controls
           endocytosis; activates Ypk1p and Ykr2p, components of
           signaling cascade required for maintenance of cell wall
           integrity; redundant with Pkh1p
          Length = 1081

 Score = 90.1 bits (222), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 68/244 (27%), Positives = 115/244 (47%), Gaps = 38/244 (15%)

Query: 487 EIELLEKLKDQRRVIQLLDYEMGDGLLYLIMECG-DHDLSQILNQRSNMPLDFNFVRFYT 545
           E   L+KL +   V++L      +  LY ++E   + D   ++ +  +  LD    R+Y 
Sbjct: 227 EKTALQKLNNSPSVVRLFSTFQDESSLYFLLEYAPNGDFLSLMKKYGS--LDETCARYYA 284

Query: 546 KEMLLCIKVVHDAGIVHSDLKPANFVLVKGILKI--IDFGIA-------NAV--PEHTVN 594
            +++  I  +H  GI+H D+KP N +L+ G +KI   DFG A       N+V  PE+ ++
Sbjct: 285 AQIIDAIDYLHSNGIIHRDIKPEN-ILLDGEMKIKLTDFGTAKLLNPTNNSVSKPEYDLS 343

Query: 595 IYRETQIGTPNYMAPEALVAMNYTQSSDNQHEGNKWKVGRPSDMWSCGCIIYQMIYGKPP 654
              ++ +GT  Y++PE L               N        D+W+ GCI++QMI GKPP
Sbjct: 344 TRSKSFVGTAEYVSPELL---------------NDSFTDYRCDIWAFGCILFQMIAGKPP 388

Query: 655 YGSFQGQNRLLAIMNPDVKIPFPEYTSNNEKIPKSAIELMKACLYRNPDKRWTVDKVLSS 714
              F+  N  L       K+   +Y +     P    +L+K  L +N D+R T+ ++   
Sbjct: 389 ---FKATNEYLTFQ----KVMKVQY-AFTPGFPLIIRDLVKKILVKNLDRRLTISQIKEH 440

Query: 715 TFLQ 718
            F +
Sbjct: 441 HFFK 444

>CAGL0K02673g Chr11 complement(241338..244085) [2748 bp, 915 aa]
           {ON} similar to uniprot|Q03497 Saccharomyces cerevisiae
           YHL007c STE20 Serine/threonine-protein kinase
          Length = 915

 Score = 89.7 bits (221), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 63/237 (26%), Positives = 110/237 (46%), Gaps = 27/237 (11%)

Query: 500 VIQLLDYEMGDGLLYLIMECGDHDLSQILNQRSNMPLDFNFVRFYTKEMLLCIKVVHDAG 559
           ++  +D  +  G L+++ME  +     + +  ++  L    +    +E L  ++ +H  G
Sbjct: 677 IVNFIDSYLAKGDLWIVMEYMEG--GSLTDVVTHCLLSEGQIGAVCRETLKGLQFLHSKG 734

Query: 560 IVHSDLKPANFVL-VKGILKIIDFGIANAVPEHTVNIYRETQIGTPNYMAPEALVAMNYT 618
           ++H D+K  N +L +KG +K+ DFG    + E+  N+ R T +GTP +MAPE +    Y 
Sbjct: 735 VLHRDIKSDNILLSLKGNIKLTDFGFCAQINEN--NLKRTTMVGTPYWMAPEVVSRKEY- 791

Query: 619 QSSDNQHEGNKWKVGRPSDMWSCGCIIYQMIYGKPPYGSFQGQNRL-LAIMNPDVKIPFP 677
                         G   D+WS G +I +MI G+PPY +      L L   N   K+  P
Sbjct: 792 --------------GPKVDIWSLGIMIIEMIEGEPPYLNETPLRALYLIATNGTPKLKEP 837

Query: 678 EYTSNNEKIPKSAIELMKACLYRNPDKRWTVDKVLSSTFLQPFMISGSIMEDLIKNA 734
           E  S+      +  + +  CL  +P +R T  ++L   F+       S +  L+K A
Sbjct: 838 EALSD------TLTKFLDWCLKVDPSERATATELLDDPFITEIAEDNSSLSPLVKLA 888

>Kwal_26.7861 s26 complement(544126..546993) [2868 bp, 955 aa] {ON}
           YHL007C (STE20) - serine/threonine protein kinase
           [contig 55] FULL
          Length = 955

 Score = 89.7 bits (221), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 75/299 (25%), Positives = 132/299 (44%), Gaps = 35/299 (11%)

Query: 441 YEKIELLGRGGSSRVYKVKGSG-NKIYALKRXXXXXXXXXXXXGFKGEIELLEKLKDQRR 499
           Y+ +  +G+G S  VY     G N   A+K+                EI L+ K      
Sbjct: 667 YKNLIKIGQGASGGVYTAYEVGTNASVAIKQMNLEKQPKKEL--IINEI-LVMKASKHAN 723

Query: 500 VIQLLDYEMGDGLLYLIMECGDHDLSQILNQRSNMPLDFNFVRFYTKEMLLCIKVVHDAG 559
           ++  +D  +  G L+++ME    +   + +  ++  L    +   ++E L  ++ +H  G
Sbjct: 724 IVNFIDSYLLRGDLWVVMEY--MEGGSLTDVVTHCILTEGQIGAVSRETLKGLQFLHSKG 781

Query: 560 IVHSDLKPANFVL-VKGILKIIDFGIANAVPEHTVNIYRETQIGTPNYMAPEALVAMNYT 618
           ++H D+K  N +L + G +K+ DFG    + E  +N+ R T +GTP +MAPE +    Y 
Sbjct: 782 VIHRDIKSDNVLLSMSGEIKLTDFGFCAQINE--INLKRTTMVGTPYWMAPEVVSRKEY- 838

Query: 619 QSSDNQHEGNKWKVGRPSDMWSCGCIIYQMIYGKPPYGSFQGQNRLLAIM---NPDVKIP 675
                         G   D+WS G +I +MI G+PPY +      L  I     P++K  
Sbjct: 839 --------------GPKVDIWSLGIMIIEMIEGEPPYLNETPLRALYLIATNGTPELK-- 882

Query: 676 FPEYTSNNEKIPKSAIELMKACLYRNPDKRWTVDKVLSSTFLQPFMISGSIMEDLIKNA 734
                 + + +       +  CL+ NPD+R T  ++LS  F+  +      +  L+K A
Sbjct: 883 ------DADSLSDDLKSFLGWCLHVNPDERATASQLLSDPFISTYADHVRSLAPLVKLA 935

>CAGL0G04609g Chr7 complement(437162..440059) [2898 bp, 965 aa] {ON}
           similar to uniprot|Q12236 Saccharomyces cerevisiae
           YOL100w PKH2
          Length = 965

 Score = 89.7 bits (221), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 79/292 (27%), Positives = 130/292 (44%), Gaps = 54/292 (18%)

Query: 436 VNDSQYEKIELL-GRGGSSRVYKVKGSGNKIYALKRXXXX-----XXXXXXXXGFKGEIE 489
           + D  Y ++ L   +  SS+ Y VK   NK Y +K+                    G I 
Sbjct: 124 LGDGSYSQVFLATSKTDSSKTYAVK-VLNKEYLIKQKKVKYVNIEKTALQNLKSVTGVIN 182

Query: 490 LLEKLKDQRRVIQLLDYEMGDGLLYLIMECGDHDLSQILNQRSNMPLDFNFVRFYTKEML 549
           L    +D+  +  LL+Y      L LI + G       LN+   +        +Y+ +++
Sbjct: 183 LSFTFQDEANLYFLLEYAPNGDFLSLIKKFG------TLNEECTI--------YYSAQII 228

Query: 550 LCIKVVHDAGIVHSDLKPANFVLVKGI-LKIIDFGIA---------NAVPEHTVNIYRET 599
             I  +H  GI+H D+KP N +L   + +K+ DFG A         N  P + +     +
Sbjct: 229 DAIGSMHSHGIIHRDIKPENILLDGNMKIKLTDFGTAKLLQKKSDKNGKPHYNLLTRSSS 288

Query: 600 QIGTPNYMAPEALVAMNYTQSSDNQHEGNKWKVGRPSDMWSCGCIIYQMIYGKPPYGSFQ 659
            +GT  Y++PE L++ NYT           +K     D+W+ GC++YQMI GKPP   F+
Sbjct: 289 FVGTAEYVSPE-LLSDNYTD----------YKC----DIWAFGCLVYQMIAGKPP---FK 330

Query: 660 GQNRLLAIMNPDVKIPFPEYTSNNEKIPKSAIELMKACLYRNPDKRWTVDKV 711
             N  L      +K+ F  +T+     P    +L+K  L + P+KR T+ ++
Sbjct: 331 ATNEYLTFQKV-MKVQF-AFTAG---FPTIIRDLVKNILVKQPEKRLTIPQI 377

>CAGL0M08404g Chr13 complement(836791..838179) [1389 bp, 462 aa]
           {ON} some similarities with uniprot|P05986 Saccharomyces
           cerevisiae YKL166c TPK3 or uniprot|P06244 Saccharomyces
           cerevisiae YJL164c SRA3 or uniprot|P06245 Saccharomyces
           cerevisiae YPL203w TPK2
          Length = 462

 Score = 88.2 bits (217), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 71/264 (26%), Positives = 113/264 (42%), Gaps = 51/264 (19%)

Query: 427 SSNNRSMITVNDSQYEKIELLGRGGSSRVYKVKGSGN-KIYALKRXXXXXXXXXXXXGFK 485
            +N     T++D  ++ +  LG G   RV+ ++ + N + YALK                
Sbjct: 140 GANTSGKYTLSD--FQILRTLGTGSFGRVHLIRSNHNGRFYALKALKKHTVVKLKQVEHT 197

Query: 486 GE-------------IELLEKLKDQRRVIQLLDYEMGDGLLYLIMECGDHDLSQILNQRS 532
            +             I +    +D + V  ++DY  G  L  L+ +          +QR 
Sbjct: 198 NDERRMLSIVSHPFIIRMWGTFQDSQHVFMVMDYIEGGELFSLLRK----------SQRF 247

Query: 533 NMPLDFNFVRFYTKEMLLCIKVVHDAGIVHSDLKPANFVLVK-GILKIIDFGIANAVPEH 591
             P+     +FY  E+ L ++ +H   I++ DLKP N +L K G +KI DFG A  VP+ 
Sbjct: 248 PNPV----AKFYAAEVCLALEYLHSKEIIYRDLKPENILLDKNGHIKITDFGFAKYVPDV 303

Query: 592 TVNIYRETQIGTPNYMAPEALVAMNYTQSSDNQHEGNKWKVGRPSDMWSCGCIIYQMIYG 651
           T      T  GTP+Y+APE +    Y +S D       W        WS G +IY+M+ G
Sbjct: 304 TY-----TLCGTPDYIAPEVVSTKPYNKSVD-------W--------WSFGILIYEMLAG 343

Query: 652 KPPYGSFQGQNRLLAIMNPDVKIP 675
             P+           I+N ++K P
Sbjct: 344 YTPFYDANTMKTYEHILNSELKFP 367

>TBLA0B08250 Chr2 complement(1968879..1972922) [4044 bp, 1347 aa]
           {ON} Anc_3.92 YDR490C
          Length = 1347

 Score = 89.7 bits (221), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 73/299 (24%), Positives = 130/299 (43%), Gaps = 56/299 (18%)

Query: 436 VNDSQYEKIELLGRGGSSRVYKVKGSGNKIYALKRXXXXX------XXXXXXXGFKGEIE 489
           + D  Y  + L+    +++ + +K   NK Y +K+                     G I+
Sbjct: 265 IGDGSYSTVNLVKSKETNKTFAIK-ILNKKYLIKQKKVKYVNIEKIALQKLNNSINGIIK 323

Query: 490 LLEKLKDQRRVIQLLDYEMGDGLLYLIMECGDHDLSQILNQRSNMPLDFNFVRFYTKEML 549
           L    +D+  +  LL+Y     LL L+ + G  D +  +              ++T +++
Sbjct: 324 LYCTFQDEANLYFLLEYASNGDLLTLLKKYGSFDETSTI--------------YFTAQII 369

Query: 550 LCIKVVHDAGIVHSDLKPANFVLVKGI-LKIIDFGIANAVPEHT---------VNIYRET 599
             I  +H  GI+H D+KP N +L K   +K+ DFG A  +              N+   +
Sbjct: 370 DSIHYIHSMGIIHRDIKPENILLTKDFKIKLTDFGTAKILDPSQPSQSQSQPHFNLLERS 429

