Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Smik_4.2063.161ON39139120150.0
YDL029W (ARP2)3.161ON39139119900.0
Suva_4.2203.161ON39139119870.0
Skud_4.2223.161ON39139119830.0
NCAS0C035503.161ON39239119400.0
NDAI0G029003.161ON39139119380.0
TDEL0D046103.161ON39139119250.0
Kpol_479.253.161ON39139119120.0
SAKL0C07370g3.161ON39139119020.0
CAGL0K01595g3.161ON39139119020.0
KLLA0C03850g3.161ON39139118860.0
TPHA0A009203.161ON39139118790.0
TBLA0F008703.161ON39139118590.0
KNAG0K01130na 1ON39339318580.0
KLTH0F06490g3.161ON39139118540.0
ZYRO0B04928g3.161ON39139118500.0
ADR316W3.161ON39139118460.0
Ecym_52373.161ON39139118140.0
KAFR0C01040na 1ON33733716360.0
Kwal_33.141773.161ON33733716060.0
Ecym_15208.23ON3763778691e-114
NDAI0G030408.23ON3753778661e-113
ABR222W8.23ON3763778651e-113
NCAS0C037008.23ON3753778641e-113
TDEL0C004708.23ON3753778631e-113
CAGL0K12694g8.23ON3753778631e-113
Suva_6.188.23ON3753778631e-113
Smik_6.398.23ON3753778631e-113
YFL039C (ACT1)8.23ON3753778631e-113
KNAG0L002508.23ON3753778631e-113
KAFR0D009408.23ON3753778631e-113
TPHA0D002508.23ON3753778621e-113
ZYRO0F02772g8.23ON3753778621e-113
TBLA0C004408.23ON3753778621e-113
SAKL0B00968g8.23ON3753778621e-113
KLLA0D05357g8.23ON3753778611e-113
KLTH0G18832g8.23ON3753778611e-113
Kpol_1058.158.23ON3753778581e-112
Skud_6.318.23ON3603698351e-109
Kwal_14.11098.23ON3603698331e-109
SAKL0E11814g2.117ON3793866941e-87
AFR051W2.117ON4053776933e-87
Ecym_63852.117ON3773866844e-86
Kpol_1023.188.23ON3192906785e-86
KLTH0B05940g2.117ON3833886653e-83
KLLA0E22925g2.117ON3803916635e-83
NCAS0B071302.117ON3813816341e-78
ZYRO0G05676g2.117ON3813976296e-78
TBLA0B010702.117ON3833786219e-77
Kwal_33.146422.117ON3833886211e-76
KAFR0F005902.117ON3863786192e-76
YHR129C (ARP1)2.117ON3843785974e-73
Suva_15.3262.117ON3843785966e-73
Smik_8.2102.117ON3843785966e-73
Skud_8.1902.117ON3843785896e-72
TPHA0I013002.117ON3793785861e-71
TDEL0B048102.117ON3733785703e-69
NDAI0B044602.117ON3813815679e-69
KNAG0H036502.117ON3873965305e-63
CAGL0H09042g2.117ON3873804615e-53
Kwal_27.99581.514ON4454414316e-48
KNAG0B001701.514ON4534504308e-48
KLTH0C02508g1.514ON4514484291e-47
TPHA0O010401.514ON4584554282e-47
SAKL0D12804g1.514ON4564534273e-47
Suva_12.1541.514ON4494464246e-47
YJR065C (ARP3)1.514ON4494464246e-47
CAGL0F00517g1.514ON4544514247e-47
Smik_10.3551.514ON4494464211e-46
Skud_10.2891.514ON4494464202e-46
KLLA0B13904g1.514ON4564534177e-46
TBLA0D036801.514ON4584594168e-46
TDEL0F004701.514ON4614584161e-45
KAFR0D037001.514ON4494464142e-45
NCAS0A122701.514ON4544514132e-45
Ecym_31531.514ON4584534081e-44
Kpol_1056.161.514ON4603574072e-44
NDAI0A039701.514ON4624614045e-44
AFR419C1.514ON4554523974e-43
ZYRO0G01936g1.514ON4613563906e-42
NDAI0G055801.287ON5152992112e-17
NCAS0B060601.287ON4972932102e-17
KLTH0G13772g8.258ON4203822065e-17
Skud_10.1321.287ON4882912067e-17
Suva_6.1541.287ON4893032041e-16
YJL081C (ARP4)1.287ON4892982013e-16
Smik_10.1611.287ON4892981978e-16
Kwal_56.238328.258ON4193821906e-15
TDEL0F038508.258ON4193661896e-15
ZYRO0C01738g8.258ON4143621871e-14
AFR105C1.287ON4792951862e-14
KLLA0F19063g8.258ON4153791852e-14
KAFR0B027008.258ON4203711825e-14
SAKL0H17138g8.258ON4193701826e-14
Kpol_543.368.258ON4273761801e-13
KNAG0B019201.287ON5052061801e-13
Ecym_43128.258ON4113581782e-13
Kpol_282.41.287ON5012781773e-13
Suva_14.2812.248ON7552341783e-13
TPHA0A018308.258ON4213671754e-13
AGR091W8.258ON4103621721e-12
KAFR0A015601.287ON4853061721e-12
Skud_14.2722.248ON7552341722e-12
KLTH0H09702g1.287ON4811981712e-12
KLLA0D02288g1.287ON5201941702e-12
CAGL0M03201g1.287ON4932031702e-12
TDEL0D015501.287ON4802921693e-12
TPHA0I010301.287ON5032631675e-12
TBLA0D053601.287ON5962371676e-12
Smik_12.1448.258ON4383901641e-11
Smik_14.2672.248ON7552411651e-11
KNAG0G020108.258ON4243831631e-11
ZYRO0G21428g1.287ON4831931632e-11
CAGL0L12166g8.258ON4213731622e-11
NCAS0B049908.258ON4203821612e-11
NDAI0B019608.258ON4392431586e-11
KLTH0G09482g2.248ON7452281552e-10
Kwal_14.23771.287ON4811851542e-10
Skud_12.1538.258ON4381821532e-10
SAKL0D05874g1.287ON4972771524e-10
Ecym_63301.287ON4801841524e-10
YNL059C (ARP5)2.248ON7552341509e-10
Suva_10.1698.258ON4381821462e-09
YLR085C (ARP6)8.258ON4381821452e-09
KAFR0J011602.248ON7512321462e-09
ZYRO0A01584g2.248ON7481391454e-09
NCAS0G030502.248ON7432281428e-09
NDAI0D010602.248ON7532341411e-08
KLLA0F03421g2.248ON7472021355e-08
TBLA0H014608.258ON4421801346e-08
TBLA0E038602.248ON7592441356e-08
TDEL0C041402.248ON7492331331e-07
Kwal_23.48482.248ON7452291284e-07
SAKL0E08602g2.248ON7472301284e-07
TPHA0C031602.248ON7551341222e-06
CAGL0J10054g2.248ON7542311179e-06
Kpol_1003.162.248ON7492351115e-05
KNAG0I018602.248ON7532311098e-05
ADL253C2.248ON7512291000.001
Ecym_32852.248ON74672920.011
SAKL0H17358g8.251ON311241900.013
NCAS0A147207.448ON485197860.044
Kpol_543.105.477ON876217870.044
KLLA0F11913g8.251ON25398810.13
Kpol_520.117.448ON488360820.14
Ecym_35058.251ON305280810.15
TBLA0H028002.593ON484302810.16
NDAI0A013007.448ON565197810.18
KAFR0K021507.448ON490115780.47
Skud_15.3045.477ON883139780.49
KLLA0F26455g2.618ON863168741.3
Smik_15.3205.477ON873128741.3
YOR141C (ARP8)5.477ON88187722.6
ACR184C7.448ON401154703.4
ADR128C2.618ON86744687.0
KAFR0E025305.477ON842173687.6
SAKL0D00594g8.864ON464199678.3
YPR034W (ARP7)7.448ON477183679.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Smik_4.206
         (391 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Smik_4.206 Chr4 (379506..379527,379652..380805) [1176 bp, 391 aa...   780   0.0  
YDL029W Chr4 (399340..399361,399485..400638) [1176 bp, 391 aa] {...   771   0.0  
Suva_4.220 Chr4 (389822..389843,389967..391120) [1176 bp, 391 aa...   769   0.0  
Skud_4.222 Chr4 (394174..394195,394321..395474) [1176 bp, 391 aa...   768   0.0  
NCAS0C03550 Chr3 (709102..709123,709273..710429) [1179 bp, 392 a...   751   0.0  
NDAI0G02900 Chr7 (671423..671444,671694..672847) [1176 bp, 391 a...   751   0.0  
TDEL0D04610 Chr4 complement(846092..847245,847317..847338) [1176...   746   0.0  
Kpol_479.25 s479 complement(49227..50402) [1176 bp, 391 aa] {ON}...   741   0.0  
SAKL0C07370g Chr3 complement(680403..681556,681672..681693) [117...   737   0.0  
CAGL0K01595g Chr11 (141618..141639,141971..143124) [1176 bp, 391...   737   0.0  
KLLA0C03850g Chr3 complement(351772..352947) [1176 bp, 391 aa] {...   731   0.0  
TPHA0A00920 Chr1 (181205..182380) [1176 bp, 391 aa] {ON} Anc_2.1...   728   0.0  
TBLA0F00870 Chr6 complement(222947..224100,224325..224346) [1176...   720   0.0  
KNAG0K01130 Chr11 (220520..220541,220822..221981) [1182 bp, 393 ...   720   0.0  
KLTH0F06490g Chr6 complement(561947..563100,563192..563213) [117...   718   0.0  
ZYRO0B04928g Chr2 complement(398291..399444,399538..399559) [117...   717   0.0  
ADR316W Chr4 (1261691..1262866) [1176 bp, 391 aa] {ON} Syntenic ...   715   0.0  
Ecym_5237 Chr5 complement(489181..490356) [1176 bp, 391 aa] {ON}...   703   0.0  
KAFR0C01040 Chr3 complement(212570..213583) [1014 bp, 337 aa] {O...   634   0.0  
Kwal_33.14177 s33 complement(557522..558535) [1014 bp, 337 aa] {...   623   0.0  
Ecym_1520 Chr1 (1071497..1071506,1072543..1073663) [1131 bp, 376...   339   e-114
NDAI0G03040 Chr7 complement(708715..709832,710590..710599) [1128...   338   e-113
ABR222W Chr2 (818719..818728,819032..820152) [1131 bp, 376 aa] {...   337   e-113
NCAS0C03700 Chr3 complement(745133..746250,746901..746910) [1128...   337   e-113
TDEL0C00470 Chr3 complement(72546..73663,73929..73938) [1128 bp,...   337   e-113
CAGL0K12694g Chr11 (1258451..1258460,1259340..1260457) [1128 bp,...   337   e-113
Suva_6.18 Chr6 complement(26677..27794,28152..28161) [1128 bp, 3...   337   e-113
Smik_6.39 Chr6 complement(68673..69790,70076..70085) [1128 bp, 3...   337   e-113
YFL039C Chr6 complement(53260..54377,54687..54696) [1128 bp, 375...   337   e-113
KNAG0L00250 Chr12 complement(32595..33712,34194..34203) [1128 bp...   337   e-113
KAFR0D00940 Chr4 complement(198280..199397,199945..199954) [1128...   337   e-113
TPHA0D00250 Chr4 complement(34030..35147,35712..35721) [1128 bp,...   336   e-113
ZYRO0F02772g Chr6 complement(235322..236439,236524..236533) [112...   336   e-113
TBLA0C00440 Chr3 complement(81591..82708,83412..83421) [1128 bp,...   336   e-113
SAKL0B00968g Chr2 complement(89966..91083,91524..91533) [1128 bp...   336   e-113
KLLA0D05357g Chr4 (461726..461735,462516..463633) [1128 bp, 375 ...   336   e-113
KLTH0G18832g Chr7 (1626178..1626187,1626854..1627971) [1128 bp, ...   336   e-113
Kpol_1058.15 s1058 complement(49082..50199,50349..50358) [1128 b...   335   e-112
Skud_6.31 Chr6 complement(56454..57536) [1083 bp, 360 aa] {ON} Y...   326   e-109
Kwal_14.1109 s14 complement(199181..200263) [1083 bp, 360 aa] {O...   325   e-109
SAKL0E11814g Chr5 complement(984199..985338) [1140 bp, 379 aa] {...   271   1e-87
AFR051W Chr6 (522829..524046) [1218 bp, 405 aa] {ON} Syntenic ho...   271   3e-87
Ecym_6385 Chr6 complement(749508..750641) [1134 bp, 377 aa] {ON}...   268   4e-86
Kpol_1023.18 s1023 complement(36072..36143,36193..36201,36244..3...   265   5e-86
KLTH0B05940g Chr2 complement(485135..486286) [1152 bp, 383 aa] {...   260   3e-83
KLLA0E22925g Chr5 complement(2040279..2041421) [1143 bp, 380 aa]...   259   5e-83
NCAS0B07130 Chr2 complement(1354064..1355209) [1146 bp, 381 aa] ...   248   1e-78
ZYRO0G05676g Chr7 (452257..453402) [1146 bp, 381 aa] {ON} simila...   246   6e-78
TBLA0B01070 Chr2 (236811..237962) [1152 bp, 383 aa] {ON} Anc_2.1...   243   9e-77
Kwal_33.14642 s33 (753758..754909) [1152 bp, 383 aa] {ON} YHR129...   243   1e-76
KAFR0F00590 Chr6 (120359..121519) [1161 bp, 386 aa] {ON} Anc_2.1...   243   2e-76
YHR129C Chr8 complement(362999..364153) [1155 bp, 384 aa] {ON}  ...   234   4e-73
Suva_15.326 Chr15 complement(565392..566546) [1155 bp, 384 aa] {...   234   6e-73
Smik_8.210 Chr8 complement(339093..340247) [1155 bp, 384 aa] {ON...   234   6e-73
Skud_8.190 Chr8 complement(336365..337519) [1155 bp, 384 aa] {ON...   231   6e-72
TPHA0I01300 Chr9 (295950..297089) [1140 bp, 379 aa] {ON} Anc_2.1...   230   1e-71
TDEL0B04810 Chr2 (849529..850650) [1122 bp, 373 aa] {ON} Anc_2.1...   224   3e-69
NDAI0B04460 Chr2 complement(1115478..1116623) [1146 bp, 381 aa] ...   223   9e-69
KNAG0H03650 Chr8 complement(678598..679761) [1164 bp, 387 aa] {O...   208   5e-63
CAGL0H09042g Chr8 (884592..885755) [1164 bp, 387 aa] {ON} simila...   182   5e-53
Kwal_27.9958 s27 (139638..140975) [1338 bp, 445 aa] {ON} YJR065C...   170   6e-48
KNAG0B00170 Chr2 (18478..19839) [1362 bp, 453 aa] {ON} Anc_1.514...   170   8e-48
KLTH0C02508g Chr3 (224722..226077) [1356 bp, 451 aa] {ON} highly...   169   1e-47
TPHA0O01040 Chr15 (196178..197554) [1377 bp, 458 aa] {ON} Anc_1....   169   2e-47
SAKL0D12804g Chr4 complement(1066058..1067428) [1371 bp, 456 aa]...   169   3e-47
Suva_12.154 Chr12 complement(235605..236954) [1350 bp, 449 aa] {...   167   6e-47
YJR065C Chr10 complement(557809..559158) [1350 bp, 449 aa] {ON} ...   167   6e-47
CAGL0F00517g Chr6 (54743..56107) [1365 bp, 454 aa] {ON} highly s...   167   7e-47
Smik_10.355 Chr10 complement(546673..548022) [1350 bp, 449 aa] {...   166   1e-46
Skud_10.289 Chr10 complement(515300..516649) [1350 bp, 449 aa] {...   166   2e-46
KLLA0B13904g Chr2 complement(1218228..1219598) [1371 bp, 456 aa]...   165   7e-46
TBLA0D03680 Chr4 (914687..916063) [1377 bp, 458 aa] {ON} Anc_1.5...   164   8e-46
TDEL0F00470 Chr6 (80760..82145) [1386 bp, 461 aa] {ON} Anc_1.514...   164   1e-45
KAFR0D03700 Chr4 complement(718438..719787) [1350 bp, 449 aa] {O...   164   2e-45
NCAS0A12270 Chr1 complement(2428834..2430198) [1365 bp, 454 aa] ...   163   2e-45
Ecym_3153 Chr3 (288213..289589) [1377 bp, 458 aa] {ON} similar t...   161   1e-44
Kpol_1056.16 s1056 (36274..37656) [1383 bp, 460 aa] {ON} (36274....   161   2e-44
NDAI0A03970 Chr1 (895219..896607) [1389 bp, 462 aa] {ON} Anc_1.514    160   5e-44
AFR419C Chr6 complement(1186951..1188318) [1368 bp, 455 aa] {ON}...   157   4e-43
ZYRO0G01936g Chr7 complement(144085..145470) [1386 bp, 461 aa] {...   154   6e-42
NDAI0G05580 Chr7 complement(1374852..1376399) [1548 bp, 515 aa] ...    86   2e-17
NCAS0B06060 Chr2 complement(1146248..1147741) [1494 bp, 497 aa] ...    86   2e-17
KLTH0G13772g Chr7 (1188875..1190137) [1263 bp, 420 aa] {ON} simi...    84   5e-17
Skud_10.132 Chr10 complement(251748..253214) [1467 bp, 488 aa] {...    84   7e-17
Suva_6.154 Chr6 (266531..268000) [1470 bp, 489 aa] {ON} YJL081C ...    83   1e-16
YJL081C Chr10 complement(283802..285271) [1470 bp, 489 aa] {ON} ...    82   3e-16
Smik_10.161 Chr10 complement(275455..276924) [1470 bp, 489 aa] {...    80   8e-16
Kwal_56.23832 s56 (726199..727458) [1260 bp, 419 aa] {ON} YLR085...    78   6e-15
TDEL0F03850 Chr6 complement(707880..709139) [1260 bp, 419 aa] {O...    77   6e-15
ZYRO0C01738g Chr3 (135066..136310) [1245 bp, 414 aa] {ON} simila...    77   1e-14
AFR105C Chr6 complement(625098..626537) [1440 bp, 479 aa] {ON} S...    76   2e-14
KLLA0F19063g Chr6 complement(1756529..1757776) [1248 bp, 415 aa]...    76   2e-14
KAFR0B02700 Chr2 complement(543626..544888) [1263 bp, 420 aa] {O...    75   5e-14
SAKL0H17138g Chr8 (1515123..1516382) [1260 bp, 419 aa] {ON} high...    75   6e-14
Kpol_543.36 s543 complement(80922..82205) [1284 bp, 427 aa] {ON}...    74   1e-13
KNAG0B01920 Chr2 complement(362300..363817) [1518 bp, 505 aa] {O...    74   1e-13
Ecym_4312 Chr4 (671413..672648) [1236 bp, 411 aa] {ON} similar t...    73   2e-13
Kpol_282.4 s282 (8483..9988) [1506 bp, 501 aa] {ON} (8483..9988)...    73   3e-13
Suva_14.281 Chr14 complement(511583..513850) [2268 bp, 755 aa] {...    73   3e-13
TPHA0A01830 Chr1 (369897..371162) [1266 bp, 421 aa] {ON} Anc_8.2...    72   4e-13
AGR091W Chr7 (907238..908470) [1233 bp, 410 aa] {ON} Syntenic ho...    71   1e-12
KAFR0A01560 Chr1 complement(311746..313203) [1458 bp, 485 aa] {O...    71   1e-12
Skud_14.272 Chr14 complement(502920..505187) [2268 bp, 755 aa] {...    71   2e-12
KLTH0H09702g Chr8 complement(835255..836700) [1446 bp, 481 aa] {...    70   2e-12
KLLA0D02288g Chr4 complement(194724..196286) [1563 bp, 520 aa] {...    70   2e-12
CAGL0M03201g Chr13 complement(364771..366252) [1482 bp, 493 aa] ...    70   2e-12
TDEL0D01550 Chr4 complement(305973..307415) [1443 bp, 480 aa] {O...    70   3e-12
TPHA0I01030 Chr9 complement(236150..237661) [1512 bp, 503 aa] {O...    69   5e-12
TBLA0D05360 Chr4 (1321243..1323033) [1791 bp, 596 aa] {ON} Anc_1...    69   6e-12
Smik_12.144 Chr12 complement(280513..281829) [1317 bp, 438 aa] {...    68   1e-11
Smik_14.267 Chr14 complement(493008..495275) [2268 bp, 755 aa] {...    68   1e-11
KNAG0G02010 Chr7 complement(447621..448895) [1275 bp, 424 aa] {O...    67   1e-11
ZYRO0G21428g Chr7 (1766725..1768176) [1452 bp, 483 aa] {ON} high...    67   2e-11
CAGL0L12166g Chr12 complement(1308681..1309946) [1266 bp, 421 aa...    67   2e-11
NCAS0B04990 Chr2 complement(916170..917432) [1263 bp, 420 aa] {O...    67   2e-11
NDAI0B01960 Chr2 complement(477552..478871) [1320 bp, 439 aa] {O...    65   6e-11
KLTH0G09482g Chr7 complement(789233..791470) [2238 bp, 745 aa] {...    64   2e-10
Kwal_14.2377 s14 complement(733179..734624) [1446 bp, 481 aa] {O...    64   2e-10
Skud_12.153 Chr12 complement(284046..285362) [1317 bp, 438 aa] {...    64   2e-10
SAKL0D05874g Chr4 complement(479873..481366) [1494 bp, 497 aa] {...    63   4e-10
Ecym_6330 Chr6 (632900..634342) [1443 bp, 480 aa] {ON} similar t...    63   4e-10
YNL059C Chr14 complement(512668..514935) [2268 bp, 755 aa] {ON} ...    62   9e-10
Suva_10.169 Chr10 complement(305734..307050) [1317 bp, 438 aa] {...    61   2e-09
YLR085C Chr12 complement(300673..301989) [1317 bp, 438 aa] {ON} ...    60   2e-09
KAFR0J01160 Chr10 (212425..214680) [2256 bp, 751 aa] {ON} Anc_2....    61   2e-09
ZYRO0A01584g Chr1 complement(130119..132365) [2247 bp, 748 aa] {...    60   4e-09
NCAS0G03050 Chr7 complement(560525..562756) [2232 bp, 743 aa] {O...    59   8e-09
NDAI0D01060 Chr4 complement(238631..240892) [2262 bp, 753 aa] {O...    59   1e-08
KLLA0F03421g Chr6 complement(321000..323243) [2244 bp, 747 aa] {...    57   5e-08
TBLA0H01460 Chr8 complement(323962..325290) [1329 bp, 442 aa] {O...    56   6e-08
TBLA0E03860 Chr5 complement(969721..972000) [2280 bp, 759 aa] {O...    57   6e-08
TDEL0C04140 Chr3 (732580..734829) [2250 bp, 749 aa] {ON} Anc_2.2...    56   1e-07
Kwal_23.4848 s23 complement(892162..894399) [2238 bp, 745 aa] {O...    54   4e-07
SAKL0E08602g Chr5 (702206..704449) [2244 bp, 747 aa] {ON} simila...    54   4e-07
TPHA0C03160 Chr3 complement(699424..701691) [2268 bp, 755 aa] {O...    52   2e-06
CAGL0J10054g Chr10 complement(985402..987666) [2265 bp, 754 aa] ...    50   9e-06
Kpol_1003.16 s1003 complement(43655..45904) [2250 bp, 749 aa] {O...    47   5e-05
KNAG0I01860 Chr9 (364390..366651) [2262 bp, 753 aa] {ON} Anc_2.2...    47   8e-05
ADL253C Chr4 complement(255550..257805) [2256 bp, 751 aa] {ON} S...    43   0.001
Ecym_3285 Chr3 complement(539184..541424) [2241 bp, 746 aa] {ON}...    40   0.011
SAKL0H17358g Chr8 complement(1535040..1535975) [936 bp, 311 aa] ...    39   0.013
NCAS0A14720 Chr1 (2903450..2904907) [1458 bp, 485 aa] {ON} Anc_7...    38   0.044
Kpol_543.10 s543 complement(25137..27767) [2631 bp, 876 aa] {ON}...    38   0.044
KLLA0F11913g Chr6 complement(1094612..1095373) [762 bp, 253 aa] ...    36   0.13 
Kpol_520.11 s520 complement(26673..28139) [1467 bp, 488 aa] {ON}...    36   0.14 
Ecym_3505 Chr3 complement(941314..942231) [918 bp, 305 aa] {ON} ...    36   0.15 
TBLA0H02800 Chr8 (655357..656811) [1455 bp, 484 aa] {ON} Anc_2.5...    36   0.16 
NDAI0A01300 Chr1 complement(280662..282359) [1698 bp, 565 aa] {O...    36   0.18 
KAFR0K02150 Chr11 (441832..443304) [1473 bp, 490 aa] {ON} Anc_7....    35   0.47 
Skud_15.304 Chr15 complement(543860..546511) [2652 bp, 883 aa] {...    35   0.49 
KLLA0F26455g Chr6 (2450871..2453462) [2592 bp, 863 aa] {ON} simi...    33   1.3  
Smik_15.320 Chr15 complement(551333..553954) [2622 bp, 873 aa] {...    33   1.3  
YOR141C Chr15 complement(589942..592587) [2646 bp, 881 aa] {ON} ...    32   2.6  
ACR184C Chr3 complement(669411..670616) [1206 bp, 401 aa] {ON} S...    32   3.4  
ADR128C Chr4 complement(934445..937048) [2604 bp, 867 aa] {ON} S...    31   7.0  
KAFR0E02530 Chr5 (516623..519151) [2529 bp, 842 aa] {ON} Anc_5.4...    31   7.6  
SAKL0D00594g Chr4 complement(48583..49875,50031..50132) [1395 bp...    30   8.3  
YPR034W Chr16 (639525..640958) [1434 bp, 477 aa] {ON}  ARP7Compo...    30   9.2  

>Smik_4.206 Chr4 (379506..379527,379652..380805) [1176 bp, 391 aa]
           {ON} YDL029W (REAL)
          Length = 391

 Score =  780 bits (2015), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 379/391 (96%), Positives = 379/391 (96%)

Query: 1   MDPHNPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASVTTPLKDIMIGDEA 60
           MDPHNPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASVTTPLKDIMIGDEA
Sbjct: 1   MDPHNPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASVTTPLKDIMIGDEA 60

Query: 61  SDVRSYLQISYPMENGIIKNWTDMELLWDYAFFEQMKLPSTSNGKILLTEPPMNPLKNRE 120
           SDVRSYLQISYPMENGIIKNWTDMELLWDYAFFEQMKLPSTSNGKILLTEPPMNPLKNRE
Sbjct: 61  SDVRSYLQISYPMENGIIKNWTDMELLWDYAFFEQMKLPSTSNGKILLTEPPMNPLKNRE 120

Query: 121 KMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLSHLTRR 180
           KMCEVMFEKYDFGGVYVAIQAVLALYAQGL            THIVPVYESVVLSHLTRR
Sbjct: 121 KMCEVMFEKYDFGGVYVAIQAVLALYAQGLSSGVVVDSGDGVTHIVPVYESVVLSHLTRR 180

Query: 181 LDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLDLDTKLARETTALV 240
           LDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLDLDTKLARETTALV
Sbjct: 181 LDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLDLDTKLARETTALV 240

Query: 241 ESYELPDGRTIKVGQERFEAPECLFQPGLVDVEQPGVGELLFNTVQSADVDIRSSLYKAI 300
           ESYELPDGRTIKVGQERFEAPECLFQPGLVDVEQPGVGELLFNTVQSADVDIRSSLYKAI
Sbjct: 241 ESYELPDGRTIKVGQERFEAPECLFQPGLVDVEQPGVGELLFNTVQSADVDIRSSLYKAI 300

Query: 301 VLSGGSSMYPGLPSRLEKELKQLWFSRVLHNDPSRLDKFKVRIEDPPRRKHMVFIGGAVL 360
           VLSGGSSMYPGLPSRLEKELKQLWFSRVLHNDPSRLDKFKVRIEDPPRRKHMVFIGGAVL
Sbjct: 301 VLSGGSSMYPGLPSRLEKELKQLWFSRVLHNDPSRLDKFKVRIEDPPRRKHMVFIGGAVL 360

Query: 361 ASIMADKDHMWLSKQEWLESGPASMAKFGPR 391
           ASIMADKDHMWLSKQEWLESGPASMAKFGPR
Sbjct: 361 ASIMADKDHMWLSKQEWLESGPASMAKFGPR 391

>YDL029W Chr4 (399340..399361,399485..400638) [1176 bp, 391 aa] {ON}
            ARP2Essential component of the Arp2/3 complex, which is
           a highly conserved actin nucleation center required for
           the motility and integrity of actin patches; involved in
           endocytosis and membrane growth and polarity
          Length = 391

 Score =  771 bits (1990), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 373/391 (95%), Positives = 376/391 (96%)

Query: 1   MDPHNPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASVTTPLKDIMIGDEA 60
           MDPHNPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASV TPLKDIMIGDEA
Sbjct: 1   MDPHNPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASVATPLKDIMIGDEA 60

Query: 61  SDVRSYLQISYPMENGIIKNWTDMELLWDYAFFEQMKLPSTSNGKILLTEPPMNPLKNRE 120
           S+VRSYLQISYPMENGIIKNWTDMELLWDYAFFEQMKLPSTSNGKILLTEPPMNPLKNRE
Sbjct: 61  SEVRSYLQISYPMENGIIKNWTDMELLWDYAFFEQMKLPSTSNGKILLTEPPMNPLKNRE 120

Query: 121 KMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLSHLTRR 180
           KMCEVMFEKYDFGGVYVAIQAVLALYAQGL            THIVPVYESVVLSHLTRR
Sbjct: 121 KMCEVMFEKYDFGGVYVAIQAVLALYAQGLSSGVVVDSGDGVTHIVPVYESVVLSHLTRR 180

Query: 181 LDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLDLDTKLARETTALV 240
           LDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLDLDTKLARETTALV
Sbjct: 181 LDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLDLDTKLARETTALV 240

Query: 241 ESYELPDGRTIKVGQERFEAPECLFQPGLVDVEQPGVGELLFNTVQSADVDIRSSLYKAI 300
           ESYELPDGRTIKVGQERFEAPECLFQPGLVDVEQPGVGELLFNTVQSADVDIRSSLYKAI
Sbjct: 241 ESYELPDGRTIKVGQERFEAPECLFQPGLVDVEQPGVGELLFNTVQSADVDIRSSLYKAI 300

Query: 301 VLSGGSSMYPGLPSRLEKELKQLWFSRVLHNDPSRLDKFKVRIEDPPRRKHMVFIGGAVL 360
           VLSGGSSMYPGLPSRLEKELKQLWFSRVLHNDPSRLDKFKVRIEDPPRRKHMVFIGGAVL
Sbjct: 301 VLSGGSSMYPGLPSRLEKELKQLWFSRVLHNDPSRLDKFKVRIEDPPRRKHMVFIGGAVL 360

Query: 361 ASIMADKDHMWLSKQEWLESGPASMAKFGPR 391
           ASIMADKDHMWLSKQEW ESGP++M KFGPR
Sbjct: 361 ASIMADKDHMWLSKQEWQESGPSAMTKFGPR 391

>Suva_4.220 Chr4 (389822..389843,389967..391120) [1176 bp, 391 aa]
           {ON} YDL029W (REAL)
          Length = 391

 Score =  769 bits (1987), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 373/391 (95%), Positives = 376/391 (96%)

Query: 1   MDPHNPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASVTTPLKDIMIGDEA 60
           MDPHNPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASVTTPLKDIMIGDEA
Sbjct: 1   MDPHNPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASVTTPLKDIMIGDEA 60

Query: 61  SDVRSYLQISYPMENGIIKNWTDMELLWDYAFFEQMKLPSTSNGKILLTEPPMNPLKNRE 120
           SDVRSYLQISYPMENGIIKNWTDMELLWDYAFFEQMKL STSNGKILLTEPPMNPLKNRE
Sbjct: 61  SDVRSYLQISYPMENGIIKNWTDMELLWDYAFFEQMKLQSTSNGKILLTEPPMNPLKNRE 120

Query: 121 KMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLSHLTRR 180
           KMCEVMFEKYDFGGVYVAIQAVLALYAQGL            THIVPVYESVVL+HLTRR
Sbjct: 121 KMCEVMFEKYDFGGVYVAIQAVLALYAQGLSSGVVVDSGDGVTHIVPVYESVVLNHLTRR 180

Query: 181 LDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLDLDTKLARETTALV 240
           LDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLDLDTKLARETT LV
Sbjct: 181 LDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLDLDTKLARETTTLV 240

Query: 241 ESYELPDGRTIKVGQERFEAPECLFQPGLVDVEQPGVGELLFNTVQSADVDIRSSLYKAI 300
           ESYELPDGRTIKVGQERFEAPECLFQPGLVDVEQPGVGELLFNTVQSADVDIRSSLYKAI
Sbjct: 241 ESYELPDGRTIKVGQERFEAPECLFQPGLVDVEQPGVGELLFNTVQSADVDIRSSLYKAI 300

Query: 301 VLSGGSSMYPGLPSRLEKELKQLWFSRVLHNDPSRLDKFKVRIEDPPRRKHMVFIGGAVL 360
           VLSGGSSMYPGLPSRLEKELKQLWFSRVLHNDPSRLDKFKVRIEDPPRRKHMVFIGGAVL
Sbjct: 301 VLSGGSSMYPGLPSRLEKELKQLWFSRVLHNDPSRLDKFKVRIEDPPRRKHMVFIGGAVL 360

Query: 361 ASIMADKDHMWLSKQEWLESGPASMAKFGPR 391
           ASIMADKDHMWLSKQEW ESGPA+M+KFGPR
Sbjct: 361 ASIMADKDHMWLSKQEWQESGPAAMSKFGPR 391

>Skud_4.222 Chr4 (394174..394195,394321..395474) [1176 bp, 391 aa]
           {ON} YDL029W (REAL)
          Length = 391

 Score =  768 bits (1983), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 372/391 (95%), Positives = 375/391 (95%)

Query: 1   MDPHNPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASVTTPLKDIMIGDEA 60
           MDPHNPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASV TPLKDIMIGDEA
Sbjct: 1   MDPHNPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASVATPLKDIMIGDEA 60

Query: 61  SDVRSYLQISYPMENGIIKNWTDMELLWDYAFFEQMKLPSTSNGKILLTEPPMNPLKNRE 120
           SDVRSYLQISYPMENGIIKNWTDMELLWDYAFFEQMKLPSTSNGKILLTEPPMNPLKNRE
Sbjct: 61  SDVRSYLQISYPMENGIIKNWTDMELLWDYAFFEQMKLPSTSNGKILLTEPPMNPLKNRE 120

Query: 121 KMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLSHLTRR 180
           KMCEVMFEKYDFGGVYVAIQAVLALYAQGL            THIVPVYESVVLSHLTRR
Sbjct: 121 KMCEVMFEKYDFGGVYVAIQAVLALYAQGLSSGVVVDSGDGVTHIVPVYESVVLSHLTRR 180

Query: 181 LDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLDLDTKLARETTALV 240
           LDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLDLDTKLARETT LV
Sbjct: 181 LDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLDLDTKLARETTVLV 240

Query: 241 ESYELPDGRTIKVGQERFEAPECLFQPGLVDVEQPGVGELLFNTVQSADVDIRSSLYKAI 300
           ESYELPDGRTIKVGQERFEAPECLFQPGLVDVEQPGVGELLFNTVQSADVDIRSSLY+AI
Sbjct: 241 ESYELPDGRTIKVGQERFEAPECLFQPGLVDVEQPGVGELLFNTVQSADVDIRSSLYRAI 300

Query: 301 VLSGGSSMYPGLPSRLEKELKQLWFSRVLHNDPSRLDKFKVRIEDPPRRKHMVFIGGAVL 360
           VLSGGSSMYPGLPSRLEKELKQLWF+RVLHNDPSRLDKFKVRIEDPPRRKHMVFIGGAVL
Sbjct: 301 VLSGGSSMYPGLPSRLEKELKQLWFNRVLHNDPSRLDKFKVRIEDPPRRKHMVFIGGAVL 360

Query: 361 ASIMADKDHMWLSKQEWLESGPASMAKFGPR 391
           ASIMADKDHMWLSKQEW ESGPA+M KFGPR
Sbjct: 361 ASIMADKDHMWLSKQEWQESGPAAMTKFGPR 391

>NCAS0C03550 Chr3 (709102..709123,709273..710429) [1179 bp, 392 aa]
           {ON} Anc_3.161
          Length = 392

 Score =  751 bits (1940), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 361/391 (92%), Positives = 372/391 (95%)

Query: 1   MDPHNPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASVTTPLKDIMIGDEA 60
           MDPH+PIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERA++TTPLKDIMIGDEA
Sbjct: 1   MDPHSPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERANITTPLKDIMIGDEA 60

Query: 61  SDVRSYLQISYPMENGIIKNWTDMELLWDYAFFEQMKLPSTSNGKILLTEPPMNPLKNRE 120
           S+VRSYLQISYPMENGIIKNWTDMELLWDYAFFEQMKLP+TSNGKILLTEPPMNP KNRE
Sbjct: 61  SEVRSYLQISYPMENGIIKNWTDMELLWDYAFFEQMKLPTTSNGKILLTEPPMNPTKNRE 120

Query: 121 KMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLSHLTRR 180
           KMCEVMFEKYDFGGVYVAIQAVLALYAQGL            THIVPVYESVVL HLTRR
Sbjct: 121 KMCEVMFEKYDFGGVYVAIQAVLALYAQGLSSGVVVDSGDGVTHIVPVYESVVLGHLTRR 180

Query: 181 LDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLDLDTKLARETTALV 240
           LDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLDLDTKLARETT LV
Sbjct: 181 LDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLDLDTKLARETTTLV 240

Query: 241 ESYELPDGRTIKVGQERFEAPECLFQPGLVDVEQPGVGELLFNTVQSADVDIRSSLYKAI 300
           ESYELPDGRTIKVGQERFEAPECLFQPGLVDVEQPG+GELLF+TVQSADVD+RS+LYKAI
Sbjct: 241 ESYELPDGRTIKVGQERFEAPECLFQPGLVDVEQPGMGELLFDTVQSADVDVRSALYKAI 300

Query: 301 VLSGGSSMYPGLPSRLEKELKQLWFSRVLHNDPSRLDKFKVRIEDPPRRKHMVFIGGAVL 360
           VLSGGSSMYPGLPSRLEKELKQLWF+RVL NDP+RLDKFKVRIEDPPRRKHMVFIGGAVL
Sbjct: 301 VLSGGSSMYPGLPSRLEKELKQLWFTRVLRNDPTRLDKFKVRIEDPPRRKHMVFIGGAVL 360

Query: 361 ASIMADKDHMWLSKQEWLESGPASMAKFGPR 391
           ASIMADKDHMWLSKQEW ESG ASM KFGPR
Sbjct: 361 ASIMADKDHMWLSKQEWQESGAASMVKFGPR 391

>NDAI0G02900 Chr7 (671423..671444,671694..672847) [1176 bp, 391 aa]
           {ON} Anc_3.161 YDL029W
          Length = 391

 Score =  751 bits (1938), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 360/391 (92%), Positives = 372/391 (95%)

Query: 1   MDPHNPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASVTTPLKDIMIGDEA 60
           MDPH+PIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERA++TTPL+DIMIGDEA
Sbjct: 1   MDPHSPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERANITTPLRDIMIGDEA 60

Query: 61  SDVRSYLQISYPMENGIIKNWTDMELLWDYAFFEQMKLPSTSNGKILLTEPPMNPLKNRE 120
           SDVRSYLQISYPMENGIIKNWTDMELLWDYAFF QMKL +TS GKILLTEPPMNPLKNRE
Sbjct: 61  SDVRSYLQISYPMENGIIKNWTDMELLWDYAFFNQMKLNNTSGGKILLTEPPMNPLKNRE 120

Query: 121 KMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLSHLTRR 180
           KMCEVMFEKYDFGGVYVAIQAVLALYAQGL            THIVPVYESVVL+HLTRR
Sbjct: 121 KMCEVMFEKYDFGGVYVAIQAVLALYAQGLSSGVVVDSGDGVTHIVPVYESVVLNHLTRR 180

Query: 181 LDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLDLDTKLARETTALV 240
           LDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLDLDTKLARETT LV
Sbjct: 181 LDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLDLDTKLARETTTLV 240

Query: 241 ESYELPDGRTIKVGQERFEAPECLFQPGLVDVEQPGVGELLFNTVQSADVDIRSSLYKAI 300
           ESYELPDGRTIKVGQERFEAPECLFQPGLVDVEQPGVGELLFNT+QSADVD+RS+LYKAI
Sbjct: 241 ESYELPDGRTIKVGQERFEAPECLFQPGLVDVEQPGVGELLFNTIQSADVDVRSALYKAI 300

Query: 301 VLSGGSSMYPGLPSRLEKELKQLWFSRVLHNDPSRLDKFKVRIEDPPRRKHMVFIGGAVL 360
           VLSGGSSMYPGLPSRLEKELKQLW++RVLHNDPSRLDKFKVRIEDPPRRKHMVFIGGAVL
Sbjct: 301 VLSGGSSMYPGLPSRLEKELKQLWYTRVLHNDPSRLDKFKVRIEDPPRRKHMVFIGGAVL 360

Query: 361 ASIMADKDHMWLSKQEWLESGPASMAKFGPR 391
           ASIMADKDHMWLSKQEW E G A+MAKFGPR
Sbjct: 361 ASIMADKDHMWLSKQEWYEGGAAAMAKFGPR 391

>TDEL0D04610 Chr4 complement(846092..847245,847317..847338) [1176
           bp, 391 aa] {ON} Anc_3.161 YDL029W
          Length = 391

 Score =  746 bits (1925), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 355/391 (90%), Positives = 373/391 (95%)

Query: 1   MDPHNPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASVTTPLKDIMIGDEA 60
           MDPHNPIVLDQGTGFVKIGRAGENFPD+TFPSIVGRPILRAEERA+V+TPLKDIMIGDEA
Sbjct: 1   MDPHNPIVLDQGTGFVKIGRAGENFPDHTFPSIVGRPILRAEERANVSTPLKDIMIGDEA 60

Query: 61  SDVRSYLQISYPMENGIIKNWTDMELLWDYAFFEQMKLPSTSNGKILLTEPPMNPLKNRE 120
           SDVRSYLQISYPMENGIIKNWTDMELLWDYAFF+QMKLP+TSNGKILLTEPPMNP+KNRE
Sbjct: 61  SDVRSYLQISYPMENGIIKNWTDMELLWDYAFFDQMKLPTTSNGKILLTEPPMNPVKNRE 120

Query: 121 KMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLSHLTRR 180
           +MCEVMFEKYDFGGVYVAIQAVLALYAQGL            THIVPVYESVVL+HLTRR
Sbjct: 121 QMCEVMFEKYDFGGVYVAIQAVLALYAQGLSSGVVVDSGDGVTHIVPVYESVVLNHLTRR 180

Query: 181 LDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLDLDTKLARETTALV 240
           LDVAGRDVTRHLIDLLSRRGYAFNR+ADFETVRQIKEK+CYVSYDLDLDTKLARETT LV
Sbjct: 181 LDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQIKEKVCYVSYDLDLDTKLARETTTLV 240

Query: 241 ESYELPDGRTIKVGQERFEAPECLFQPGLVDVEQPGVGELLFNTVQSADVDIRSSLYKAI 300
           E+YELPDGR IKVGQERFEAPECLFQP LVDVEQ GVGELLFNT+Q+ADVDIRS+LY+AI
Sbjct: 241 ENYELPDGRVIKVGQERFEAPECLFQPSLVDVEQAGVGELLFNTIQTADVDIRSALYRAI 300

Query: 301 VLSGGSSMYPGLPSRLEKELKQLWFSRVLHNDPSRLDKFKVRIEDPPRRKHMVFIGGAVL 360
           VLSGGSSMYPGLPSRLEKELKQLWF+RVLHND SRLDKFKVRIEDPPRRKHMVFIGGAVL
Sbjct: 301 VLSGGSSMYPGLPSRLEKELKQLWFTRVLHNDASRLDKFKVRIEDPPRRKHMVFIGGAVL 360

Query: 361 ASIMADKDHMWLSKQEWLESGPASMAKFGPR 391
           A+IMADKDHMWLSKQEW ESGPA+MAKFGPR
Sbjct: 361 ANIMADKDHMWLSKQEWQESGPAAMAKFGPR 391

>Kpol_479.25 s479 complement(49227..50402) [1176 bp, 391 aa] {ON}
           complement(49227..50402) [1176 nt, 392 aa]
          Length = 391

 Score =  741 bits (1912), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 354/391 (90%), Positives = 370/391 (94%)

Query: 1   MDPHNPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASVTTPLKDIMIGDEA 60
           MDPH+PIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERAS++TPLKDIMIGDEA
Sbjct: 1   MDPHSPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASISTPLKDIMIGDEA 60

Query: 61  SDVRSYLQISYPMENGIIKNWTDMELLWDYAFFEQMKLPSTSNGKILLTEPPMNPLKNRE 120
           S+VRSYLQISYPMENGIIKNWTDMELLWDYAF+EQMKLPSTS GK+LLTEPPMNPLKNRE
Sbjct: 61  SEVRSYLQISYPMENGIIKNWTDMELLWDYAFYEQMKLPSTSGGKVLLTEPPMNPLKNRE 120

Query: 121 KMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLSHLTRR 180
           +MCEVMFEKYDFGGVYVAIQAVLALYAQGL            THIVPVYESVVL+HLTRR
Sbjct: 121 QMCEVMFEKYDFGGVYVAIQAVLALYAQGLSSGVVVDSGDGVTHIVPVYESVVLNHLTRR 180

Query: 181 LDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLDLDTKLARETTALV 240
           LDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLDLDT+LARETT LV
Sbjct: 181 LDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLDLDTRLARETTTLV 240

Query: 241 ESYELPDGRTIKVGQERFEAPECLFQPGLVDVEQPGVGELLFNTVQSADVDIRSSLYKAI 300
           E YELPDGR IKVGQERFEAPECLFQP LVDVE  GVGELLFNT+QSADVD+RSSLYKAI
Sbjct: 241 EKYELPDGRIIKVGQERFEAPECLFQPNLVDVESAGVGELLFNTIQSADVDVRSSLYKAI 300

Query: 301 VLSGGSSMYPGLPSRLEKELKQLWFSRVLHNDPSRLDKFKVRIEDPPRRKHMVFIGGAVL 360
           VLSGGSSMYPGLPSRLEKELKQLWF+RVL+ DPSRLDKFKVRIEDPPRRKHMVFIGGAVL
Sbjct: 301 VLSGGSSMYPGLPSRLEKELKQLWFTRVLNKDPSRLDKFKVRIEDPPRRKHMVFIGGAVL 360

Query: 361 ASIMADKDHMWLSKQEWLESGPASMAKFGPR 391
           A+IMADKDHMWLSKQEW ESGPA+M+KFGPR
Sbjct: 361 ANIMADKDHMWLSKQEWQESGPAAMSKFGPR 391

>SAKL0C07370g Chr3 complement(680403..681556,681672..681693) [1176
           bp, 391 aa] {ON} highly similar to uniprot|P32381
           Saccharomyces cerevisiae YDL029W ARP2 Essential
           component of the Arp2/3 complex which is a highly
           conserved actin nucleation center required for the
           motility and integrity of actin patches involved in
           endocytosis and membrane growth and polarity
          Length = 391

 Score =  737 bits (1902), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 349/391 (89%), Positives = 369/391 (94%)

Query: 1   MDPHNPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASVTTPLKDIMIGDEA 60
           MDPH PIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERAS+TTPLKDIMIGDEA
Sbjct: 1   MDPHTPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASITTPLKDIMIGDEA 60

Query: 61  SDVRSYLQISYPMENGIIKNWTDMELLWDYAFFEQMKLPSTSNGKILLTEPPMNPLKNRE 120
           SDVRSYLQISYPMENGIIKNW DMELLWDYAF+EQMKLPSTS GK+LLTEPPMNPL+NRE
Sbjct: 61  SDVRSYLQISYPMENGIIKNWADMELLWDYAFYEQMKLPSTSGGKVLLTEPPMNPLRNRE 120

Query: 121 KMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLSHLTRR 180
           +MCEVMFEKYDFGGVYVAIQAVLALYAQGL            THIVPVYESVVLSHLT+R
Sbjct: 121 QMCEVMFEKYDFGGVYVAIQAVLALYAQGLSSGVVVDSGDGVTHIVPVYESVVLSHLTKR 180

Query: 181 LDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLDLDTKLARETTALV 240
           LDVAGRDVTRHLIDLLSRRGYAFNR+ADFETVRQIKEKLCYVSYDLDLDTKLARETT LV
Sbjct: 181 LDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQIKEKLCYVSYDLDLDTKLARETTTLV 240

Query: 241 ESYELPDGRTIKVGQERFEAPECLFQPGLVDVEQPGVGELLFNTVQSADVDIRSSLYKAI 300
           E+YELPDGR IKVG ERFEAPECLFQP LVDVEQPGVGE+LFNTVQ+ADVD+R++LY+A+
Sbjct: 241 ENYELPDGRVIKVGSERFEAPECLFQPSLVDVEQPGVGEMLFNTVQAADVDVRTALYRAV 300

Query: 301 VLSGGSSMYPGLPSRLEKELKQLWFSRVLHNDPSRLDKFKVRIEDPPRRKHMVFIGGAVL 360
           VLSGGSSMYPGLPSRLEKELKQLWF+RVL NDPSRLDKFKVRIEDPPRRKHMVFIGGAVL
Sbjct: 301 VLSGGSSMYPGLPSRLEKELKQLWFTRVLRNDPSRLDKFKVRIEDPPRRKHMVFIGGAVL 360

Query: 361 ASIMADKDHMWLSKQEWLESGPASMAKFGPR 391
           A+IMADKDHMWL+KQEW E GPA+M+KFGPR
Sbjct: 361 ANIMADKDHMWLTKQEWQEMGPAAMSKFGPR 391

>CAGL0K01595g Chr11 (141618..141639,141971..143124) [1176 bp, 391
           aa] {ON} highly similar to uniprot|P32381 Saccharomyces
           cerevisiae YDL029w ACT2
          Length = 391

 Score =  737 bits (1902), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 350/391 (89%), Positives = 369/391 (94%)

Query: 1   MDPHNPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASVTTPLKDIMIGDEA 60
           MDPHNPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERA++  PLKDIMIGDEA
Sbjct: 1   MDPHNPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERATINKPLKDIMIGDEA 60

Query: 61  SDVRSYLQISYPMENGIIKNWTDMELLWDYAFFEQMKLPSTSNGKILLTEPPMNPLKNRE 120
           SDVRSYLQISYPMENGIIKNWTDMELLWDYAFF QM+LP+TS GKILLTEPPMNP+KNRE
Sbjct: 61  SDVRSYLQISYPMENGIIKNWTDMELLWDYAFFNQMQLPTTSGGKILLTEPPMNPVKNRE 120

Query: 121 KMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLSHLTRR 180
           +MCEVMFEKYDFGGVYVAIQAVLALYAQGL            THIVPVYESVVL+HLTRR
Sbjct: 121 QMCEVMFEKYDFGGVYVAIQAVLALYAQGLSSGVVVDSGDGVTHIVPVYESVVLNHLTRR 180

Query: 181 LDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLDLDTKLARETTALV 240
           LDVAGRDVTRHLIDLLSRRGYAFNR+ADFETVRQIKEKLCYVSYDLDLDTKLARETT LV
Sbjct: 181 LDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQIKEKLCYVSYDLDLDTKLARETTTLV 240

Query: 241 ESYELPDGRTIKVGQERFEAPECLFQPGLVDVEQPGVGELLFNTVQSADVDIRSSLYKAI 300
           E+YELPDGR IKVGQERFEAPECLFQP LVDVEQ G+GELLFNT+QSADVD+RSSLYKAI
Sbjct: 241 ENYELPDGRIIKVGQERFEAPECLFQPNLVDVEQAGIGELLFNTIQSADVDVRSSLYKAI 300

Query: 301 VLSGGSSMYPGLPSRLEKELKQLWFSRVLHNDPSRLDKFKVRIEDPPRRKHMVFIGGAVL 360
           VLSGGSSMYPGLPSRLEKELKQLWF+RVL+NDP+RLDKFKVRIEDPPRR+HMVFIGGAVL
Sbjct: 301 VLSGGSSMYPGLPSRLEKELKQLWFTRVLNNDPTRLDKFKVRIEDPPRRRHMVFIGGAVL 360

Query: 361 ASIMADKDHMWLSKQEWLESGPASMAKFGPR 391
           ASIMADKDHMWL+KQEW ESG A+M+KFGPR
Sbjct: 361 ASIMADKDHMWLTKQEWRESGAAAMSKFGPR 391

>KLLA0C03850g Chr3 complement(351772..352947) [1176 bp, 391 aa] {ON}
           highly similar to uniprot|P32381 Saccharomyces
           cerevisiae YDL029W ARP2 Essential component of the
           Arp2/3 complex which is a highly conserved actin
           nucleation center required for the motility and
           integrity of actin patches involved in endocytosis and
           membrane growth and polarity
          Length = 391

 Score =  731 bits (1886), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 349/391 (89%), Positives = 365/391 (93%)

Query: 1   MDPHNPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASVTTPLKDIMIGDEA 60
           MDPH PIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEER   +TPLKDIMIGDEA
Sbjct: 1   MDPHTPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERGHASTPLKDIMIGDEA 60

Query: 61  SDVRSYLQISYPMENGIIKNWTDMELLWDYAFFEQMKLPSTSNGKILLTEPPMNPLKNRE 120
           S+VRSYLQISYPMENGII+NW DMELLWDYAFFEQMKLP+TS GK+LLTEPPMNP+KNRE
Sbjct: 61  SEVRSYLQISYPMENGIIRNWADMELLWDYAFFEQMKLPTTSGGKVLLTEPPMNPIKNRE 120

Query: 121 KMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLSHLTRR 180
           +MCEVMFEKYDFGG YVAIQAVLALYAQGL            THIVPVYESVVL+HLTRR
Sbjct: 121 QMCEVMFEKYDFGGTYVAIQAVLALYAQGLSSGVVVDSGDGVTHIVPVYESVVLNHLTRR 180

Query: 181 LDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLDLDTKLARETTALV 240
           LDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLDLDTKLARETT LV
Sbjct: 181 LDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLDLDTKLARETTTLV 240

Query: 241 ESYELPDGRTIKVGQERFEAPECLFQPGLVDVEQPGVGELLFNTVQSADVDIRSSLYKAI 300
           ESYELPDGR IKVG ERFEAPECLFQP LVDVEQPGVGELLFNT+Q+ADVDIR+SLYKAI
Sbjct: 241 ESYELPDGRVIKVGPERFEAPECLFQPSLVDVEQPGVGELLFNTIQAADVDIRTSLYKAI 300

Query: 301 VLSGGSSMYPGLPSRLEKELKQLWFSRVLHNDPSRLDKFKVRIEDPPRRKHMVFIGGAVL 360
           VLSGGSSMYPGLPSRLEKELKQLWF+RVL NDP+RLDKFKVRIEDPPRRKHMVFIGGAVL
Sbjct: 301 VLSGGSSMYPGLPSRLEKELKQLWFTRVLRNDPTRLDKFKVRIEDPPRRKHMVFIGGAVL 360

Query: 361 ASIMADKDHMWLSKQEWLESGPASMAKFGPR 391
           A+IMADKDHMWLSKQEW E GPA+M+KFGPR
Sbjct: 361 ANIMADKDHMWLSKQEWHEIGPAAMSKFGPR 391

>TPHA0A00920 Chr1 (181205..182380) [1176 bp, 391 aa] {ON} Anc_2.117
           YHR129C
          Length = 391

 Score =  728 bits (1879), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 346/391 (88%), Positives = 367/391 (93%)

Query: 1   MDPHNPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASVTTPLKDIMIGDEA 60
           MDPH+PIVLDQGTGFVKIGRAGENFPD+TFPSIVGRPILRAEER ++  PLKD+MIG+EA
Sbjct: 1   MDPHSPIVLDQGTGFVKIGRAGENFPDHTFPSIVGRPILRAEERGNLNIPLKDVMIGEEA 60

Query: 61  SDVRSYLQISYPMENGIIKNWTDMELLWDYAFFEQMKLPSTSNGKILLTEPPMNPLKNRE 120
           S VRSYLQISYPMENGIIKNWTDMELLWDYAF+EQMKLPSTS GK+LLTEPP+NPLKNRE
Sbjct: 61  SAVRSYLQISYPMENGIIKNWTDMELLWDYAFYEQMKLPSTSGGKVLLTEPPLNPLKNRE 120

Query: 121 KMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLSHLTRR 180
           KMCEVMFEKYDFGGVYVAIQAVLALYAQGL            THIVPVYESVVL+HLTRR
Sbjct: 121 KMCEVMFEKYDFGGVYVAIQAVLALYAQGLSSGVVIDSGDGVTHIVPVYESVVLNHLTRR 180

Query: 181 LDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLDLDTKLARETTALV 240
           LDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDL+LDTKLARETT LV
Sbjct: 181 LDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLELDTKLARETTTLV 240

Query: 241 ESYELPDGRTIKVGQERFEAPECLFQPGLVDVEQPGVGELLFNTVQSADVDIRSSLYKAI 300
           E+YELPDGR IKVGQERFEA ECLFQP LVDVE  GVGELLFNT+QSAD+D+RSSLYKAI
Sbjct: 241 ENYELPDGRVIKVGQERFEAAECLFQPNLVDVESAGVGELLFNTIQSADIDVRSSLYKAI 300

Query: 301 VLSGGSSMYPGLPSRLEKELKQLWFSRVLHNDPSRLDKFKVRIEDPPRRKHMVFIGGAVL 360
           VLSGGSSMYPGLPSR+EKELKQLW++RVL+NDP+RLDKFKVRIEDPPRRKHMVFIGGAVL
Sbjct: 301 VLSGGSSMYPGLPSRIEKELKQLWYTRVLNNDPARLDKFKVRIEDPPRRKHMVFIGGAVL 360

Query: 361 ASIMADKDHMWLSKQEWLESGPASMAKFGPR 391
           ASIMADKDHMWLSKQEW ESGPA+MAKFGPR
Sbjct: 361 ASIMADKDHMWLSKQEWAESGPAAMAKFGPR 391

>TBLA0F00870 Chr6 complement(222947..224100,224325..224346) [1176
           bp, 391 aa] {ON} Anc_3.161 YDL029W
          Length = 391

 Score =  720 bits (1859), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 340/391 (86%), Positives = 365/391 (93%)

Query: 1   MDPHNPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASVTTPLKDIMIGDEA 60
           MDPH+PIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEER +++TPLKDIMIGDEA
Sbjct: 1   MDPHSPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERGTISTPLKDIMIGDEA 60

Query: 61  SDVRSYLQISYPMENGIIKNWTDMELLWDYAFFEQMKLPSTSNGKILLTEPPMNPLKNRE 120
           S+VRSYLQISYPMENGIIKNWTDMELLWDYAFF QMKLP+TS GK+LLTEPPMNP+KNRE
Sbjct: 61  SEVRSYLQISYPMENGIIKNWTDMELLWDYAFFNQMKLPTTSGGKVLLTEPPMNPVKNRE 120

Query: 121 KMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLSHLTRR 180
           +MCEVMFE+YDFGGVYVAIQAVLALYAQGL            THIVPVYESVVL+HLTRR
Sbjct: 121 RMCEVMFERYDFGGVYVAIQAVLALYAQGLSSGVVVDSGDGVTHIVPVYESVVLNHLTRR 180

Query: 181 LDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLDLDTKLARETTALV 240
           LDVAGRDVTRHLIDLLSRRGY+FNRTADFETVRQIKEK+CYVSYDL+LDTKLARETT LV
Sbjct: 181 LDVAGRDVTRHLIDLLSRRGYSFNRTADFETVRQIKEKVCYVSYDLNLDTKLARETTTLV 240

Query: 241 ESYELPDGRTIKVGQERFEAPECLFQPGLVDVEQPGVGELLFNTVQSADVDIRSSLYKAI 300
           + YELPDGR IKVGQERFEAPECLFQP LVDVE PGVGELLFNT+QSAD+D+RSSLYKAI
Sbjct: 241 QEYELPDGRIIKVGQERFEAPECLFQPDLVDVESPGVGELLFNTIQSADIDVRSSLYKAI 300

Query: 301 VLSGGSSMYPGLPSRLEKELKQLWFSRVLHNDPSRLDKFKVRIEDPPRRKHMVFIGGAVL 360
           VLSGGSSMYPGLPSRLE+ELKQLWF+R+L  D  RLDKFKVRIEDPPRRKHMVFIGGAVL
Sbjct: 301 VLSGGSSMYPGLPSRLERELKQLWFTRILKGDAERLDKFKVRIEDPPRRKHMVFIGGAVL 360

Query: 361 ASIMADKDHMWLSKQEWLESGPASMAKFGPR 391
           A+IMADKDHMWLSKQEW E+G A++AKFGPR
Sbjct: 361 ANIMADKDHMWLSKQEWQENGAAALAKFGPR 391

>KNAG0K01130 Chr11 (220520..220541,220822..221981) [1182 bp, 393 aa]
           {ON} 
          Length = 393

 Score =  720 bits (1858), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 348/393 (88%), Positives = 366/393 (93%), Gaps = 2/393 (0%)

Query: 1   MDPHNPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASV--TTPLKDIMIGD 58
           MDPH+PIVLDQGTGFVKIGRAGENFPD+TFPSIVGRPILRAEER+ +   TP+KDIM+G+
Sbjct: 1   MDPHSPIVLDQGTGFVKIGRAGENFPDFTFPSIVGRPILRAEERSFMDSKTPIKDIMVGE 60

Query: 59  EASDVRSYLQISYPMENGIIKNWTDMELLWDYAFFEQMKLPSTSNGKILLTEPPMNPLKN 118
           EASDVRSYLQISYPMENGIIK+WTDMELLWD+AFFE+MKLPSTS GKILLTEPPMNPLKN
Sbjct: 61  EASDVRSYLQISYPMENGIIKHWTDMELLWDHAFFEKMKLPSTSGGKILLTEPPMNPLKN 120

Query: 119 REKMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLSHLT 178
           RE MC+VMFEKYDFGGVYVAIQAVLALYAQGL            THIVPVYESVVL+HLT
Sbjct: 121 REMMCQVMFEKYDFGGVYVAIQAVLALYAQGLSSGVVVDSGDGVTHIVPVYESVVLNHLT 180

Query: 179 RRLDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLDLDTKLARETTA 238
           RRLDVAGRDVTRHLIDLLSRRGYAFNR+ADFETVRQIKEKL YVSYDLD DTKLARETT 
Sbjct: 181 RRLDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQIKEKLSYVSYDLDFDTKLARETTT 240

Query: 239 LVESYELPDGRTIKVGQERFEAPECLFQPGLVDVEQPGVGELLFNTVQSADVDIRSSLYK 298
           LVE+YELPDGR IKVGQERFEAPECLFQP LVDVEQPGVGELLFNT+QSADVDIRSSLYK
Sbjct: 241 LVENYELPDGRIIKVGQERFEAPECLFQPNLVDVEQPGVGELLFNTIQSADVDIRSSLYK 300

Query: 299 AIVLSGGSSMYPGLPSRLEKELKQLWFSRVLHNDPSRLDKFKVRIEDPPRRKHMVFIGGA 358
           AIVLSGGSSMYPGLPSRLEKELKQLWF+RVL NDPSRLDKFKVRIEDPPRRKHMVFIGGA
Sbjct: 301 AIVLSGGSSMYPGLPSRLEKELKQLWFTRVLKNDPSRLDKFKVRIEDPPRRKHMVFIGGA 360

Query: 359 VLASIMADKDHMWLSKQEWLESGPASMAKFGPR 391
           VLA+IMADKDHMWLSKQEW ESG  +MAKFGPR
Sbjct: 361 VLANIMADKDHMWLSKQEWEESGAQAMAKFGPR 393

>KLTH0F06490g Chr6 complement(561947..563100,563192..563213) [1176
           bp, 391 aa] {ON} highly similar to uniprot|P32381
           Saccharomyces cerevisiae YDL029W ARP2 Essential
           component of the Arp2/3 complex which is a highly
           conserved actin nucleation center required for the
           motility and integrity of actin patches involved in
           endocytosis and membrane growth and polarity
          Length = 391

 Score =  718 bits (1854), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 341/391 (87%), Positives = 365/391 (93%)