Query: 600 Q--IGTPNYMAPEALVAMNYTQSSDNQHEGNKWKVGRPSDMWSCGCIIYQMIYGKPPYGS 657
           +  +GT  Y++PE L+  +YT S                D+W+ GCI++Q+I GKPP   
Sbjct: 430 KSFVGTAEYVSPE-LLTDSYTDSR--------------CDIWAFGCILFQLIAGKPP--- 471

Query: 658 FQGQNRLLAIMNPDVKIPFPEYTSNNEKIPKSAIELMKACLYRNPDKRWTVDKVLSSTF 716
           F+  N  L      +K+ +  +T+     P    +L+K  L +NP+ R T+ ++ S  F
Sbjct: 472 FKATNEYLTFQK-IIKLQY-AFTAG---FPTILRDLIKKILIKNPNNRLTIHQIKSHLF 525

>Sklu_YGOB_Anc_2.496 Chr5 (185447..187306) [1860 bp, 619 aa] {ON}
           ANNOTATED BY YGOB -
          Length = 619

 Score = 89.0 bits (219), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 79/297 (26%), Positives = 130/297 (43%), Gaps = 31/297 (10%)

Query: 441 YEKIELLGRGGSSRVYKVKGSG-NKIYALKRXXXXXXXXXXXXGFKGEIELLEKLKDQRR 499
           Y  +  +G+G S  VY     G N   A+K+                EI L+ K      
Sbjct: 329 YRNLIKIGQGASGGVYTAYELGTNASVAIKQMNLEKQPKKEL--IINEI-LVMKGSKHSN 385

Query: 500 VIQLLDYEMGDGLLYLIMECGDHDLSQILNQRSNMPLDFNFVRFYTKEMLLCIKVVHDAG 559
           ++  +D  +  G L+++ME    +   + +  ++  L    +    +E L  ++ +H  G
Sbjct: 386 IVNFIDSYLLKGDLWVVMEY--MEGGSLTDVVTHCILTEGQIGAVCRETLKGLQFLHSKG 443

Query: 560 IVHSDLKPANFVL-VKGILKIIDFGIANAVPEHTVNIYRETQIGTPNYMAPEALVAMNYT 618
           ++H D+K  N +L + G +K+ DFG    + E  VN+ R T +GTP +MAPE +    Y 
Sbjct: 444 VIHRDIKSDNILLSMNGDIKLTDFGFCAQINE--VNLKRTTMVGTPYWMAPEVVSRKEY- 500

Query: 619 QSSDNQHEGNKWKVGRPSDMWSCGCIIYQMIYGKPPYGSFQGQNRL-LAIMNPDVKIPFP 677
                         G   D+WS G +I +MI G+PPY +      L L   N   K+  P
Sbjct: 501 --------------GPKVDIWSLGIMIIEMIEGEPPYLNETPLRALYLIATNGTPKLKDP 546

Query: 678 EYTSNNEKIPKSAIELMKACLYRNPDKRWTVDKVLSSTFLQPFMISGSIMEDLIKNA 734
           E  S+  K      E +  CL  +P+ R    ++LS TF+  +      +  L+K A
Sbjct: 547 ENLSDTLK------EFLGWCLKVDPEDRANAAELLSGTFISTYAEKNECLAPLVKLA 597

>KLLA0E21693g Chr5 complement(1936438..1939488) [3051 bp, 1016 aa]
           {ON} weakly similar to uniprot|P38692 Saccharomyces
           cerevisiae YHR102W KIC1 Protein kinase of the PAK/Ste20
           kinase family required for cell integrity possibly
           through regulating 1 6-beta-glucan levels in the wall
           physically interacts with Cdc31p (centrin) which is a
           component of the spindle pole body
          Length = 1016

 Score = 89.7 bits (221), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 77/314 (24%), Positives = 141/314 (44%), Gaps = 30/314 (9%)

Query: 439 SQYEKIELLGRGGSSRVYKV-KGSGNKIYALKRXXXXXXXXXXXXGFKGEIELLEKLKDQ 497
           S +++ E++GRG    VYK       ++YA+K               + EI+ L  LK  
Sbjct: 14  SLFKRKEIIGRGKFGVVYKAFHVKTQQVYAIK-VLNLDNTEDEVEDIRKEIQFLSSLKQT 72

Query: 498 RRVIQLLDYEMGDGLLYLIME-CGDHDLSQILNQRSNMPLDFNFVRFYTKEMLLCIKVVH 556
             +       + D  L++IME C    L  +L  R  + ++  ++    +E+L+ +  +H
Sbjct: 73  PNITHYYGSYLIDTKLWVIMEYCAGGSLRTLL--RPGI-IEEKYIGVIMREILVALISIH 129

Query: 557 DAGIVHSDLKPANFVLVK-GILKIIDFGIANAVPEHTVNIYRETQIGTPNYMAPEALVAM 615
              ++H D+K AN ++   G +K+ DFG+A  + +  +   R+T  GTP +MAPE ++  
Sbjct: 130 RDNVIHRDIKAANILIANNGSVKLCDFGVAAQLSQSMLK--RQTMAGTPYWMAPEVIMEG 187

Query: 616 NYTQSSDNQHEGNKWKVGRPSDMWSCGCIIYQMIYGKPPYGSFQGQNRLLAIMNPDVKIP 675
            Y  +          KV    D+WS G   Y++  G PPY   +    +  I     K P
Sbjct: 188 VYYDT----------KV----DIWSLGITAYEIATGNPPYCHMEAIRAMQMITK--SKPP 231

Query: 676 FPEYTSNNEKIPKSAIELMKACLYRNPDKRWTVDKVLSSTFL-QPFMISGSIMEDLIKNA 734
             E    ++ +     E +  CL  +P +R   +++  S  + Q    S  I+++LI   
Sbjct: 232 RLEGREYSQPLK----EFIALCLDEDPKERPYAEELFKSKLIKQEKGTSTVILKELITRY 287

Query: 735 VRYGSEKPQISHDD 748
           + +  +  Q  H++
Sbjct: 288 LLFREKNEQYKHEE 301

>YKL166C Chr11 complement(134509..135705) [1197 bp, 398 aa] {ON}
           TPK3cAMP-dependent protein kinase catalytic subunit;
           promotes vegetative growth in response to nutrients via
           the Ras-cAMP signaling pathway; partially redundant with
           Tpk1p and Tpk2p; localizes to P-bodies during stationary
           phase
          Length = 398

 Score = 87.4 bits (215), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 69/252 (27%), Positives = 110/252 (43%), Gaps = 49/252 (19%)

Query: 439 SQYEKIELLGRGGSSRVYKVKGSGN-KIYALKRXXXXXXXXXXXXGFKGE---------- 487
           S ++ +  LG G   RV+ ++ + N + YALK                 +          
Sbjct: 86  SDFQILRTLGTGSFGRVHLIRSNHNGRFYALKTLKKHTIVKLKQVEHTNDERRMLSIVSH 145

Query: 488 ---IELLEKLKDQRRVIQLLDYEMGDGLLYLIMECGDHDLSQILNQRSNMPLDFNFVRFY 544
              I +    +D ++V  ++DY  G  L  L+ +          +QR   P+     +FY
Sbjct: 146 PFIIRMWGTFQDSQQVFMVMDYIEGGELFSLLRK----------SQRFPNPV----AKFY 191

Query: 545 TKEMLLCIKVVHDAGIVHSDLKPANFVLVK-GILKIIDFGIANAVPEHTVNIYRETQIGT 603
             E+ L ++ +H   I++ DLKP N +L K G +KI DFG A  VP+ T      T  GT
Sbjct: 192 AAEVCLALEYLHSKDIIYRDLKPENILLDKNGHIKITDFGFAKYVPDVTY-----TLCGT 246

Query: 604 PNYMAPEALVAMNYTQSSDNQHEGNKWKVGRPSDMWSCGCIIYQMIYGKPPYGSFQGQNR 663
           P+Y+APE +    Y +S D       W        WS G +IY+M+ G  P+ +      
Sbjct: 247 PDYIAPEVVSTKPYNKSVD-------W--------WSFGVLIYEMLAGYTPFYNSNTMKT 291

Query: 664 LLAIMNPDVKIP 675
              I+N ++K P
Sbjct: 292 YENILNAELKFP 303

>Suva_3.190 Chr3 (288639..288813,288870..291766) [3072 bp, 1024 aa]
           {ON} YDR507C (REAL)
          Length = 1024

 Score = 89.4 bits (220), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 67/230 (29%), Positives = 107/230 (46%), Gaps = 25/230 (10%)

Query: 493 KLKDQRRVIQLLDYEMGDGLLYLIMECGDH-DLSQILNQRSNMPLDFNFVRFYTKEMLLC 551
           KL     V+ L D    +  LYLI+E  +  +L  +L  R  +P +   V+ + +++++ 
Sbjct: 74  KLLSHPNVLSLYDVWETNNNLYLILEYAEKGELFNLLVDRGPLP-EKEAVKCF-RQIIIA 131

Query: 552 IKVVHDAGIVHSDLKPANFVLVKGI-LKIIDFGIANAVPEHTVNIYRETQIGTPNYMAPE 610
           I   H  GIVH DLKP N +L     +KI DFG+A      T     ET  G+P+Y APE
Sbjct: 132 ISYCHALGIVHRDLKPENLLLDNDYNIKIADFGMAAL---QTDARLLETSCGSPHYAAPE 188

Query: 611 ALVAMNYTQSSDNQHEGNKWKVGRPSDMWSCGCIIYQMIYGKPPYGSFQGQNRLLAIMNP 670
            +  + Y               G  SD+WSCG I++ ++ G+ P+    G  R L +   
Sbjct: 189 IVSGLPYR--------------GFASDVWSCGVILFALLTGRLPFDEDNGNVRDLLLKVQ 234

Query: 671 DVKIPFPEYTSNNEKIPKSAIELMKACLYRNPDKRWTVDKVLSSTFLQPF 720
             +   P+ T    +I K A  L+   L  +P +R     +L+   L+ +
Sbjct: 235 RGQFEMPDAT----EISKDAQNLISRILVVDPTQRMKTRDILTHPLLKKY 280

>YOL113W Chr15 (104326..106293) [1968 bp, 655 aa] {ON}  SKM1Member
           of the PAK family of serine/threonine protein kinases
           with similarity to Ste20p and Cla4p; involved in
           down-regulation of sterol uptake; proposed to be a
           downstream effector of Cdc42p during polarized growth
          Length = 655

 Score = 89.0 bits (219), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 71/234 (30%), Positives = 112/234 (47%), Gaps = 38/234 (16%)

Query: 497 QRRVIQLLD-YEMGDGLLYLIMECGDHD-LSQILNQ--RSNM-----PLDFNFVRFYTKE 547
           Q  ++  L+ Y + D  L++IME  +   L+ IL+   RSN      PL+ N + +  KE
Sbjct: 431 QENIVNFLEAYIIDDEELWVIMEYMEGGCLTDILDAVARSNTGEHSSPLNENQMAYIVKE 490

Query: 548 MLLCIKVVHDAGIVHSDLKPANFVL-VKGILKIIDFGIANAVPEHTVNIYRETQIGTPNY 606
               +K +H+  I+H D+K  N +L  +G++KI DFG    + E      R T +GTP +
Sbjct: 491 TCQGLKFLHNKKIIHRDIKSDNILLNSQGLVKITDFGFCVELTEKRSK--RATMVGTPYW 548

Query: 607 MAPEALVAMNYTQSSDNQHEGNKWKVGRPSDMWSCGCIIYQMIYGKPPYGSFQGQNRLLA 666
           MAPE +    Y +                 D+WS G ++ +MI G+PPY +      L  
Sbjct: 549 MAPEIVNQKGYDEK---------------VDVWSLGIMLIEMIEGEPPYLNEDPLKALYL 593

Query: 667 IMN---PDVKIPFPEYTSNNEKIPKSAIELMKACLYRNPDKRWTVDKVLSSTFL 717
           I N   P ++ P        E + K   + + ACL  N + R +V K+L+  FL
Sbjct: 594 IANNGSPKLRHP--------ESVSKQTKQFLDACLQVNVESRASVRKLLTFEFL 639

>Suva_6.169 Chr6 complement(300200..304654) [4455 bp, 1484 aa] {ON}
            YJL095W (REAL)
          Length = 1484

 Score = 89.7 bits (221), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 83/321 (25%), Positives = 141/321 (43%), Gaps = 40/321 (12%)

Query: 441  YEKIELLGRGGSSRVY-KVKGSGNKIYALKR------XXXXXXXXXXXXGFKGEIELLEK 493
            + K E++G+G    VY  +  +  ++ A+K+                    + E+  L+ 
Sbjct: 1181 WMKGEMIGKGSFGAVYLCLNVTTGEMMAVKQVEVPKYSSQNEAILSTVEALRSEVSTLKD 1240