Query: 1   MDPHNPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASVTTPLKDIMIGDEA 60
           MD   PIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERA+V TPLKDIMIGDEA
Sbjct: 1   MDLRTPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERANVVTPLKDIMIGDEA 60

Query: 61  SDVRSYLQISYPMENGIIKNWTDMELLWDYAFFEQMKLPSTSNGKILLTEPPMNPLKNRE 120
           S VRSYLQISYPMENG+IKNW+DMELLWDYAF++QMKLPSTS GK++LTEPPMNPL+NRE
Sbjct: 61  SAVRSYLQISYPMENGVIKNWSDMELLWDYAFYDQMKLPSTSGGKVMLTEPPMNPLRNRE 120

Query: 121 KMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLSHLTRR 180
           +MCEVMFEKYDFGGVYVAIQAVLALYAQGL            THIVPVYESVVL+HLTRR
Sbjct: 121 QMCEVMFEKYDFGGVYVAIQAVLALYAQGLSSGVVVDSGDGVTHIVPVYESVVLNHLTRR 180

Query: 181 LDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLDLDTKLARETTALV 240
           LDVAGRDVTRHLIDLLSRRGYAFNR+ADFETVRQIKEKL YVSYDLDLDTKLARETT LV
Sbjct: 181 LDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQIKEKLSYVSYDLDLDTKLARETTTLV 240

Query: 241 ESYELPDGRTIKVGQERFEAPECLFQPGLVDVEQPGVGELLFNTVQSADVDIRSSLYKAI 300
           E+YELPDGR IKVG ERFEAPECLFQP LVDVEQPGVGE+LFNT+Q+ADVD+RS+LY+AI
Sbjct: 241 ENYELPDGRVIKVGSERFEAPECLFQPNLVDVEQPGVGEMLFNTIQAADVDVRSALYRAI 300

Query: 301 VLSGGSSMYPGLPSRLEKELKQLWFSRVLHNDPSRLDKFKVRIEDPPRRKHMVFIGGAVL 360
           VLSGGSSMYPGLPSRLEKELKQLWF+RVL NDPSRL+KFKVRIEDPPRRKHMVFIGGAVL
Sbjct: 301 VLSGGSSMYPGLPSRLEKELKQLWFTRVLRNDPSRLEKFKVRIEDPPRRKHMVFIGGAVL 360

Query: 361 ASIMADKDHMWLSKQEWLESGPASMAKFGPR 391
           A+IMADKDHMWLSKQEW E GP++M+KFGPR
Sbjct: 361 ANIMADKDHMWLSKQEWQEMGPSAMSKFGPR 391

>ZYRO0B04928g Chr2 complement(398291..399444,399538..399559) [1176
           bp, 391 aa] {ON} highly similar to uniprot|P32381
           Saccharomyces cerevisiae YDL029W ARP2 Essential
           component of the Arp2/3 complex which is a highly
           conserved actin nucleation center required for the
           motility and integrity of actin patches involved in
           endocytosis and membrane growth and polarity
          Length = 391

 Score =  717 bits (1850), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 342/391 (87%), Positives = 364/391 (93%)

Query: 1   MDPHNPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASVTTPLKDIMIGDEA 60
           MDPH+PIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEER S++TPLKDIMIG+EA
Sbjct: 1   MDPHSPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERGSISTPLKDIMIGEEA 60

Query: 61  SDVRSYLQISYPMENGIIKNWTDMELLWDYAFFEQMKLPSTSNGKILLTEPPMNPLKNRE 120
           SDVRSYLQISYPMENGII+NW DME LWDYAF+ QMK PSTS GKILLTEPPMNPLKNRE
Sbjct: 61  SDVRSYLQISYPMENGIIRNWQDMEHLWDYAFYNQMKFPSTSGGKILLTEPPMNPLKNRE 120

Query: 121 KMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLSHLTRR 180
            MCEVMFEKYDFGGVYVAIQAVLALYAQGL            THIVPVYESVVL+HLTRR
Sbjct: 121 LMCEVMFEKYDFGGVYVAIQAVLALYAQGLSSGVVVDSGDGVTHIVPVYESVVLNHLTRR 180

Query: 181 LDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLDLDTKLARETTALV 240
           LDVAGRDVTRHLIDLLSRRGYAFNR+ADFETVRQIKEKL YVSYDL+LDTKLARETT LV
Sbjct: 181 LDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQIKEKLSYVSYDLNLDTKLARETTVLV 240

Query: 241 ESYELPDGRTIKVGQERFEAPECLFQPGLVDVEQPGVGELLFNTVQSADVDIRSSLYKAI 300
           E+YELPDGR IKVGQERFEAPECLFQP LVDVEQPG+GELLFNT+QSADVDIRSSLY+AI
Sbjct: 241 ENYELPDGRVIKVGQERFEAPECLFQPDLVDVEQPGIGELLFNTIQSADVDIRSSLYRAI 300

Query: 301 VLSGGSSMYPGLPSRLEKELKQLWFSRVLHNDPSRLDKFKVRIEDPPRRKHMVFIGGAVL 360
           VLSGGSSMYPGLPSRLEKELKQLW++R+L  D +RLDKFKV+IEDPPRRKHMVFIGGAVL
Sbjct: 301 VLSGGSSMYPGLPSRLEKELKQLWYTRILRGDAARLDKFKVKIEDPPRRKHMVFIGGAVL 360

Query: 361 ASIMADKDHMWLSKQEWLESGPASMAKFGPR 391
           ASIMA+KDHMWL+K+EW ESGPA+MAKFGPR
Sbjct: 361 ASIMAEKDHMWLTKEEWHESGPAAMAKFGPR 391

>ADR316W Chr4 (1261691..1262866) [1176 bp, 391 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDL029W (ARP2)
          Length = 391

 Score =  715 bits (1846), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 339/391 (86%), Positives = 364/391 (93%)

Query: 1   MDPHNPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASVTTPLKDIMIGDEA 60
           MDP  PIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRA+ERA+V+TPLKDIMIGDEA
Sbjct: 1   MDPQKPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRADERANVSTPLKDIMIGDEA 60

Query: 61  SDVRSYLQISYPMENGIIKNWTDMELLWDYAFFEQMKLPSTSNGKILLTEPPMNPLKNRE 120
           S VRSYLQISYPMENGII++W DMELLWDYAF+EQMKLPSTS GK+LLTEPPMNPL+NRE
Sbjct: 61  SQVRSYLQISYPMENGIIRDWADMELLWDYAFYEQMKLPSTSGGKVLLTEPPMNPLRNRE 120

Query: 121 KMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLSHLTRR 180
           +MCEVMFEKYDFGGVYV IQAVLALYAQGL            THIVPVYESVVL+HLTRR
Sbjct: 121 QMCEVMFEKYDFGGVYVGIQAVLALYAQGLSSGVVVDSGDGVTHIVPVYESVVLNHLTRR 180

Query: 181 LDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLDLDTKLARETTALV 240
           LDVAGRD+TR+LIDLLSRRGYAFN+TADFETVRQIKEKLCYVSYDLDLDT+LA+ETT LV
Sbjct: 181 LDVAGRDMTRYLIDLLSRRGYAFNKTADFETVRQIKEKLCYVSYDLDLDTRLAQETTTLV 240

Query: 241 ESYELPDGRTIKVGQERFEAPECLFQPGLVDVEQPGVGELLFNTVQSADVDIRSSLYKAI 300
           E YELPDGR IKVG ERFEAPECLFQP LVDVEQPG+GE+LFNT+QSADVDI S+LYKAI
Sbjct: 241 EQYELPDGRVIKVGSERFEAPECLFQPSLVDVEQPGIGEMLFNTIQSADVDIVSTLYKAI 300

Query: 301 VLSGGSSMYPGLPSRLEKELKQLWFSRVLHNDPSRLDKFKVRIEDPPRRKHMVFIGGAVL 360
           VLSGGSSMYPGLPSRLEKELKQLWF+RVL NDP+RL+KFKVRIEDPPRRKHMVF GGAVL
Sbjct: 301 VLSGGSSMYPGLPSRLEKELKQLWFTRVLKNDPTRLEKFKVRIEDPPRRKHMVFTGGAVL 360

Query: 361 ASIMADKDHMWLSKQEWLESGPASMAKFGPR 391
           ASIMADK+HMWL+KQEW ESGPASM+KFGPR
Sbjct: 361 ASIMADKEHMWLTKQEWEESGPASMSKFGPR 391

>Ecym_5237 Chr5 complement(489181..490356) [1176 bp, 391 aa] {ON}
           similar to Ashbya gossypii ADR316W
          Length = 391

 Score =  703 bits (1814), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 333/391 (85%), Positives = 362/391 (92%)

Query: 1   MDPHNPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASVTTPLKDIMIGDEA 60
           MDP+ PIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRA ER++++TPLKDIMIGDEA
Sbjct: 1   MDPYVPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAGERSNISTPLKDIMIGDEA 60

Query: 61  SDVRSYLQISYPMENGIIKNWTDMELLWDYAFFEQMKLPSTSNGKILLTEPPMNPLKNRE 120
           S+VRSYLQISYPMENGIIKNW DME LWDYAF++QMK+PST+  K+LLTEPPMNPLKNRE
Sbjct: 61  SNVRSYLQISYPMENGIIKNWADMEQLWDYAFYDQMKIPSTAGHKVLLTEPPMNPLKNRE 120

Query: 121 KMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLSHLTRR 180
           +MCEVMFEKYDFGGVYVAIQAVLALYAQGL            THIVPVYESVVL+HLTRR
Sbjct: 121 QMCEVMFEKYDFGGVYVAIQAVLALYAQGLSSGVVVDSGDGVTHIVPVYESVVLNHLTRR 180

Query: 181 LDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLDLDTKLARETTALV 240
           LDVAGRDVTR+LIDLLSRRGYAFN+TADFETVRQIKEKLCYVSYDLDLDTKLA ETT LV
Sbjct: 181 LDVAGRDVTRYLIDLLSRRGYAFNKTADFETVRQIKEKLCYVSYDLDLDTKLAHETTTLV 240

Query: 241 ESYELPDGRTIKVGQERFEAPECLFQPGLVDVEQPGVGELLFNTVQSADVDIRSSLYKAI 300
           E+YELPDGR IKVG ERFEAPECLFQP LVDVEQ G+GE+LF+T+QSADVDI S+LY+AI
Sbjct: 241 ETYELPDGRVIKVGSERFEAPECLFQPSLVDVEQQGIGEMLFSTIQSADVDIISALYRAI 300

Query: 301 VLSGGSSMYPGLPSRLEKELKQLWFSRVLHNDPSRLDKFKVRIEDPPRRKHMVFIGGAVL 360
           VLSGGSSMYPGLPSRLEKELKQLWF+RVL NDP+RLDKFKVRIEDPPRRKHMVF GGAVL
Sbjct: 301 VLSGGSSMYPGLPSRLEKELKQLWFTRVLKNDPARLDKFKVRIEDPPRRKHMVFTGGAVL 360

Query: 361 ASIMADKDHMWLSKQEWLESGPASMAKFGPR 391
           A+IMADKDHMWL+K+EW E GPA+M+KFGPR
Sbjct: 361 ANIMADKDHMWLTKKEWEEMGPAAMSKFGPR 391

>KAFR0C01040 Chr3 complement(212570..213583) [1014 bp, 337 aa] {ON} 
          Length = 337

 Score =  634 bits (1636), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 304/337 (90%), Positives = 317/337 (94%)

Query: 55  MIGDEASDVRSYLQISYPMENGIIKNWTDMELLWDYAFFEQMKLPSTSNGKILLTEPPMN 114
           MIG EAS+VRSYLQISYPMENGIIKNWTDMELLWDYAF+EQMKLP TSNGKILLTEPPMN
Sbjct: 1   MIGGEASEVRSYLQISYPMENGIIKNWTDMELLWDYAFYEQMKLPDTSNGKILLTEPPMN 60

Query: 115 PLKNREKMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVL 174
           P+KNREKMCEVMFEKY+FGGVYVAIQAVLALYAQGL            THIVPVYESVVL
Sbjct: 61  PIKNREKMCEVMFEKYNFGGVYVAIQAVLALYAQGLSSGVVVDSGDGVTHIVPVYESVVL 120

Query: 175 SHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLDLDTKLAR 234
           +HLTRRLDVAGRDVTR+LIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLDLDTKLAR
Sbjct: 121 NHLTRRLDVAGRDVTRNLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLDLDTKLAR 180

Query: 235 ETTALVESYELPDGRTIKVGQERFEAPECLFQPGLVDVEQPGVGELLFNTVQSADVDIRS 294
           ETT LVESYELPDGR IKVG ERFEAPECLFQP LVDVEQ GVGELLFNT+QSADVDIRS
Sbjct: 181 ETTTLVESYELPDGRVIKVGSERFEAPECLFQPNLVDVEQAGVGELLFNTIQSADVDIRS 240

Query: 295 SLYKAIVLSGGSSMYPGLPSRLEKELKQLWFSRVLHNDPSRLDKFKVRIEDPPRRKHMVF 354
           +L+KAIVLSGGSSMYPGLPSRLEKELKQLWF+RVLHNDP+RLDKFKVRIEDPPRRKHMVF
Sbjct: 241 TLFKAIVLSGGSSMYPGLPSRLEKELKQLWFTRVLHNDPTRLDKFKVRIEDPPRRKHMVF 300

Query: 355 IGGAVLASIMADKDHMWLSKQEWLESGPASMAKFGPR 391
           IGGAVLA+IMADKDHMWLSKQEW ESGPA+MAKFGPR
Sbjct: 301 IGGAVLANIMADKDHMWLSKQEWEESGPAAMAKFGPR 337

>Kwal_33.14177 s33 complement(557522..558535) [1014 bp, 337 aa] {ON}
           YDL029W (ARP2) - actin-related protein [contig 105] FULL
          Length = 337

 Score =  623 bits (1606), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 294/337 (87%), Positives = 315/337 (93%)

Query: 55  MIGDEASDVRSYLQISYPMENGIIKNWTDMELLWDYAFFEQMKLPSTSNGKILLTEPPMN 114
           MIGDEAS VRSYLQISYPMENG+IKNW+DMELLWDYAF++QM+LPSTS GK++LTEPPMN
Sbjct: 1   MIGDEASAVRSYLQISYPMENGVIKNWSDMELLWDYAFYDQMQLPSTSGGKVMLTEPPMN 60

Query: 115 PLKNREKMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVL 174
           P+KNRE+MCEVMFEKYDFGGVYVAIQAVLALYAQGL            THIVPVYESVVL
Sbjct: 61  PVKNREQMCEVMFEKYDFGGVYVAIQAVLALYAQGLSSGVVVDSGDGVTHIVPVYESVVL 120

Query: 175 SHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLDLDTKLAR 234
           +HLTRRLDVAGRDVTRHLIDLLSRRGYAFNR+ADFETVRQIKEKL YVSYDLDLDTKLAR
Sbjct: 121 NHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRSADFETVRQIKEKLSYVSYDLDLDTKLAR 180

Query: 235 ETTALVESYELPDGRTIKVGQERFEAPECLFQPGLVDVEQPGVGELLFNTVQSADVDIRS 294
           ETT LVE+YELPDGR IKVG ERFEAPECLFQP LVDVEQPGVGE+LFNT+QSADVD+RS
Sbjct: 181 ETTTLVENYELPDGRVIKVGSERFEAPECLFQPSLVDVEQPGVGEMLFNTIQSADVDVRS 240

Query: 295 SLYKAIVLSGGSSMYPGLPSRLEKELKQLWFSRVLHNDPSRLDKFKVRIEDPPRRKHMVF 354
           +LY+AIVLSGGSSMYPGLPSRLEKELKQLWF+RVLHNDPSRLDKFKVRIEDPPRRKHMVF
Sbjct: 241 ALYRAIVLSGGSSMYPGLPSRLEKELKQLWFTRVLHNDPSRLDKFKVRIEDPPRRKHMVF 300

Query: 355 IGGAVLASIMADKDHMWLSKQEWLESGPASMAKFGPR 391
           IGGAVLA+IMADKDHMWLSKQEW E G A+M+KFGPR
Sbjct: 301 IGGAVLANIMADKDHMWLSKQEWQEMGSAAMSKFGPR 337

>Ecym_1520 Chr1 (1071497..1071506,1072543..1073663) [1131 bp, 376
           aa] {ON} similar to Ashbya gossypii ABR222W  1-intron
          Length = 376

 Score =  339 bits (869), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 167/377 (44%), Positives = 243/377 (64%), Gaps = 16/377 (4%)

Query: 7   IVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASVTTPLKDIMIGDEASDVRSY 66
           +V+D G+G  K G AG++ P   FPSIVGRP     +   V    KD  +GDEA   R  
Sbjct: 9   LVIDNGSGMCKAGFAGDDAPRAVFPSIVGRP---RHQGIMVGMGQKDCYVGDEAQSKRGI 65

Query: 67  LQISYPMENGIIKNWTDMELLWDYAFFEQMKLPSTSNGKILLTEPPMNPLKNREKMCEVM 126
           L + YP+E+GI+ NW DME +W + F+ ++++    +  +LLTE PMNP  NREKM ++M
Sbjct: 66  LTLRYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEH-PVLLTEAPMNPKSNREKMTQIM 124

Query: 127 FEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLSHLTRRLDVAGR 186
           FE ++    YV+IQAVL+LY+ G             TH+VP+Y    L H   R+D+AGR
Sbjct: 125 FETFNVPAFYVSIQAVLSLYSSGRTTGIVLDSGDGVTHVVPIYAGFSLPHAILRIDLAGR 184

Query: 187 DVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLDLDTKLARETTALVESYELP 246
           D+T +L+ +LS RGY+F+ TA+ E VR IKEKLCYV+ D D + + A +++A+ +SYELP
Sbjct: 185 DMTDYLMKILSERGYSFSTTAEREIVRDIKEKLCYVALDYDQEMQTAAQSSAIEKSYELP 244

Query: 247 DGRTIKVGQERFEAPECLFQPGLVDVEQPGVGELLFNTVQSADVDIRSSLYKAIVLSGGS 306
           DG+ I +G ERF APE LF P ++ +E  G+ +  +N++   DVD+R  LY  IV+SGG+
Sbjct: 245 DGQVITIGNERFRAPEALFHPSVLGLEAAGIDQTTYNSIMKCDVDVRKELYGNIVMSGGT 304

Query: 307 SMYPGLPSRLEKELKQLWFSRVLHNDPSRLDKFKVRIEDPPRRKHMVFIGGAVLASIMAD 366
           +M+PG+  R++KE+  L         PS +   KV+I  PP RK+ V+IGG++LAS+   
Sbjct: 305 TMFPGIAERMQKEITAL--------APSSM---KVKIIAPPERKYSVWIGGSILASLTTF 353

Query: 367 KDHMWLSKQEWLESGPA 383
           +  MW+SKQE+ ESGP+
Sbjct: 354 Q-QMWISKQEYDESGPS 369

>NDAI0G03040 Chr7 complement(708715..709832,710590..710599) [1128
           bp, 375 aa] {ON} Anc_8.23 YFL039C
          Length = 375

 Score =  338 bits (866), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 166/377 (44%), Positives = 243/377 (64%), Gaps = 16/377 (4%)

Query: 7   IVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASVTTPLKDIMIGDEASDVRSY 66
           +V+D G+G  K G AG++ P   FPSIVGRP     +   V    KD  +GDEA   R  
Sbjct: 8   LVIDNGSGMCKAGFAGDDAPRAVFPSIVGRP---RHQGIMVGMGQKDSYVGDEAQSKRGI 64

Query: 67  LQISYPMENGIIKNWTDMELLWDYAFFEQMKLPSTSNGKILLTEPPMNPLKNREKMCEVM 126
           L + YP+E+GI+ NW DME +W + F+ ++++    +  +LLTE PMNP  NREKM ++M
Sbjct: 65  LTLRYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEH-PVLLTEAPMNPKSNREKMTQIM 123

Query: 127 FEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLSHLTRRLDVAGR 186
           FE ++    YV+IQAVL+LY+ G             TH+VP+Y    L H   R+D+AGR
Sbjct: 124 FETFNVPAFYVSIQAVLSLYSSGRTTGIVLDSGDGVTHVVPIYAGFSLPHAILRIDLAGR 183

Query: 187 DVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLDLDTKLARETTALVESYELP 246
           D+T +L+ +LS RGY+F+ TA+ E VR IKEKLCYV+ D + + + A +++++ +SYELP
Sbjct: 184 DLTDYLMKILSERGYSFSTTAEREIVRDIKEKLCYVALDFEQEMQTASQSSSIEKSYELP 243

Query: 247 DGRTIKVGQERFEAPECLFQPGLVDVEQPGVGELLFNTVQSADVDIRSSLYKAIVLSGGS 306
           DG+ I +G ERF APE LF P ++ +E  G+ +  +N++   DVD+R  LY  IV+SGGS
Sbjct: 244 DGQVITIGNERFRAPEALFHPSVLGLESSGIDQTTYNSIMKCDVDVRKELYGNIVMSGGS 303

Query: 307 SMYPGLPSRLEKELKQLWFSRVLHNDPSRLDKFKVRIEDPPRRKHMVFIGGAVLASIMAD 366
           +M+PG+  R++KE+  L         PS +   KV+I  PP RK+ V+IGG++LAS+   
Sbjct: 304 TMFPGIAERMQKEITAL--------APSSM---KVKIIAPPERKYSVWIGGSILASLTTF 352

Query: 367 KDHMWLSKQEWLESGPA 383
           +  MW+SKQE+ ESGP+
Sbjct: 353 Q-QMWISKQEYDESGPS 368

>ABR222W Chr2 (818719..818728,819032..820152) [1131 bp, 376 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YFL039C
           (ACT1); 1-intron
          Length = 376

 Score =  337 bits (865), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 166/377 (44%), Positives = 243/377 (64%), Gaps = 16/377 (4%)

Query: 7   IVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASVTTPLKDIMIGDEASDVRSY 66
           +V+D G+G  K G AG++ P   FPSIVGRP     +   V    KD  +GDEA   R  
Sbjct: 9   LVIDNGSGMCKAGFAGDDAPRAVFPSIVGRP---RHQGIMVGMGQKDSYVGDEAQSKRGI 65

Query: 67  LQISYPMENGIIKNWTDMELLWDYAFFEQMKLPSTSNGKILLTEPPMNPLKNREKMCEVM 126
           L + YP+E+GI+ NW DME +W + F+ ++++    +  +LLTE PMNP  NREKM ++M
Sbjct: 66  LTLRYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEH-PVLLTEAPMNPKSNREKMTQIM 124

Query: 127 FEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLSHLTRRLDVAGR 186
           FE ++    YV+IQAVL+LY+ G             TH+VP+Y    L H   R+D+AGR
Sbjct: 125 FETFNVPAFYVSIQAVLSLYSSGRTTGIVLDSGDGVTHVVPIYAGFSLPHAILRIDLAGR 184

Query: 187 DVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLDLDTKLARETTALVESYELP 246
           D+T +L+ +LS RGY+F+ TA+ E VR IKEKLCYV+ D + + + A +++A+ +SYELP
Sbjct: 185 DMTDYLMKILSERGYSFSTTAEREIVRDIKEKLCYVALDFEQEMQTAAQSSAIEKSYELP 244

Query: 247 DGRTIKVGQERFEAPECLFQPGLVDVEQPGVGELLFNTVQSADVDIRSSLYKAIVLSGGS 306
           DG+ I +G ERF APE LF P ++ +E  G+ +  +N++   DVD+R  LY  IV+SGG+
Sbjct: 245 DGQVITIGNERFRAPEALFHPSVLGLEAAGIDQTTYNSIMKCDVDVRKELYGNIVMSGGT 304

Query: 307 SMYPGLPSRLEKELKQLWFSRVLHNDPSRLDKFKVRIEDPPRRKHMVFIGGAVLASIMAD 366
           +M+PG+  R++KE+  L         PS +   KV+I  PP RK+ V+IGG++LAS+   
Sbjct: 305 TMFPGIAERMQKEITAL--------APSSM---KVKIIAPPERKYSVWIGGSILASLTTF 353

Query: 367 KDHMWLSKQEWLESGPA 383
           +  MW+SKQE+ ESGP+
Sbjct: 354 Q-QMWISKQEYDESGPS 369

>NCAS0C03700 Chr3 complement(745133..746250,746901..746910) [1128
           bp, 375 aa] {ON} Anc_8.23 YFL039C
          Length = 375

 Score =  337 bits (864), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 165/377 (43%), Positives = 243/377 (64%), Gaps = 16/377 (4%)

Query: 7   IVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASVTTPLKDIMIGDEASDVRSY 66
           +V+D G+G  K G AG++ P   FPSIVGRP     +   V    KD  +GDEA   R  
Sbjct: 8   LVIDNGSGMCKAGFAGDDAPRAVFPSIVGRP---RHQGIMVGMGQKDSYVGDEAQSKRGI 64

Query: 67  LQISYPMENGIIKNWTDMELLWDYAFFEQMKLPSTSNGKILLTEPPMNPLKNREKMCEVM 126
           L + YP+E+GI+ NW DME +W + F+ ++++    +  +LLTE PMNP  NREKM ++M
Sbjct: 65  LTLRYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEH-PVLLTEAPMNPKSNREKMTQIM 123

Query: 127 FEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLSHLTRRLDVAGR 186
           FE ++    YV+IQAVL+LY+ G             TH+VP+Y    L H   R+D+AGR
Sbjct: 124 FETFNVPAFYVSIQAVLSLYSSGRTTGIVLDSGDGVTHVVPIYAGFSLPHAILRIDLAGR 183

Query: 187 DVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLDLDTKLARETTALVESYELP 246
           D+T +L+ +LS RGY+F+ TA+ E VR IKEKLCYV+ D + + + A +++++ +SYELP
Sbjct: 184 DLTDYLMKILSERGYSFSTTAEREIVRDIKEKLCYVALDFEQEMQTAAQSSSIEKSYELP 243

Query: 247 DGRTIKVGQERFEAPECLFQPGLVDVEQPGVGELLFNTVQSADVDIRSSLYKAIVLSGGS 306
           DG+ I +G ERF APE LF P ++ +E  G+ +  +N++   DVD+R  LY  IV+SGG+
Sbjct: 244 DGQVITIGNERFRAPEALFHPSILSLESAGIDQTTYNSIMKCDVDVRKELYGNIVMSGGT 303

Query: 307 SMYPGLPSRLEKELKQLWFSRVLHNDPSRLDKFKVRIEDPPRRKHMVFIGGAVLASIMAD 366
           +M+PG+  R++KE+  L         PS +   KV+I  PP RK+ V+IGG++LAS+   
Sbjct: 304 TMFPGIAERMQKEITAL--------APSSM---KVKIIAPPERKYSVWIGGSILASLTTF 352

Query: 367 KDHMWLSKQEWLESGPA 383
           +  MW+SKQE+ ESGP+
Sbjct: 353 Q-QMWISKQEYDESGPS 368

>TDEL0C00470 Chr3 complement(72546..73663,73929..73938) [1128 bp,
           375 aa] {ON} 
          Length = 375

 Score =  337 bits (863), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 165/377 (43%), Positives = 243/377 (64%), Gaps = 16/377 (4%)

Query: 7   IVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASVTTPLKDIMIGDEASDVRSY 66
           +V+D G+G  K G AG++ P   FPSIVGRP     +   V    KD  +GDEA   R  
Sbjct: 8   LVIDNGSGMCKAGFAGDDAPRAVFPSIVGRP---RHQGIMVGMGQKDSYVGDEAQSKRGI 64

Query: 67  LQISYPMENGIIKNWTDMELLWDYAFFEQMKLPSTSNGKILLTEPPMNPLKNREKMCEVM 126
           L + YP+E+GI+ NW DME +W + F+ ++++    +  +LLTE PMNP  NREKM ++M
Sbjct: 65  LTLRYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEH-PVLLTEAPMNPKSNREKMTQIM 123

Query: 127 FEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLSHLTRRLDVAGR 186
           FE ++    YV+IQAVL+LY+ G             TH+VP+Y    L H   R+D+AGR
Sbjct: 124 FETFNVPAFYVSIQAVLSLYSSGRTTGIVLDSGDGVTHVVPIYAGFSLPHAILRIDLAGR 183

Query: 187 DVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLDLDTKLARETTALVESYELP 246
           D+T +L+ +LS RGY+F+ TA+ E VR IKEKLCYV+ D + + + A +++++ +SYELP
Sbjct: 184 DLTDYLMKILSERGYSFSTTAEREIVRDIKEKLCYVALDFEQEMQTAAQSSSIEKSYELP 243

Query: 247 DGRTIKVGQERFEAPECLFQPGLVDVEQPGVGELLFNTVQSADVDIRSSLYKAIVLSGGS 306
           DG+ I +G ERF APE LF P ++ +E  G+ +  +N++   DVD+R  LY  IV+SGG+
Sbjct: 244 DGQVITIGNERFRAPEALFHPSVLGLESAGIDQTTYNSIMKCDVDVRKELYGNIVMSGGT 303

Query: 307 SMYPGLPSRLEKELKQLWFSRVLHNDPSRLDKFKVRIEDPPRRKHMVFIGGAVLASIMAD 366
           +M+PG+  R++KE+  L         PS +   KV+I  PP RK+ V+IGG++LAS+   
Sbjct: 304 TMFPGIAERMQKEITAL--------APSSM---KVKIIAPPERKYSVWIGGSILASLTTF 352

Query: 367 KDHMWLSKQEWLESGPA 383
           +  MW+SKQE+ ESGP+
Sbjct: 353 Q-QMWISKQEYDESGPS 368

>CAGL0K12694g Chr11 (1258451..1258460,1259340..1260457) [1128 bp,
           375 aa] {ON} highly similar to uniprot|P02579
           Saccharomyces cerevisiae YFL039c ACT1 actin
          Length = 375

 Score =  337 bits (863), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 165/377 (43%), Positives = 243/377 (64%), Gaps = 16/377 (4%)

Query: 7   IVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASVTTPLKDIMIGDEASDVRSY 66
           +V+D G+G  K G AG++ P   FPSIVGRP     +   V    KD  +GDEA   R  
Sbjct: 8   LVIDNGSGMCKAGFAGDDAPRAVFPSIVGRP---RHQGIMVGMGQKDSYVGDEAQSKRGI 64

Query: 67  LQISYPMENGIIKNWTDMELLWDYAFFEQMKLPSTSNGKILLTEPPMNPLKNREKMCEVM 126
           L + YP+E+GI+ NW DME +W + F+ ++++    +  +LLTE PMNP  NREKM ++M
Sbjct: 65  LTLRYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEH-PVLLTEAPMNPKSNREKMTQIM 123

Query: 127 FEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLSHLTRRLDVAGR 186
           FE ++    YV+IQAVL+LY+ G             TH+VP+Y    L H   R+D+AGR
Sbjct: 124 FETFNVPAFYVSIQAVLSLYSSGRTTGIVLDSGDGVTHVVPIYAGFSLPHAILRIDLAGR 183

Query: 187 DVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLDLDTKLARETTALVESYELP 246
           D+T +L+ +LS RGY+F+ TA+ E VR IKEKLCYV+ D + + + A +++++ +SYELP
Sbjct: 184 DLTDYLMKILSERGYSFSTTAEREIVRDIKEKLCYVALDFEQEMQTAAQSSSIEKSYELP 243

Query: 247 DGRTIKVGQERFEAPECLFQPGLVDVEQPGVGELLFNTVQSADVDIRSSLYKAIVLSGGS 306
           DG+ I +G ERF APE LF P ++ +E  G+ +  +N++   DVD+R  LY  IV+SGG+
Sbjct: 244 DGQVITIGNERFRAPEALFHPSVLGLESAGIDQTTYNSIMKCDVDVRKELYGNIVMSGGT 303

Query: 307 SMYPGLPSRLEKELKQLWFSRVLHNDPSRLDKFKVRIEDPPRRKHMVFIGGAVLASIMAD 366
           +M+PG+  R++KE+  L         PS +   KV+I  PP RK+ V+IGG++LAS+   
Sbjct: 304 TMFPGIAERMQKEITAL--------APSSM---KVKIIAPPERKYSVWIGGSILASLTTF 352

Query: 367 KDHMWLSKQEWLESGPA 383
           +  MW+SKQE+ ESGP+
Sbjct: 353 Q-QMWISKQEYDESGPS 368

>Suva_6.18 Chr6 complement(26677..27794,28152..28161) [1128 bp, 375
           aa] {ON} YFL039C (REAL)
          Length = 375

 Score =  337 bits (863), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 165/377 (43%), Positives = 243/377 (64%), Gaps = 16/377 (4%)

Query: 7   IVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASVTTPLKDIMIGDEASDVRSY 66
           +V+D G+G  K G AG++ P   FPSIVGRP     +   V    KD  +GDEA   R  
Sbjct: 8   LVIDNGSGMCKAGFAGDDAPRAVFPSIVGRP---RHQGIMVGMGQKDSYVGDEAQSKRGI 64

Query: 67  LQISYPMENGIIKNWTDMELLWDYAFFEQMKLPSTSNGKILLTEPPMNPLKNREKMCEVM 126
           L + YP+E+GI+ NW DME +W + F+ ++++    +  +LLTE PMNP  NREKM ++M
Sbjct: 65  LTLRYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEH-PVLLTEAPMNPKSNREKMTQIM 123

Query: 127 FEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLSHLTRRLDVAGR 186
           FE ++    YV+IQAVL+LY+ G             TH+VP+Y    L H   R+D+AGR
Sbjct: 124 FETFNVPAFYVSIQAVLSLYSSGRTTGIVLDSGDGVTHVVPIYAGFSLPHAILRIDLAGR 183

Query: 187 DVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLDLDTKLARETTALVESYELP 246
           D+T +L+ +LS RGY+F+ TA+ E VR IKEKLCYV+ D + + + A +++++ +SYELP
Sbjct: 184 DLTDYLMKILSERGYSFSTTAEREIVRDIKEKLCYVALDFEQEMQTAAQSSSIEKSYELP 243

Query: 247 DGRTIKVGQERFEAPECLFQPGLVDVEQPGVGELLFNTVQSADVDIRSSLYKAIVLSGGS 306
           DG+ I +G ERF APE LF P ++ +E  G+ +  +N++   DVD+R  LY  IV+SGG+
Sbjct: 244 DGQVITIGNERFRAPEALFHPSVLGLESAGIDQTTYNSIMKCDVDVRKELYGNIVMSGGT 303

Query: 307 SMYPGLPSRLEKELKQLWFSRVLHNDPSRLDKFKVRIEDPPRRKHMVFIGGAVLASIMAD 366
           +M+PG+  R++KE+  L         PS +   KV+I  PP RK+ V+IGG++LAS+   
Sbjct: 304 TMFPGIAERMQKEITAL--------APSSM---KVKIIAPPERKYSVWIGGSILASLTTF 352

Query: 367 KDHMWLSKQEWLESGPA 383
           +  MW+SKQE+ ESGP+
Sbjct: 353 Q-QMWISKQEYDESGPS 368

>Smik_6.39 Chr6 complement(68673..69790,70076..70085) [1128 bp, 375
           aa] {ON} YFL039C (REAL)
          Length = 375

 Score =  337 bits (863), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 165/377 (43%), Positives = 243/377 (64%), Gaps = 16/377 (4%)

Query: 7   IVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASVTTPLKDIMIGDEASDVRSY 66
           +V+D G+G  K G AG++ P   FPSIVGRP     +   V    KD  +GDEA   R  
Sbjct: 8   LVIDNGSGMCKAGFAGDDAPRAVFPSIVGRP---RHQGIMVGMGQKDSYVGDEAQSKRGI 64

Query: 67  LQISYPMENGIIKNWTDMELLWDYAFFEQMKLPSTSNGKILLTEPPMNPLKNREKMCEVM 126
           L + YP+E+GI+ NW DME +W + F+ ++++    +  +LLTE PMNP  NREKM ++M
Sbjct: 65  LTLRYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEH-PVLLTEAPMNPKSNREKMTQIM 123

Query: 127 FEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLSHLTRRLDVAGR 186
           FE ++    YV+IQAVL+LY+ G             TH+VP+Y    L H   R+D+AGR
Sbjct: 124 FETFNVPAFYVSIQAVLSLYSSGRTTGIVLDSGDGVTHVVPIYAGFSLPHAILRIDLAGR 183

Query: 187 DVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLDLDTKLARETTALVESYELP 246
           D+T +L+ +LS RGY+F+ TA+ E VR IKEKLCYV+ D + + + A +++++ +SYELP
Sbjct: 184 DLTDYLMKILSERGYSFSTTAEREIVRDIKEKLCYVALDFEQEMQTAAQSSSIEKSYELP 243

Query: 247 DGRTIKVGQERFEAPECLFQPGLVDVEQPGVGELLFNTVQSADVDIRSSLYKAIVLSGGS 306
           DG+ I +G ERF APE LF P ++ +E  G+ +  +N++   DVD+R  LY  IV+SGG+
Sbjct: 244 DGQVITIGNERFRAPEALFHPSVLGLESAGIDQTTYNSIMKCDVDVRKELYGNIVMSGGT 303

Query: 307 SMYPGLPSRLEKELKQLWFSRVLHNDPSRLDKFKVRIEDPPRRKHMVFIGGAVLASIMAD 366
           +M+PG+  R++KE+  L         PS +   KV+I  PP RK+ V+IGG++LAS+   
Sbjct: 304 TMFPGIAERMQKEITAL--------APSSM---KVKIIAPPERKYSVWIGGSILASLTTF 352

Query: 367 KDHMWLSKQEWLESGPA 383
           +  MW+SKQE+ ESGP+
Sbjct: 353 Q-QMWISKQEYDESGPS 368

>YFL039C Chr6 complement(53260..54377,54687..54696) [1128 bp, 375
           aa] {ON}  ACT1Actin, structural protein involved in cell
           polarization, endocytosis, and other cytoskeletal
           functions
          Length = 375

 Score =  337 bits (863), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 165/377 (43%), Positives = 243/377 (64%), Gaps = 16/377 (4%)

Query: 7   IVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASVTTPLKDIMIGDEASDVRSY 66
           +V+D G+G  K G AG++ P   FPSIVGRP     +   V    KD  +GDEA   R  
Sbjct: 8   LVIDNGSGMCKAGFAGDDAPRAVFPSIVGRP---RHQGIMVGMGQKDSYVGDEAQSKRGI 64

Query: 67  LQISYPMENGIIKNWTDMELLWDYAFFEQMKLPSTSNGKILLTEPPMNPLKNREKMCEVM 126
           L + YP+E+GI+ NW DME +W + F+ ++++    +  +LLTE PMNP  NREKM ++M
Sbjct: 65  LTLRYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEH-PVLLTEAPMNPKSNREKMTQIM 123

Query: 127 FEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLSHLTRRLDVAGR 186
           FE ++    YV+IQAVL+LY+ G             TH+VP+Y    L H   R+D+AGR
Sbjct: 124 FETFNVPAFYVSIQAVLSLYSSGRTTGIVLDSGDGVTHVVPIYAGFSLPHAILRIDLAGR 183

Query: 187 DVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLDLDTKLARETTALVESYELP 246
           D+T +L+ +LS RGY+F+ TA+ E VR IKEKLCYV+ D + + + A +++++ +SYELP
Sbjct: 184 DLTDYLMKILSERGYSFSTTAEREIVRDIKEKLCYVALDFEQEMQTAAQSSSIEKSYELP 243

Query: 247 DGRTIKVGQERFEAPECLFQPGLVDVEQPGVGELLFNTVQSADVDIRSSLYKAIVLSGGS 306
           DG+ I +G ERF APE LF P ++ +E  G+ +  +N++   DVD+R  LY  IV+SGG+
Sbjct: 244 DGQVITIGNERFRAPEALFHPSVLGLESAGIDQTTYNSIMKCDVDVRKELYGNIVMSGGT 303

Query: 307 SMYPGLPSRLEKELKQLWFSRVLHNDPSRLDKFKVRIEDPPRRKHMVFIGGAVLASIMAD 366
           +M+PG+  R++KE+  L         PS +   KV+I  PP RK+ V+IGG++LAS+   
Sbjct: 304 TMFPGIAERMQKEITAL--------APSSM---KVKIIAPPERKYSVWIGGSILASLTTF 352

Query: 367 KDHMWLSKQEWLESGPA 383
           +  MW+SKQE+ ESGP+
Sbjct: 353 Q-QMWISKQEYDESGPS 368

>KNAG0L00250 Chr12 complement(32595..33712,34194..34203) [1128 bp,
           375 aa] {ON} Anc_8.23 YFL039C
          Length = 375

 Score =  337 bits (863), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 165/377 (43%), Positives = 243/377 (64%), Gaps = 16/377 (4%)

Query: 7   IVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASVTTPLKDIMIGDEASDVRSY 66
           +V+D G+G  K G AG++ P   FPSIVGRP     +   V    KD  +GDEA   R  
Sbjct: 8   LVIDNGSGMCKAGFAGDDAPRAVFPSIVGRP---RHQGIMVGMGQKDSYVGDEAQSKRGI 64

Query: 67  LQISYPMENGIIKNWTDMELLWDYAFFEQMKLPSTSNGKILLTEPPMNPLKNREKMCEVM 126
           L + YP+E+GI+ NW DME +W + F+ ++++    +  +LLTE PMNP  NREKM ++M
Sbjct: 65  LTLRYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEH-PVLLTEAPMNPKSNREKMTQIM 123

Query: 127 FEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLSHLTRRLDVAGR 186
           FE ++    YV+IQAVL+LY+ G             TH+VP+Y    L H   R+D+AGR
Sbjct: 124 FETFNVPAFYVSIQAVLSLYSSGRTTGIVLDSGDGVTHVVPIYAGFSLPHAILRIDLAGR 183

Query: 187 DVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLDLDTKLARETTALVESYELP 246
           D+T +L+ +LS RGY+F+ TA+ E VR IKEKLCYV+ D + + + A +++++ +SYELP
Sbjct: 184 DLTDYLMKILSERGYSFSTTAEREIVRDIKEKLCYVALDFEQEMQTAAQSSSIEKSYELP 243

Query: 247 DGRTIKVGQERFEAPECLFQPGLVDVEQPGVGELLFNTVQSADVDIRSSLYKAIVLSGGS 306
           DG+ I +G ERF APE LF P ++ +E  G+ +  +N++   DVD+R  LY  IV+SGG+
Sbjct: 244 DGQVITIGNERFRAPEALFHPSVLGLESSGIDQTTYNSIMKCDVDVRKELYGNIVMSGGT 303

Query: 307 SMYPGLPSRLEKELKQLWFSRVLHNDPSRLDKFKVRIEDPPRRKHMVFIGGAVLASIMAD 366
           +M+PG+  R++KE+  L         PS +   KV+I  PP RK+ V+IGG++LAS+   
Sbjct: 304 TMFPGIAERMQKEITAL--------APSSM---KVKIIAPPERKYSVWIGGSILASLTTF 352

Query: 367 KDHMWLSKQEWLESGPA 383
           +  MW+SKQE+ ESGP+
Sbjct: 353 Q-QMWISKQEYDESGPS 368

>KAFR0D00940 Chr4 complement(198280..199397,199945..199954) [1128
           bp, 375 aa] {ON} Anc_8.23 YFL039C
          Length = 375

 Score =  337 bits (863), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 165/377 (43%), Positives = 243/377 (64%), Gaps = 16/377 (4%)

Query: 7   IVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASVTTPLKDIMIGDEASDVRSY 66
           +V+D G+G  K G AG++ P   FPSIVGRP     +   V    KD  +GDEA   R  
Sbjct: 8   LVIDNGSGMCKAGFAGDDAPRAVFPSIVGRP---RHQGIMVGMGQKDSYVGDEAQSKRGI 64

Query: 67  LQISYPMENGIIKNWTDMELLWDYAFFEQMKLPSTSNGKILLTEPPMNPLKNREKMCEVM 126
           L + YP+E+GI+ NW DME +W + F+ ++++    +  +LLTE PMNP  NREKM ++M
Sbjct: 65  LTLRYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEH-PVLLTEAPMNPKSNREKMTQIM 123

Query: 127 FEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLSHLTRRLDVAGR 186
           FE ++    YV+IQAVL+LY+ G             TH+VP+Y    L H   R+D+AGR
Sbjct: 124 FETFNVPAFYVSIQAVLSLYSSGRTTGIVLDSGDGVTHVVPIYAGFSLPHAILRIDLAGR 183

Query: 187 DVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLDLDTKLARETTALVESYELP 246
           D+T +L+ +LS RGY+F+ TA+ E VR IKEKLCYV+ D + + + A +++++ +SYELP
Sbjct: 184 DLTDYLMKILSERGYSFSTTAEREIVRDIKEKLCYVALDFEQEMQTAAQSSSIEKSYELP 243

Query: 247 DGRTIKVGQERFEAPECLFQPGLVDVEQPGVGELLFNTVQSADVDIRSSLYKAIVLSGGS 306
           DG+ I +G ERF APE LF P ++ +E  G+ +  +N++   DVD+R  LY  IV+SGG+
Sbjct: 244 DGQVITIGNERFRAPEALFHPSVLGLESSGIDQTTYNSIMKCDVDVRKELYGNIVMSGGT 303

Query: 307 SMYPGLPSRLEKELKQLWFSRVLHNDPSRLDKFKVRIEDPPRRKHMVFIGGAVLASIMAD 366
           +M+PG+  R++KE+  L         PS +   KV+I  PP RK+ V+IGG++LAS+   
Sbjct: 304 TMFPGIAERMQKEITAL--------APSSM---KVKIIAPPERKYSVWIGGSILASLTTF 352

Query: 367 KDHMWLSKQEWLESGPA 383
           +  MW+SKQE+ ESGP+
Sbjct: 353 Q-QMWISKQEYDESGPS 368

>TPHA0D00250 Chr4 complement(34030..35147,35712..35721) [1128 bp,
           375 aa] {ON} Anc_8.23 YFL039C
          Length = 375

 Score =  336 bits (862), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 164/377 (43%), Positives = 243/377 (64%), Gaps = 16/377 (4%)

Query: 7   IVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASVTTPLKDIMIGDEASDVRSY 66
           +V+D G+G  K G AG++ P   FPSIVGRP     +   V    KD  +GDEA   R  
Sbjct: 8   LVIDNGSGMCKAGFAGDDAPRAVFPSIVGRP---RHQGIMVGMGQKDSYVGDEAQSKRGI 64

Query: 67  LQISYPMENGIIKNWTDMELLWDYAFFEQMKLPSTSNGKILLTEPPMNPLKNREKMCEVM 126
           L + YP+E+GI+ NW DME +W + F+ ++++    +  +LLTE PMNP  NREKM ++M
Sbjct: 65  LTLRYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEH-PVLLTEAPMNPKSNREKMTQIM 123

Query: 127 FEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLSHLTRRLDVAGR 186
           FE ++    YV+IQAVL+LY+ G             TH+VP+Y    L H   R+D+AGR
Sbjct: 124 FETFNVPAFYVSIQAVLSLYSSGRTTGIVLDSGDGVTHVVPIYAGFSLPHAILRIDLAGR 183

Query: 187 DVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLDLDTKLARETTALVESYELP 246
           D+T +L+ +LS RGY+F+ TA+ E VR IKEKLCYV+ D + + + A +++++ +SYELP
Sbjct: 184 DLTDYLMKILSERGYSFSTTAEREIVRDIKEKLCYVALDFEQEMQTAAQSSSIEKSYELP 243

Query: 247 DGRTIKVGQERFEAPECLFQPGLVDVEQPGVGELLFNTVQSADVDIRSSLYKAIVLSGGS 306
           DG+ I +G ERF APE LF P ++ +E  G+ +  +N++   D+D+R  LY  IV+SGG+
Sbjct: 244 DGQVITIGNERFRAPEALFHPSVLSLESAGIDQTTYNSIMKCDIDVRKELYGNIVMSGGT 303

Query: 307 SMYPGLPSRLEKELKQLWFSRVLHNDPSRLDKFKVRIEDPPRRKHMVFIGGAVLASIMAD 366
           +M+PG+  R++KE+  L         PS +   KV+I  PP RK+ V+IGG++LAS+   
Sbjct: 304 TMFPGIAERMQKEITAL--------APSSM---KVKIIAPPERKYSVWIGGSILASLTTF 352

Query: 367 KDHMWLSKQEWLESGPA 383
           +  MW+SKQE+ ESGP+
Sbjct: 353 Q-QMWISKQEYDESGPS 368

>ZYRO0F02772g Chr6 complement(235322..236439,236524..236533) [1128
           bp, 375 aa] {ON} uniprot|Q2HWE7 Zygosaccharomyces rouxii
           ACT1 Actin
          Length = 375

 Score =  336 bits (862), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 165/377 (43%), Positives = 243/377 (64%), Gaps = 16/377 (4%)

Query: 7   IVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASVTTPLKDIMIGDEASDVRSY 66
           +V+D G+G  K G AG++ P   FPSIVGRP     +   V    KD  +GDEA   R  
Sbjct: 8   LVIDNGSGMCKAGFAGDDAPRAVFPSIVGRP---RHQGIMVGMGQKDSYVGDEAQSKRGI 64

Query: 67  LQISYPMENGIIKNWTDMELLWDYAFFEQMKLPSTSNGKILLTEPPMNPLKNREKMCEVM 126
           L + YP+E+GI+ NW DME +W + F+ ++++    +  +LLTE PMNP  NREKM ++M
Sbjct: 65  LTLRYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEH-PVLLTEAPMNPKSNREKMTQIM 123

Query: 127 FEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLSHLTRRLDVAGR 186
           FE ++    YV+IQAVL+LY+ G             TH+VP+Y    + H   R+D+AGR
Sbjct: 124 FETFNVPAFYVSIQAVLSLYSSGRTTGIVLDSGDGVTHVVPIYAGFSMPHAILRIDLAGR 183

Query: 187 DVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLDLDTKLARETTALVESYELP 246
           D+T +L+ +LS RGY+F+ TA+ E VR IKEKLCYV+ D + + + A +++++ +SYELP
Sbjct: 184 DLTDYLMKILSERGYSFSTTAEREIVRDIKEKLCYVALDFEQEMQTAAQSSSVEKSYELP 243

Query: 247 DGRTIKVGQERFEAPECLFQPGLVDVEQPGVGELLFNTVQSADVDIRSSLYKAIVLSGGS 306
           DG+ I +G ERF APE LF P ++ +E  GV +  +N++   DVD+R  LY  IV+SGG+
Sbjct: 244 DGQVITIGNERFRAPEALFHPSVLSLESSGVDQTTYNSIMKCDVDVRKDLYGNIVMSGGT 303

Query: 307 SMYPGLPSRLEKELKQLWFSRVLHNDPSRLDKFKVRIEDPPRRKHMVFIGGAVLASIMAD 366
           +M+PG+  R++KE+  L         PS +   KV+I  PP RK+ V+IGG++LAS+   
Sbjct: 304 TMFPGIAERMQKEITAL--------APSSM---KVKIIAPPERKYSVWIGGSILASLTTF 352

Query: 367 KDHMWLSKQEWLESGPA 383
           +  MW+SKQE+ ESGP+
Sbjct: 353 Q-QMWISKQEYDESGPS 368

>TBLA0C00440 Chr3 complement(81591..82708,83412..83421) [1128 bp,
           375 aa] {ON} Anc_8.23 YFL039C
          Length = 375

 Score =  336 bits (862), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 164/377 (43%), Positives = 243/377 (64%), Gaps = 16/377 (4%)

Query: 7   IVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASVTTPLKDIMIGDEASDVRSY 66
           +V+D G+G  K G AG++ P   FPSIVGRP     +   V    KD  +GDEA   R  
Sbjct: 8   LVIDNGSGMCKAGFAGDDAPRAVFPSIVGRP---RHQGIMVGMGQKDSYVGDEAQSKRGI 64

Query: 67  LQISYPMENGIIKNWTDMELLWDYAFFEQMKLPSTSNGKILLTEPPMNPLKNREKMCEVM 126
           L + YP+E+GI+ NW DME +W + F+ ++++    +  +LLTE PMNP  NREKM ++M
Sbjct: 65  LTLRYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEH-PVLLTEAPMNPKSNREKMTQIM 123

Query: 127 FEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLSHLTRRLDVAGR 186
           FE ++    YV+IQAVL+LY+ G             TH+VP+Y    L H   R+D+AGR
Sbjct: 124 FETFNVPAFYVSIQAVLSLYSSGRTTGIVLDSGDGVTHVVPIYAGFSLPHAIMRIDLAGR 183

Query: 187 DVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLDLDTKLARETTALVESYELP 246
           D+T +L+ +LS RGY+F+ TA+ E VR IKEKLCYV+ D + + + A +++++ +SYELP
Sbjct: 184 DLTDYLMKILSERGYSFSTTAEREIVRDIKEKLCYVALDFEQEMQTAAQSSSIEKSYELP 243

Query: 247 DGRTIKVGQERFEAPECLFQPGLVDVEQPGVGELLFNTVQSADVDIRSSLYKAIVLSGGS 306
           DG+ I +G ERF APE LF P ++ +E  G+ +  +N++   DVD+R  LY  IV+SGG+
Sbjct: 244 DGQVITIGNERFRAPEALFHPSVLSLESAGIDQTTYNSIMKCDVDVRKELYGNIVMSGGT 303

Query: 307 SMYPGLPSRLEKELKQLWFSRVLHNDPSRLDKFKVRIEDPPRRKHMVFIGGAVLASIMAD 366
           +M+PG+  R++KE+  L         PS ++   V+I  PP RK+ V+IGG++LAS+   
Sbjct: 304 TMFPGIAERMQKEITAL--------APSSME---VKIIAPPERKYSVWIGGSILASLTTF 352

Query: 367 KDHMWLSKQEWLESGPA 383
           +  MW+SKQE+ ESGP+
Sbjct: 353 Q-QMWISKQEYDESGPS 368

>SAKL0B00968g Chr2 complement(89966..91083,91524..91533) [1128 bp,
           375 aa] {ON} highly similar to uniprot|P02579
           Saccharomyces cerevisiae YFL039C ACT1 Actin
          Length = 375

 Score =  336 bits (862), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 165/377 (43%), Positives = 243/377 (64%), Gaps = 16/377 (4%)

Query: 7   IVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASVTTPLKDIMIGDEASDVRSY 66
           +V+D G+G  K G AG++ P   FPSIVGRP     +   V    KD  +GDEA   R  
Sbjct: 8   LVIDNGSGMCKAGFAGDDAPRAVFPSIVGRP---RHQGIMVGMGQKDSYVGDEAQSKRGI 64

Query: 67  LQISYPMENGIIKNWTDMELLWDYAFFEQMKLPSTSNGKILLTEPPMNPLKNREKMCEVM 126
           L + YP+E+GI+ NW DME +W + F+ ++++    +  +LLTE PMNP  NREKM +++
Sbjct: 65  LTLRYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEH-PVLLTEAPMNPKSNREKMTQIL 123

Query: 127 FEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLSHLTRRLDVAGR 186
           FE ++    YV+IQAVL+LY+ G             TH+VP+Y    L H   R+D+AGR
Sbjct: 124 FETFNVPAFYVSIQAVLSLYSSGRTTGIVLDSGDGVTHVVPIYAGFSLPHAILRIDLAGR 183

Query: 187 DVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLDLDTKLARETTALVESYELP 246
           D+T +L+ +LS RGY+F+ TA+ E VR IKEKLCYV+ D + + + A +++A+ +SYELP
Sbjct: 184 DMTDYLMKILSERGYSFSTTAEREIVRDIKEKLCYVALDFEQEMQTAAQSSAIEKSYELP 243

Query: 247 DGRTIKVGQERFEAPECLFQPGLVDVEQPGVGELLFNTVQSADVDIRSSLYKAIVLSGGS 306
           DG+ I +G ERF APE LF P ++ +E  G+ +  +N++   DVD+R  LY  IV+SGG+
Sbjct: 244 DGQVITIGNERFRAPEALFHPSVLGLEAAGIDQTTYNSIMKCDVDVRKELYGNIVMSGGT 303

Query: 307 SMYPGLPSRLEKELKQLWFSRVLHNDPSRLDKFKVRIEDPPRRKHMVFIGGAVLASIMAD 366
           +M+PG+  R++KE+  L         PS +   KV+I  PP RK+ V+IGG++LAS+   
Sbjct: 304 TMFPGIAERMQKEITAL--------APSSM---KVKIIAPPERKYSVWIGGSILASLTTF 352

Query: 367 KDHMWLSKQEWLESGPA 383
           +  MW+SKQE+ ESGP+
Sbjct: 353 Q-QMWISKQEYDESGPS 368

>KLLA0D05357g Chr4 (461726..461735,462516..463633) [1128 bp, 375 aa]
           {ON} highly similar to uniprot|P60010 Saccharomyces
           cerevisiae YFL039C ACT1 Actin structural protein
           involved in cell polarization endocytosis and other
           cytoskeletal functions
          Length = 375

 Score =  336 bits (861), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 164/377 (43%), Positives = 243/377 (64%), Gaps = 16/377 (4%)

Query: 7   IVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASVTTPLKDIMIGDEASDVRSY 66
           +V+D G+G  K G AG++ P   FPSIVGRP     +   V    KD  +GDEA   R  
Sbjct: 8   LVIDNGSGMCKAGFAGDDAPRAVFPSIVGRP---RHQGIMVGMGQKDSYVGDEAQSKRGI 64

Query: 67  LQISYPMENGIIKNWTDMELLWDYAFFEQMKLPSTSNGKILLTEPPMNPLKNREKMCEVM 126
           L + YP+E+GI+ NW DME +W + F+ ++++    +  +LLTE PMNP  NREKM +++
Sbjct: 65  LTLRYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEH-PVLLTEAPMNPKNNREKMTQIL 123

Query: 127 FEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLSHLTRRLDVAGR 186
           FE ++    YV+IQAVL+LY+ G             TH+VP+Y    L H   R+D+AGR
Sbjct: 124 FETFNVPAFYVSIQAVLSLYSSGRTTGIVLDSGDGVTHVVPIYAGFSLPHAILRIDLAGR 183

Query: 187 DVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLDLDTKLARETTALVESYELP 246
           D+T +L+ +L+ RGY+F+ TA+ E VR IKEKLCYV+ D + + + A +++A+ +SYELP
Sbjct: 184 DITDYLMKILAERGYSFSTTAEREIVRDIKEKLCYVALDFEQEMQTASQSSAVEKSYELP 243

Query: 247 DGRTIKVGQERFEAPECLFQPGLVDVEQPGVGELLFNTVQSADVDIRSSLYKAIVLSGGS 306
           DG+ I +G ERF APE LF P ++ +E  G+ +  +N++   DVD+R  LY  IV+SGG+
Sbjct: 244 DGQVITIGNERFRAPEALFHPSVLSLEAAGIDQTTYNSIMKCDVDVRKELYGNIVMSGGT 303

Query: 307 SMYPGLPSRLEKELKQLWFSRVLHNDPSRLDKFKVRIEDPPRRKHMVFIGGAVLASIMAD 366
           +M+PG+  R++KE+  L         PS +   KV+I  PP RK+ V+IGG++LAS+   
Sbjct: 304 TMFPGIAERMQKEITAL--------APSSM---KVKIIAPPERKYSVWIGGSILASLTTF 352

Query: 367 KDHMWLSKQEWLESGPA 383
           +  MW+SKQE+ ESGP+
Sbjct: 353 Q-QMWISKQEYDESGPS 368

>KLTH0G18832g Chr7 (1626178..1626187,1626854..1627971) [1128 bp, 375
           aa] {ON} highly similar to uniprot|P60010 Saccharomyces
           cerevisiae YFL039C ACT1 Actin structural protein
           involved in cell polarization endocytosis and other
           cytoskeletal functions
          Length = 375

 Score =  336 bits (861), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 166/377 (44%), Positives = 243/377 (64%), Gaps = 16/377 (4%)

Query: 7   IVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASVTTPLKDIMIGDEASDVRSY 66
           +V+D G+G  K G AG++ P   FPSIVGRP     +   V    KD  +GDEA   R  
Sbjct: 8   LVIDNGSGMCKAGFAGDDAPRAVFPSIVGRP---RHQGIMVGMGQKDSYVGDEAQSKRGI 64

Query: 67  LQISYPMENGIIKNWTDMELLWDYAFFEQMKLPSTSNGKILLTEPPMNPLKNREKMCEVM 126
           L + YP+E+GI+ NW DME +W + F+ ++++    +  +LLTE PMNP  NREKM +++
Sbjct: 65  LTLRYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEH-PVLLTEAPMNPKSNREKMTQIL 123

Query: 127 FEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLSHLTRRLDVAGR 186
           FE ++    YV+IQAVL+LY+ G             TH+VP+Y    L H   R+D+AGR
Sbjct: 124 FETFNVPAFYVSIQAVLSLYSSGRTTGIVLDSGDGVTHVVPIYAGFSLPHGILRIDLAGR 183

Query: 187 DVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLDLDTKLARETTALVESYELP 246
           D+T +L+ +LS RGY+F+ TA+ E VR IKEKLCYV+ D + + + A +++A+ +SYELP
Sbjct: 184 DMTDYLMKILSERGYSFSTTAEREIVRDIKEKLCYVALDFEQEMQTAAQSSAIEKSYELP 243

Query: 247 DGRTIKVGQERFEAPECLFQPGLVDVEQPGVGELLFNTVQSADVDIRSSLYKAIVLSGGS 306
           DG+ I +G ERF APE LF P L+ +E  G+ +  +N++   DVD+R  LY  IV+SGG+
Sbjct: 244 DGQVITIGNERFRAPEALFHPSLLGLEAAGIDQTAYNSIMKCDVDVRKELYGNIVMSGGT 303

Query: 307 SMYPGLPSRLEKELKQLWFSRVLHNDPSRLDKFKVRIEDPPRRKHMVFIGGAVLASIMAD 366
           +M+PG+  R++KE+  L         PS +   KV+I  PP RK+ V+IGG++LAS+   
Sbjct: 304 TMFPGIAERMQKEITAL--------APSSM---KVKIIAPPERKYSVWIGGSILASLTTF 352

Query: 367 KDHMWLSKQEWLESGPA 383
           +  MW+SKQE+ ESGP+
Sbjct: 353 Q-QMWISKQEYDESGPS 368

>Kpol_1058.15 s1058 complement(49082..50199,50349..50358) [1128 bp,
           375 aa] {ON} complement(49082..50199,50349..50358) [1128
           nt, 376 aa]
          Length = 375

 Score =  335 bits (858), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 164/377 (43%), Positives = 243/377 (64%), Gaps = 16/377 (4%)

Query: 7   IVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASVTTPLKDIMIGDEASDVRSY 66
           +V+D G+G  K G AG++ P   FPSIVGRP     +   V    KD  +GDEA   R  
Sbjct: 8   LVIDNGSGMCKAGFAGDDAPRAVFPSIVGRP---RHQGIMVGMGQKDSYVGDEAQSKRGI 64

Query: 67  LQISYPMENGIIKNWTDMELLWDYAFFEQMKLPSTSNGKILLTEPPMNPLKNREKMCEVM 126
           L + YP+E+GI+ NW DME +W + F+ ++++    +  +LLTE PMNP  NREKM ++M
Sbjct: 65  LTLRYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEH-PVLLTEAPMNPKSNREKMTQIM 123

Query: 127 FEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLSHLTRRLDVAGR 186
           FE ++    YV+IQAVL+LY+ G             TH+VP+Y    + H   R+D+AGR
Sbjct: 124 FETFNVPAFYVSIQAVLSLYSSGRTTGIVLDSGDGVTHVVPIYAGFSMPHGILRIDLAGR 183

Query: 187 DVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLDLDTKLARETTALVESYELP 246
           D+T +L+ +LS RGY+F+ TA+ E VR IKEKLCYV+ D + + + A +++++ +SYELP
Sbjct: 184 DLTDYLMKILSERGYSFSTTAEREIVRDIKEKLCYVALDFEQEMQTAAQSSSIEKSYELP 243

Query: 247 DGRTIKVGQERFEAPECLFQPGLVDVEQPGVGELLFNTVQSADVDIRSSLYKAIVLSGGS 306
           DG+ I +G ERF APE LF P ++ +E  G+ +  +N++   DVD+R  LY  IV+SGG+
Sbjct: 244 DGQVITIGNERFRAPEALFHPSVLGLESSGIDQTTYNSIMKCDVDVRKELYGNIVMSGGT 303

Query: 307 SMYPGLPSRLEKELKQLWFSRVLHNDPSRLDKFKVRIEDPPRRKHMVFIGGAVLASIMAD 366
           +M+PG+  R++KE+  L         PS +   KV+I  PP RK+ V+IGG++LAS+   
Sbjct: 304 TMFPGIAERMQKEITAL--------APSSM---KVKIIAPPERKYSVWIGGSILASLTTF 352