Query: 494  LKDQRRVIQLLDYEMGDGLLYLIME--CGDHDLSQILNQRSNMPLDFNFVRFYTKEMLLC 551
            L D   ++Q L +E  + +  L +E   G    S I   R     D + ++  T ++L  
Sbjct: 1241 L-DHLNIVQYLGFENKNSIYSLFLEYVAGGSVGSLI---RMYGRFDESLIKHLTTQVLRG 1296

Query: 552  IKVVHDAGIVHSDLKPANFVLVK-GILKIIDFGIANAVPEHTVNIYRETQI---GTPNYM 607
            +  +H  GI+H D+K  N +L + GI KI DFGI+      + +IY  + +   GT  +M
Sbjct: 1297 LAYLHSKGILHRDMKADNLLLDQDGICKISDFGIS----RKSKDIYSNSDMTMRGTVFWM 1352

Query: 608  APEALVAMNYTQSSDNQHEGNKWKVGRPSDMWSCGCIIYQMIYGKPPYGSFQGQNRLLAI 667
            APE +          +  +G   KV    D+WS GCI+ +M  GK P+ + +    +  I
Sbjct: 1353 APEMV----------DTKQGYSAKV----DIWSLGCIVLEMFAGKRPWSNLEVVAAMFKI 1398

Query: 668  MNPDVKIPFPEYTSNNEKIPKSAIELMKACLYRNPDKRWTVDKVLSSTFLQ---PFMISG 724
                   P PE T     I +     + AC   +P+KR T  K+LS  F +    F    
Sbjct: 1399 GKSKSAPPIPEDTL--PLITRVGRSFLDACFEIDPEKRPTATKLLSHQFSEVDVTFDFKS 1456

Query: 725  SIMEDLIKNAVRYGSEKPQIS 745
            + +   IK+  +  S K +I+
Sbjct: 1457 TTLAKFIKSNDKLNSSKLRIT 1477

>ADL315C Chr4 complement(146096..147400) [1305 bp, 434 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPR054W
           (SMK1)
          Length = 434

 Score = 87.8 bits (216), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 84/346 (24%), Positives = 151/346 (43%), Gaps = 73/346 (21%)

Query: 418 IVEPAKSASSSNNRSMITVNDSQYEKIELLGRGGSSRVYKVKGSGNKIY----ALKRXXX 473
           +V P ++  +  N S+       YE +++LG+G    V     + N  Y    A+K+   
Sbjct: 54  VVHPPRTIYTKANFSI----PGHYEVLQMLGKGSYGTVVSAIDNLNANYPIRIAIKKITN 109

Query: 474 XXXXXXXXXGFKGEIELLEKLKDQRRVIQLLDYEMG-----DGLLYLIMECGDHDLSQIL 528
                        E++ +   K  + ++ L++ E+      DGL Y   E  D+DL++++
Sbjct: 110 IFQREVLLKRAIRELKFMHYFKGHKNIVSLINLEIVNEKPYDGL-YCYQELIDYDLARVI 168

Query: 529 NQRSNMPLDFNFVRFYTKEMLLCIKVVHDAGIVHSDLKPANFVL-VKGILKIIDFGIANA 587
           +  SN+      ++ +T ++L  +K +H A ++H DLKP N +  + G LKI DFG+A  
Sbjct: 169 H--SNVQFSEFHIKHFTYQILCGVKYIHSADVIHRDLKPGNILCSISGQLKICDFGLARG 226

Query: 588 VPEHTVNIYRETQI----GTPNYMAPEALVAMNYTQSSDNQHEGNKWKVGRPSDMWSCGC 643
           +     N      I     T  Y APE +++                +  +  DMW+ GC
Sbjct: 227 ISPLFTNTKTSNHITNYVATRWYRAPELILSHK--------------RYNKSIDMWAIGC 272

Query: 644 IIYQMIYGKPPYGSFQGQN---------RLLAIMNPDVKI-------------PFPEYTS 681
           I+ +  YG+ P   F GQ+         ++L   + D  I             P P+Y  
Sbjct: 273 ILAEF-YGRKPI--FMGQDSMHQISEIVKVLGTPSRDTIIKYGSSRAYDIFCPPKPQYA- 328

Query: 682 NNEKIPKS---------AIELMKACLYRNPDKRWTVDKVLSSTFLQ 718
              KIP +         A++L++  L  +PD+R TV++ +   F++
Sbjct: 329 ---KIPWAEIYPFAGPDALDLIERLLDWDPDRRLTVEEAIEHDFVK 371

>TDEL0A07560 Chr1 complement(1316498..1321225) [4728 bp, 1575 aa] {ON}
            Anc_6.341 YNR031C
          Length = 1575

 Score = 89.7 bits (221), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 84/328 (25%), Positives = 142/328 (43%), Gaps = 59/328 (17%)

Query: 425  ASSSNNRSMITVNDSQYEKIELLGRGGSSRVY-KVKGSGNKIYALK--RXXXXXXXXXXX 481
            ASS +N SM      +++K   +G G    VY  V     +I A+K  +           
Sbjct: 1253 ASSISNVSM------RWQKRNFVGGGTFGTVYSAVNLDNGEILAVKEIKIQDANAMKKFF 1306

Query: 482  XGFKGEIELLEKLKDQRRVIQLLDYEMGDGLLYLIME-CGDHDLSQILNQRSNMPLDFNF 540
               K E+ +LE L     V+Q    E+    + + ME C    ++ +L        D   
Sbjct: 1307 PSIKEEMSVLEMLS-HPNVVQYYGVEVHRDKVNIFMEYCEGGSMASLLEH--GRIEDEMV 1363

Query: 541  VRFYTKEMLLCIKVVHDAGIVHSDLKPANFVL-VKGILKIIDFGIANAVPEHTVN----- 594
             + YT E+L  +  +H +G+VH D+KP N +L   GI+K +DFG A  + ++  +     
Sbjct: 1364 TQVYTLELLEGLAYLHQSGVVHRDIKPENILLDFNGIIKYVDFGAAKKIAKNGTDTRGFA 1423

Query: 595  --------------------IYRETQIGTPNYMAPEALVAMNYTQSSDNQHEGNKWKVGR 634
                                +  +  +GTP YMAPE++               NK ++G 
Sbjct: 1424 RSVASDSSTGSADNTSEQDGLALQDMMGTPMYMAPESITG-----------SPNKGRLG- 1471

Query: 635  PSDMWSCGCIIYQMIYGKPPYGSFQGQNRLLAIMNPDVKIPFPEYTSNNEKIPKSAIELM 694
              D+WS GC+I +MI G+ P+     +    AIM        P+  SN+E +  +  + +
Sbjct: 1472 ADDIWSLGCVILEMITGRRPWAKLDNE---WAIMYHVAAGHIPQLPSNDE-VSSAGKKFL 1527

Query: 695  KACLYRNPDKRWTVDKVLSSTFLQPFMI 722
            + CL  NP KR +  ++L    + P+++
Sbjct: 1528 RRCLQENPFKRASAVELL----MDPWIV 1551

>KAFR0A01760 Chr1 complement(363462..366119) [2658 bp, 885 aa] {ON}
           Anc_2.496 YHL007C
          Length = 885

 Score = 89.4 bits (220), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 69/251 (27%), Positives = 114/251 (45%), Gaps = 35/251 (13%)

Query: 490 LLEKLKDQRRVIQLLDYEMGDGLLYLIME-CGDHDLSQILNQRSNMPLDFNFVRFYTKEM 548
           L+ K      ++  +D    +G L++IME      L+ ++   ++  L    +   T+E 
Sbjct: 612 LVMKASRHENIVNFIDSYFLNGNLWVIMEYMKGGSLTDVV---THCILTEQQISTVTRET 668

Query: 549 LLCIKVVHDAGIVHSDLKPANFVL-VKGILKIIDFGIANAVPEHTVNIYRETQIGTPNYM 607
           L  ++ +H  G++H D+K  N +L + G +K+ DFG    + E  +N+ R T +GTP +M
Sbjct: 669 LNGLRFLHSKGVIHRDIKSDNVLLSLSGDIKLTDFGFCAQINE--INLKRTTMVGTPYWM 726

Query: 608 APEALVAMNYTQSSDNQHEGNKWKVGRPSDMWSCGCIIYQMIYGKPPYGSFQGQNRLLAI 667
           APE +    Y               G   D+WS G +I +MI G+PPY +      L  I
Sbjct: 727 APEVVSRKEY---------------GPKVDIWSLGIMIIEMIEGEPPYLNETPLRALYLI 771

Query: 668 MNPDVKIPFPEYTSNNEKIPKSAIELMKA----CLYRNPDKRWTVDKVLSSTFLQPFMIS 723
                    PE      K P S  E +KA    CL  +P +R +  ++L+  F+  F   
Sbjct: 772 ATNGT----PEL-----KDPDSLSECLKAFLDWCLKVDPHERASATELLNDRFIVEFSEK 822

Query: 724 GSIMEDLIKNA 734
              +  L+K A
Sbjct: 823 TETLSPLVKLA 833

>Smik_10.147 Chr10 (239101..243537) [4437 bp, 1478 aa] {ON} YJL095W
            (REAL)
          Length = 1478

 Score = 89.4 bits (220), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 79/290 (27%), Positives = 130/290 (44%), Gaps = 39/290 (13%)

Query: 441  YEKIELLGRGGSSRVY-KVKGSGNKIYALKR------XXXXXXXXXXXXGFKGEIELLEK 493
            + K E++G+G    VY  +  +  ++ A+K+                    + E+  L+ 
Sbjct: 1175 WMKGEMIGKGSFGAVYLCLNVTTGEMMAVKQVEVPKYSSQNEAILSTVEALRSEVSTLKD 1234

Query: 494  LKDQRRVIQLLDYEMGDGLLYLIME--CGDHDLSQI-LNQRSNMPLDFNFVRFYTKEMLL 550
            L D   ++Q L +E  D +  L +E   G    S I +  R + PL    ++  T ++L 
Sbjct: 1235 L-DHLNIVQYLGFENKDNIYSLFLEYVAGGSVGSLIRMYGRFDEPL----IKHLTTQVLK 1289

Query: 551  CIKVVHDAGIVHSDLKPANFVLVK-GILKIIDFGIANAVPEHTVNIYRETQI---GTPNY 606
             +  +H  GI+H D+K  N +L + GI KI DFGI+      + +IY  + +   GT  +
Sbjct: 1290 GLAYLHSKGILHRDMKADNLLLDQDGICKISDFGIS----RKSKDIYSNSDMTMRGTVFW 1345

Query: 607  MAPEALVAMNYTQSSDNQHEGNKWKVGRPSDMWSCGCIIYQMIYGKPPYGSFQGQNRLLA 666
            MAPE +          +  +G   KV    D+WS GCI+ +M  GK P+ + +    +  
Sbjct: 1346 MAPEMV----------DTKQGYSAKV----DIWSLGCIVLEMFAGKRPWSNLEVVAAMFK 1391

Query: 667  IMNPDVKIPFPEYTSNNEKIPKSAIELMKACLYRNPDKRWTVDKVLSSTF 716
            I       P PE T     I +     + AC   NP+KR T  ++LS  F
Sbjct: 1392 IGKSKSAPPIPEDTL--PLISQVGRGFLDACFEINPEKRPTATELLSHRF 1439

>Ecym_5505 Chr5 (1027605..1030616) [3012 bp, 1003 aa] {ON} similar
           to Ashbya gossypii ACL104C
          Length = 1003

 Score = 89.4 bits (220), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 78/306 (25%), Positives = 137/306 (44%), Gaps = 33/306 (10%)

Query: 441 YEKIELLGRGGSSRVYKVKGSGNK-IYALKRXXXXXXXXXXXXGFKGEIELLEKLKDQRR 499
           + + E++GRG    VYK      K +YA+K               + E++ L  LK    
Sbjct: 23  FRRTEIVGRGKFGVVYKAYHVKTKQVYAIK-VLNLDCPEDEVEDVQKEVQFLSSLKQVPN 81

Query: 500 VIQLLDYEMGDGLLYLIME-CGDHDLSQILNQRSNMPLDFNFVRFYTKEMLLCIKVVHDA 558
           + Q     + +  L++IME C    L  +L       +D  ++    + +L+ +  +H  
Sbjct: 82  ITQYYGSFLYETKLWVIMEYCAGGSLRTLLRPGK---IDEKYLGVIVRNLLVALLYIHKD 138