Query: 367 KDHMWLSKQEWLESGPA 383
           +  MW+SKQE+ ESGP+
Sbjct: 353 Q-QMWISKQEYDESGPS 368

>Skud_6.31 Chr6 complement(56454..57536) [1083 bp, 360 aa] {ON}
           YFL039C (REAL)
          Length = 360

 Score =  326 bits (835), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 161/369 (43%), Positives = 236/369 (63%), Gaps = 16/369 (4%)

Query: 15  FVKIGRAGENFPDYTFPSIVGRPILRAEERASVTTPLKDIMIGDEASDVRSYLQISYPME 74
             K G AG++ P   FPSIVGRP     +   V    KD  +GDEA   R  L + YP+E
Sbjct: 1   MCKAGFAGDDAPRAVFPSIVGRP---RHQGIMVGMGQKDSYVGDEAQSKRGILTLRYPIE 57

Query: 75  NGIIKNWTDMELLWDYAFFEQMKLPSTSNGKILLTEPPMNPLKNREKMCEVMFEKYDFGG 134
           +GI+ NW DME +W + F+ ++++    +  +LLTE PMNP  NREKM ++MFE ++   
Sbjct: 58  HGIVTNWDDMEKIWHHTFYNELRVAPEEH-PVLLTEAPMNPKSNREKMTQIMFETFNVPA 116

Query: 135 VYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLSHLTRRLDVAGRDVTRHLID 194
            YV+IQAVL+LY+ G             TH+VP+Y    L H   R+D+AGRD+T +L+ 
Sbjct: 117 FYVSIQAVLSLYSSGRTTGIVLDSGDGVTHVVPIYAGFSLPHAILRIDLAGRDLTDYLMK 176

Query: 195 LLSRRGYAFNRTADFETVRQIKEKLCYVSYDLDLDTKLARETTALVESYELPDGRTIKVG 254
           +LS RGY+F+ TA+ E VR IKEKLCYV+ D + + + A +++++ +SYELPDG+ I +G
Sbjct: 177 ILSERGYSFSTTAEREIVRDIKEKLCYVALDFEQEMQTAAQSSSIEKSYELPDGQVITIG 236

Query: 255 QERFEAPECLFQPGLVDVEQPGVGELLFNTVQSADVDIRSSLYKAIVLSGGSSMYPGLPS 314
            ERF APE LF P ++ +E  G+ +  +N++   DVD+R  LY  IV+SGG++M+PG+  
Sbjct: 237 NERFRAPEALFHPSVLGLESAGIDQTTYNSIMKCDVDVRKELYGNIVMSGGTTMFPGIAE 296

Query: 315 RLEKELKQLWFSRVLHNDPSRLDKFKVRIEDPPRRKHMVFIGGAVLASIMADKDHMWLSK 374
           R++KE+  L         PS +   KV+I  PP RK+ V+IGG++LAS+   +  MW+SK
Sbjct: 297 RMQKEITAL--------APSSM---KVKIIAPPERKYSVWIGGSILASLTTFQ-QMWISK 344

Query: 375 QEWLESGPA 383
           QE+ ESGP+
Sbjct: 345 QEYDESGPS 353

>Kwal_14.1109 s14 complement(199181..200263) [1083 bp, 360 aa] {ON}
           YFL039C (ACT1) - Actin [contig 244] FULL
          Length = 360

 Score =  325 bits (833), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 162/369 (43%), Positives = 236/369 (63%), Gaps = 16/369 (4%)

Query: 15  FVKIGRAGENFPDYTFPSIVGRPILRAEERASVTTPLKDIMIGDEASDVRSYLQISYPME 74
             K G AG++ P   FPSIVGRP     +   V    KD  +GDEA   R  L + YP+E
Sbjct: 1   MCKAGFAGDDAPRAVFPSIVGRP---RHQGIMVGMGQKDSYVGDEAQSKRGILTLRYPIE 57

Query: 75  NGIIKNWTDMELLWDYAFFEQMKLPSTSNGKILLTEPPMNPLKNREKMCEVMFEKYDFGG 134
           +GI+ NW DME +W + F+ ++++    +  +LLTE PMNP  NREKM +++FE ++   
Sbjct: 58  HGIVTNWDDMEKIWHHTFYNELRVAPEEH-PVLLTEAPMNPKSNREKMTQILFETFNVPA 116

Query: 135 VYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLSHLTRRLDVAGRDVTRHLID 194
            YV+IQAVL+LY+ G             TH+VP+Y    L H   R+D+AGRD+T +L+ 
Sbjct: 117 FYVSIQAVLSLYSSGRTTGIVLDSGDGVTHVVPIYAGFSLPHGILRIDLAGRDMTDYLMK 176

Query: 195 LLSRRGYAFNRTADFETVRQIKEKLCYVSYDLDLDTKLARETTALVESYELPDGRTIKVG 254
           +LS RGY+F+ TA+ E VR IKEKLCYV+ D + + + A +++A+ +SYELPDG+ I +G
Sbjct: 177 ILSERGYSFSTTAEREIVRDIKEKLCYVALDFEQEMQTAAQSSAIEKSYELPDGQVITIG 236

Query: 255 QERFEAPECLFQPGLVDVEQPGVGELLFNTVQSADVDIRSSLYKAIVLSGGSSMYPGLPS 314
            ERF APE LF P L+ +E  G+ +  +N++   DVD+R  LY  IV+SGG++M+PG+  
Sbjct: 237 NERFRAPEALFHPSLLGLEAAGIDQTAYNSIMKCDVDVRKELYGNIVMSGGTTMFPGIAE 296

Query: 315 RLEKELKQLWFSRVLHNDPSRLDKFKVRIEDPPRRKHMVFIGGAVLASIMADKDHMWLSK 374
           R++KE+  L         PS +   KV+I  PP RK+ V+IGG++LAS+   +  MW+SK
Sbjct: 297 RMQKEITAL--------APSSM---KVKIIAPPERKYSVWIGGSILASLTTFQ-QMWISK 344

Query: 375 QEWLESGPA 383
           QE+ ESGP+
Sbjct: 345 QEYDESGPS 353

>SAKL0E11814g Chr5 complement(984199..985338) [1140 bp, 379 aa] {ON}
           highly similar to gnl|GLV|KLLA0E23012g Kluyveromyces
           lactis KLLA0E23012g and similar to uniprot|P38696
           Saccharomyces cerevisiae YHR129C ARP1 Actin- related
           protein of the dynactin complex required for spindle
           orientation and nuclear migration putative ortholog of
           mammalian centractin
          Length = 379

 Score =  271 bits (694), Expect = 1e-87,   Method: Compositional matrix adjust.
 Identities = 147/386 (38%), Positives = 225/386 (58%), Gaps = 17/386 (4%)

Query: 4   HNPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASVTTPLKDIMIGDEASDV 63
           + PIVLD G+G +K G +GE  P     S++G P         +     +  IG++A ++
Sbjct: 9   NQPIVLDNGSGIIKAGFSGEERPKCFEYSLIGTPKYNKVMAGGLE---GEQFIGNQAQEL 65

Query: 64  RSYLQISYPMENGIIKNWTDMELLWDYAFFEQMKLPSTSNGKILLTEPPMNPLKNREKMC 123
           R  L++ YP+E+GI+KNW+DMEL+W++ F + ++L +     +L TE P+NPLKNRE MC
Sbjct: 66  RGLLKLRYPLEHGIVKNWSDMELIWNHVFHKSLQLNNIEEHPVLATEAPLNPLKNREAMC 125

Query: 124 EVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLSHLTRRLDV 183
           E++FE ++   VYV+IQAVL+LYA G              H VPV++   L    RR+DV
Sbjct: 126 EMLFETFNVPAVYVSIQAVLSLYASGRTTGCVLDCGDGCCHSVPVFDGFSLPSSIRRIDV 185

Query: 184 AGRDVTRHLIDLLSR-RGYAFNRTADFETVRQIKEKLCYVSYDLDLDTKLARETTALVES 242
           AGRDVT  L  LL +  G +   +++ E VR IKEK CYV+ D  L  +     T     
Sbjct: 186 AGRDVTEFLQLLLRKTTGVSLLSSSEREIVRIIKEKACYVARD-PLTEEQTYHLTPTSTI 244

Query: 243 YELPDGRTIKVGQERFEAPECLFQPGLVDVEQPGVGELLFNTVQSADVDIRSSLYKAIVL 302
           ++LPDG+ + +  E+F APE LFQP L+  E   + E+   ++   D+D+R +L   IVL
Sbjct: 245 FKLPDGKVLDLKNEKFRAPEVLFQPQLIGSEFESIPEMCHQSISKVDLDLRPALLSNIVL 304

Query: 303 SGGSSMYPGLPSRLEKELKQLWFSRVLHNDPSRLDKFKVRIEDPPRRKHMVFIGGAVLAS 362
           SGG++M+PG   RL  EL+ L       ++P    + K++I  PP RK+  +IGG++L+ 
Sbjct: 305 SGGTTMFPGFGDRLLTELRNL-------SEP----QTKIKIFAPPERKYSTWIGGSILSG 353

Query: 363 IMADKDHMWLSKQEWLESGPASMAKF 388
           +   K  +W++K EW E+     ++F
Sbjct: 354 LSTFKK-IWVTKSEWQENPDCVHSRF 378

>AFR051W Chr6 (522829..524046) [1218 bp, 405 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YHR129C (ARP1)
          Length = 405

 Score =  271 bits (693), Expect = 3e-87,   Method: Compositional matrix adjust.
 Identities = 144/377 (38%), Positives = 222/377 (58%), Gaps = 17/377 (4%)

Query: 4   HNPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASVTTPLKDIMIGDEASDV 63
           + P+VLD G+G +K G +GE  P     S++G           +     D  IG++A ++
Sbjct: 35  NQPVVLDNGSGIIKAGFSGEEKPKCFEYSLIGTTKYNKVMAGGLEG---DTFIGNQAQEL 91

Query: 64  RSYLQISYPMENGIIKNWTDMELLWDYAFFEQMKLPSTSNGKILLTEPPMNPLKNREKMC 123
           R  L++ YP+++GI+ NW DME +W Y F + ++L +  +   L+TE P+NP KNREKMC
Sbjct: 92  RGLLKLRYPLQHGIVTNWADMEQVWGYVFNKSLQLQNVEDHPNLVTEAPLNPHKNREKMC 151

Query: 124 EVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLSHLTRRLDV 183
           E++FE ++   +YV++QAVL+LYA G              H VPV++   +    RR+D+
Sbjct: 152 ELLFESFNVPALYVSVQAVLSLYASGRTTGCVVDCGDGCCHAVPVFDGFSVPSSIRRIDI 211

Query: 184 AGRDVTRHLIDLLSR-RGYAFNRTADFETVRQIKEKLCYVSYDLDLDTKLARETTALVES 242
           AGRD+T  L  LL +  G +   +++ E VR IKEK C+V+ D  L+ +      +    
Sbjct: 212 AGRDITEFLQLLLRKTTGVSLLSSSEREIVRTIKEKACFVTKDPKLEEQNFPMNPSF-SK 270

Query: 243 YELPDGRTIKVGQERFEAPECLFQPGLVDVEQPGVGELLFNTVQSADVDIRSSLYKAIVL 302
           ++LPDG+TI++GQER+ APE LFQP L+  E   + ++ + ++   D+D+RS LY  I+L
Sbjct: 271 FKLPDGKTIELGQERYRAPEILFQPELIGSEFESLPDMCYQSIGKVDLDLRSLLYSNILL 330

Query: 303 SGGSSMYPGLPSRLEKELKQLWFSRVLHNDPSRLDKFKVRIEDPPRRKHMVFIGGAVLAS 362
           SGG+SM PG   RL KELK L  SR            K++I  PP RK+  +IGG++L+ 
Sbjct: 331 SGGTSMLPGFGDRLLKELKSLSGSRT-----------KIKIFAPPERKYSTWIGGSILSG 379

Query: 363 IMADKDHMWLSKQEWLE 379
           +   K  +W++K EW E
Sbjct: 380 LSTFKK-LWVTKSEWEE 395

>Ecym_6385 Chr6 complement(749508..750641) [1134 bp, 377 aa] {ON}
           similar to Ashbya gossypii AFR051W
          Length = 377

 Score =  268 bits (684), Expect = 4e-86,   Method: Compositional matrix adjust.
 Identities = 141/386 (36%), Positives = 226/386 (58%), Gaps = 17/386 (4%)

Query: 4   HNPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASVTTPLKDIMIGDEASDV 63
           + PIVLD G+G +K G +GE  P     S++G           +     D  IG++A ++
Sbjct: 7   NQPIVLDNGSGIIKAGFSGEEKPKCFEYSLIGTVKYNKVMAGGLEG---DTFIGNQAQEL 63

Query: 64  RSYLQISYPMENGIIKNWTDMELLWDYAFFEQMKLPSTSNGKILLTEPPMNPLKNREKMC 123
           R  L++ +P+E+GI+KNW+DME +W Y F + ++L +  +  IL+TE P+NP  NRE+MC
Sbjct: 64  RGLLKLRHPVEHGIVKNWSDMEHIWSYVFNKSLQLQNVEDHPILITEAPLNPRNNRERMC 123

Query: 124 EVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLSHLTRRLDV 183
           E++FE ++   +YV+IQAVL+LYA G              H VPV++   +    RR+D+
Sbjct: 124 ELLFESFNVPALYVSIQAVLSLYASGRTTGCVVDCGDGCCHAVPVFDGFSIPSSIRRIDI 183

Query: 184 AGRDVTRHLIDLLSR-RGYAFNRTADFETVRQIKEKLCYVSYDLDLDTKLARETTALVES 242
           AGRD+T  L  LL +  G +   +++ E VR IKEK CYV+ D  ++ +           
Sbjct: 184 AGRDITEFLQLLLRKTTGVSLLSSSEREVVRIIKEKACYVAKDPHIEEQ-NFSINPNYTK 242

Query: 243 YELPDGRTIKVGQERFEAPECLFQPGLVDVEQPGVGELLFNTVQSADVDIRSSLYKAIVL 302
           ++LPDG+TI +GQE+F APE LFQP L+  E   + ++ + +++  D+D+RS L+  ++L
Sbjct: 243 FKLPDGKTIDLGQEKFRAPEILFQPELIGSEFESLPDMCYQSIEKVDLDLRSLLFSNVLL 302

Query: 303 SGGSSMYPGLPSRLEKELKQLWFSRVLHNDPSRLDKFKVRIEDPPRRKHMVFIGGAVLAS 362
           SGG+S+ PG   RL  ELK L  S+            K++I  PP RK+  +IGG++L+ 
Sbjct: 303 SGGTSILPGFGDRLLSELKSLSDSQT-----------KIKIFAPPERKYSTWIGGSILSG 351

Query: 363 IMADKDHMWLSKQEWLESGPASMAKF 388
           +   K  +W+++ EW E+     ++F
Sbjct: 352 LSTFK-KLWVTRAEWEEAADCIHSRF 376

>Kpol_1023.18 s1023
           complement(36072..36143,36193..36201,36244..37112,
           37854..37863) [960 bp, 319 aa] {ON}
           complement(36072..36143,36193..36201,36244..37112,
           37854..37863) [960 nt, 320 aa]
          Length = 319

 Score =  265 bits (678), Expect = 5e-86,   Method: Compositional matrix adjust.
 Identities = 125/290 (43%), Positives = 185/290 (63%), Gaps = 4/290 (1%)

Query: 7   IVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASVTTPLKDIMIGDEASDVRSY 66
           +V+D G+G  K G AG++ P   FPSIVGRP     +   V    KD  +GDEA   R  
Sbjct: 8   LVIDNGSGMCKAGFAGDDAPRAVFPSIVGRP---RHQGIMVGMGQKDSYVGDEAQSKRGI 64

Query: 67  LQISYPMENGIIKNWTDMELLWDYAFFEQMKLPSTSNGKILLTEPPMNPLKNREKMCEVM 126
           L + YP+E+GI+ NW DME +W + F+ ++++    +  +LLTE PMNP  NREKM ++M
Sbjct: 65  LTLRYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEH-PVLLTEAPMNPKSNREKMTQIM 123

Query: 127 FEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLSHLTRRLDVAGR 186
           FE ++    YV+IQAVL+LY+ G             TH+VP+Y    + H   R+D+AGR
Sbjct: 124 FETFNVPAFYVSIQAVLSLYSSGRTTGIVLDSGDGVTHVVPIYAGFSMPHGILRIDLAGR 183

Query: 187 DVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLDLDTKLARETTALVESYELP 246
           D+T +L+ +LS RGY+F+ TA+ E VR IKEKLCYV+ D + + + A +++++ +SYELP
Sbjct: 184 DLTDYLMKILSERGYSFSTTAEREIVRDIKEKLCYVALDFEQEMQTAAQSSSIEKSYELP 243

Query: 247 DGRTIKVGQERFEAPECLFQPGLVDVEQPGVGELLFNTVQSADVDIRSSL 296
           DG+ I +G ERF APE LF P ++ +E  G+ +  +N++   DVD+R  L
Sbjct: 244 DGQVITIGNERFRAPEALFHPSVLGLESSGIDQTTYNSIMKCDVDVRKEL 293

>KLTH0B05940g Chr2 complement(485135..486286) [1152 bp, 383 aa] {ON}
           similar to uniprot|P38696 Saccharomyces cerevisiae
           YHR129C ARP1 Actin-related protein of the dynactin
           complex required for spindle orientation and nuclear
           migration putative ortholog of mammalian centractin
          Length = 383

 Score =  260 bits (665), Expect = 3e-83,   Method: Compositional matrix adjust.
 Identities = 141/388 (36%), Positives = 230/388 (59%), Gaps = 17/388 (4%)

Query: 4   HNPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASVTTPLKDIMIGDEASDV 63
           + P+VLD G+G +K G +GE  P     S++G P         + +  +  +IG+EA  +
Sbjct: 9   NQPVVLDNGSGIIKAGFSGEEQPKCFEYSLIGTPKYNKVMAGGLASDSQ--LIGNEAQKM 66

Query: 64  RSYLQISYPMENGIIKNWTDMELLWDYAFFEQMKLPSTSNGKILLTEPPMNPLKNREKMC 123
           R  L++ YP+E+G++++W  +E LW + F+  +KL +     +L+TE P+NP+KNR KMC
Sbjct: 67  RGLLKLHYPLEHGVVQDWPGLEQLWTHVFYNSLKLANIEEHPMLITEAPLNPMKNRNKMC 126

Query: 124 EVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLSHLTRRLDV 183
           E++FE +    VYV+IQAVLALYA G                VPVY+   L    +R+DV
Sbjct: 127 EMLFETFGSPAVYVSIQAVLALYAGGRTTGCVIDCGDGCCQSVPVYDGFTLPSAIQRIDV 186

Query: 184 AGRDVTRHLIDLLSR-RGYAFNRTADFETVRQIKEKLCYVSYDL-DLDTKLARETTALVE 241
           AGRD+T  L  LL +  G   + +++ E VR IKEK C+V+ D+ + +       +A +E
Sbjct: 187 AGRDITEFLQLLLRKSSGVTLSSSSEREIVRMIKEKACFVATDVGNEEQNYEGANSAELE 246

Query: 242 S-YELPDGRTIKVGQERFEAPECLFQPGLVDVEQPGVGELLFNTVQSADVDIRSSLYKAI 300
           + ++LPDG+ + +G E+F APE LFQP L+  E   + E+   ++   D+D+RSSLY +I
Sbjct: 247 TRFKLPDGKILTLGAEKFRAPEVLFQPHLIGSEFCSIQEMCQQSISKVDLDLRSSLYSSI 306

Query: 301 VLSGGSSMYPGLPSRLEKELKQLWFSRVLHNDPSRLDKFKVRIEDPPRRKHMVFIGGAVL 360
           VLSGGS+M+ G   RL  E+++        ++P+     K++I  PP RK+  +IGG++L
Sbjct: 307 VLSGGSTMFSGFGDRLLSEIRKT-------SEPNT----KIKIFAPPERKYSTWIGGSIL 355

Query: 361 ASIMADKDHMWLSKQEWLESGPASMAKF 388
           A  ++  + +W+++ EW E+     ++F
Sbjct: 356 AG-LSTFEKLWVTRAEWQENPQCIHSRF 382

>KLLA0E22925g Chr5 complement(2040279..2041421) [1143 bp, 380 aa]
           {ON} similar to uniprot|P38696 Saccharomyces cerevisiae
           YHR129C ARP1 Actin-related protein of the dynactin
           complex required for spindle orientation and nuclear
           migration putative ortholog of mammalian centractin
          Length = 380

 Score =  259 bits (663), Expect = 5e-83,   Method: Compositional matrix adjust.
 Identities = 142/391 (36%), Positives = 229/391 (58%), Gaps = 27/391 (6%)

Query: 4   HNPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASVTTPLKDIMIGDEASDV 63
           + PIVLD G+G +K G  GE+ P     S+VG P      +        +  +G++A ++
Sbjct: 10  NQPIVLDNGSGLIKAGFGGEDKPKCYEHSLVGIP---KYSKVMAGRFDGNTFVGNQAQEI 66

Query: 64  RSYLQISYPMENGIIKNWTDMELLWDYAFFEQMKLPSTSNGKILLTEPPMNPLKNREKMC 123
           R  L++ +P+E+G++ +W  +E LW + F + ++L S  +  +L+TE P+NP KNRE+MC
Sbjct: 67  RGLLKLRHPLEHGVVTDWNALEQLWGHVFEKGLQLSSLQDHPVLVTEAPLNPKKNREQMC 126

Query: 124 EVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLSHLTRRLDV 183
           E++FE +    VYV+IQAVL+LYA G             +H VPVY+   L    RR+D+
Sbjct: 127 ELLFETFSVPAVYVSIQAVLSLYASGRTTGCVLDSGDGCSHAVPVYDGYTLPSAIRRIDI 186

Query: 184 AGRDVTRHLIDLLSRR--GYAFNRTADFETVRQIKEKLCYVSYDLDLDTK----LARETT 237
           AGRD++  L+ +L R+  G +   +++ E VR IKEK CY++ D   + K      ++T 
Sbjct: 187 AGRDIS-ELLQVLIRKSTGVSLLSSSEREIVRIIKEKACYIALDPKEEEKNYTMHGKQTM 245

Query: 238 ALVESYELPDGRTIKVGQERFEAPECLFQPGLVDVEQPGVGELLFNTVQSADVDIRSSLY 297
                + LPDG+ I++  E+F APE LF P L+  E   + E+L+ ++Q  D+D+R+SL+
Sbjct: 246 -----FRLPDGKQIELDNEKFRAPEILFNPQLIGSEFQSLPEILYESIQKVDLDLRTSLF 300

Query: 298 KAIVLSGGSSMYPGLPSRLEKELKQLWFSRVLHNDPSRLDKFKVRIEDPPRRKHMVFIGG 357
             IV SGG++M PG   R+ KELK       L  +P    + K++I  PP RK+  +IGG
Sbjct: 301 SNIVFSGGTTMIPGFGDRVLKELK-------LSCEP----QTKIKIFAPPERKYSTWIGG 349

Query: 358 AVLASIMADKDHMWLSKQEWLESGPASMAKF 388
           ++L+ +   K  +W++K+EW E+     A+F
Sbjct: 350 SILSGLSTFK-KIWVTKKEWEENPRCVHARF 379

>NCAS0B07130 Chr2 complement(1354064..1355209) [1146 bp, 381 aa]
           {ON} Anc_2.117
          Length = 381

 Score =  248 bits (634), Expect = 1e-78,   Method: Compositional matrix adjust.
 Identities = 132/381 (34%), Positives = 211/381 (55%), Gaps = 20/381 (5%)

Query: 4   HNPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASVTTPLKD---IMIGDEA 60
           + P+VLD G+  +K G +G+N P     +++G P     E+  +T  + +     IG+ A
Sbjct: 8   NQPVVLDNGSSVIKSGFSGQNKPQCFEYNLIGTP---KYEKVMLTNAISNNDLTYIGNRA 64

Query: 61  SDVRSYLQISYPMENGIIKNWTDMELLWDYAFFEQMKLPSTSNGKILLTEPPMNPLKNRE 120
              R  L++ +PM  GI++NW DME LW + F + +K+       +L+TE P+NP KNR+
Sbjct: 65  QKSRGLLRLRHPMNRGIVENWDDMETLWSHTFNDILKINDFDEHPLLITEAPLNPEKNRD 124

Query: 121 KMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLSHLTRR 180
           KMCEV FEK+DF  VY+A  + L+LYA G                VP+YE   L    RR
Sbjct: 125 KMCEVFFEKFDFAAVYIANPSTLSLYASGRTTGCVLDCGDGYCSSVPIYEGFALPSSIRR 184

Query: 181 LDVAGRDVTRHL-IDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLDLDTKLARETTAL 239
           +DV GRDVT  L   +    G +   +++ E V+ +KEK CYVS D   D  ++      
Sbjct: 185 IDVGGRDVTEQLQFQIRKYTGISLYSSSEHEIVKNVKEKACYVSTDFAHDEDMSNLNPEK 244

Query: 240 VES-YELPDGRTIKVGQERFEAPECLFQPGLVDVEQPGVGELLFNTVQSADVDIRSSLYK 298
           +   ++LPDG+ + + + RF APE LF+P ++ +E   V ++ F ++   D+++R  L+ 
Sbjct: 245 IRCQFKLPDGKDLILDKARFRAPEILFRPQIMGLEYDSVSDMCFESISKVDLELRPKLFS 304

Query: 299 AIVLSGGSSMYPGLPSRLEKELKQLWFSRVLHNDPSRLDKFKVRIEDPPRRKHMVFIGGA 358
           +I+L+GGS+M+ G   RL KEL+    ++ L           ++I  PP RK+  +IGG+
Sbjct: 305 SIILNGGSTMFRGFGDRLLKELQIRTGNKNL-----------IKIIAPPERKYTSWIGGS 353

Query: 359 VLASIMADKDHMWLSKQEWLE 379
           +L  +   K  +W++K EW E
Sbjct: 354 ILTGLSTFK-QLWMTKAEWQE 373

>ZYRO0G05676g Chr7 (452257..453402) [1146 bp, 381 aa] {ON} similar
           to uniprot|P38696 Saccharomyces cerevisiae YHR129C ARP1
           Actin-related protein of the dynactin complex required
           for spindle orientation and nuclear migration putative
           ortholog of mammalian centractin
          Length = 381

 Score =  246 bits (629), Expect = 6e-78,   Method: Compositional matrix adjust.
 Identities = 139/397 (35%), Positives = 223/397 (56%), Gaps = 25/397 (6%)

Query: 1   MDPH-----NPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASVTTPLKD-I 54
           +DP+      P+VLD G+  +K G +GE+ P +   SIVG P         V    KD  
Sbjct: 2   LDPNAVLYSQPVVLDNGSAILKAGYSGEDRPKFLEHSIVGSP-----RHGYVNDSSKDDT 56

Query: 55  MIGDEASDVRSYLQISYPMENGIIKNWTDMELLWDYAFFEQMKLPSTSNGKILLTEPPMN 114
            +G+ A + RS LQ+ +P+++G++KNW DMEL+WDY F +++KL       +L+TE P+N
Sbjct: 57  FVGNLAQERRSILQLRHPVDHGVVKNWNDMELIWDYMFKDKLKLKDVDEHPVLITEAPLN 116

Query: 115 PLKNREKMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVL 174
           P+ NR++MC+++FE +    +YVA  AVL+LYA G             +  VPVY+   L
Sbjct: 117 PVSNRDEMCDLLFESFGVQALYVANPAVLSLYASGKISGCVLDCGDGYSCSVPVYQGYTL 176

Query: 175 SHLTRRLDVAGRDVTRHL-IDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLDL-DTKL 232
               +R+D+ GRD+T  L + L    G +   + + E VR IKEK CYV+ DLD+ + K 
Sbjct: 177 KSAIKRIDLGGRDLTEQLQLQLRKSTGLSLTTSGEMELVRMIKEKSCYVAVDLDIEEEKC 236

Query: 233 ARETTALVESYELPDGRTIKVGQERFEAPECLFQPGLVDVEQPGVGELLFNTVQSADVDI 292
             E   +   ++LPDG+ I + ++RF+ PE LFQP ++  E   + E+++ +V   D D+
Sbjct: 237 NYEGDQVGLKFKLPDGKFITLSKDRFQVPEILFQPSVISSEVSSIPEIIWQSVSKLDTDL 296

Query: 293 RSSLYKAIVLSGGSSMYPGLPSRLEKELKQLWFSRVLHNDPSRLDKFKVRIEDPPRRKHM 352
           R  ++  I+LSGG++M  G  +RL +EL +L              + +V+I  PP RK+ 
Sbjct: 297 RPQMWSDILLSGGTTMLKGFGNRLVQELDKL-----------NQAQSRVKIWAPPERKYT 345

Query: 353 VFIGGAVLASIMADKDHMWLSKQEWLESGPASMAKFG 389
            +IGG++LA  ++    + ++K +W E       K G
Sbjct: 346 SWIGGSILAE-LSTFQKIIVTKSQWQEDPSIIHTKCG 381

>TBLA0B01070 Chr2 (236811..237962) [1152 bp, 383 aa] {ON} Anc_2.117
           YHR129C
          Length = 383

 Score =  243 bits (621), Expect = 9e-77,   Method: Compositional matrix adjust.
 Identities = 135/378 (35%), Positives = 211/378 (55%), Gaps = 21/378 (5%)

Query: 4   HNPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASVTTPLKDIMIGDEASDV 63
           + PIVLD G+  +K G  G++ P     S++G P     ++  V    K   +G+ A + 
Sbjct: 11  NQPIVLDNGSALLKAGFGGDDKPKCFEYSLIGTP---KYDKVMVGGVEKGKFVGNLAQEY 67

Query: 64  RSYLQISYPMENGIIKNWTDMELLWDYAFFEQMKLPSTSNGKILLTEPPMNPLKNREKMC 123
           R  L++ YPM++GII+NW  ME +WD+ F + +K+ +     +++TE P+NP  NREKMC
Sbjct: 68  RGLLKLRYPMDHGIIENWEHMETVWDHIFKDCLKVSNLGEHPLVVTEAPLNPKPNREKMC 127

Query: 124 EVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLSHLTRRLDV 183
           E +FE ++   +Y+A  AVL+LYA G                VP+YE   L+   RR+D+
Sbjct: 128 ETLFESFNIPALYIANPAVLSLYASGRTTGCVVEAGDGYCSSVPIYEGFALTPSIRRIDI 187

Query: 184 AGRDVTRHL-IDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLDLDTK---LARETTAL 239
            GRD+T+HL + L    G     +++ E VR IKE  CY+  +   + +   L +E  ++
Sbjct: 188 GGRDITKHLQLQLRKSTGMWLYSSSEQEIVRLIKENGCYICSNHKKEEEKFLLDQEKKSI 247

Query: 240 VESYELPDGRTIKVGQERFEAPECLFQPGLVDVEQPGVGELLFNTVQSADVDIRSSLYKA 299
             S++LPDG+ + +G  RF APE LF P L+  E   + +++  ++   D+D+RS L   
Sbjct: 248 --SFKLPDGKNLVIGPGRFRAPEILFNPLLIGSEDSSLPDMIMQSISKVDIDLRSKLLNN 305

Query: 300 IVLSGGSSMYPGLPSRLEKELKQLWFSRVLHNDPSRLDKFKVRIEDPPRRKHMVFIGGAV 359
           I LSGGS+M+ G   RL  EL           D S     KVRI  PP RK+  FIGG++
Sbjct: 306 ITLSGGSTMFQGFCDRLITEL-----------DFSVDKTTKVRILAPPERKYSAFIGGSI 354

Query: 360 LASIMADKDHMWLSKQEW 377
           LA++   ++ MW++K +W
Sbjct: 355 LANLSTFRN-MWVTKDQW 371

>Kwal_33.14642 s33 (753758..754909) [1152 bp, 383 aa] {ON} YHR129C
           (ARP1) - Centractin [contig 388] FULL
          Length = 383

 Score =  243 bits (621), Expect = 1e-76,   Method: Compositional matrix adjust.
 Identities = 141/388 (36%), Positives = 231/388 (59%), Gaps = 17/388 (4%)

Query: 4   HNPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASVTTPLKDIMIGDEASDV 63
           + P+VLD G+G +K G +GE  P     S++G P         +++  +  ++G+EA   
Sbjct: 9   NQPVVLDNGSGIIKAGFSGEEKPKCFEYSLIGTPKYDKIMAGGLSS--RGQLVGNEAQKQ 66

Query: 64  RSYLQISYPMENGIIKNWTDMELLWDYAFFEQMKLPSTSNGKILLTEPPMNPLKNREKMC 123
           R  L++ YP+E+GI+++W+ +E LW + F+  +KL +  +  +L+TE P+NPL+NR+KMC
Sbjct: 67  RGLLRLQYPVEHGIVQDWSGLEQLWTHVFYSSLKLNNIGDHPMLVTEAPLNPLENRDKMC 126

Query: 124 EVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLSHLTRRLDV 183
           E+++E ++   VYV+IQAVLALYA G                VPVY+   +    RR+DV
Sbjct: 127 EMLYETFNVPAVYVSIQAVLALYAGGRTTGCVIDCGDGCCQSVPVYDGFSIPSAIRRIDV 186

Query: 184 AGRDVTRHLIDLLSRR-GYAFNRTADFETVRQIKEKLCYVSYDLDLDTK--LARETTALV 240
           AGRDVT  L  LL +  G     +++ E VR IKEK CYV+ ++  + +   +   +  +
Sbjct: 187 AGRDVTEFLQLLLRKSIGVTLLSSSEREIVRMIKEKACYVAPEVAAEEQKYASSRGSEEL 246

Query: 241 ESYELPDGRTIKVGQERFEAPECLFQPGLVDVEQPGVGELLFNTVQSADVDIRSSLYKAI 300
             ++LPDG+ + +G E+F APE LFQP L+  E   + ++ F ++   D+D+RSSLY ++
Sbjct: 247 TKFKLPDGKILSLGAEKFRAPEILFQPQLIGSEFNSIQDMCFQSISKVDLDLRSSLYSSL 306

Query: 301 VLSGGSSMYPGLPSRLEKELKQLWFSRVLHNDPSRLDKFKVRIEDPPRRKHMVFIGGAVL 360
           VLSGGS+++ G   RL  EL+    SR   N        K++I  PP RK+ V+IGG++L
Sbjct: 307 VLSGGSTLFAGFGDRLLNELR----SRCEPN-------VKIKIFAPPERKYSVWIGGSIL 355

Query: 361 ASIMADKDHMWLSKQEWLESGPASMAKF 388
           A  ++  + +W+++ EW E+     ++F
Sbjct: 356 AG-LSTFEKIWVTRSEWQENPQCVHSRF 382

>KAFR0F00590 Chr6 (120359..121519) [1161 bp, 386 aa] {ON} Anc_2.117
           YHR129C
          Length = 386

 Score =  243 bits (619), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 131/378 (34%), Positives = 209/378 (55%), Gaps = 16/378 (4%)

Query: 4   HNPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASVTTPLKDIMIGDEASDV 63
           + PIV+D GT  +K G  GE  P     SIVG P  + ++         D  IG++A   
Sbjct: 12  NQPIVIDNGTNVIKGGFTGETKPRCLEYSIVGTP--KYDKIMQSNGIESDSFIGNKAQKY 69

Query: 64  RSYLQISYPMENGIIKNWTDMELLWDYAFFEQMKLPSTSNGKILLTEPPMNPLKNREKMC 123
           R  L++ +PM  G+++NW DME +W Y F + + L + +   IL+TEPP+N + NR+KMC
Sbjct: 70  RGILKLRHPMLRGVVQNWDDMETIWQYVFDDTLYLENLNEHPILITEPPLNNMANRQKMC 129

Query: 124 EVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLSHLTRRLDV 183
           E +FE + F  VY+++  VL+LYA G                +PVY    L+   +++D+
Sbjct: 130 EALFEIFGFPAVYISVSPVLSLYASGQTTGCAVDCGDGYCTSIPVYNGFSLASSVKKIDI 189

Query: 184 AGRDVTRHL-IDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLDLDT-KLARETTALVE 241
            G D+T  L   +L   G     +++ E VR IKEK+CY++ D +L+T K       +  
Sbjct: 190 GGCDITEQLQFSILKNTGLFMYSSSEREIVRTIKEKVCYIATDYNLETEKYLFNEEKMAS 249

Query: 242 SYELPDGRTIKVGQERFEAPECLFQPGLVDVEQPGVGELLFNTVQSADVDIRSSLYKAIV 301
            ++LPDG+ + + Q ++ + E LF+P L+  E   + E+ + +++  D D+R  LY  IV
Sbjct: 250 QFKLPDGKMLNISQGKYTSTEILFRPELIGSEFDSLPEICYQSIKKVDSDLRLPLYSNIV 309

Query: 302 LSGGSSMYPGLPSRLEKELKQLWFSRVLHNDPSRLDKFKVRIEDPPRRKHMVFIGGAVLA 361
           LSGG++M PG  SRL KEL+ L          +  D  K+RI  PP RK+  +IGG++L+
Sbjct: 310 LSGGTTMCPGFGSRLLKELQTL----------TGYDT-KIRIIAPPERKYTSWIGGSILS 358

Query: 362 SIMADKDHMWLSKQEWLE 379
             ++    +W++K  W E
Sbjct: 359 G-LSTFSKIWVTKSMWEE 375

>YHR129C Chr8 complement(362999..364153) [1155 bp, 384 aa] {ON}
           ARP1Actin-related protein of the dynactin complex;
           required for spindle orientation and nuclear migration;
           putative ortholog of mammalian centractin
          Length = 384

 Score =  234 bits (597), Expect = 4e-73,   Method: Compositional matrix adjust.
 Identities = 123/378 (32%), Positives = 206/378 (54%), Gaps = 17/378 (4%)

Query: 4   HNPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASVTTPLKDIMIGDEASDV 63
           + P+V+D G+G +K G +GE  P      +VG       ++  +     D  IG+ A  +
Sbjct: 12  NQPVVIDNGSGIIKAGFSGEERPKALEYCLVGNT---KYDKVMLEGLQGDTFIGNNAQKL 68

Query: 64  RSYLQISYPMENGIIKNWTDMELLWDYAFFEQMKLPSTSNGKILLTEPPMNPLKNREKMC 123
           R  L++ YP+++G++++W  MEL+W Y   E ++L +     +L+TE PMNPLKNRE+M 
Sbjct: 69  RGLLKLRYPIKHGVVEDWDSMELIWSYVLNEVLQLQNIGEHPLLITEAPMNPLKNREQMA 128

Query: 124 EVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLSHLTRRLDV 183
           +V+FE +D   +YV+  AVL+LYA G                VP+Y+   L     R+D+
Sbjct: 129 QVLFETFDVSALYVSNPAVLSLYASGRTTGCVVDCGEGYCSTVPIYDGFALPASMMRMDI 188

Query: 184 AGRDVTRHL-IDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLDL-DTKLARETTALVE 241
            G D+T  L   L    G +   +++ E VR +KEK+CY++ ++   + K  + T  L+ 
Sbjct: 189 GGADITEQLQFQLRKSAGVSLFSSSEREIVRTMKEKVCYLAKNIKKEEEKYLQGTQDLIS 248

Query: 242 SYELPDGRTIKVGQERFEAPECLFQPGLVDVEQPGVGELLFNTVQSADVDIRSSLYKAIV 301
           +++LPDGR I+VG +R+ APE LF P ++ +   G+ ++   ++   D+D+R  L  +I+
Sbjct: 249 TFKLPDGRCIEVGNDRYRAPEILFSPQIIGLGYDGLSDMCMQSIWKVDLDLRKPLLSSII 308

Query: 302 LSGGSSMYPGLPSRLEKELKQLWFSRVLHNDPSRLDKFKVRIEDPPRRKHMVFIGGAVLA 361
           LSGG++   G   R+      LW    L    S     K++I  P  RK+  +IGG++L 
Sbjct: 309 LSGGTTTLKGFGDRM------LWDLEALTKGTS-----KIKIIAPSERKYTTWIGGSILT 357

Query: 362 SIMADKDHMWLSKQEWLE 379
             ++    +W  K +WLE
Sbjct: 358 G-LSTFQRLWTKKSDWLE 374

>Suva_15.326 Chr15 complement(565392..566546) [1155 bp, 384 aa] {ON}
           YHR129C (REAL)
          Length = 384

 Score =  234 bits (596), Expect = 6e-73,   Method: Compositional matrix adjust.
 Identities = 121/378 (32%), Positives = 211/378 (55%), Gaps = 17/378 (4%)

Query: 4   HNPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASVTTPLKDIMIGDEASDV 63
           + PIV+D G+G +K G +GE  P     S+VG       ++  +     D  +G++A  +
Sbjct: 12  NQPIVIDNGSGIIKAGFSGEEKPKSLEYSLVGHA---KYDKVMLEGLQGDTFVGNKAQRL 68

Query: 64  RSYLQISYPMENGIIKNWTDMELLWDYAFFEQMKLPSTSNGKILLTEPPMNPLKNREKMC 123
           R  L++ YP+E+G++++W  MEL+W +   E ++L +     +L+TE PMNPLKNRE M 
Sbjct: 69  RGLLRLQYPIEHGVVEDWDSMELIWAHILNEVLQLQNIEEHPLLITEAPMNPLKNREVMA 128

Query: 124 EVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLSHLTRRLDV 183
           +V+FE ++   +YV+  AVL+LYA G                VP+Y+   L     R+D+
Sbjct: 129 QVLFETFNLPALYVSNPAVLSLYASGRTTGCVIDCGEGYCSTVPIYDGFALPASMMRMDI 188

Query: 184 AGRDVTRHL-IDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLDL-DTKLARETTALVE 241
            GRD+T+ L   L    G +   +++ E VR IKEK+CY++ D+   +    +E+  L  
Sbjct: 189 GGRDITKQLQFQLRKSAGVSLFSSSEREIVRTIKEKVCYLATDIKKEENTYMQESQDLTS 248

Query: 242 SYELPDGRTIKVGQERFEAPECLFQPGLVDVEQPGVGELLFNTVQSADVDIRSSLYKAIV 301
            ++LPDG+ I++G +R+ APE LF P ++     G+ ++   ++   D+D+R++L  +I+
Sbjct: 249 VFKLPDGKCIEIGNDRYRAPEILFSPQIIGSGYDGLSDMCMQSIWKVDLDLRTTLLSSII 308

Query: 302 LSGGSSMYPGLPSRLEKELKQLWFSRVLHNDPSRLDKFKVRIEDPPRRKHMVFIGGAVLA 361
           LSGG++   G   R+  +L+   F++            K++I  PP RK+  ++GG++L 
Sbjct: 309 LSGGTTTLRGFGDRMLHDLEA--FTK---------GTSKIKIIAPPERKYTTWVGGSILT 357

Query: 362 SIMADKDHMWLSKQEWLE 379
             ++    +W  K +WLE
Sbjct: 358 G-LSTFQRLWTKKSDWLE 374

>Smik_8.210 Chr8 complement(339093..340247) [1155 bp, 384 aa] {ON}
           YHR129C (REAL)
          Length = 384

 Score =  234 bits (596), Expect = 6e-73,   Method: Compositional matrix adjust.
 Identities = 122/378 (32%), Positives = 207/378 (54%), Gaps = 17/378 (4%)

Query: 4   HNPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASVTTPLKDIMIGDEASDV 63
           + PIV+D G+G +K G +GE  P     S+VG       ++  +     D  +G++A  +
Sbjct: 12  NQPIVIDNGSGIIKAGFSGEERPKALEYSLVGHT---KYDKVMLEGLQGDTFVGNKAQKL 68

Query: 64  RSYLQISYPMENGIIKNWTDMELLWDYAFFEQMKLPSTSNGKILLTEPPMNPLKNREKMC 123
           R  L++ YPM++G++++W  MEL+W Y   E ++L +     +L+TE PMNPLKNRE + 
Sbjct: 69  RGLLRLRYPMKHGVVEDWDSMELIWSYVLNEVLQLQNIEEHPLLITEAPMNPLKNREMIA 128

Query: 124 EVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLSHLTRRLDV 183
           +VMFE ++   +YV+  AVL+LYA G                VP+Y+   L     R+D+
Sbjct: 129 QVMFETFNLSAIYVSDPAVLSLYASGRTTGCVVDCGEGYCSSVPIYDGFALPASIMRMDI 188

Query: 184 AGRDVTRHL-IDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLDLDT-KLARETTALVE 241
            G D+T  L   +    G +   +++ E VR IKEK+CY++ D   +  K  + T  L+ 
Sbjct: 189 GGGDITEQLQFQIRKSAGVSLFSSSEREIVRTIKEKVCYLAKDAKKEEDKYLQGTQDLIS 248

Query: 242 SYELPDGRTIKVGQERFEAPECLFQPGLVDVEQPGVGELLFNTVQSADVDIRSSLYKAIV 301
           +++LPDG++I+VG +R+ APE LF P ++     G+  +   ++   D+D+R +L  +++
Sbjct: 249 AFKLPDGKSIEVGNDRYRAPEILFSPQIIGSGYDGLSNMCMQSIWKVDLDLRKNLLSSVI 308

Query: 302 LSGGSSMYPGLPSRLEKELKQLWFSRVLHNDPSRLDKFKVRIEDPPRRKHMVFIGGAVLA 361
           LSGG++   G   R+  +L+ L                K++I  PP RK+  +IGG++L 
Sbjct: 309 LSGGTTTLKGFGDRMLHDLEAL-----------TKGTSKIKIIAPPERKYTAWIGGSILT 357

Query: 362 SIMADKDHMWLSKQEWLE 379
             ++    +W  K +WLE
Sbjct: 358 G-LSTFQKLWTKKSDWLE 374

>Skud_8.190 Chr8 complement(336365..337519) [1155 bp, 384 aa] {ON}
           YHR129C (REAL)
          Length = 384

 Score =  231 bits (589), Expect = 6e-72,   Method: Compositional matrix adjust.
 Identities = 120/378 (31%), Positives = 206/378 (54%), Gaps = 17/378 (4%)

Query: 4   HNPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASVTTPLKDIMIGDEASDV 63
           + PIV+D G+G +K+G +GE  P     S+VG       E+  +     D  +G++A  +
Sbjct: 12  NQPIVIDNGSGIIKVGFSGEERPKALEYSLVGHV---KYEKVMLEGLQGDTFVGNKAQKL 68

Query: 64  RSYLQISYPMENGIIKNWTDMELLWDYAFFEQMKLPSTSNGKILLTEPPMNPLKNREKMC 123
           R  L++ YPM +G++++W  MEL+W Y   E ++L +     +L+TE PMNPLKNRE M 
Sbjct: 69  RGLLRLRYPMTHGVVEDWDSMELIWSYMLNEVLQLQNIEEHPLLITEAPMNPLKNREVMA 128

Query: 124 EVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLSHLTRRLDV 183
           +V+FE ++   +Y++  AVL+LYA G                VP+Y+   L     R+D+
Sbjct: 129 QVLFETFNLPALYISNPAVLSLYASGRTTGCVVDCGEGYCSTVPIYDGFALPASIMRMDI 188

Query: 184 AGRDVTRHL-IDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLDLDT-KLARETTALVE 241
            GRD+T  L   L    G +   +++ E VR IKEK+CY++ ++  +  +  +    L  
Sbjct: 189 GGRDITEQLQFQLRKSAGISLFSSSELEVVRMIKEKVCYLAKNIKKEEDRYLQGHHDLGS 248

Query: 242 SYELPDGRTIKVGQERFEAPECLFQPGLVDVEQPGVGELLFNTVQSADVDIRSSLYKAIV 301
            ++LPDG+ I++G +R+ APE LF P ++     G+ ++   ++   D+D+R +L  +I+
Sbjct: 249 VFKLPDGKCIEIGNDRYRAPEILFSPQIIGSGYDGLSDMCMQSIWKVDLDLRKTLLSSII 308

Query: 302 LSGGSSMYPGLPSRLEKELKQLWFSRVLHNDPSRLDKFKVRIEDPPRRKHMVFIGGAVLA 361
           LSGG++   G   R+  +L+ L                K++I  PP RK+  ++GG++L 
Sbjct: 309 LSGGTTTLRGFGERMLHDLEAL-----------SKGTCKIKIIAPPERKYTTWVGGSILT 357

Query: 362 SIMADKDHMWLSKQEWLE 379
             ++    +W  K +WLE
Sbjct: 358 G-LSTFQKLWTKKSDWLE 374

>TPHA0I01300 Chr9 (295950..297089) [1140 bp, 379 aa] {ON} Anc_2.117
           YHR129C
          Length = 379

 Score =  230 bits (586), Expect = 1e-71,   Method: Compositional matrix adjust.
 Identities = 125/378 (33%), Positives = 211/378 (55%), Gaps = 17/378 (4%)

Query: 4   HNPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASVTTPLKDIMIGDEASDV 63
           + P+V+D GTG +K+G  G++ P     +IVG P     ++  +     ++ IG++A + 
Sbjct: 8   NQPVVIDNGTGVLKVGFVGDDKPKCFQHNIVGTPKF---DKVMIGGLDDNMYIGNKAQEN 64

Query: 64  RSYLQISYPMENGIIKNWTDMELLWDYAFFEQMKLPSTSNGKILLTEPPMNPLKNREKMC 123
           R  L++ +PME+G +K+W +ME +W +     + +       IL+TE P+N  KNRE MC
Sbjct: 65  RGLLRLRHPMEHGEVKHWDEMEAVWKHTLLHDLNIQHIEEHPILITEAPLNSSKNREHMC 124

Query: 124 EVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLSHLTRRLDV 183
           E++FE ++   ++V   AVLALY+ G                VP+YE   L+   RR+D+
Sbjct: 125 EILFESFNIPAIHVENPAVLALYSGGRTTGCVIDCGEGYCSAVPIYEGFALTPSIRRIDI 184

Query: 184 AGRDVTRHL-IDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLDLDT-KLARETTALVE 241
            GR++T  L   +    G +   + + E VR IKE+ CYV+ D+  +  K   ++ +   
Sbjct: 185 GGREITEQLQFQIRKSVGMSLFSSNEKEIVRTIKERACYVADDISKEEHKYILDSESNSS 244

Query: 242 SYELPDGRTIKVGQERFEAPECLFQPGLVDVEQPGVGELLFNTVQSADVDIRSSLYKAIV 301
            ++LPDG+++ +G  RF A E LF P L+  E   V E++F T+   D+D+R  LYK++V
Sbjct: 245 KFKLPDGKSLSIGNVRFRATELLFNPRLIGCESDSVPEIVFQTLSRVDIDLRPMLYKSLV 304

Query: 302 LSGGSSMYPGLPSRLEKELKQLWFSRVLHNDPSRLDKFKVRIEDPPRRKHMVFIGGAVLA 361
           L+GG+++ PG  +R+ KEL+ L          ++ D  K+RI   P RK+  +IGG++LA
Sbjct: 305 LNGGTTVLPGFGNRILKELQIL----------TKQDT-KLRIIASPERKYTTWIGGSILA 353

Query: 362 SIMADKDHMWLSKQEWLE 379
             ++    + ++K  W E
Sbjct: 354 G-LSTFQKILVTKSNWNE 370

>TDEL0B04810 Chr2 (849529..850650) [1122 bp, 373 aa] {ON} Anc_2.117
           YHR129C
          Length = 373

 Score =  224 bits (570), Expect = 3e-69,   Method: Compositional matrix adjust.
 Identities = 128/378 (33%), Positives = 199/378 (52%), Gaps = 17/378 (4%)

Query: 4   HNPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASVTTPLKDIMIGDEASDV 63
           + P+V+D G+  VK G  GE  P     S++G        +  V     D  +G++A  +
Sbjct: 9   NQPVVIDNGSAVVKAGFCGEEKPRCMEYSLIGDA---NYNKIMVGGLECDSFVGNKAQRL 65

Query: 64  RSYLQISYPMENGIIKNWTDMELLWDYAFFEQMKLPSTSNGKILLTEPPMNPLKNREKMC 123
           R  L++ +PME G++ +W DMELLW +  F+ ++L S     +L+TE P+NP  N+EKM 
Sbjct: 66  RGLLKLKHPMERGVVSDWDDMELLWSHILFDSLQLTSGMEHPLLITEAPLNPESNKEKML 125

Query: 124 EVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLSHLTRRLDV 183
           EV FE ++   + V+I  VL+LYA G                VPV E   L+   +R+++
Sbjct: 126 EVFFETFNIPAICVSIPGVLSLYASGRTTGCVVDCGEGYCSSVPVCEGYTLASSIKRINL 185

Query: 184 AGRDVTRHL-IDLLSRRGYAFNRTADFETVRQIKEKLCYVSYD-LDLDTKLARETTALVE 241
            G DVT+ L   L    G     + + E VR +KEK CYVS + L  + K   E   +  
Sbjct: 186 GGIDVTKQLQFQLRKESGVWLFSSGERELVRTMKEKSCYVSLNQLKDEEKFTFEPGKMNT 245

Query: 242 SYELPDGRTIKVGQERFEAPECLFQPGLVDVEQPGVGELLFNTVQSADVDIRSSLYKAIV 301
           +++LPDG  + + + RF APE LFQP ++  E+P + E+   ++ S DV++R  L   I 
Sbjct: 246 NFKLPDGNMLTLSKSRFRAPEILFQPQIIASEEPSLPEMCLQSILSVDVELRPRLMSRIT 305

Query: 302 LSGGSSMYPGLPSRLEKELKQLWFSRVLHNDPSRLDKFKVRIEDPPRRKHMVFIGGAVLA 361
           LSGG++M+ G   R  +EL+            S   K  +RI  PP RK+  +IGG++LA
Sbjct: 306 LSGGTTMFRGFGDRFLQELQ-----------ISTCKKSNIRILAPPERKYTAWIGGSMLA 354

Query: 362 SIMADKDHMWLSKQEWLE 379
            +   +  M  +K +W E
Sbjct: 355 GLTTFR-KMLTTKSDWRE 371

>NDAI0B04460 Chr2 complement(1115478..1116623) [1146 bp, 381 aa]
           {ON} Anc_2.117
          Length = 381

 Score =  223 bits (567), Expect = 9e-69,   Method: Compositional matrix adjust.
 Identities = 121/381 (31%), Positives = 208/381 (54%), Gaps = 19/381 (4%)

Query: 4   HNPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASVTTPLKDI--MIGDEAS 61
           + PIV+D G+  +K G + ++ P     ++ G P     ++  +T  L+++   IG+ A 
Sbjct: 9   NQPIVIDNGSCIIKSGFSRQDKPAGFEYNLTGMP---KYDKIMITGQLENLDKYIGNRAQ 65

Query: 62  DVRSYLQISYPMENGIIKNWTDMELLWDYAFFEQMKLPSTSNGKILLTEPPMNPLKNREK 121
            +R  L++ +PM  G++ NW DMELLW + F + + + +     +L+TE P+   K R  
Sbjct: 66  SIRGLLRLQHPMNRGVVDNWDDMELLWWHIFNDTLNVQNIEEHPLLITEAPLTIEKQRHI 125

Query: 122 MCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLSHLTRRL 181
           MCE +FE ++   +YVA  +VL+LYA G                 P+YE  VL    R++
Sbjct: 126 MCERLFETFNIPSLYVANPSVLSLYASGNTTGCVVDCGDGYCSSTPIYEGFVLPASIRKM 185

Query: 182 DVAGRDVTRHL-IDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLD-LDTKLARETTAL 239
           +V GRD+T HL   +    G +   + + E VR IKEK+CY+S D +  +         +
Sbjct: 186 EVGGRDITEHLQFQIRKSSGISLYSSNEKEIVRTIKEKVCYISEDFNKSEESYYLRQDEM 245

Query: 240 VESYELPDGRTIKVGQERFEAPECLFQPGLVDVEQPGVGELLFNTVQSADVDIRSSLYKA 299
              ++LPDG+ + + +ERF +PE LF P L+ +E   V  + F ++   D+++R  L+  
Sbjct: 246 SCKFKLPDGKELTLNKERFRSPEVLFNPQLMGLENENVSAMCFESISKVDLELRPKLFSN 305

Query: 300 IVLSGGSSMYPGLPSRLEKELKQLWFSRVLHNDPSRLDKFKVRIEDPPRRKHMVFIGGAV 359
           I+L+GGS+++ G  SRL  +L++L  +R            K++I  PP RK+  +IGG++
Sbjct: 306 ILLTGGSTLFKGFGSRLLGDLQELTNNRA-----------KIKILAPPERKYTSWIGGSI 354

Query: 360 LASIMADKDHMWLSKQEWLES 380
           L  +   K+ +W++K +W ES
Sbjct: 355 LTGLSTFKN-LWVTKSDWEES 374

>KNAG0H03650 Chr8 complement(678598..679761) [1164 bp, 387 aa] {ON}
           Anc_2.117 YHR129C
          Length = 387

 Score =  208 bits (530), Expect = 5e-63,   Method: Compositional matrix adjust.
 Identities = 128/396 (32%), Positives = 209/396 (52%), Gaps = 31/396 (7%)

Query: 4   HNPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASVTTPLKD-IMIGDEASD 62
           + P+VLD G+  +K G +G+  P     ++ G+P      +  +TT L+D   +G+EA  
Sbjct: 11  NQPVVLDNGSAILKAGFSGDETPAILEYTMAGKP----RYKKVMTTGLEDRTFVGNEAQR 66

Query: 63  VRSYLQISYPMENGIIKNWTDMELLWDYAFFEQMKLPSTSNGKI-----LLTEPPMNPLK 117
           +R  L +  P+  G + NW DMELLW + F+ +++L    N +I     L+TE P+N  K
Sbjct: 67  LRGLLALRRPISRGEVTNWDDMELLWSHIFYSKLQL-GQGNSQIGDHPLLITEAPLNSTK 125

Query: 118 NREKMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLSHL 177
           NRE MCE+++E ++F  +YVA  AVL+LYA G             +   PVY+   L   
Sbjct: 126 NRETMCEILYETFNFDALYVAHPAVLSLYATGQTTGCVLECGEGYSASTPVYQGFALPSS 185

Query: 178 TRRLDVAGRDVTRHLIDLLSRR-GYAFNRTADFETVRQIKEKLCYVSYDLDLDTKL---- 232
            RR+D+ GRD+T+ L   + +  G +    ++ E VR IKEK  YV+ D   + +     
Sbjct: 186 IRRIDIGGRDITQELQFYIRKSTGLSLFSNSEQEIVRTIKEKANYVALDYKFEEEKFFIH 245

Query: 233 ARETTALVESYELPDGRTIKVGQERFEAPECLFQPGLVDVEQPGVGELLFNTVQSADVDI 292
            RE T+ V+   LPDG+ +  G+ ++   E LFQP L+  E   V E+L  ++   D+D+
Sbjct: 246 ERENTSTVK---LPDGQELTFGKGKYRTSEILFQPQLIGSECVSVPEMLLESINKVDMDL 302

Query: 293 RSSLYKAIVLSGGSSMYPGLPSRLEKELKQLWFSRVLHNDPSRLDKFKVRIEDPPRRKHM 352
           R+ L + IVLSGG++M  G   R   E K++                KV+I     R ++
Sbjct: 303 RTQLLENIVLSGGTTMLKGFDQRTMSETKKMLPKHT-----------KVKIRSLAERSYI 351

Query: 353 VFIGGAVLASIMADKDHMWLSKQEWLESGPASMAKF 388
            +IGG++L+ +   ++ +WL+++ + E       KF
Sbjct: 352 AWIGGSILSGLYGFRN-LWLTREMYEEDPSMVHRKF 386

>CAGL0H09042g Chr8 (884592..885755) [1164 bp, 387 aa] {ON} similar
           to uniprot|P38696 Saccharomyces cerevisiae YHR129c ACT5
          Length = 387

 Score =  182 bits (461), Expect = 5e-53,   Method: Compositional matrix adjust.
 Identities = 112/380 (29%), Positives = 185/380 (48%), Gaps = 20/380 (5%)

Query: 4   HNPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASVTTPLKDIMIGDEASDV 63
           + P++LD G+  +K G AG   PD    + +G P+    ER+ VT   K+  IG+ A + 
Sbjct: 10  NQPVILDNGSSVIKAGFAGSQQPDVLEYAWIGNPL---AERSMVTVSNKETYIGNSAYER 66

Query: 64  RSYLQISYPMENGIIKNWTDMELLWDYAFFEQMKLPSTSNGKILLTEPPMNPLKNREKMC 123
           R+ L +  P     I +W  +E LWDY    ++++       ++LT       K  EKMC
Sbjct: 67  RATLHLESPYSTNAIMSWDRLEDLWDYVLLNKLEIEQLQEHPVVLTNSMSTSKKEEEKMC 126

Query: 124 EVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLSHLTRRLDV 183
           EV+FEK+    +Y +   +++LY  G               I  V + +++   ++  + 
Sbjct: 127 EVLFEKFSIPAIYCSRDPIMSLYGLGRTTGCSVSCGHRGIGITTVIDGMIVGGSSQISNT 186

Query: 184 AGRDVTRHLIDLLSRRGYAF-NRTADFETVRQIKEKLCYVSYDLDLDTKLARETTALVES 242
            G  VT  ++DLL        N     E +R IKE+ C +S D   + +     T+   +
Sbjct: 187 GGSAVTNTMLDLLRHNHPKLENGQNGIELIRSIKERCCVLSKDFYNEIRAYELITSKTSN 246

Query: 243 --YELPDGRTIKVGQERFEAPECLFQPGLVDVEQPGVGELLFNTVQSADVDIRSSLYKAI 300
             Y LPDG  I++G ERFEAPE +F P      +  + +++ N++  A +  RS L ++I
Sbjct: 247 NKYRLPDGNIIEIGSERFEAPEIIFNPQAYGYSEIPLQKMIINSISRAGILPRSQLLESI 306

Query: 301 VLSGGSSMYPGLPSRLEKELKQLWFSRVLHNDPSRLD-KFKVRIEDPPRRKHMVFIGGAV 359
           VLSGGSS+  G   RL KE+++             +D   K+ +  P  R+ + +IGG+V
Sbjct: 307 VLSGGSSLIKGFGERLTKEIRK------------EIDGNQKIMLNAPHERRFLPWIGGSV 354

Query: 360 LASIMADKDHMWLSKQEWLE 379
           L+ +   K  +W SK  + E
Sbjct: 355 LSGLSTMK-LLWKSKSAYRE 373

>Kwal_27.9958 s27 (139638..140975) [1338 bp, 445 aa] {ON} YJR065C
           (ARP3) - involved in the function of the actin
           cytoskeleton [contig 43] FULL
          Length = 445

 Score =  170 bits (431), Expect = 6e-48,   Method: Compositional matrix adjust.
 Identities = 134/441 (30%), Positives = 211/441 (47%), Gaps = 64/441 (14%)

Query: 5   NP-IVLDQGTGFVKIGRAGENFPDYTFPSIVG--RPILRAEERASVT------------- 48
           NP IV+D GTG  K+G AG + P + FP+ +   +P    ++  S               
Sbjct: 6   NPAIVMDNGTGLTKLGFAGNDSPSWIFPTAIATAQPSTTTKQSGSSGGVGPGSGSIQTQG 65

Query: 49  --------------------TPLKDIMIGDEA---SDVRSYLQISYPMENGIIKNWTDME 85
                               T   D  IGDEA   S   SY  +SYP+ +G ++NW  ME
Sbjct: 66  VGSSSLSAALLSNNLAGKRGTEDLDFYIGDEAIAASQGPSY-SLSYPIRHGQVENWDHME 124

Query: 86  LLWDYAFFEQMKLPSTSNGKILLTEPPMNPLKNREKMCEVMFEKYDFGGVYVAIQAVLAL 145
             W+ + F+ ++     +   LLTEPP+NP +NRE++ E+ FE ++  G+Y+A+QAVLAL
Sbjct: 125 RFWENSIFKYLRTEPEDH-YFLLTEPPLNPPENREQVAEIFFESFNCAGLYIAVQAVLAL 183

Query: 146 YAQGLXXXXXXXXXXXX--------THIVPVYESVVLSHLTRRLDVAGRDVTRHLIDLLS 197
            A                       TH++PV E  V+    + + +AGRD+T  +  LL 
Sbjct: 184 AASWTSSKVVDRSLTGTVIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITLFIQSLLR 243