Query: 559 GIVHSDLKPANFVLVKGI-LKIIDFGIANAVPEHTVNIYRETQIGTPNYMAPEALVAMNY 617
            ++H D+K AN ++  G  +K+ DFG+A  +   T N  R+T  GTP +MAPE ++   Y
Sbjct: 139 NVIHRDIKAANVLITNGGHVKLCDFGVAAQL--TTANHKRQTMAGTPYWMAPEVIMEGVY 196

Query: 618 TQSSDNQHEGNKWKVGRPSDMWSCGCIIYQMIYGKPPYGSFQGQNRLLAIMNPDVKIPFP 677
             +               +D+WS G   Y++  G PPY   +     L  M    K   P
Sbjct: 197 YNTK--------------ADIWSLGITTYEIATGNPPYCDVEA----LRAMQLITKSKPP 238

Query: 678 EYTSNN-EKIPKSAIELMKACLYRNPDKRWTVDKVLSSTFLQPFMISG-SIMEDLIKNAV 735
                N   + K   E +  CL  +P+ R T +++L++  ++    S  +I+++LI   +
Sbjct: 239 RLEGRNYSPLLK---EFIALCLDEDPEARPTAEELLTTKLVKTHKGSSVTILKELISRYL 295

Query: 736 RYGSEK 741
            + SEK
Sbjct: 296 LF-SEK 300

>KAFR0H01040 Chr8 complement(189604..190860) [1257 bp, 418 aa] {ON}
           Anc_3.338 YPR054W
          Length = 418

 Score = 87.4 bits (215), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 83/332 (25%), Positives = 145/332 (43%), Gaps = 78/332 (23%)

Query: 440 QYEKIELLGRGGSSRVYKVKGSGNK----IYALKRXXXXXXXXXXXXGFKGEIELLEKLK 495
           +YE +E+LG+G    V  V+   N     + A+K+                E++ L+  +
Sbjct: 65  RYEVVEVLGKGSYGIVCSVRDKSNSNPETLLAIKKITNIFQREILLKRAIRELKFLKFFR 124

Query: 496 DQRRVIQLLDYEM--------GDGLLYLIMECGDHDLSQILNQRSNMPLDFNFVRFYTKE 547
             + +I L+D E+         +GL Y   E  D+DL++I++  SN+ L    ++++  +
Sbjct: 125 GHKNIINLIDLEILYSENNPQYNGL-YCYQELIDYDLAKIIH--SNVSLTEFHIKYFFYQ 181

Query: 548 MLLCIKVVHDAGIVHSDLKPAN-FVLVKGILKIIDFGIANAVPEHTVNIYRETQ------ 600
           +L  +K +H A ++H DLKP N  V + G LKI DFG+A  +  +   + +E +      
Sbjct: 182 ILCGLKYIHSAEVIHRDLKPGNILVTLNGCLKICDFGLARGI-SNQFQLKQENKKTKPIT 240

Query: 601 --IGTPNYMAPEALVAMN-YTQSSDNQHEGNKWKVGRPSDMWSCGCIIYQM--------- 648
             + T  Y APE +++ N YT++                D+W+ GCI+ +          
Sbjct: 241 NYVATRWYRAPELILSQNTYTKA---------------IDLWAIGCILAEFYTRKPIFMG 285

Query: 649 ------------IYGKPP------YGSFQGQNRLL-AIMNPDVKIPFPEY---TSNNEKI 686
                       + G PP      + S +  N L    M P  KIP+  Y    SN+   
Sbjct: 286 NDSIHQTFEIIKVLGFPPTHLLVKFNSLKSLNLLKNKTMTPGKKIPWSTYLPFASND--- 342

Query: 687 PKSAIELMKACLYRNPDKRWTVDKVLSSTFLQ 718
              A +L+   L   P+ R+T  + +   F+Q
Sbjct: 343 ---AWDLLDHLLTWEPELRYTAAEAIEHRFVQ 371

>Skud_15.112 Chr15 (202308..205613) [3306 bp, 1101 aa] {ON} YOL045W
            (REAL)
          Length = 1101

 Score = 89.4 bits (220), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 66/244 (27%), Positives = 115/244 (47%), Gaps = 47/244 (19%)

Query: 486  GEIELLEKLK--DQRRVIQLLDYEMGDGLLYLIM----ECGDHDLSQILNQRSNMPLDFN 539
             EI+++  L    Q+ +++LLD+   D   Y+      E G  DL  ++  + +M    +
Sbjct: 893  SEIQIMATLNKNSQKNILKLLDFFEDDDYYYIETPVHGETGSIDLFDVIEFKKDMVE--H 950

Query: 540  FVRFYTKEMLLCIKVVHDAGIVHSDLKPANFVL-VKGILKIIDFGIANAVPEHTVNIYRE 598
              +   K+++  IK +H+ GIVH D+K  N ++   G +K+IDFG A  V     +++  
Sbjct: 951  EAKLVFKQVVASIKHLHNQGIVHRDIKDENVIVDSHGFVKLIDFGSAAYVKSGPFDVF-- 1008

Query: 599  TQIGTPNYMAPEALVAMNYTQSSDNQHEGNKWKVGRPSDMWSCGCIIYQMIYGKPPYGS- 657
              +GT +Y APE L   +Y               G+P D+W+ G ++Y +IY + PY + 
Sbjct: 1009 --VGTMDYAAPEVLGGSSYK--------------GKPQDIWALGVLLYTIIYKENPYYNI 1052

Query: 658  ---FQGQNRLLAIMNPDVKIPFPEYTSNNEKIPKSAIELMKACLYRNPDKRWTVDKVLSS 714
                +G+ R                    EK+ +  I L+K  L R  DKR T+D++   
Sbjct: 1053 DEILEGELRF----------------DKAEKVSEGCIGLIKRILTREVDKRPTIDEIYED 1096

Query: 715  TFLQ 718
             +L+
Sbjct: 1097 KWLR 1100

>KAFR0E01580 Chr5 (318991..320280) [1290 bp, 429 aa] {ON} Anc_5.274
           YHR030C
          Length = 429

 Score = 87.4 bits (215), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 82/320 (25%), Positives = 143/320 (44%), Gaps = 60/320 (18%)

Query: 438 DSQYEKIELLGRGG-----SSRVYKVKGSGNKIYALKRXXXXXXXXXXXXGFKGEIELLE 492
           DS+++ I+ +GRGG     S+   +    G ++ A+K+                E++LL 
Sbjct: 20  DSRFQVIKEIGRGGYGIVCSAEYVEPPYQGVRV-AIKKIPNVFSKTLACKRSLRELKLLR 78

Query: 493 KLKDQRRVIQLLDYEM------GDGLLYLIMECGDHDLSQILNQRSNMPLDFNFVRFYTK 546
             +  + ++ L D ++          LYL  E  D DL QI+  +S  PL  +  +++  
Sbjct: 79  HFRGHKNIVYLFDSDIVFNHDNSFNGLYLYCELLDCDLHQII--QSKQPLTDSHYQYFIY 136

Query: 547 EMLLCIKVVHDAGIVHSDLKPANFVLVKGI-LKIIDFGIANAVPEHTV--NIYRETQIGT 603
           ++L  +K +H AG++H DLKP N ++     LKI DFG A    +  V  N +    + T
Sbjct: 137 QILCALKYIHSAGVLHRDLKPKNILINSDCQLKIADFGFARGYSQDPVDNNQFLTEYVAT 196

Query: 604 PNYMAPEALVAMNYTQSSDNQHEGNKWKVGRPSDMWSCGCIIYQMIYGKP--PYGSFQGQ 661
             Y APE ++      ++               D+WS GCI+ +++ G    P   +  Q
Sbjct: 197 RWYRAPEIMLGYKAYFTA--------------IDVWSVGCILAELLGGTAMFPGSDYVDQ 242

Query: 662 -NRLLAIM-NPDV----------------------KIPFPEYTSNNEKIPKSAIELMKAC 697
            NR+L ++ +P V                      KIPF E  ++   +   AI++++  
Sbjct: 243 LNRILYVLGSPSVDTLRRIGSMNVQQYILQLGDIQKIPFKEIFTSGSIL---AIDMLEKT 299

Query: 698 LYRNPDKRWTVDKVLSSTFL 717
           L  +PD+R +VD  L   +L
Sbjct: 300 LTFDPDQRISVDDALRHPYL 319

>KLLA0C12485g Chr3 (1060167..1062944) [2778 bp, 925 aa] {ON} similar
           to uniprot|Q12236 YOL100W Saccharomyces cerevisiae
           YOL100W PKH2 Serine/threonine protein kinase involved in
           sphingolipid-mediated signaling pathway that controls
           endocytosis
          Length = 925

 Score = 89.0 bits (219), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 76/292 (26%), Positives = 137/292 (46%), Gaps = 43/292 (14%)

Query: 435 TVNDSQYEKIELLGRGGSSRVYKVKGSGNKIYALKRXXXXXXXXXXXXGFKGEIELLEKL 494
           T+ D  Y  + L     S++ Y VK   NK Y +K+                E   L++L
Sbjct: 160 TLGDGSYSTVLLATSIESNKKYAVK-ILNKEYLIKQKKVKYVNI--------EKNTLQRL 210

Query: 495 KDQRRVIQLLDYEMGDGLLYLIMECG-DHDLSQILNQRSNMPLDFNFVRFYTKEMLLCIK 553
           K+ + +I L      +  LY ++E   + DL  ++  R +  ++    ++Y  +++  + 
Sbjct: 211 KNTKGIISLYFTFQDESSLYFLLEYAPNGDLLSLM--RKHGSVNEKCTQYYAAQIIDALG 268

Query: 554 VVHDAGIVHSDLKPANFVL-VKGILKIIDFGIANAVPEHTVNIYR-------ETQIGTPN 605
            +HD G++H DLKP N +L V   +K+ DFG A  +   + +  +        + +GT  
Sbjct: 269 FMHDKGVIHRDLKPENILLDVDMKVKLTDFGTARLLDSTSEDDLKYDLLTRSNSFVGTAE 328

Query: 606 YMAPEALVAMNYTQSSDNQHEGNKWKVGRPSDMWSCGCIIYQMIYGKPPYGSFQGQNRLL 665
           Y++PE L+  NY              V    D+W+ GCI++QMI GKPP   F+  N  L
Sbjct: 329 YVSPE-LLNDNY--------------VDFRCDIWAFGCILFQMIAGKPP---FKANNEYL 370

Query: 666 AIMNPDVKIPFPEYTSNNEKIPKSAIELMKACLYRNPDKRWTVDKVLSSTFL 717
                 +K+ F  +T+     P +  +L+K  L +NP++R  ++++ +  F 
Sbjct: 371 TFQKV-MKVQF-AFTAG---FPMTVRDLVKNILIKNPERRLLINQIKAHQFF 417

>Suva_15.216 Chr15 complement(376197..377624) [1428 bp, 475 aa] {ON}
           YHR030C (REAL)
          Length = 475

 Score = 87.8 bits (216), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 93/369 (25%), Positives = 163/369 (44%), Gaps = 71/369 (19%)

Query: 438 DSQYEKIELLGRGGSSRVYKVK---GSGNKIYALKRXXXXXXXXXXXXGFKGEIELLEKL 494
           D +++ I+ +G G    V   +    + +   A+K+                E++LL   
Sbjct: 20  DKRFQLIKEIGHGAYGIVCSARFAEAAEDTTVAIKKVTNVFSKTLLCKRSLRELKLLRHF 79

Query: 495 KDQRRVIQLLDYEM---GDGL---LYLIMECGDHDLSQILNQRSNMPLDFNFVRFYTKEM 548
           +  + +  L D ++    DG    LYL  E  + D+ QI+  +S  PL     + +T ++
Sbjct: 80  RGHKNITCLYDMDIVFYSDGSINGLYLYEELMECDMHQII--KSGQPLTDAHYQSFTYQI 137

Query: 549 LLCIKVVHDAGIVHSDLKPANFVL-VKGILKIIDFGIANAVPEHTV--NIYRETQIGTPN 605
           L  +K +H A ++H DLKP N ++     LKI DFG+A    E+ V  + +    + T  
Sbjct: 138 LCGLKYIHSADVLHRDLKPGNLLVNADCQLKICDFGLARGYSENPVENSQFLTEYVATRW 197

Query: 606 YMAPEALVA-MNYTQSSDNQHEGNKWKVGRPSDMWSCGCIIYQMIYGKPPYGSFQGQ--- 661
           Y APE +++   YT++                D+WS GCI+ + + GKP    F+G+   
Sbjct: 198 YRAPEIMLSYQGYTKA---------------IDVWSAGCILAEFLGGKP---VFKGKDYV 239