Query: 198 RRGYAFNRTADFETVRQIKEKLCYVSYDL-----DLDTKLARETTALVESYELPDGRTIK 252
            RG          T  +IK++ CYV  D+       D    +    +VE+ E    + I 
Sbjct: 244 ERG---EEDTTLRTAERIKQEYCYVCSDIVKEFNKFDRDSEKFAQFIVENSEKTRRKVID 300

Query: 253 VGQERFEAPECLFQPGLV--DVEQPGVGELLFNTVQSADVDIRSSLYKAIVLSGGSSMYP 310
           VG ERF APE  F P +   D   P +  ++  T+Q+  +D+R  LY  IVLSGGS+M+ 
Sbjct: 301 VGYERFLAPEIFFNPEIASSDFLTP-LPTIVDQTIQACPIDVRKGLYNNIVLSGGSTMFK 359

Query: 311 GLPSRLEKELKQLWFSRVL---HNDPSRLDKFKVRIEDPPRRKHMVFIGGAVLASIMADK 367
               RL+++LK +  +R+    H   ++     V++    R+++ V+ GG++LA     +
Sbjct: 360 DFGRRLQRDLKGIVNNRIALSEHLSGTKSTGVDVQVISHRRQRNAVWFGGSLLAETAEFR 419

Query: 368 DHMWLSKQEWLESGPASMAKF 388
            +   SKQ++ E GP  +  F
Sbjct: 420 GYCH-SKQDYEEIGPEIVRNF 439

>KNAG0B00170 Chr2 (18478..19839) [1362 bp, 453 aa] {ON} Anc_1.514
           YJR065C
          Length = 453

 Score =  170 bits (430), Expect = 8e-48,   Method: Compositional matrix adjust.
 Identities = 131/450 (29%), Positives = 214/450 (47%), Gaps = 72/450 (16%)

Query: 4   HNP-IVLDQGTGFVKIGRAGENFPDYTFPSIV----GRPILRAEERASVT---------- 48
           +NP +V+D GTG  K+G AG + P + FP+ +    G      + +A  T          
Sbjct: 5   NNPAVVMDNGTGLTKLGFAGNDSPSWIFPTAIATSQGTATGSNKNKAQATGGSNAGGSNP 64

Query: 49  -----------------------------TPLKDIMIGDEA---SDVRSYLQISYPMENG 76
                                        T   D  IG+EA   S   SY  +SYP+ +G
Sbjct: 65  YFGNSTSATSFNNLSSQMLMSNNLAGKRGTEDLDFYIGNEALIASQGASY-SLSYPIRHG 123

Query: 77  IIKNWTDMELLWDYAFFEQMKLPSTSNGKILLTEPPMNPLKNREKMCEVMFEKYDFGGVY 136
            ++NW  ME  W+ + F+ ++     +   LLTEPP+NP +NRE++ E+ FE ++  G+Y
Sbjct: 124 QVENWDHMERFWENSIFKYLRT-EPEDHFFLLTEPPLNPPENREQIAEIFFESFNCAGLY 182

Query: 137 VAIQAVLALYAQGLXXXXXXXXXXXX--------THIVPVYESVVLSHLTRRLDVAGRDV 188
           +A+QAVLAL A                       TH++PV E  V+    + + +AGRD+
Sbjct: 183 IAVQAVLALAASWTSSKVVDRSLTGTVIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDI 242

Query: 189 TRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDL-----DLDTKLARETTALVESY 243
           T+ +  LL  RG A        T  +IK++ CYV  D+       D    +    +VE+ 
Sbjct: 243 TQFIQTLLRERGEA---DTSLRTAERIKQEYCYVCPDIVKEFNKFDRDPEKFAQYVVENQ 299

Query: 244 ELPDGRTIKVGQERFEAPECLFQPGLV--DVEQPGVGELLFNTVQSADVDIRSSLYKAIV 301
           E    + + VG ERF APE  F P +   D   P +  ++  T+Q+  +D+R  LY  IV
Sbjct: 300 EKTQKKVVDVGYERFLAPEIFFNPEIASSDFLTP-LPTIVDQTIQACPIDVRKGLYNNIV 358

Query: 302 LSGGSSMYPGLPSRLEKELKQLWFSRVLHND---PSRLDKFKVRIEDPPRRKHMVFIGGA 358
           LSGGS+M+     RL+++LK +  +R+  N+    ++     V +    ++++ V+ GG+
Sbjct: 359 LSGGSTMFKDFGRRLQRDLKSIVNNRIAQNELLSGTKSTGVDVSVISHRKQRNAVWFGGS 418

Query: 359 VLASIMADKDHMWLSKQEWLESGPASMAKF 388
           +LA     K +   +K+++ E GP  +  F
Sbjct: 419 LLAQTAEFKSYCH-TKKDYEEYGPEIVRNF 447

>KLTH0C02508g Chr3 (224722..226077) [1356 bp, 451 aa] {ON} highly
           similar to uniprot|P47117 Saccharomyces cerevisiae
           YJR065C ARP3 Essential component of the Arp2/3 complex
           which is a highly conserved actin nucleation center
           required for the motility and integrity of actin patches
           involved in endocytosis and membrane growth and polarity
          Length = 451

 Score =  169 bits (429), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 133/448 (29%), Positives = 210/448 (46%), Gaps = 70/448 (15%)

Query: 4   HNP-IVLDQGTGFVKIGRAGENFPDYTFPSIVG-----------------------RPIL 39
           +NP IV+D GTG  K+G AG + P + FP+ +                         P  
Sbjct: 5   NNPAIVMDNGTGLTKLGFAGNDSPSWVFPTAIATAQRSTTKQGGSGSGAGQSQGSGNPYF 64

Query: 40  RAEERASVTTPLK------------------DIMIGDEA---SDVRSYLQISYPMENGII 78
                A+    L                   D  IG+EA   S   SY  +SYP+ +G +
Sbjct: 65  GNSTSATSFNSLASAALLSNNLAGKRGTEDLDFYIGNEALAASQGPSY-SLSYPIRHGQV 123

Query: 79  KNWTDMELLWDYAFFEQMKLPSTSNGKILLTEPPMNPLKNREKMCEVMFEKYDFGGVYVA 138
           +NW  ME  W+ + F+ ++     +   LLTEPP+NP +NRE++ E+ FE ++  G+Y+A
Sbjct: 124 ENWDHMERFWENSIFKYLRT-EPEDHFFLLTEPPLNPPENREQVAEIFFESFNCAGLYIA 182

Query: 139 IQAVLALYAQGLXXXXXXXXXXXX--------THIVPVYESVVLSHLTRRLDVAGRDVTR 190
           +QAVLAL A                       TH++PV E  V+    + + +AGRD+T 
Sbjct: 183 VQAVLALAASWTSSKVVDRSLTGTVIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITL 242

Query: 191 HLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDL-----DLDTKLARETTALVESYEL 245
            +  LL  RG          T  +IK++ CYV  D+       D    +    +VE+ E 
Sbjct: 243 FIQSLLRERG---EEDTTLRTAERIKQEYCYVCSDIVKEFNKFDRDPQKFAQFIVENSEK 299

Query: 246 PDGRTIKVGQERFEAPECLFQPGLV--DVEQPGVGELLFNTVQSADVDIRSSLYKAIVLS 303
              + I VG ERF APE  F P +   D   P +  ++  T+Q+  +D+R  LY  IVLS
Sbjct: 300 TKRKVIDVGYERFLAPEIFFNPEIASSDFLTP-LPTVVDQTIQACPIDVRKGLYNNIVLS 358

Query: 304 GGSSMYPGLPSRLEKELKQLWFSRVL---HNDPSRLDKFKVRIEDPPRRKHMVFIGGAVL 360
           GGS+M+     RL+++LK +  +R+    H   ++     V++    R+++ V+ GG++L
Sbjct: 359 GGSTMFKDFGRRLQRDLKGIVNNRIALSEHLSGTKSTGVDVQVISHRRQRNAVWFGGSLL 418

Query: 361 ASIMADKDHMWLSKQEWLESGPASMAKF 388
           A     K +   +KQ++ E GP  +  F
Sbjct: 419 AQTAEFKSYCH-TKQDYEEIGPEIVRNF 445

>TPHA0O01040 Chr15 (196178..197554) [1377 bp, 458 aa] {ON} Anc_1.514
           YJR065C
          Length = 458

 Score =  169 bits (428), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 128/455 (28%), Positives = 217/455 (47%), Gaps = 77/455 (16%)

Query: 4   HNP-IVLDQGTGFVKIGRAGENFPDYTFPSIVGR------------PILRAEERASVTTP 50
           +NP IV+D GTG  K+G AG + P + FP+ +              P      +A V+ P
Sbjct: 5   NNPAIVMDNGTGLTKLGFAGNDSPSWIFPTAIATAQSSNAKSSANAPQGLGNAKAGVSNP 64

Query: 51  LK------------------------------------DIMIGDEA---SDVRSYLQISY 71
                                                 D  IG+EA   S   +Y  +SY
Sbjct: 65  ATSNPYFGNSTSATSFASNSNAFLLSNNLAGKRGTEDLDFYIGNEALVASQGPAY-SLSY 123

Query: 72  PMENGIIKNWTDMELLWDYAFFEQMKLPSTSNGKILLTEPPMNPLKNREKMCEVMFEKYD 131
           P+ +G ++NW  ME  W+ + F+ ++     +   LLTEPP+NP +NRE++ E+ FE ++
Sbjct: 124 PIRHGQVENWDHMERFWENSIFKYLR-AEPEDHFFLLTEPPLNPPENREQVAEIFFESFN 182

Query: 132 FGGVYVAIQAVLALYAQGLXXXXXXXXXXXX--------THIVPVYESVVLSHLTRRLDV 183
             G+Y+A+QAVLAL A                       TH++PV E  V+    + + +
Sbjct: 183 CAGLYIAVQAVLALAASWTSAQVTDRSLTGTVIDSGDGVTHVIPVAEGYVVGSAIKNIPI 242

Query: 184 AGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDL-----DLDTKLARETTA 238
           AGRD+T  +  LL  RG A    +  +T  +IK++ CYV  D+       D +  +    
Sbjct: 243 AGRDITLFIQSLLRERGEA---DSSLKTAERIKQEYCYVCPDIVKEFNKFDRQPEKFAQF 299

Query: 239 LVESYELPDGRTIKVGQERFEAPECLFQPGLV--DVEQPGVGELLFNTVQSADVDIRSSL 296
           ++E+ +    + I +G ERF APE  F P +   D   P +  ++  T+Q+  +D+R  L
Sbjct: 300 IIENQDKTTKKVIDIGYERFLAPEIFFNPEIASSDFLTP-LPTVVDQTIQACPIDVRKGL 358

Query: 297 YKAIVLSGGSSMYPGLPSRLEKELKQLWFSRVLHNDP---SRLDKFKVRIEDPPRRKHMV 353
           Y  IVLSGGS+M+     RL++++K +  +R+  N+    ++     V++    ++++ V
Sbjct: 359 YNNIVLSGGSTMFKDFSRRLQRDVKSIVSNRIAQNEALTGTKSTGVDVQVISHRKQRNAV 418

Query: 354 FIGGAVLASIMADKDHMWLSKQEWLESGPASMAKF 388
           + GG++LA     K +   +K+++ E GP  +  F
Sbjct: 419 WFGGSLLAQTAEFKGYCH-TKKDYEEHGPEIVRNF 452

>SAKL0D12804g Chr4 complement(1066058..1067428) [1371 bp, 456 aa]
           {ON} highly similar to uniprot|P47117 Saccharomyces
           cerevisiae YJR065C ARP3 Essential component of the
           Arp2/3 complex which is a highly conserved actin
           nucleation center required for the motility and
           integrity of actin patches involved in endocytosis and
           membrane growth and polarity
          Length = 456

 Score =  169 bits (427), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 131/453 (28%), Positives = 212/453 (46%), Gaps = 75/453 (16%)

Query: 4   HNP-IVLDQGTGFVKIGRAGENFPDYTFPSIV---------------------------- 34
           +NP +V+D GTG  K+G AG + P + FP+ +                            
Sbjct: 5   NNPAVVMDNGTGLTKLGFAGNDSPSWVFPTAIATAQPSNTKKSSAVATMGGSGAQPGGSA 64

Query: 35  GRPILRAEERASVTTPLK------------------DIMIGDEA---SDVRSYLQISYPM 73
           G P       A+    L                   D  IG+EA   S   SY  +SYP+
Sbjct: 65  GNPYFGNSTSATSFDSLAASALLSNNLAGKRGTEDLDFYIGNEALAASRGPSY-SLSYPI 123

Query: 74  ENGIIKNWTDMELLWDYAFFEQMKLPSTSNGKILLTEPPMNPLKNREKMCEVMFEKYDFG 133
            +G ++NW  ME  W+ + F+ ++     +   LLTEPP+NP +NRE++ E+ FE ++  
Sbjct: 124 RHGQVENWDHMERFWENSIFKYLRT-EPEDHFFLLTEPPLNPPENREQVAEIFFESFNCA 182

Query: 134 GVYVAIQAVLALYAQGLXXXXXXXXXXXX--------THIVPVYESVVLSHLTRRLDVAG 185
           G+Y+A+QAVLAL A                       TH++PV E  V+    + + +AG
Sbjct: 183 GLYIAVQAVLALAASWTSSKVTDRSLTGTVIDSGDGVTHVIPVAEGYVIGSAIKNIPIAG 242

Query: 186 RDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDL-----DLDTKLARETTALV 240
           RD+T  +  LL  RG          T  +IK++ CYV  D+       D    +    +V
Sbjct: 243 RDITLFIQSLLRERGEV---DTSLRTAERIKQEYCYVCPDIVKEFNKFDRDAGKFAQFIV 299

Query: 241 ESYELPDGRTIKVGQERFEAPECLFQPGLV--DVEQPGVGELLFNTVQSADVDIRSSLYK 298
           E+ E    + + VG ERF APE  F P +   D   P +  ++  T+Q+  +D+R  LY 
Sbjct: 300 ENSESTKKKIVDVGYERFLAPEIFFNPEIASSDFLTP-LPTVVDQTIQACPIDVRKGLYN 358

Query: 299 AIVLSGGSSMYPGLPSRLEKELKQLWFSRVLHND---PSRLDKFKVRIEDPPRRKHMVFI 355
            IVLSGGS+M+     RL+++LK +  +R+  ++    ++     V++    R+++ V+ 
Sbjct: 359 NIVLSGGSTMFKDFGRRLQRDLKSIVNNRIAQSELLSGTKSTGVDVQVISHRRQRNAVWF 418

Query: 356 GGAVLASIMADKDHMWLSKQEWLESGPASMAKF 388
           GG++LA     K +   +KQ++ E GP  +  F
Sbjct: 419 GGSLLAQTAEFKSYCH-TKQDYEEYGPEIVRNF 450

>Suva_12.154 Chr12 complement(235605..236954) [1350 bp, 449 aa] {ON}
           YJR065C (REAL)
          Length = 449

 Score =  167 bits (424), Expect = 6e-47,   Method: Compositional matrix adjust.
 Identities = 130/446 (29%), Positives = 215/446 (48%), Gaps = 68/446 (15%)

Query: 4   HNP-IVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERAS---------------- 46
           +NP +V+D GTG  K+G AG + P + FP+ +        ++AS                
Sbjct: 5   NNPAVVMDNGTGLTKLGFAGNDSPSWVFPTAIATAAPSNTKKASGVGASSAAGSDTSYFG 64

Query: 47  ----------VTTPLK-------------DIMIGDEA---SDVRSYLQISYPMENGIIKN 80
                     VT  L              D  IG+EA   S   SY  +SYP+ +G ++N
Sbjct: 65  NSTSATNFNGVTGGLLSNNLSGKRGTEDLDFYIGNEALVASQGPSY-SLSYPIRHGQVEN 123

Query: 81  WTDMELLWDYAFFEQMKLPSTSNGKILLTEPPMNPLKNREKMCEVMFEKYDFGGVYVAIQ 140
           W  ME  W+ + F+ ++     +   LLTEPP+NP +NRE++ E+ FE ++  G+Y+A+Q
Sbjct: 124 WDHMERFWENSIFKYLRT-EPEDHFFLLTEPPLNPPENREQVAEIFFESFNCAGLYIAVQ 182

Query: 141 AVLALYAQGLXXXXXXXXXXXX--------THIVPVYESVVLSHLTRRLDVAGRDVTRHL 192
           AVLAL A                       TH++PV E  V+    + + +AGRD+T  +
Sbjct: 183 AVLALAASWTSSKVTDRSLTGTVIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITLFI 242

Query: 193 IDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDL-----DLDTKLARETTALVESYELPD 247
             LL  RG A        T  +IK++ CYV  D+       D   ++    +VE+ E   
Sbjct: 243 QSLLRERGEA---DTSLRTAEKIKQEYCYVCPDIVKEFNKFDRDPSKFAQFVVENQEKTR 299

Query: 248 GRTIKVGQERFEAPECLFQPGLV--DVEQPGVGELLFNTVQSADVDIRSSLYKAIVLSGG 305
            + + +G ERF APE  F P +   D   P +  ++  T+Q+  +D+R  LY  IVLSGG
Sbjct: 300 RKAVDIGYERFLAPEIFFNPEIASSDFLTP-LPTVVDQTIQACPIDVRKGLYNNIVLSGG 358

Query: 306 SSMYPGLPSRLEKELKQLWFSRVLHND---PSRLDKFKVRIEDPPRRKHMVFIGGAVLAS 362
           S+M+     RL+++LK +  +R+  ++    ++     V +    ++++ V+ GG++LA 
Sbjct: 359 STMFKDFGRRLQRDLKSIVNNRIAQSELLSGTKSTGVDVSVISHRKQRNAVWFGGSLLAQ 418

Query: 363 IMADKDHMWLSKQEWLESGPASMAKF 388
               K +   +K+++ E GP  +  F
Sbjct: 419 TAEFKGYCH-TKKDYEEYGPEIVRNF 443

>YJR065C Chr10 complement(557809..559158) [1350 bp, 449 aa] {ON}
           ARP3Essential component of the Arp2/3 complex, which is
           a highly conserved actin nucleation center required for
           the motility and integrity of actin patches; involved in
           endocytosis and membrane growth and polarity
          Length = 449

 Score =  167 bits (424), Expect = 6e-47,   Method: Compositional matrix adjust.
 Identities = 133/446 (29%), Positives = 216/446 (48%), Gaps = 68/446 (15%)

Query: 4   HNP-IVLDQGTGFVKIGRAGENFPDYTFP--------------SIVGRPILRAEERA--- 45
           +NP +V+D GTG  K+G AG + P + FP              S VG P   + E +   
Sbjct: 5   NNPAVVMDNGTGLTKLGFAGNDSPSWVFPTAIATAAPSNTKKSSGVGAPSAVSNEASYFG 64

Query: 46  ---SVT-------------------TPLKDIMIGDEA---SDVRSYLQISYPMENGIIKN 80
              S T                   T   D  IG+EA   S   SY  +SYP+ +G ++N
Sbjct: 65  NSTSATNFNGATGGLLSNNLSGKRGTEDLDFYIGNEALVASQGPSY-SLSYPIRHGQVEN 123

Query: 81  WTDMELLWDYAFFEQMKLPSTSNGKILLTEPPMNPLKNREKMCEVMFEKYDFGGVYVAIQ 140
           W  ME  W+ + F+ ++     +   LLTEPP+NP +NRE++ E+ FE ++  G+Y+A+Q
Sbjct: 124 WDHMERFWENSIFKYLRT-EPEDHFFLLTEPPLNPPENREQVAEIFFESFNCAGLYIAVQ 182

Query: 141 AVLALYAQGLXXXXXXXXXXXX--------THIVPVYESVVLSHLTRRLDVAGRDVTRHL 192
           AVLAL A                       TH++PV E  V+    + + +AGRD+T  +
Sbjct: 183 AVLALAASWTSSKVTDRSLTGTVIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITLFI 242

Query: 193 IDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDL-----DLDTKLARETTALVESYELPD 247
             LL  RG A        T  +IK++ CYV  D+       D   ++    +VE+ E   
Sbjct: 243 QSLLRERGEA---DTSLRTAEKIKQEYCYVCPDIVKEFNKFDKDPSKFAQFVVENQEKTR 299

Query: 248 GRTIKVGQERFEAPECLFQPGLV--DVEQPGVGELLFNTVQSADVDIRSSLYKAIVLSGG 305
            + + +G ERF APE  F P +   D   P +  ++  T+Q+  +D+R  LY  IVLSGG
Sbjct: 300 RKVVDIGYERFLAPEIFFNPEIASSDFLTP-LPTVVDQTIQACPIDVRKGLYNNIVLSGG 358

Query: 306 SSMYPGLPSRLEKELKQLWFSRVLHND---PSRLDKFKVRIEDPPRRKHMVFIGGAVLAS 362
           S+M+     RL+++LK +  +R+  ++    ++     V +    ++++ V+ GG++LA 
Sbjct: 359 STMFKDFGRRLQRDLKSIVNNRIAQSELLSGTKSTGVDVSVISHRKQRNAVWFGGSLLAQ 418

Query: 363 IMADKDHMWLSKQEWLESGPASMAKF 388
               K +   +K+++ E GP  +  F
Sbjct: 419 TAEFKGYCH-TKKDYEEYGPEIVRNF 443

>CAGL0F00517g Chr6 (54743..56107) [1365 bp, 454 aa] {ON} highly
           similar to uniprot|P47117 Saccharomyces cerevisiae
           YJR065c ACT4 actin related protein
          Length = 454

 Score =  167 bits (424), Expect = 7e-47,   Method: Compositional matrix adjust.
 Identities = 126/451 (27%), Positives = 217/451 (48%), Gaps = 73/451 (16%)

Query: 4   HNP-IVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASVT-------------- 48
           +NP +V+D GTG  K+G AG + P + FP+ +        ++++V               
Sbjct: 5   NNPAVVMDNGTGLTKLGFAGNDSPSWVFPTAIATAQASNTKKSTVVNKSSAGGADSSGSG 64

Query: 49  ------------------------------TPLKDIMIGDEA---SDVRSYLQISYPMEN 75
                                         T   D  IG+EA   +  +SY  +SYP+ +
Sbjct: 65  YFGNSTSATSFNSGDMSSLLLSNNLAGKRGTEDLDFYIGNEALAAAQGQSY-SLSYPIRH 123

Query: 76  GIIKNWTDMELLWDYAFFEQMKLPSTSNGKILLTEPPMNPLKNREKMCEVMFEKYDFGGV 135
           G ++NW  ME  W+ + F+ ++     +   LLTEPP+NP +NRE++ E+ FE ++  G+
Sbjct: 124 GQVENWDHMERFWENSIFKYLRTEPEDH-FFLLTEPPLNPPENREQVAEIFFESFNCAGL 182

Query: 136 YVAIQAVLALYAQGLXXXXXXXXXXXX--------THIVPVYESVVLSHLTRRLDVAGRD 187
           Y+A+QAVLAL A                       TH++PV E  V+    + + +AGRD
Sbjct: 183 YIAVQAVLALAASWTSPKVTDRSLTGTVIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRD 242

Query: 188 VTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDL-----DLDTKLARETTALVES 242
           +T  +  LL  RG    +    +T  +IK++ CYV  D+       D   ++    +VES
Sbjct: 243 ITLFIQQLLRERG---EQDTSLKTAERIKQEYCYVCPDIVKEFNKFDRDASKFAQFVVES 299

Query: 243 YELPDGRTIKVGQERFEAPECLFQPGLV--DVEQPGVGELLFNTVQSADVDIRSSLYKAI 300
            E    + + VG ERF APE  F P +   D   P +  ++  T+Q+  +D+R  LY  I
Sbjct: 300 QEKTRKKIVDVGYERFLAPEIFFNPEIASSDFLTP-LPTVVDETIQACPIDVRKGLYNNI 358

Query: 301 VLSGGSSMYPGLPSRLEKELKQLWFSRVLHNDP---SRLDKFKVRIEDPPRRKHMVFIGG 357
           VLSGGS+M+     RL++++K +  +R+  ++    ++     V++    ++++ V+ GG
Sbjct: 359 VLSGGSTMFKDFGRRLQRDMKSIVNNRIAQSEALSGTKSTGVDVQVISHRKQRNAVWFGG 418

Query: 358 AVLASIMADKDHMWLSKQEWLESGPASMAKF 388
           ++LA     K +   +K+++ E GP  +  F
Sbjct: 419 SLLAQTAEFKSYCH-TKKDYDEYGPEIVRNF 448

>Smik_10.355 Chr10 complement(546673..548022) [1350 bp, 449 aa] {ON}
           YJR065C (REAL)
          Length = 449

 Score =  166 bits (421), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 128/446 (28%), Positives = 215/446 (48%), Gaps = 68/446 (15%)

Query: 4   HNP-IVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERAS---------------- 46
           +NP +V+D GTG  K+G AG + P + FP+ +        ++AS                
Sbjct: 5   NNPAVVMDNGTGLTKLGFAGNDSPSWVFPTAIATAAPSNTKKASGVGTSSAAGNEASYFG 64

Query: 47  ---------------VTTPLK--------DIMIGDEA---SDVRSYLQISYPMENGIIKN 80
                          ++  L         D  IG+EA   S   SY  +SYP+ +G ++N
Sbjct: 65  NSTSATNFNGATGGLLSNNLSGKRGTEDLDFYIGNEALVASQGPSY-SLSYPIRHGQVEN 123

Query: 81  WTDMELLWDYAFFEQMKLPSTSNGKILLTEPPMNPLKNREKMCEVMFEKYDFGGVYVAIQ 140
           W  ME  W+ + F+ ++     +   LLTEPP+NP +NRE++ E+ FE ++  G+Y+A+Q
Sbjct: 124 WDHMERFWENSIFKYLRTEPEDH-FFLLTEPPLNPPENREQVAEIFFESFNCAGLYIAVQ 182

Query: 141 AVLALYAQGLXXXXXXXXXXXX--------THIVPVYESVVLSHLTRRLDVAGRDVTRHL 192
           AVLAL A                       TH++PV E  V+    + + +AGRD+T  +
Sbjct: 183 AVLALAASWTSSKVTDRSLTGTVIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITLFI 242

Query: 193 IDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDL-----DLDTKLARETTALVESYELPD 247
             LL  RG A        T  +IK++ CYV  D+       D   ++    +VE+ E   
Sbjct: 243 QSLLRERGEA---DTSLRTAEKIKQEYCYVCPDIVKEFNKFDRDPSKFAQFVVENQEKTR 299

Query: 248 GRTIKVGQERFEAPECLFQPGLV--DVEQPGVGELLFNTVQSADVDIRSSLYKAIVLSGG 305
            + + +G ERF APE  F P +   D   P +  ++  T+Q+  +D+R  LY  IVLSGG
Sbjct: 300 RKVVDIGYERFLAPEIFFNPEIASSDFLTP-LPTVVDQTIQACPIDVRKGLYNNIVLSGG 358

Query: 306 SSMYPGLPSRLEKELKQLWFSRVLHND---PSRLDKFKVRIEDPPRRKHMVFIGGAVLAS 362
           S+M+     RL+++LK +  +R+  ++    ++     V +    ++++ V+ GG++LA 
Sbjct: 359 STMFKDFGRRLQRDLKSIVNNRIAQSELLSGTKSTGVDVSVISHRKQRNAVWFGGSLLAQ 418

Query: 363 IMADKDHMWLSKQEWLESGPASMAKF 388
               K +   +K+++ E GP  +  F
Sbjct: 419 TAEFKGYCH-TKKDYEEYGPEIVRNF 443

>Skud_10.289 Chr10 complement(515300..516649) [1350 bp, 449 aa] {ON}
           YJR065C (REAL)
          Length = 449

 Score =  166 bits (420), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 128/446 (28%), Positives = 214/446 (47%), Gaps = 68/446 (15%)

Query: 4   HNP-IVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERAS---------------- 46
           +NP +V+D GTG  K+G AG + P + FP+ +        +++S                
Sbjct: 5   NNPAVVMDNGTGLTKLGFAGNDAPSWVFPTAIATAAPSNTKKSSGVGATSATGSEASYFG 64

Query: 47  -VTTPLK----------------------DIMIGDEA---SDVRSYLQISYPMENGIIKN 80
             T+                         D  IG+EA   S   SY  +SYP+ +G ++N
Sbjct: 65  NATSATNFNGATGGLLSNNLSGKRGTEDLDFYIGNEALVASQGPSY-SLSYPIRHGQVEN 123

Query: 81  WTDMELLWDYAFFEQMKLPSTSNGKILLTEPPMNPLKNREKMCEVMFEKYDFGGVYVAIQ 140
           W  ME  W+ + F+ ++     +   LLTEPP+NP +NRE++ E+ FE ++  G+Y+A+Q
Sbjct: 124 WDHMERFWENSIFKYLRTEPEDH-FFLLTEPPLNPPENREQVAEIFFESFNCAGLYIAVQ 182

Query: 141 AVLALYAQGLXXXXXXXXXXXX--------THIVPVYESVVLSHLTRRLDVAGRDVTRHL 192
           AVLAL A                       TH++PV E  V+    + + +AGRD+T  +
Sbjct: 183 AVLALAASWTSSKVTDRSLTGTVIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITLFI 242

Query: 193 IDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDL-----DLDTKLARETTALVESYELPD 247
             LL  RG A        T  +IK++ CYV  D+       D   ++    +VE+ E   
Sbjct: 243 QSLLRERGEA---DTSLRTAEKIKQEYCYVCPDIVKEFNKFDRDPSKFAQFVVENQEKTR 299

Query: 248 GRTIKVGQERFEAPECLFQPGLV--DVEQPGVGELLFNTVQSADVDIRSSLYKAIVLSGG 305
            + + +G ERF APE  F P +   D   P +  ++  T+Q+  +D+R  LY  IVLSGG
Sbjct: 300 RKVVDIGYERFLAPEIFFNPEIASSDFLTP-LPMVVDQTIQACPIDVRKGLYNNIVLSGG 358

Query: 306 SSMYPGLPSRLEKELKQLWFSRVLHND---PSRLDKFKVRIEDPPRRKHMVFIGGAVLAS 362
           S+M+     RL+++LK +  SR+  ++    ++     V +    ++++ V+ GG++LA 
Sbjct: 359 STMFKDFGRRLQRDLKSIVNSRIAQSELLSGTKSTGVDVSVISHRKQRNAVWFGGSLLAQ 418

Query: 363 IMADKDHMWLSKQEWLESGPASMAKF 388
               K +   +K+++ E GP  +  F
Sbjct: 419 TAEFKGYCH-TKKDYEEYGPEIVRNF 443

>KLLA0B13904g Chr2 complement(1218228..1219598) [1371 bp, 456 aa]
           {ON} highly similar to uniprot|P47117 Saccharomyces
           cerevisiae YJR065C ARP3 Essential component of the
           Arp2/3 complex which is a highly conserved actin
           nucleation center required for the motility and
           integrity of actin patches involved in endocytosis and
           membrane growth and polarity
          Length = 456

 Score =  165 bits (417), Expect = 7e-46,   Method: Compositional matrix adjust.
 Identities = 134/453 (29%), Positives = 214/453 (47%), Gaps = 75/453 (16%)

Query: 4   HNP-IVLDQGTGFVKIGRAGENFPDYTFPSIV------------------GRPILRAEER 44
           +NP +V+D GTG  K+G AG + P + FP+ +                  G     A+  
Sbjct: 5   NNPAVVMDNGTGLTKLGFAGNDSPSWVFPTAIATAQSGKSQSSSNKSTGFGSSSANAQSS 64

Query: 45  -----------------ASVT-----------TPLKDIMIGDEA---SDVRSYLQISYPM 73
                            AS T           T   D  IG+EA   S   SY  +SYP+
Sbjct: 65  YLSGGGNSTSATDFNSLASSTLISNNLAGKRGTEDLDFYIGNEALVASQGPSY-SLSYPI 123

Query: 74  ENGIIKNWTDMELLWDYAFFEQMKLPSTSNGKILLTEPPMNPLKNREKMCEVMFEKYDFG 133
            +G ++NW  ME  W+ + F+ ++     +   LLTEPP+NP +NR+++ E+ FE ++  
Sbjct: 124 RHGQVENWDHMERFWENSIFKYLRTEPEDH-FFLLTEPPLNPPENRQQVAEIFFESFNCA 182

Query: 134 GVYVAIQAVLALYAQGLXXXXXXXXXXXX--------THIVPVYESVVLSHLTRRLDVAG 185
           G+Y+A+QAVLAL A                       TH++PV E  V+    + + +AG
Sbjct: 183 GLYIAVQAVLALAASWTSSKVTDRSLTGTVIDSGDGVTHVIPVAEGYVIGSAIKNIPIAG 242