Query: 662 ---NRLLAIMN--PDVKIP------FPEYTSNNEKIPK------------SAIELMKACL 698
              N++L ++   PD  +         +Y      IPK             A++L++  L
Sbjct: 240 NQLNQILQVLGTPPDETLRRIGSKNVQDYIHQLGFIPKVPFINLYPNANSQALDLLEKML 299

Query: 699 YRNPDKRWTVDKVLSSTFLQPFMISGSIMEDLIKNAVRYGSEKPQISHD---DLNDVVET 755
             +P KR TVD+ L   +L       SI  D     V   SEK + S +   D+ D+ + 
Sbjct: 300 AFDPQKRMTVDEALEHPYL-------SIWHDPADEPV--CSEKFEFSFESVNDMEDLKQM 350

Query: 756 VLRKFSDYK 764
           V+++  D++
Sbjct: 351 VIQEVQDFR 359

>Skud_14.379 Chr14 (677081..679774) [2694 bp, 897 aa] {ON} YNR047W
           (REAL)
          Length = 897

 Score = 89.0 bits (219), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 82/342 (23%), Positives = 138/342 (40%), Gaps = 50/342 (14%)

Query: 408 PKPPVTKKVEIVEPAKS-----ASSSNNRSMITVNDSQYEKIELLGRGGSSRVYKVK-GS 461
           P+ P  K  +  EP +S      S SN    I V    +EKI LLG+G   +V+ V+   
Sbjct: 462 PQEPPPKISDFQEPRRSRRLRTKSFSNKFQDIMVGPQSFEKIRLLGQGDVGKVFLVREKK 521

Query: 462 GNKIYALK-RXXXXXXXXXXXXGFKGEIELLEKLKDQRRVIQLLDYEMGDGLLYLIME-C 519
            N++YALK                  E E+L    +   ++ L      +  LYL ME C
Sbjct: 522 TNRVYALKVLSKEEMIKRNKIKRVLTEQEIL-ATSNHPFIVTLYHSFQSEDYLYLCMEYC 580

Query: 520 GDHDLSQILNQRSNMPLDFNFVRFYTKEMLLCIKVVHDAGIVHSDLKPANFVLVK-GILK 578
              +  + L  R    +  +  RFY  E+   ++ +H  G ++ DLKP N +L + G + 
Sbjct: 581 MGGEFFRALQTRETKCICEDDARFYASEVTAALEYLHLLGFIYRDLKPENILLHQSGHIM 640

Query: 579 IIDFGIANAVPEHTVNIYRETQ-------------------IGTPNYMAPEALVAMNYTQ 619
           + DF ++    +  + + + +                    +GT  Y+APE +    +T 
Sbjct: 641 LSDFDLSIQAKDSKIPVVKGSAQSTLVDTKICSDGFRTNSFVGTEEYIAPEVIRGNGHTA 700

Query: 620 SSDNQHEGNKWKVGRPSDMWSCGCIIYQMIYGKPPYGSFQGQNRLLAIMNPDVKIPFPEY 679
           + D       W        W+ G +IY+M++G  P+           I+  +V  P    
Sbjct: 701 AVD-------W--------WTLGILIYEMLFGFTPFKGDNTNETFTNILKNEVSFP---- 741

Query: 680 TSNNEKIPKSAIELMKACLYRNPDKRWTVDKVLSSTFLQPFM 721
             NN +I ++  +L+K  L +N  KR       +     PF 
Sbjct: 742 --NNNEISRTCKDLIKKLLTKNESKRLGCKMGAADVKKHPFF 781

>CAGL0J00539g Chr10 (47095..48561) [1467 bp, 488 aa] {ON} highly
           similar to uniprot|Q00772 Saccharomyces cerevisiae
           YHR030c SLT2
          Length = 488

 Score = 87.8 bits (216), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 86/322 (26%), Positives = 139/322 (43%), Gaps = 65/322 (20%)

Query: 438 DSQYEKIELLGRGGSSRVYKVK---GSGNKIYALKRXXXXXXXXXXXXGFKGEIELLEKL 494
           D ++E I+ +G G    V   +    S     A+K+                E++LL   
Sbjct: 18  DKRFELIKEIGHGAYGIVCSARFTEASEETTVAIKKVTNIFSKTLLCKRSLRELKLLRHF 77

Query: 495 KDQRRVIQLLDYEM---GDGL---LYLIMECGDHDLSQILNQRSNMPLDFNFVRFYTKEM 548
           +  + +  L D ++    DG    LYL  E  + D+ QI+  +S   L     + +T ++
Sbjct: 78  RGHKNITCLYDMDIVFYPDGSINGLYLYEELMECDMHQII--KSGQALTDAHYQSFTYQI 135

Query: 549 LLCIKVVHDAGIVHSDLKPANFVL-VKGILKIIDFGIANAVPEHTV--NIYRETQIGTPN 605
           L  +K +H A ++H DLKP N ++     LKI DFG+A    E+    N +    + T  
Sbjct: 136 LCGLKYIHSADVLHRDLKPGNLLVNADCQLKICDFGLARGYSENPEENNQFLTEYVATRW 195

Query: 606 YMAPEALVA-MNYTQSSDNQHEGNKWKVGRPSDMWSCGCIIYQMIYGKPPYGSFQGQ--- 661
           Y APE +++   YT++                D+WS GCI+ + + GKP    F+G+   
Sbjct: 196 YRAPEIMLSYQGYTKA---------------IDIWSTGCILAEFLGGKP---LFKGKDYV 237

Query: 662 ---NRLLAIMN--PD---------------------VKIPFPEYTSNNEKIPKSAIELMK 695
              NR+L ++   PD                      KIPF E   N     + A++L++
Sbjct: 238 DQLNRILQVLGTPPDETLRRVGSKNVQDYIHQLGYIQKIPFSELFPNAN---EDALDLLE 294

Query: 696 ACLYRNPDKRWTVDKVLSSTFL 717
             L  +P KR TVDK L   +L
Sbjct: 295 GMLAFDPQKRITVDKALEHPYL 316

>Skud_11.58 Chr11 complement(120855..122042) [1188 bp, 395 aa] {ON}
           YKL166C (REAL)
          Length = 395

 Score = 86.7 bits (213), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 73/278 (26%), Positives = 118/278 (42%), Gaps = 56/278 (20%)

Query: 420 EPAKSASSSNNRSMITVNDSQ-------YEKIELLGRGGSSRVYKVKGSGN-KIYALKRX 471
           E   S+S    + M+   D+        ++ +  LG G   RV+ ++ + N + YALK  
Sbjct: 57  EKVSSSSCLPKKPMLQYRDTSGKYSLGDFQILRTLGTGSFGRVHLIRSNHNGRFYALKTL 116

Query: 472 XXXXXXXXXXXGFKGE-------------IELLEKLKDQRRVIQLLDYEMGDGLLYLIME 518
                          +             I +    +D ++V  ++DY  G  L  L+ +
Sbjct: 117 KKHTVVKLKQVEHTNDERRMLSIVSHPFIIRMWGTFQDSQQVFMVMDYIEGGELFSLLRK 176

Query: 519 CGDHDLSQILNQRSNMPLDFNFVRFYTKEMLLCIKVVHDAGIVHSDLKPANFVLVK-GIL 577
                     +QR   P+     +FY  E+ L ++ +H   I++ DLKP N +L K G +
Sbjct: 177 ----------SQRFPNPV----AKFYAAEVCLALEYLHSKDIIYRDLKPENILLDKNGHI 222

Query: 578 KIIDFGIANAVPEHTVNIYRETQIGTPNYMAPEALVAMNYTQSSDNQHEGNKWKVGRPSD 637
           KI DFG A  VP+ T      T  GTP+Y+APE +    Y +S D       W       
Sbjct: 223 KITDFGFAKYVPDVTY-----TLCGTPDYIAPEVVSTKPYNKSVD-------W------- 263

Query: 638 MWSCGCIIYQMIYGKPPYGSFQGQNRLLAIMNPDVKIP 675
            WS G +IY+M+ G  P+ +         I+N ++K P
Sbjct: 264 -WSFGVLIYEMLAGYTPFYNSNTMKTYENILNAELKFP 300

>Kpol_1055.24 s1055 complement(57430..60243) [2814 bp, 937 aa] {ON}
           complement(57430..60243) [2814 nt, 938 aa]
          Length = 937

 Score = 89.0 bits (219), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 77/301 (25%), Positives = 133/301 (44%), Gaps = 35/301 (11%)

Query: 439 SQYEKIELLGRGGSSRVYKVKGSGNKIY-ALKRXXXXXXXXXXXXGFKGEIELLEKLKDQ 497
           S+Y  +  +G+G S  VY       + Y A+K+                EI ++++ K +
Sbjct: 648 SKYTDLIKIGQGASGGVYTAHDPTREGYVAIKQMNLEKQPKKEL--IINEIIVMKESKHE 705

Query: 498 RRVIQLLDYEMGDGLLYLIMECGDHDLSQILNQRSNMPLDFNFVRFYTKEMLLCIKVVHD 557
             ++  +D  +  G L++IME  +     + +  ++  L    V    +E L  ++ +H 
Sbjct: 706 N-IVNFIDSYLLKGDLWVIMEYMEG--GSLTDVVTHCLLTEAQVGAVCRETLSGLQFLHS 762

Query: 558 AGIVHSDLKPANFVL-VKGILKIIDFGIANAVPEHTVNIYRETQIGTPNYMAPEALVAMN 616
            G++H D+K  N +L ++G +K+ DFG    + E  +N+ R T +GTP +MAPE +    
Sbjct: 763 KGVIHRDIKSDNILLSMRGDIKLTDFGFCAQINE--LNLKRTTMVGTPYWMAPEVVSRKE 820

Query: 617 YTQSSDNQHEGNKWKVGRPSDMWSCGCIIYQMIYGKPPYGSFQGQNRLLAIM---NPDVK 673
           Y               G   D+WS G +I +MI G+PPY +      L  I     P +K
Sbjct: 821 Y---------------GPKVDIWSLGIMIIEMIEGEPPYLNETPLRALYLIATNGTPSLK 865

Query: 674 IPFPEYTSNNEKIPKSAIELMKACLYRNPDKRWTVDKVLSSTFLQPFMISGSIMEDLIKN 733
            P        E +  +    +  CL  NPD+R +   +L   F+     S   +  L+K 
Sbjct: 866 EP--------EALSDALNNFLGWCLKVNPDERASAKDLLLDPFITEIADSNESLAPLVKL 917

Query: 734 A 734
           A
Sbjct: 918 A 918

>YOL045W Chr15 (243497..246802) [3306 bp, 1101 aa] {ON}  PSK2One of
            two (see also PSK1) PAS domain containing S/T protein
            kinases; regulates sugar flux and translation in response
            to an unknown metabolite by phosphorylating Ugp1p and
            Gsy2p (sugar flux) and Caf20p, Tif11p and Sro9p
            (translation)
          Length = 1101

 Score = 89.0 bits (219), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 65/244 (26%), Positives = 114/244 (46%), Gaps = 47/244 (19%)

Query: 486  GEIELLEKLK--DQRRVIQLLDYEMGDGLLYLIM----ECGDHDLSQILNQRSNMPLDFN 539
             EI+++  L    Q  +++LLD+   D   Y+      E G  DL  ++  + +M    +
Sbjct: 893  SEIQIMATLNKNSQENILKLLDFFEDDDYYYIETPVHGETGSIDLFDVIEFKKDMVE--H 950

Query: 540  FVRFYTKEMLLCIKVVHDAGIVHSDLKPANFVL-VKGILKIIDFGIANAVPEHTVNIYRE 598
              +   K+++  IK +HD GIVH D+K  N ++   G +K+IDFG A  +     +++  
Sbjct: 951  EAKLVFKQVVASIKHLHDQGIVHRDIKDENVIVDSHGFVKLIDFGSAAYIKSGPFDVF-- 1008

Query: 599  TQIGTPNYMAPEALVAMNYTQSSDNQHEGNKWKVGRPSDMWSCGCIIYQMIYGKPPYGS- 657
              +GT +Y APE L   +Y               G+P D+W+ G ++Y +IY + PY + 
Sbjct: 1009 --VGTMDYAAPEVLGGSSYK--------------GKPQDIWALGVLLYTIIYKENPYYNI 1052

Query: 658  ---FQGQNRLLAIMNPDVKIPFPEYTSNNEKIPKSAIELMKACLYRNPDKRWTVDKVLSS 714
                +G+ R                   +E + +  I L+K  L R  DKR T+D++   
Sbjct: 1053 DEILEGELRF----------------DKSEHVSEECISLIKRILTREVDKRPTIDEIYED 1096

Query: 715  TFLQ 718
             +L+
Sbjct: 1097 KWLK 1100

>TPHA0H02390 Chr8 (561244..563436) [2193 bp, 730 aa] {ON} Anc_6.371
           YCR091W
          Length = 730

 Score = 88.6 bits (218), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 81/311 (26%), Positives = 130/311 (41%), Gaps = 46/311 (14%)

Query: 434 ITVNDSQYEKIELLGRGGSSRVYKVK-GSGNKIYALK-RXXXXXXXXXXXXGFKGEIELL 491
           I V    +EK+ LLG+G   +VY V+    NK++ALK                  E E+L
Sbjct: 327 IKVGPKSFEKVRLLGQGDIGKVYLVREKKTNKLFALKILSKSEMIKRKKVRRILTEQEIL 386

Query: 492 EKLKDQRRVIQLLDYEMGDGLLYLIME-CGDHDLSQILNQRSNMPLDFNFVRFYTKEMLL 550
               D   ++ L         LY+ ME C   +  + L  R N  +  N  RFY  E++ 
Sbjct: 387 A-TSDHPFIVTLYHTFQTKTYLYICMEYCMGGEFFRALQTRENKCISENAARFYASEVVA 445

Query: 551 CIKVVHDAGIVHSDLKPANFVLVK-GILKIIDFGIA--------NAVPEHTVNIYRETQ- 600
            ++ +H  G ++ DLKP N +L K G + + DF ++          +   T N Y +T+ 
Sbjct: 446 ALEYLHLLGFIYRDLKPENILLHKSGHIMLADFDLSIQSQSDSEPVIDSLTNNAYIDTKK 505

Query: 601 ----------IGTPNYMAPEALVAMNYTQSSDNQHEGNKWKVGRPSDMWSCGCIIYQMIY 650
                     +GT  Y+APE +    +T + D       W        W+ G ++Y+M+Y
Sbjct: 506 ISEGFRTNSFVGTEEYIAPEVIRGNGHTTAVD-------W--------WTLGILVYEMLY 550

Query: 651 GKPPYGSFQGQNRLLAIMNPDVKIPFPEYTSNNEKIPKSAIELMKACLYRNPDKRWTVDK 710
           G   Y  F+G+N      N    I   + +     I K+  +L+K  L +N  KR    +
Sbjct: 551 G---YSPFKGRNTNETFSN----IIKEQVSFQGHDISKTGKDLIKKLLIKNEIKRLGSKQ 603

Query: 711 VLSSTFLQPFM 721
             +     PF 
Sbjct: 604 GAADIKSHPFF 614

>Ecym_3488 Chr3 complement(915087..916400) [1314 bp, 437 aa] {ON}
           similar to Ashbya gossypii ADL315C
          Length = 437

 Score = 87.0 bits (214), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 94/392 (23%), Positives = 164/392 (41%), Gaps = 88/392 (22%)

Query: 418 IVEPAKSASSSNNRSMITVNDSQYEKIELLGRGGSSRVYKVKGSGNKIY----ALKRXXX 473
           +V P ++  +  N S+       YE +++LG+G    V     + N  Y    A+K+   
Sbjct: 57  VVHPPRTIYTKANFSI----PGHYEVLQMLGKGSYGTVVSAIDNFNPNYPIRIAIKKITN 112

Query: 474 XXXXXXXXXGFKGEIELLEKLKDQRRVIQLLDYEM-----GDGLLYLIMECGDHDLSQIL 528
                        E++ +   K  + ++ L++ E+      DGL Y   E  D+DL++++
Sbjct: 113 IFQREVLLKRAIRELKFMHYFKGHKNIVSLINLEIVNEKPYDGL-YCYQELIDYDLARVI 171

Query: 529 NQRSNMPLDFNFVRFYTKEMLLCIKVVHDAGIVHSDLKPANFVL-VKGILKIIDFGIANA 587
           +  SN+      ++ +T ++L  +K +H A ++H DLKP N +  + G LKI DFG+A  
Sbjct: 172 H--SNVQFSEFHIKHFTYQILCGVKYIHSADVIHRDLKPGNILCSISGQLKICDFGLARG 229

Query: 588 VPEHTVNIYRETQI----GTPNYMAPEALVAMNYTQSSDNQHEGNKWKVGRPSDMWSCGC 643
           +     N      I     T  Y APE +++                +  +  DMW+ GC
Sbjct: 230 ISPLFTNTKTSNHITNYVATRWYRAPELILSHK--------------RYNKSIDMWAIGC 275

Query: 644 IIYQMIYGKPPYGSFQGQN---------RLLAIMNPDVKI-------------PFPEYTS 681
           I+ +  YG+ P   F GQ+         ++L   + D  I             P P+Y  
Sbjct: 276 ILAEF-YGRKPI--FMGQDSMHQISEIVKVLGTPSRDTIIKYGSSRAYDIFCPPKPQYA- 331

Query: 682 NNEKIP---------KSAIELMKACLYRNPDKRWTVDKVLSSTFLQPFMISGSIMEDLIK 732
              KIP           A++L++  L  +PD+R TV++              SI  D +K
Sbjct: 332 ---KIPWIEIYSFASGEALDLIERLLDWDPDRRLTVEE--------------SIEHDFVK 374

Query: 733 NAVRYGSEKPQISHDDLNDVVETVLRKFSDYK 764
             VR  +++P   H   N   E   +  S+ +
Sbjct: 375 T-VRDKNDEPLCPHGPFNFSYEAEFKSMSNLR 405

>AFR724C Chr6 complement(1770338..1771660) [1323 bp, 440 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR523C
           (SPS1)
          Length = 440

 Score = 87.0 bits (214), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 71/286 (24%), Positives = 127/286 (44%), Gaps = 36/286 (12%)

Query: 440 QYEKIELLGRGGSSRVYKVKG-SGNKIYALKRXXXXXXXXXXXXGFKGEIELLEKLKD-- 496
           QYE ++ +GRG    VYK +  + N+I A+K                 EI  L +L+   
Sbjct: 19  QYEILQCIGRGNFGDVYKARDLTSNEIVAIKVVNLEDTDEPIDL-LAQEIFFLSELRSPY 77

Query: 497 --QRRVIQLLDYEMGDGLLYLIME-CGDHDLSQILNQRSNMPLDFNFVRFYTKEMLLCIK 553
               +   L+D  M     +++ME CG    +++L       +      F   E+L+ + 
Sbjct: 78  ITNYKTAFLVDVSM-----WIVMEYCGGGSCAELLKYTPEHKVTEEQCAFIVSEVLIGLD 132

Query: 554 VVHDAGIVHSDLKPANFVLVK-GILKIIDFGIANAVPEHTVNIYRETQIGTPNYMAPEAL 612
            +H    +H D+K AN +L   G +K+ DFG++    +  V   R+T +GTP +MAPE +
Sbjct: 133 YLHSQRKIHRDIKSANILLTDNGHVKLGDFGVSG---QMMVTRKRDTFVGTPFWMAPEVI 189

Query: 613 VAMNYTQSSDNQHEGNKWKVGRPSDMWSCGCIIYQMIYGKPPYGSFQGQNRLLAIMNPDV 672
                        + NK      +D+WS G  + +++ G PP   +     L+A      
Sbjct: 190 -------------DRNKQGYNEMADIWSLGITVIELLMGHPPLDKYDAMKALMA------ 230

Query: 673 KIPFPEYTSNNEKIPKSAIELMKACLYRNPDKRWTVDKVLSSTFLQ 718
            IP  +    +++    A + +  CL ++P +R T  ++L   F++
Sbjct: 231 -IPKRDPPKLDKRFSSHARDFVAQCLIKDPSQRPTAAELLKHRFVK 275

>Kpol_1072.16 s1072 complement(37585..39972) [2388 bp, 795 aa] {ON}
           complement(37585..39972) [2388 nt, 796 aa]
          Length = 795

 Score = 88.6 bits (218), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 78/282 (27%), Positives = 137/282 (48%), Gaps = 23/282 (8%)

Query: 443 KIELLGRGGSSRVYK-VKGSGNKIYALKRXXXXXXXXXXXXGFKGEIELLEKLKDQRRVI 501
           K E++G+G  + V K V+ S  K +A+K             G   E+++L KL D  R++
Sbjct: 195 KDEVVGQGAFAIVKKAVERSTGKTFAVK-IINKRKVMGNMDGVTRELDVLRKL-DHPRIV 252

Query: 502 QLLDYEMGDGLLYLIME-CGDHDLSQILNQRSNMPLDFNFVRFYTKEMLLCIKVVHDAGI 560
           +L  +   +   YL+ME     DL   +    ++  D    R  T+++L  +K +H  GI
Sbjct: 253 RLKGFYEDEDSYYLLMEFVSGGDLMDFVAAHGSVGEDAG--REITRQILEAVKYIHLQGI 310

Query: 561 VHSDLKPANFVLVKG---ILKIIDFGIANAVPEHTVNIYRETQIGTPNYMAPEALVAMNY 617
            H DLKP N ++ +    ++KI DFG+A      T   + +T  GT  Y+APE +   N 
Sbjct: 311 SHRDLKPDNILIEQDDPVLVKITDFGLAKVQGNGT---FMKTFCGTLAYVAPEVIGGKNS 367

Query: 618 TQSSDNQHEGNKWKVGRPSDMWSCGCIIYQMIYGKPPY-GSFQGQNRLLAIMNPDVKIPF 676
            + ++++ E +        DMWS GC++Y ++ G  P+ GS Q Q     +     +  +
Sbjct: 368 AEENEDRIEYSSL-----VDMWSIGCLVYVILTGHLPFSGSTQDQ-----LYKQICRGSY 417

Query: 677 PEYTSNNEKIPKSAIELMKACLYRNPDKRWTVDKVLSSTFLQ 718
            E    + +I   A + + + L  +P+KR T  K L+  +++
Sbjct: 418 HEGPLKDFRISDEARDFIDSLLQVSPNKRLTAIKALNHPWIK 459

>TBLA0I00280 Chr9 (42870..46820) [3951 bp, 1316 aa] {ON} Anc_2.496
            YHL007C
          Length = 1316

 Score = 89.0 bits (219), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 75/299 (25%), Positives = 132/299 (44%), Gaps = 35/299 (11%)

Query: 441  YEKIELLGRGGSSRVYKVKGSG-NKIYALKRXXXXXXXXXXXXGFKGEIELLEKLKDQRR 499
            Y  +  +G+G S  VY     G N   A+K+                EI ++++ K  + 
Sbjct: 1027 YRNLVKIGQGASGGVYTAYEVGTNASVAVKQMNLEKQPKTEL--IINEIIVMKESK-HKN 1083

Query: 500  VIQLLDYEMGDGLLYLIMECGDHDLSQILNQRSNMPLDFNFVRFYTKEMLLCIKVVHDAG 559
            ++  +D  +  G L+++ME  +     + +  ++  L    +    +E L  +K +H  G
Sbjct: 1084 IVNFIDSYLLKGDLWVVMEYMEG--GSLTDVVTHCILTEGQIGAVCRETLNGLKFLHSKG 1141

Query: 560  IVHSDLKPANFVL-VKGILKIIDFGIANAVPEHTVNIYRETQIGTPNYMAPEALVAMNYT 618
            ++H D+K  N +L ++G +K+ DFG    + E  V++ R T +GTP +MAPE +    Y 
Sbjct: 1142 VIHRDIKSDNILLSMQGDIKLTDFGFCAQINE--VHLKRTTMVGTPYWMAPEVVSRKEY- 1198

Query: 619  QSSDNQHEGNKWKVGRPSDMWSCGCIIYQMIYGKPPYGSFQGQNRLLAIM---NPDVKIP 675
                          G   D+WS G +I +MI G+PPY +      L  I     P++K P
Sbjct: 1199 --------------GPKVDIWSLGIMIIEMIEGEPPYLNETPLRALYLIATNGTPELKEP 1244

Query: 676  FPEYTSNNEKIPKSAIELMKACLYRNPDKRWTVDKVLSSTFLQPFMISGSIMEDLIKNA 734
                    EK+       + ACL  +P+ R T  ++L +  +         +  L+K A
Sbjct: 1245 --------EKLSSILHNFLDACLKVDPEVRATATELLETELITEVASENISLAPLVKVA 1295

>NCAS0I02840 Chr9 (528136..529344) [1209 bp, 402 aa] {ON} Anc_1.24
           YDR523C
          Length = 402

 Score = 86.7 bits (213), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 76/287 (26%), Positives = 119/287 (41%), Gaps = 55/287 (19%)

Query: 408 PKPPVTK----KVEIVEPAKSASSSNNRSMITVNDSQYEKIELLGRGGSSRVYKVKGSGN 463
           P  PV +    + E   P K+          T+ND  ++ +  LG G   RV+ ++ + N
Sbjct: 24  PPAPVQQHPHPRTEHQAPRKNLHGRKTSGKYTLND--FQILRTLGTGSFGRVHLIRSNHN 81

Query: 464 -KIYALKRXXXXXXXXXXXXGFKGE-------------IELLEKLKDQRRVIQLLDYEMG 509
            + YALK                 +             + +    +D  +V  ++DY  G
Sbjct: 82  GRFYALKVLKKHTIVKLKQVEHTNDERLMLSVVSHPFLVRMWGTFQDFEQVFMIMDYIEG 141

Query: 510 DGLLYLIMECGDHDLSQILNQRSNMPLDFNFVRFYTKEMLLCIKVVHDAGIVHSDLKPAN 569
             L  L+ +          +QR   P+     +FY  E+ L ++ +H   I++ DLKP N
Sbjct: 142 GELFSLLRK----------SQRFPNPV----AKFYAAEVCLALEYLHSMDIIYRDLKPEN 187

Query: 570 FVLVK-GILKIIDFGIANAVPEHTVNIYRETQIGTPNYMAPEALVAMNYTQSSDNQHEGN 628
            +L K G +KI DFG A  VP+ T      T  GTP+Y+APE +    Y +S D      
Sbjct: 188 ILLDKNGHIKITDFGFAKYVPDITY-----TLCGTPDYIAPEVVSTKPYNKSVD------ 236

Query: 629 KWKVGRPSDMWSCGCIIYQMIYGKPPYGSFQGQNRLLAIMNPDVKIP 675
            W        WS G +IY+M+ G  P+           I+N  +K P
Sbjct: 237 -W--------WSFGILIYEMLAGYTPFYDSNTMKTYENILNCKLKFP 274

>Ecym_7392 Chr7 complement(803240..807544) [4305 bp, 1434 aa] {ON}
           similar to Ashbya gossypii ABL034W
          Length = 1434

 Score = 89.0 bits (219), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 78/281 (27%), Positives = 122/281 (43%), Gaps = 38/281 (13%)

Query: 447 LGRGGSSRVYKVKG-SGNKIYALK------RXXXXXXXXXXXXGFKGEIELLEKLKDQRR 499
           LG+G S RV   K     K+ A+K                   G + EI ++ KL     
Sbjct: 70  LGKGSSGRVRLAKNMETGKLAAIKIVPKRNVRHNNTQLTSLPYGIEREI-IIMKLISHPN 128

Query: 500 VIQLLDYEMGDGLLYLIME-CGDHDLSQILNQRSNMPLDFNFVRFYTKEMLLCIKVVHDA 558
           V+ L +       LYL++E     +L   L  R  +P +   V ++ K+++  +   H  
Sbjct: 129 VMALYEVWENKPELYLVLEYVEGGELFDYLISRGKLP-EQEAVHYF-KQIVQGVSYCHHF 186

Query: 559 GIVHSDLKPANFVLVKGIL--KIIDFGIANAVPEHTVNIYRETQIGTPNYMAPEALVAMN 616
            I H DLKP N +L K  L  KI DFG+A      T +   ET  G+P+Y +PE ++   
Sbjct: 187 NICHRDLKPENLLLDKKNLSVKIADFGMAAL---ETTDKLLETSCGSPHYASPEIVMGQK 243

Query: 617 YTQSSDNQHEGNKWKVGRPSDMWSCGCIIYQMIYGKPPYGSFQGQNRLLAIMNPDVKIPF 676
           Y               G PSD+WSCG I++ ++ G  P+     +  LL + +   ++P 
Sbjct: 244 YH--------------GSPSDVWSCGIILFALLTGHLPFNDDNVKKLLLKVQSGKYQMP- 288

Query: 677 PEYTSNNEKIPKSAIELMKACLYRNPDKRWTVDKVLSSTFL 717
                  + I   A +L+   L  +P  R T+D+VL    L
Sbjct: 289 -------QNISNEAKDLIAKILIVDPAMRITIDEVLEHPLL 322

>Kwal_26.7154 s26 (237387..241028) [3642 bp, 1213 aa] {ON} YOL045W -
            Hypothetical ORF [contig 47] FULL
          Length = 1213

 Score = 89.0 bits (219), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 63/239 (26%), Positives = 117/239 (48%), Gaps = 39/239 (16%)

Query: 487  EIELLEKL--KDQRRVIQLLDYEMGDGLLYLIMEC----GDHDLSQILNQRSNMPLDFNF 540
            EI+++  L  K    ++ LLD+   D   Y+        G  DL  ++  +++M      
Sbjct: 1006 EIQIMATLNAKPHENILMLLDFFEDDDYYYIETAVHGTSGSIDLFDLIEMKTDMTEHEAM 1065

Query: 541  VRFYTKEMLLCIKVVHDAGIVHSDLKPANFVL-VKGILKIIDFGIANAVPEHTVNIYRET 599
            + F  K++   IK +HD GIVH D+K  N ++   G +KI+DFG A  V     +++   
Sbjct: 1066 LIF--KQIASGIKNLHDNGIVHRDIKDENVIVDCNGFVKIVDFGSAAYVKSGPFDVF--- 1120

Query: 600  QIGTPNYMAPEALVAMNYTQSSDNQHEGNKWKVGRPSDMWSCGCIIYQMIYGKPPYGSFQ 659
             +GT +Y APE L    Y               G+P D+W+ G ++Y +IY + P+ +  
Sbjct: 1121 -VGTIDYAAPEVLGGEPYE--------------GKPQDIWAIGVLLYTIIYKENPFYNID 1165

Query: 660  GQNRLLAIMNPDVKIPFPEYTSNNEKIPKSAIELMKACLYRNPDKRWTVDKVLSSTFLQ 718
                   I++ D+++      +++E+I    I L++  L R+  KR ++D++ +  +L+
Sbjct: 1166 ------EILDADLRV------NSSERISDDCIALIRKILNRSVSKRPSIDEICNHKWLE 1212

>YDR466W Chr4 (1395121..1397817) [2697 bp, 898 aa] {ON}  PKH3Protein
           kinase with similarity to mammalian
           phosphoinositide-dependent kinase 1 (PDK1) and yeast
           Pkh1p and Pkh2p, two redundant upstream activators of
           Pkc1p; identified as a multicopy suppressor of a pkh1
           pkh2 double mutant
          Length = 898

 Score = 88.6 bits (218), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 74/256 (28%), Positives = 110/256 (42%), Gaps = 70/256 (27%)

Query: 445 ELLGRGGSSRVYKV--KGSGNKIYALKRXXXXXXXXXXXXGF----------------KG 486
           E LG G  S V+K   K S NKIYA+K              +                 G
Sbjct: 15  EELGHGSYSTVFKALDKKSPNKIYAIKVCSKKHIIKEAKVKYVTIEKNTMNLLAQKHHAG 74

Query: 487 EIELLEKLKDQRRVIQLLDYEMGDGLLYLIMECGDHDLSQILNQRSNMPLDFN--FVRFY 544
            I+L     D+  +  +LD+  G  LL L+ + G                 FN  + R +
Sbjct: 75  IIKLYYTFHDEENLYFVLDFAPGGELLSLLHKMGT----------------FNDIWTRHF 118

Query: 545 TKEMLLCIKVVHDAGIVHSDLKPANFVLVK-GILKIIDFGIANAV-PEHT---------V 593
           T +++  ++ +H  GI+H DLKP N +L + G L I DFG A  + P  +          
Sbjct: 119 TAQLIDALEFIHSHGIIHRDLKPENVLLDRDGRLMITDFGAAATIDPSLSGDSAKFNSDS 178

Query: 594 NIYRETQ-----IGTPNYMAPEALVAMNYTQSSDNQHEGNKWKVGRPSDMWSCGCIIYQM 648
           N  ++ Q     +GT  Y++PE L+   Y Q             G  SD+W+ GC+IYQ 
Sbjct: 179 NGSKDNQNCASFVGTAEYVSPELLL---YNQ------------CGYGSDIWALGCMIYQF 223

Query: 649 IYGKPPYGSFQGQNRL 664
           + G+PP   F+G+N L
Sbjct: 224 VQGQPP---FRGENEL 236

>YCL024W Chr3 (79162..82275) [3114 bp, 1037 aa] {ON}  KCC4Protein
           kinase of the bud neck involved in the septin
           checkpoint, associates with septin proteins, negatively
           regulates Swe1p by phosphorylation, shows structural
           homology to bud neck kinases Gin4p and Hsl1p
          Length = 1037

 Score = 88.6 bits (218), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 67/235 (28%), Positives = 109/235 (46%), Gaps = 29/235 (12%)

Query: 490 LLEKLKDQRRVIQLLDYEMGDGLLYLIMECGDH-DLSQILNQRSNMPLDFNFVRFYTKEM 548
           ++ KL     V+ L D    +  LYLI+E  +  +L  +L     +P       F  +++
Sbjct: 79  VIMKLLSHPNVLSLYDVWETNNNLYLILEYAEKGELFNLLVDHGPLPEREAINCF--RQI 136

Query: 549 LLCIKVVHDAGIVHSDLKPANFVLVKGI-LKIIDFGIANAVPEHTVNIYRETQIGTPNYM 607
           ++ I   H  GIVH DLKP N +L     +KI DFG+A      T     ET  G+P+Y 
Sbjct: 137 IIGISYCHALGIVHRDLKPENLLLDSFYNIKIADFGMAAL---QTDADLLETSCGSPHYA 193

Query: 608 APEALVAMNYTQSSDNQHEGNKWKVGRPSDMWSCGCIIYQMIYGKPPYGSFQGQNR--LL 665
           APE +  + Y               G  SD+WSCG I++ ++ G+ P+    G  R  LL
Sbjct: 194 APEIVSGLPYE--------------GFASDVWSCGVILFALLTGRLPFDEENGNVRDLLL 239

Query: 666 AIMNPDVKIPFPEYTSNNEKIPKSAIELMKACLYRNPDKRWTVDKVLSSTFLQPF 720
            +     ++P      N+ +I + A +L+   L  +P +R  +  +LS   L+ +
Sbjct: 240 KVQKGQFEMP------NDTEISRDAQDLIGKILVVDPRQRIKIRDILSHPLLKKY 288

>KNAG0D03980 Chr4 (721049..722170) [1122 bp, 373 aa] {ON} Anc_4.184
           YGR040W
          Length = 373

 Score = 86.3 bits (212), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 77/322 (23%), Positives = 137/322 (42%), Gaps = 62/322 (19%)

Query: 439 SQYEKIELLGRGGSSRVYKVKGSGNKI-YALKRXXXXXXXXXXXXGFKGEIELLEKLKDQ 497
           S Y+ I+L+G G    V       +++  A+K+              + EI+LL      
Sbjct: 11  SSYKLIDLIGEGAYGTVCSALHKPSQVKVAIKKIQPFSKRMFVTRTLR-EIKLLRFFHAH 69

Query: 498 RRVIQLLDYEMGDGL-----LYLIMECGDHDLSQILNQRSNMPLDFNFVRFYTKEMLLCI 552
             +I +LD      +     +Y++ E  + DL ++L  +    L  + ++++  + L  +
Sbjct: 70  ENIISILDQVTPQTVQELQAVYIVQELMETDLHRVLAAQR---LSDDHIQYFVYQTLRAL 126

Query: 553 KVVHDAGIVHSDLKPANFVLVKGI-LKIIDFGIANAVPEHTVNIYRETQIG-------TP 604
           K +H AG++H D+KP+N +L     LK+ DFG+A  +   + +  RET  G       T 
Sbjct: 127 KAIHSAGVIHRDIKPSNLLLNSNCDLKVCDFGLARCLQSSSAS--RETMFGFMTEYVATR 184

Query: 605 NYMAPEALVAMN-YTQSSDNQHEGNKWKVGRPSDMWSCGCIIYQMIYGKPPYGSFQGQNR 663
            Y APE +++   YT +                D+WS GCI+ +M+ G+P +      ++
Sbjct: 185 WYRAPEIMLSFQEYTTA---------------MDIWSVGCILAEMLLGRPLFPGRDYHHQ 229

Query: 664 LLAIMNPDVKIPFP------------EYTSN-------------NEKIPKSAIELMKACL 698
           L  I+   +  P P            EY +              +  I  S ++L+   L
Sbjct: 230 LWLILE-ILGTPHPADFDQIKSRRAREYIAGMPLRQRKPWDLVFSRPIDTSLLDLLTRML 288

Query: 699 YRNPDKRWTVDKVLSSTFLQPF 720
             NPD R T  + L   +L P+
Sbjct: 289 TFNPDNRITAHEALEHAYLAPY 310

>YHR030C Chr8 complement(168890..170344) [1455 bp, 484 aa] {ON}
           SLT2Serine/threonine MAP kinase; involved in regulating
           maintenance of cell wall integrity, progression through
           the cell cycle, and nuclear mRNA retention in heat
           shock; required for mitophagy and pexophagy; affects
           recruitment of mitochondria to the phagophore assembly
           site (PAS); regulated by the PKC1-mediated signaling
           pathway
          Length = 484

 Score = 87.0 bits (214), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 93/373 (24%), Positives = 163/373 (43%), Gaps = 77/373 (20%)

Query: 438 DSQYEKIELLGRGGSSRVYKVK---GSGNKIYALKRXXXXXXXXXXXXGFKGEIELLEKL 494
           D +++ I+ +G G    V   +    + +   A+K+                E++LL   
Sbjct: 20  DKRFQLIKEIGHGAYGIVCSARFAEAAEDTTVAIKKVTNVFSKTLLCKRSLRELKLLRHF 79

Query: 495 KDQRRVIQLLDYEM---GDGL---LYLIMECGDHDLSQILNQRSNMPLDFNFVRFYTKEM 548
           +  + +  L D ++    DG    LYL  E  + D+ QI+  +S  PL     + +T ++
Sbjct: 80  RGHKNITCLYDMDIVFYPDGSINGLYLYEELMECDMHQII--KSGQPLTDAHYQSFTYQI 137

Query: 549 LLCIKVVHDAGIVHSDLKPANFVL-VKGILKIIDFGIANAVPEHTV--NIYRETQIGTPN 605
           L  +K +H A ++H DLKP N ++     LKI DFG+A    E+ V  + +    + T  
Sbjct: 138 LCGLKYIHSADVLHRDLKPGNLLVNADCQLKICDFGLARGYSENPVENSQFLTEYVATRW 197

Query: 606 YMAPEALVA-MNYTQSSDNQHEGNKWKVGRPSDMWSCGCIIYQMIYGKPPYGSFQGQ--- 661
           Y APE +++   YT++                D+WS GCI+ + + GKP    F+G+   
Sbjct: 198 YRAPEIMLSYQGYTKA---------------IDVWSAGCILAEFLGGKP---IFKGKDYV 239

Query: 662 ---NRLLAIMN--PD---------------------VKIPFPEYTSNNEKIPKSAIELMK 695
              N++L ++   PD                      K+PF     N       A++L++
Sbjct: 240 NQLNQILQVLGTPPDETLRRIGSKNVQDYIHQLGFIPKVPFVNLYPNAN---SQALDLLE 296

Query: 696 ACLYRNPDKRWTVDKVLSSTFLQPFMISGSIMEDLIKNAVRYGSEKPQISHD---DLNDV 752
             L  +P KR TVD+ L   +L       SI  D     V   SEK + S +   D+ D+
Sbjct: 297 QMLAFDPQKRITVDEALEHPYL-------SIWHDPADEPV--CSEKFEFSFESVNDMEDL 347

Query: 753 VETVLRKFSDYKI 765
            + V+++  D+++
Sbjct: 348 KQMVIQEVQDFRL 360

>NDAI0G03450 Chr7 (822716..825562) [2847 bp, 948 aa] {ON} Anc_8.141
          Length = 948

 Score = 88.6 bits (218), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 75/278 (26%), Positives = 119/278 (42%), Gaps = 72/278 (25%)

Query: 487 EIELLEKLKDQRRVIQLLDYEMGDGLLYLIME-CGDHDLSQILNQR----SNMPL----- 536
           EI +L+K+ +   +++L+D E      YLIME C   DL+ ++ +R     N PL     
Sbjct: 94  EIAILKKI-NHPHIVKLIDCERTTTDFYLIMEYCALGDLTFLIKKRHELIKNHPLLEKIF 152

Query: 537 --------DFN-----FVRFYTKEMLLCIKVVHDAGIVHSDLKPANFVLVKG-------- 575
                   ++N     F+  Y +++   +K +    +VH D+KP N +L+          
Sbjct: 153 EKYPSPNENYNGLHRAFILNYLQQLASALKFLRSKNLVHRDIKPQNLLLLTPLINYNDSK 212

Query: 576 --------------ILKIIDFGIANAVPEHTVNIYRETQIGTPNYMAPEALVAMNYTQSS 621
                         ILKI DFG A  +P  ++    ET  G+P YMAPE L         
Sbjct: 213 AFKKLGFIGIYELPILKIADFGFARFLPNTSM---AETLCGSPLYMAPEIL--------- 260

Query: 622 DNQHEGNKWKVGRPSDMWSCGCIIYQMIYGKPPYGSFQGQNRLLAIMNPDVKIPFPEY-- 679
                 N  K    +D+WS G ++Y+M YG PP+ +         I   + KI FP Y  
Sbjct: 261 ------NYQKYNAKADLWSVGTVLYEMCYGTPPFKASNHLELYKKIKRSNNKINFPNYIQ 314

Query: 680 TSNNEKIPKSAIELMKACLYRNPDKRWTVDKVLSSTFL 717
             N+ KI      L+   L  +P +R   D+  ++  +
Sbjct: 315 IQNDMKI------LISKLLTFDPQRRIEFDEFFNNNLV 346

>Suva_11.56 Chr11 complement(119479..120675) [1197 bp, 398 aa] {ON}
           YKL166C (REAL)
          Length = 398

 Score = 86.3 bits (212), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 68/250 (27%), Positives = 109/250 (43%), Gaps = 49/250 (19%)

Query: 441 YEKIELLGRGGSSRVYKVKGSGN-KIYALKRXXXXXXXXXXXXGFKGE------------ 487
           ++ +  LG G   RV+ ++ + N + YALK                 +            
Sbjct: 88  FQILRTLGTGSFGRVHLIRSNHNGRFYALKTLKKHTIVKLKQVEHTNDERRMLSIVSHPF 147

Query: 488 -IELLEKLKDQRRVIQLLDYEMGDGLLYLIMECGDHDLSQILNQRSNMPLDFNFVRFYTK 546
            I +    +D ++V  ++DY  G  L  L+ +          +QR   P+     +FY  
Sbjct: 148 IIRMWGTFQDSQQVFMVMDYIEGGELFSLLRK----------SQRFPNPV----AKFYAA 193

Query: 547 EMLLCIKVVHDAGIVHSDLKPANFVLVK-GILKIIDFGIANAVPEHTVNIYRETQIGTPN 605
           E+ L ++ +H   I++ DLKP N +L K G +KI DFG A  VP+ T      T  GTP+
Sbjct: 194 EVCLALEYLHSKDIIYRDLKPENILLDKNGHIKITDFGFAKFVPDVTY-----TLCGTPD 248

Query: 606 YMAPEALVAMNYTQSSDNQHEGNKWKVGRPSDMWSCGCIIYQMIYGKPPYGSFQGQNRLL 665
           Y+APE +    Y +S D       W        WS G +IY+M+ G  P+ +        
Sbjct: 249 YIAPEVVSTKPYNKSVD-------W--------WSFGILIYEMLAGYTPFYNSNTMKTYE 293

Query: 666 AIMNPDVKIP 675
            I+N ++K P
Sbjct: 294 NILNAELKFP 303

>KAFR0C04780 Chr3 (948771..951131) [2361 bp, 786 aa] {ON} Anc_6.371
           YCR091W
          Length = 786

 Score = 87.8 bits (216), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 85/344 (24%), Positives = 139/344 (40%), Gaps = 85/344 (24%)

Query: 414 KKVEIVEPAKS-----ASSSNNRSMITVNDSQYEKIELLGRGGSSRVYKVK-GSGNKIYA 467
           K  ++VEP +S      S SN    I V+   +EKI LLG+G   +VY VK  + N++YA
Sbjct: 336 KGADVVEPKRSRRLRNKSFSNKFQDIRVSPQSFEKIRLLGQGDVGKVYLVKEKASNRLYA 395

Query: 468 LKRXXXXXXXXXXXXGFKGEIELLEKLK------------DQRRVIQLLDYEMGDGLLYL 515
           LK               KGE+   +K+K            +   ++ L      +  LYL
Sbjct: 396 LKILT------------KGEMIKRKKIKRILTEQEILASSNHPFIVTLYHSFQTEDYLYL 443

Query: 516 IME-CGDHDLSQILNQRSNMPLDFNFVRFYTKEMLLCIKVVHDAGIVHSDLKPANFVLVK 574
            ME C   +  + L  R +  +     RFY  E+   ++ +H  G ++ DLKP N +L K
Sbjct: 444 CMEYCMGGEFFRALQTRKSKCISEGDARFYASEVTAALEYLHLLGFIYRDLKPENILLHK 503

Query: 575 -GILKIIDFGIA-----------------------------NAVPEHTV---NIYRETQI 601
            G + + DF ++                             N + +  V        + +
Sbjct: 504 SGHIMLSDFDLSVQANDSGKVKTPMIITPPSSSSSGKRSRSNTMIDTKVFSDGFRTNSFV 563

Query: 602 GTPNYMAPEALVAMNYTQSSDNQHEGNKWKVGRPSDMWSCGCIIYQMIYGKPPYGSFQGQ 661
           GT  Y+APE +    +T + D       W        W+ G +IY+M++G  P+      
Sbjct: 564 GTEEYIAPEVIRGNGHTAAVD-------W--------WTLGILIYEMLFGFTPFKGSNTN 608

Query: 662 NRLLAIMNPDVKIPFPEYTSNNEKIPKSAIELMKACLYRNPDKR 705
                I+  +V  P      NN  + ++  +L+K  L +N  KR
Sbjct: 609 ETFCNILKNEVTFP------NNNDVSRNCKDLIKKLLCKNEQKR 646

>Smik_1.79 Chr1 complement(149839..152763) [2925 bp, 974 aa] {ON}
           YAR019C (REAL)
          Length = 974

 Score = 88.2 bits (217), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 76/281 (27%), Positives = 128/281 (45%), Gaps = 35/281 (12%)

Query: 440 QYEKIELLGRGGSSRVYK-VKGSGNKIYALKRXXXXXXXXXXXXGFKGEIELLEKLKDQR 498
           QY   +++GRG    VYK +    +++ A+K                 EI LL+ L +  
Sbjct: 24  QYHLKQVIGRGSYGVVYKAINKHTDQVVAIKEIVYENDEELN--DIMAEISLLKNL-NHH 80

Query: 499 RVIQLLDYEMGDGLLYLIME-CGDHDLSQILNQRSNMPLDFNFVRFYTKEMLLCIKVVHD 557
            +++   +      LY+++E C +  L ++++ RS+  L  N  + Y  + LL +K +H 
Sbjct: 81  NIVKYHGFIRKSYELYILLEYCANGSLRRLIS-RSSTGLSENESKTYVTQTLLGLKYLHG 139

Query: 558 AGIVHSDLKPANFVL-VKGILKIIDFGIANAVPEHTVNIYRETQIGTPNYMAPEALVAMN 616
            G++H D+K AN +L     +K+ DFG++  V    +     T  GT N+MAPE L    
Sbjct: 140 EGVIHRDIKAANILLSADNTVKLADFGVSTIVNSSAL-----TLAGTLNWMAPEIL---- 190

Query: 617 YTQSSDNQHEGNKWKVGRPSDMWSCGCIIYQMIYGKPPYGSFQGQNRLLAIMNPDVKIPF 676
                     GN+      SD+WS G  + +M+   PPY +    N   A+ N D   P 
Sbjct: 191 ----------GNR-GASTLSDIWSLGATVVEMLTKNPPYHNLTDANIYYAVEN-DTYYP- 237

Query: 677 PEYTSNNEKIPKSAIELMKACLYRNPDKRWTVDKVLSSTFL 717
           P   S + K      + +  C  +N  KR T D++L   ++
Sbjct: 238 PSSFSESLK------DFLSKCFVKNMYKRPTADQLLKHVWI 272

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.315    0.132    0.372 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 80,936,519
Number of extensions: 3671565
Number of successful extensions: 18066
Number of sequences better than 10.0: 2085
Number of HSP's gapped: 15926
Number of HSP's successfully gapped: 2271
Length of query: 765
Length of database: 53,481,399
Length adjustment: 117
Effective length of query: 648
Effective length of database: 40,065,477
Effective search space: 25962429096
Effective search space used: 25962429096
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 70 (31.6 bits)