Query: 186 RDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDL-----DLDTKLARETTALV 240
           RD+T  +  LL  RG    + A   T  +IK++ CYV  D+       D    +    +V
Sbjct: 243 RDITLFIQSLLRERG---EQDASLRTAERIKQEYCYVCPDIVKEFNKFDRDSEKFAQFIV 299

Query: 241 ESYELPDGRTIKVGQERFEAPECLFQPGLV--DVEQPGVGELLFNTVQSADVDIRSSLYK 298
           E+ E    + + VG ERF APE  F P +   D   P +  ++  T+Q+  +D+R  LY 
Sbjct: 300 ENKERTTKKVVDVGYERFLAPEIFFNPEIASSDFLTP-LPVVVDETIQACPIDVRKGLYN 358

Query: 299 AIVLSGGSSMYPGLPSRLEKELKQLWFSRVLHNDP---SRLDKFKVRIEDPPRRKHMVFI 355
            IVLSGGS+M+     RL+++LK +   R+  ++    +R     V +    R+++ V+ 
Sbjct: 359 NIVLSGGSTMFKDFGRRLQRDLKGIVNDRISQSEKLSGTRSTGVDVSVISHKRQRNAVWF 418

Query: 356 GGAVLASIMADKDHMWLSKQEWLESGPASMAKF 388
           GG++LA     K +   +KQ++ E GP  +  F
Sbjct: 419 GGSLLAQTGEFKSYCH-TKQDYEEYGPDIVRNF 450

>TBLA0D03680 Chr4 (914687..916063) [1377 bp, 458 aa] {ON} Anc_1.514
           YJR065C
          Length = 458

 Score =  164 bits (416), Expect = 8e-46,   Method: Compositional matrix adjust.
 Identities = 127/459 (27%), Positives = 213/459 (46%), Gaps = 78/459 (16%)

Query: 1   MDPHNPIVLDQGTGFVKIGRAGENFPDYTFPSIV-------------------------- 34
           M+ +  +V+D GTG  K+G AG + P + FP+ +                          
Sbjct: 1   MNLNPAVVMDNGTGLTKLGFAGNDSPSWIFPTAIATASPSGNKKTGSSATSSSVSGSGTN 60

Query: 35  ------------------------GRPILRAEERASVTTPLKDIMIGDEA---SDVRSYL 67
                                   G+ +L         T   D  IG+EA   +   SY 
Sbjct: 61  GSNGSSNPYFGNSTSATNFGGLTGGKMLLSNNLAGKRGTEDLDFYIGNEALVAAQSPSY- 119

Query: 68  QISYPMENGIIKNWTDMELLWDYAFFEQMKLPSTSNGKILLTEPPMNPLKNREKMCEVMF 127
            +SYP+ +G ++NW  ME  W+ + F+ ++     +   LLTEPP+NP +NRE++ E+ F
Sbjct: 120 SLSYPIRHGQVENWDHMERFWENSIFKYLRT-EPEDHYFLLTEPPLNPPENREQVAEIFF 178

Query: 128 EKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXX--------THIVPVYESVVLSHLTR 179
           E ++  G+Y+A+QAVLAL A                       TH++PV E  V+    +
Sbjct: 179 ESFNCAGLYIAVQAVLALAASWTSSKVIDRSLTGTVIDSGDGVTHVIPVAEGYVIGSAIK 238

Query: 180 RLDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDL-----DLDTKLAR 234
            + +AGRD+T  +  LL  RG A        T  +IK++ CYV  D+       D +  +
Sbjct: 239 NIPIAGRDITEFIQSLLRERGEA---DTSLRTAERIKQEYCYVCPDIVKEFNKFDRQPEK 295

Query: 235 ETTALVESYELPDGRTIKVGQERFEAPECLFQPGLV--DVEQPGVGELLFNTVQSADVDI 292
               +VES E    + + VG ERF APE  F P +   D   P +  ++  T+Q+  +D+
Sbjct: 296 FAQFIVESQEKTKQKVVDVGYERFLAPEIFFNPEIASSDYLTP-LPTVVDQTIQACPIDV 354

Query: 293 RSSLYKAIVLSGGSSMYPGLPSRLEKELKQLWFSRVLHNDP---SRLDKFKVRIEDPPRR 349
           R  LY  IVLSGGS+M+     RL++++K +  +R+  N+     +     V++    ++
Sbjct: 355 RKGLYNNIVLSGGSTMFKDFSRRLQRDMKSIVNARISQNEKMTGVKSSGVDVQVISHRKQ 414

Query: 350 KHMVFIGGAVLASIMADKDHMWLSKQEWLESGPASMAKF 388
           ++ V+ GG++LA     + +   +K+++ E GP  +  F
Sbjct: 415 RNAVWFGGSLLAQTAEFRGYCH-TKRDYEEIGPEIVRNF 452

>TDEL0F00470 Chr6 (80760..82145) [1386 bp, 461 aa] {ON} Anc_1.514
           YJR065C
          Length = 461

 Score =  164 bits (416), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 129/458 (28%), Positives = 214/458 (46%), Gaps = 80/458 (17%)

Query: 4   HNP-IVLDQGTGFVKIGRAGENFPDYTFPSIV---------------------------- 34
           +NP +V+D GTG  K+G AG + P + FP+ +                            
Sbjct: 5   NNPAVVMDNGTGLTKLGFAGNDSPSWVFPTAIATAQPSNAKQTSSNAVSAGASSVANTGQ 64

Query: 35  ----GRPILRAEERASVTTPLK-------------------DIMIGDEA---SDVRSYLQ 68
               GR        A+    L                    D  IG+EA   +   SY  
Sbjct: 65  SSGSGRQYFGNSTSATAFNSLSSGSALMSNNLAGKRGTEDLDFYIGNEALIAAQGPSY-G 123

Query: 69  ISYPMENGIIKNWTDMELLWDYAFFEQMKLPSTSNGKILLTEPPMNPLKNREKMCEVMFE 128
           +SYP+ +G ++NW  ME  W+ + F+ ++     +   LLTEPP+NP +NRE++ E+ FE
Sbjct: 124 LSYPIRHGQVENWDHMERFWENSIFKYLRTEPEDHC-FLLTEPPLNPPENREQVAEIFFE 182

Query: 129 KYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXX--------THIVPVYESVVLSHLTRR 180
            ++  G+Y+A+QAVLAL A                       TH++PV E  V+    + 
Sbjct: 183 SFNCAGLYIAVQAVLALAASWTSSKVIDRSLTGTVIDSGDGVTHVIPVAEGYVIGSAIKN 242

Query: 181 LDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDL-----DLDTKLARE 235
           + +AGRD+T  +  LL  RG          T  +IK++ CYV  D+       D    + 
Sbjct: 243 IPIAGRDITLFIQQLLRERG---EEDTSLRTAERIKQEYCYVCPDIVKEFNKFDRDSEKF 299

Query: 236 TTALVESYELPDGRTIKVGQERFEAPECLFQPGLV--DVEQPGVGELLFNTVQSADVDIR 293
              +VES E    + + VG ERF APE  F P +   D   P +  ++ +T+Q+  +D+R
Sbjct: 300 AQFVVESQEKTRRKVVDVGCERFMAPEIFFNPEIASSDFLTP-LPTIVDHTIQACPIDVR 358

Query: 294 SSLYKAIVLSGGSSMYPGLPSRLEKELKQLWFSRVLHND---PSRLDKFKVRIEDPPRRK 350
             LY  IVLSGGS+M+     RL+++LK +  +R++ ++    ++     V++    +++
Sbjct: 359 KGLYNNIVLSGGSTMFKDFGRRLQRDLKSIVNNRIVQSEYLSGTKSTGVDVQVISHRKQR 418

Query: 351 HMVFIGGAVLASIMADKDHMWLSKQEWLESGPASMAKF 388
           + V+ GG++LA     K +   +K+++ E GP  +  F
Sbjct: 419 NAVWFGGSLLAQTAEFKSYCH-TKKDYEEIGPEIVRNF 455

>KAFR0D03700 Chr4 complement(718438..719787) [1350 bp, 449 aa] {ON}
           Anc_1.514 YJR065C
          Length = 449

 Score =  164 bits (414), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 127/446 (28%), Positives = 212/446 (47%), Gaps = 68/446 (15%)

Query: 4   HNP-IVLDQGTGFVKIGRAGENFPDYTFPSIVG--------------------------- 35
           +NP IV+D GTG  K+G AG + P + FP+ +                            
Sbjct: 5   NNPAIVMDNGTGLTKLGFAGNDSPSWIFPTAIATSQNHTKKTSSMSSTSNTTSSNQYFGN 64

Query: 36  RPILRAEERASVTTPLK------------DIMIGDEA---SDVRSYLQISYPMENGIIKN 80
                +    + + PL             D  IG+EA   +   SY  +SYP+ +G I+N
Sbjct: 65  STSATSFNSLNASMPLSNNLAGKRGTEDLDFYIGNEALAAAQGPSY-SLSYPIRHGQIEN 123

Query: 81  WTDMELLWDYAFFEQMKLPSTSNGKILLTEPPMNPLKNREKMCEVMFEKYDFGGVYVAIQ 140
           W  ME  W+ + F+ ++     +   LLTEPP+NP +NRE++ E+ FE ++  G+Y+A+Q
Sbjct: 124 WDHMERFWENSIFKYLRT-EPEDHFFLLTEPPLNPPENREQVAEIFFESFNCAGLYIAVQ 182

Query: 141 AVLALYAQGLXXXXXXXXXXXX--------THIVPVYESVVLSHLTRRLDVAGRDVTRHL 192
           AVLAL A                       TH++PV E  V+    + + +AGRD+T  +
Sbjct: 183 AVLALAASWTSSKVTDRSLTGTVIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITLFI 242

Query: 193 IDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDL-----DLDTKLARETTALVESYELPD 247
             LL  RG          T  +IK++ CYV  D+       D    +    +VE+ E   
Sbjct: 243 QSLLRERG---ETDTSLRTAERIKQEYCYVCPDIVKEFNKFDRNPDKFAQFIVENQEKTQ 299

Query: 248 GRTIKVGQERFEAPECLFQPGLV--DVEQPGVGELLFNTVQSADVDIRSSLYKAIVLSGG 305
            + + VG ERF APE  F P +   D   P +  ++ +T+Q+  +D+R  LY  IVLSGG
Sbjct: 300 KKIVDVGYERFLAPEIFFNPEIASSDFLTP-LPTIVDHTIQACPIDVRKGLYNNIVLSGG 358

Query: 306 SSMYPGLPSRLEKELKQLWFSRVLHND---PSRLDKFKVRIEDPPRRKHMVFIGGAVLAS 362
           S+M+     RL++++K +  +R+  ++    ++     V +    ++++ V+ GG++LA 
Sbjct: 359 STMFKDFGRRLQRDIKSIVNNRIAQSELLSGTKSTGVDVNVITHRKQRNAVWFGGSLLAQ 418

Query: 363 IMADKDHMWLSKQEWLESGPASMAKF 388
               K +   +K+++ E GP  +  F
Sbjct: 419 TAEFKSYCH-TKKDYEEYGPEIVRNF 443

>NCAS0A12270 Chr1 complement(2428834..2430198) [1365 bp, 454 aa]
           {ON} Anc_1.514
          Length = 454

 Score =  163 bits (413), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 130/451 (28%), Positives = 213/451 (47%), Gaps = 73/451 (16%)

Query: 4   HNP-IVLDQGTGFVKIGRAGENFPDYTFPSIV-------------------------GRP 37
           +NP +V+D GTG  K+G AG + P + FP+ +                         G P
Sbjct: 5   NNPAVVMDNGTGLTKLGFAGNDSPSWIFPTAIATSQGGSSSNAKKSMSSSAASSATAGNP 64

Query: 38  ILRAEERASV-------------------TTPLKDIMIGDEA---SDVRSYLQISYPMEN 75
                  A+                     T   D  IG+EA   S   SY  +SYP+ +
Sbjct: 65  YYGNSTSATSFNDNNLSSMLLSNNLAGKRGTEDLDFYIGNEALVASQGPSY-SLSYPIRH 123

Query: 76  GIIKNWTDMELLWDYAFFEQMKLPSTSNGKILLTEPPMNPLKNREKMCEVMFEKYDFGGV 135
           G ++NW  ME  W+ + F+ ++     +   LLTEPP+NP +NRE++ E+ FE ++  G+
Sbjct: 124 GQVENWDHMERFWENSIFKYLRTEPEDH-FFLLTEPPLNPPENREQIAEIFFESFNCAGL 182

Query: 136 YVAIQAVLALYAQGLXXXXXXXXXXXX--------THIVPVYESVVLSHLTRRLDVAGRD 187
           Y+A+QAVLAL A                       TH++PV E  V+    + + +AGRD
Sbjct: 183 YIAVQAVLALAASWTSSKVTDRSLTGTVIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRD 242

Query: 188 VTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDL-----DLDTKLARETTALVES 242
           +T  +  LL  RG A        T  +IK++ CYV  D+       D    +    +VE+
Sbjct: 243 ITLFIQSLLRERGEA---DTSLRTAERIKQEYCYVCPDIVKEFNKFDRDGEKFAQFVVEN 299

Query: 243 YELPDGRTIKVGQERFEAPECLFQPGLV--DVEQPGVGELLFNTVQSADVDIRSSLYKAI 300
            E    + + VG ERF APE  F P +   D   P +  ++  T+Q+  +D+R  LY  I
Sbjct: 300 QESTRKKIVDVGYERFLAPEIFFNPEIASSDFLTP-LPTVVDQTIQACPIDVRKGLYNNI 358

Query: 301 VLSGGSSMYPGLPSRLEKELKQLWFSRVLHND---PSRLDKFKVRIEDPPRRKHMVFIGG 357
           VLSGGS+M+     RL+++LK +  +R+  ++    ++     V++    ++++ V+ GG
Sbjct: 359 VLSGGSTMFKDFGRRLQRDLKGIVNNRIAQSEMLSGTKSTGVNVQVISHRKQRNAVWFGG 418

Query: 358 AVLASIMADKDHMWLSKQEWLESGPASMAKF 388
           ++LA     K +   +K+++ E GP  +  F
Sbjct: 419 SLLAQTAEFKGYCH-TKKDYDEYGPEIVRNF 448

>Ecym_3153 Chr3 (288213..289589) [1377 bp, 458 aa] {ON} similar to
           Ashbya gossypii AFR419C
          Length = 458

 Score =  161 bits (408), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 119/453 (26%), Positives = 216/453 (47%), Gaps = 74/453 (16%)

Query: 4   HNPIVLDQGTGFVKIGRAGENFPDYTFPSIV-------------GRPILRAEERASVTTP 50
           ++ +V+D GTG  K+G AG + P + FP+ +             G     ++ +A+ ++ 
Sbjct: 6   NHAVVMDNGTGLTKLGFAGNDSPSWIFPTAIATAQPSNSSGKSTGGGNTSSQSQANTSSG 65

Query: 51  LKDIMIGDEAS------------------------DVRSYL-------------QISYPM 73
           +     G+  S                        D+  Y+              +SYP+
Sbjct: 66  VIGSYFGNSTSATSFNNFASSLLLSNNLAGKRGTEDLDFYIGNEALTAAQGPAYSLSYPI 125

Query: 74  ENGIIKNWTDMELLWDYAFFEQMKLPSTSNGKILLTEPPMNPLKNREKMCEVMFEKYDFG 133
           ++G ++NW  ME  W+ + F+ ++     +   LLTEPP+NP +NRE++ E+ FE ++  
Sbjct: 126 KHGQVENWNHMERFWENSIFKYLRTEPEDH-FFLLTEPPLNPPENREQVAEIFFESFNCA 184

Query: 134 GVYVAIQAVLALYAQGLXXXXXXXXXXXX--------THIVPVYESVVLSHLTRRLDVAG 185
           G+Y+A+QAVLAL A                       TH++PV E  V+    + + +AG
Sbjct: 185 GLYIAVQAVLALAASWTSSKVTDRSLTGTVIDSGDGVTHVIPVAEGYVIGSAIKNIPIAG 244

Query: 186 RDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDL-----DLDTKLARETTALV 240
           RD+T  +  LL  RG         +T  +IK++ CYV  D+       D  + + +  ++
Sbjct: 245 RDITLFIQSLLRERGEV---DTSLKTAERIKQEYCYVCPDIVKEFNKFDRDVGKFSQFII 301

Query: 241 ESYELPDGRTIKVGQERFEAPECLFQPGLV--DVEQPGVGELLFNTVQSADVDIRSSLYK 298
           E+      + + VG ERF APE  F P +   D   P +  ++ +T+Q+  +D+R  LY 
Sbjct: 302 ENQGKTQKKIVDVGYERFLAPEIFFNPEIASSDFLTP-LPTIVDHTIQACPIDVRKGLYS 360

Query: 299 AIVLSGGSSMYPGLPSRLEKELKQLWFSRVLHND---PSRLDKFKVRIEDPPRRKHMVFI 355
            IVLSGGS+M+     RL+++L+ +   R+  ++    ++     V++    R+++ V+ 
Sbjct: 361 NIVLSGGSTMFKDFGRRLQRDLRSIVNDRIAQSELLSGTKSTGVDVQVISHRRQRNAVWF 420

Query: 356 GGAVLASIMADKDHMWLSKQEWLESGPASMAKF 388
           GG++LA     K +   +K+++ E GP  +  F
Sbjct: 421 GGSLLAQTAEFKSYCH-TKRDYEEYGPEIVRNF 452

>Kpol_1056.16 s1056 (36274..37656) [1383 bp, 460 aa] {ON}
           (36274..37656) [1383 nt, 461 aa]
          Length = 460

 Score =  161 bits (407), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 111/357 (31%), Positives = 188/357 (52%), Gaps = 28/357 (7%)

Query: 53  DIMIGDEA---SDVRSYLQISYPMENGIIKNWTDMELLWDYAFFEQMKLPSTSNGKILLT 109
           D  IG+EA   S   SY  +SYP+ +G I+NW  ME  W+ + F+ ++     +   LLT
Sbjct: 105 DFYIGNEALIASQGPSY-SLSYPIRHGQIENWDHMERFWENSIFKYLR-AEPEDHFFLLT 162

Query: 110 EPPMNPLKNREKMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXX------- 162
           EPP+NP +NRE++ E+ FE ++  G+Y+A+QAVLAL A                      
Sbjct: 163 EPPLNPPENREQVAEIFFESFNCAGLYIAVQAVLALAASWTSSQVTDRSLTGTVIDSGDG 222

Query: 163 -THIVPVYESVVLSHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCY 221
            TH++PV E  V+    + + +AGRD+T  +  LL  RG A        T  +IK++ CY
Sbjct: 223 VTHVIPVAEGYVIGSAIKNIPIAGRDITLFIQSLLRERGEA---DTSLRTAERIKQEYCY 279

Query: 222 VSYDL-----DLDTKLARETTALVESYELPDGRTIKVGQERFEAPECLFQPGLV--DVEQ 274
           V  D+       D +  +    ++E+ +    + + +G ERF APE  F P +   D   
Sbjct: 280 VCPDIVKEFNKFDRQPEKFAQFIIENQDKTKQKVVDIGYERFLAPEIFFNPEIASSDFLT 339

Query: 275 PGVGELLFNTVQSADVDIRSSLYKAIVLSGGSSMYPGLPSRLEKELKQLWFSRVLHNDP- 333
           P +  ++ +T+Q+  +D+R  LY  IVLSGGS+M+     RL++++K +  SR++ N+  
Sbjct: 340 P-LPTVVDHTIQACPIDVRKGLYNNIVLSGGSTMFKDFSRRLQRDIKSIVNSRIIQNEAV 398

Query: 334 --SRLDKFKVRIEDPPRRKHMVFIGGAVLASIMADKDHMWLSKQEWLESGPASMAKF 388
              +     V++    ++++ V+ GG++LA     K +   +K+++ E GP  +  F
Sbjct: 399 TGVKSTGVDVQVISHRKQRNAVWFGGSLLAQTAEFKSYCH-TKKDYEEYGPEIVRNF 454

 Score = 35.4 bits (80), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 15/33 (45%), Positives = 22/33 (66%), Gaps = 1/33 (3%)

Query: 4  HNP-IVLDQGTGFVKIGRAGENFPDYTFPSIVG 35
          +NP IV+D GTG  K+G AG + P + FP+ + 
Sbjct: 5  NNPAIVMDNGTGLTKLGYAGNDSPSWIFPTSIA 37

>NDAI0A03970 Chr1 (895219..896607) [1389 bp, 462 aa] {ON} Anc_1.514
          Length = 462

 Score =  160 bits (404), Expect = 5e-44,   Method: Compositional matrix adjust.
 Identities = 133/461 (28%), Positives = 215/461 (46%), Gaps = 85/461 (18%)

Query: 4   HNP-IVLDQGTGFVKIGRAGENFPDYTF---------------------------PSIVG 35
           +NP +V+D GTG  K+G AG + P + F                           PS  G
Sbjct: 5   NNPAVVMDNGTGLTKLGFAGNDSPSWIFPTAIATSQSSNTKKASSSSSSSAAALGPSNTG 64

Query: 36  R-------PILRAEERASVTTPLK------------------DIMIGDEA---SDVRSYL 67
                   P       A+    L                   D  IG+EA   S   SY 
Sbjct: 65  TSANSSATPYFGNSTSATSFNNLNKNMLLSNNLAGKRGTEDLDFYIGNEALVASQGPSY- 123

Query: 68  QISYPMENGIIKNWTDMELLWDYAFFEQMKLPSTSNGKILLTEPPMNPLKNREKMCEVMF 127
            +SYP+ +G ++NW  ME  W+ + F+ ++     +   LLTEPP+NP +NRE++ E+ F
Sbjct: 124 SLSYPIRHGQVENWDHMERFWENSIFKYLRT-EPEDHFFLLTEPPLNPPENREQIAEIFF 182

Query: 128 EKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXX--------THIVPVYESVVLSHLTR 179
           E ++  G+Y+A+QAVLAL A                       TH++PV E  V+    +
Sbjct: 183 ESFNCAGLYIAVQAVLALAASWTSSKVTDRSLTGTVIDSGDGVTHVIPVAEGYVIGSAIK 242

Query: 180 RLDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDL-----DLDTKLAR 234
            + +AGRD+T  +  LL  RG         +T  +IK++ CYV  D+       D   ++
Sbjct: 243 NIPIAGRDITLFIQSLLRERGEV---DTSLKTAERIKQEYCYVCPDIVKEFNKFDRDGSK 299

Query: 235 ETTALVESYELPDGRTIKVGQERFEAPECLFQPGLV--DVEQPGVGELLFNTVQSADVDI 292
               +VE+ E    + + VG ERF APE  F P +   D   P +  ++ +T+Q+  +D+
Sbjct: 300 FAQFIVENQEQTRKKVVDVGYERFLAPEIFFNPEIASSDFLTP-LPTVVDHTIQACPIDV 358

Query: 293 RSSLYKAIVLSGGSSMYPGLPSRLEKELKQLWFSRVLHNDPSRLDKFK-----VRIEDPP 347
           R  LY  IVLSGGS+M+     RL+++LK +  +R+  ++  RL   K     V++    
Sbjct: 359 RKGLYNNIVLSGGSTMFKDFGRRLQRDLKSIVSNRIAQSE--RLSGTKSTGVDVQVISHR 416

Query: 348 RRKHMVFIGGAVLASIMADKDHMWLSKQEWLESGPASMAKF 388
           ++++ V+ GG++LA     K +   +K+++ E GP  +  F
Sbjct: 417 KQRNAVWFGGSLLAQTAEFKSYCH-TKKDYEEYGPEIVRNF 456

>AFR419C Chr6 complement(1186951..1188318) [1368 bp, 455 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YJR065C
           (ARP3)
          Length = 455

 Score =  157 bits (397), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 125/452 (27%), Positives = 212/452 (46%), Gaps = 74/452 (16%)

Query: 4   HNP-IVLDQGTGFVKIGRAGENFPDY---------------------------------- 28
           +NP +V+D GTG  K+G AG + P +                                  
Sbjct: 5   NNPAVVMDNGTGLTKLGFAGNDSPSWVFPTAIATAQPSKTAKSSSMSGMGQSGSGMGAGG 64

Query: 29  -----------TFPSIVGRPILRAEERASVTTPLKDIMIGDEA---SDVRSYLQISYPME 74
                      +F       ++         T   D  IG+EA   +   SY  +SYP+ 
Sbjct: 65  SAFFGNTTSATSFTGFTSSSLMSNNLAGKRGTEDLDFYIGNEALAAAQGPSY-SLSYPIR 123

Query: 75  NGIIKNWTDMELLWDYAFFEQMKLPSTSNGKILLTEPPMNPLKNREKMCEVMFEKYDFGG 134
           +G +++W  ME  W+ + F+ ++     +   LLTEPP+NP +NRE++ E+ FE ++  G
Sbjct: 124 HGQVEDWNHMERFWENSIFKYLRT-EPEDHFFLLTEPPLNPPENREQVAEIFFESFNCAG 182

Query: 135 VYVAIQAVLALYAQGLXXXXXXXXXXXX--------THIVPVYESVVLSHLTRRLDVAGR 186
           +Y+A+QAVLAL A                       TH++PV E  V+    + + +AGR
Sbjct: 183 LYIAVQAVLALAASWTSSKVTDRSLTGTVIDSGDGVTHVIPVAEGYVIGSAIKHIPIAGR 242

Query: 187 DVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLDLD-TKLARETTA----LVE 241
           D+T  +  LL  RG          T  +IK++ CYV  D+  +  K  R+ T     +VE
Sbjct: 243 DITLFIQSLLRERGEV---DTSLRTAERIKQEYCYVCPDIVKEFNKFDRDATKFAQFIVE 299

Query: 242 SYELPDGRTIKVGQERFEAPECLFQPGLV--DVEQPGVGELLFNTVQSADVDIRSSLYKA 299
           + E    + + VG ERF APE  F P +   D   P +  ++  T+Q+  +D+R  LY  
Sbjct: 300 NKEKTQKKVVDVGYERFLAPEIFFNPEIASSDFLTP-LPTVVDQTIQACPIDVRKGLYNN 358

Query: 300 IVLSGGSSMYPGLPSRLEKELKQLWFSRVLHND---PSRLDKFKVRIEDPPRRKHMVFIG 356
           IVLSGGS+M+     RL+++L+ +  +R+  ++    ++    +V++    R+++ V+ G
Sbjct: 359 IVLSGGSTMFKDFGRRLQRDLRSIVNNRIAQSELLSGTKSTGVEVQVISHRRQRNAVWFG 418

Query: 357 GAVLASIMADKDHMWLSKQEWLESGPASMAKF 388
           G++LA     K +   +K+++ E GP  +  F
Sbjct: 419 GSLLAQTAEFKSYCH-TKKDYEEYGPQIVRNF 449

>ZYRO0G01936g Chr7 complement(144085..145470) [1386 bp, 461 aa] {ON}
           highly similar to uniprot|P47117 Saccharomyces
           cerevisiae YJR065C ARP3 Essential component of the
           Arp2/3 complex which is a highly conserved actin
           nucleation center required for the motility and
           integrity of actin patches involved in endocytosis and
           membrane growth and polarity
          Length = 461

 Score =  154 bits (390), Expect = 6e-42,   Method: Compositional matrix adjust.
 Identities = 107/356 (30%), Positives = 184/356 (51%), Gaps = 26/356 (7%)

Query: 53  DIMIGDEA--SDVRSYLQISYPMENGIIKNWTDMELLWDYAFFEQMKLPSTSNGKILLTE 110
           D  IG+EA  +   +   ++YP+ +G ++NW  ME  W+ + F+ ++     +   LLTE
Sbjct: 106 DFYIGNEALTASQGANYSLNYPIRHGQVENWDHMERFWENSIFKYLRT-EPEDHFFLLTE 164

Query: 111 PPMNPLKNREKMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXX-------- 162
           PP+NP +NRE++ E+ FE ++  G+Y+A+QAVLAL A                       
Sbjct: 165 PPLNPPENREQVAEIFFESFNCAGLYIAVQAVLALAASWTSSKVVDRSLTGTVIDSGDGV 224

Query: 163 THIVPVYESVVLSHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYV 222
           TH++PV E  V+    + + +AGRD+T+ +  LL  RG          T  +IK++ CYV
Sbjct: 225 THVIPVAEGYVIGSALKNIPIAGRDITQFIQSLLRERGEV---DTSLRTAERIKQEYCYV 281

Query: 223 SYDL-----DLDTKLARETTALVESYELPDGRTIKVGQERFEAPECLFQPGLV--DVEQP 275
             D+       D    +    +VE+ +    + + +G ERF APE  F P +   D   P
Sbjct: 282 CPDIVKEFNKFDRDAEKFAQYVVENQDKTRQKVVDIGYERFLAPEIFFNPEIASSDFLTP 341

Query: 276 GVGELLFNTVQSADVDIRSSLYKAIVLSGGSSMYPGLPSRLEKELKQLWFSRVLHND--- 332
            +  +L  T+Q+  +D+R  LY  IVLSGGS+M+     RL+++LK +  +R+   +   
Sbjct: 342 -LPTVLDQTIQACPIDVRKGLYNNIVLSGGSTMFKDFGRRLQRDLKSIVNNRIAETERLS 400

Query: 333 PSRLDKFKVRIEDPPRRKHMVFIGGAVLASIMADKDHMWLSKQEWLESGPASMAKF 388
            +R     V++    ++++ V+ GG++LA     K +   +K+++ E GP  +  F
Sbjct: 401 GARSTGVDVQVISHRKQRNAVWFGGSLLAQTPEFKGYCH-TKKDYEEYGPEIVRNF 455

 Score = 33.9 bits (76), Expect = 0.65,   Method: Compositional matrix adjust.
 Identities = 14/30 (46%), Positives = 21/30 (70%), Gaps = 1/30 (3%)

Query: 4  HNP-IVLDQGTGFVKIGRAGENFPDYTFPS 32
          +NP +V+D GTG  K+G AG + P + FP+
Sbjct: 5  NNPAVVMDNGTGLTKLGFAGNDSPSWIFPT 34

>NDAI0G05580 Chr7 complement(1374852..1376399) [1548 bp, 515 aa]
           {ON} Anc_1.287
          Length = 515

 Score = 85.9 bits (211), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 81/299 (27%), Positives = 123/299 (41%), Gaps = 33/299 (11%)

Query: 2   DPHNPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRA-EERASVTTPLKDIMIGDEA 60
           D    IV+D G+    IG +G + P+   PS  G+    A EE    T    +  IG   
Sbjct: 10  DEITSIVIDPGSYTTNIGYSGSDCPESIIPSSYGQYKDTAKEENQKKTKVFSEQSIGLAR 69

Query: 61  SDVRSYLQISYPMENGIIKNWTDMELLWDYAFFEQMKLPSTSNGKILLTEPPMNPLKNRE 120
            D     +I   +ENG I +W   +  WD+    ++ L S S   +LLTEP  N ++NR+
Sbjct: 70  PD----YEIKRIVENGEIADWDTAQEQWDWVLKNELFLKSNSGIPVLLTEPIWNSVENRK 125

Query: 121 KMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLSHLTRR 180
           K  EV+ E  DF   Y++  +    +A G             T + PV + + LS  + R
Sbjct: 126 KSLEVLLEGMDFEACYLSPVSTCVSFAAGRPNCLVVDIGHDTTSVSPVIDGMTLSKSSTR 185

Query: 181 LDVAGRDVTRHLID-------------LLSRRGYAFNRTADFET-------------VRQ 214
             +AGR +  HLI+             + SRR     RT +++               ++
Sbjct: 186 NFIAGRYI-NHLIETYLKPREIIPLFAIESRRPEFKRRTFNYQVDDSLFTYGNERGFYQE 244

Query: 215 IKEKLCYVSYDLDLDTKLARETTALVESYELPDGRTIKVGQE-RFEAPECLFQPGLVDV 272
            KE LC +  +  L+      +T    S E P    I    E R+   E LF P   D+
Sbjct: 245 CKETLCQIIPNSTLEKSQDELSTMTKRSIEAPWAEEIVFDNEARYGFAEQLFSPHREDI 303

 Score = 51.2 bits (121), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 32/109 (29%), Positives = 57/109 (52%), Gaps = 16/109 (14%)

Query: 276 GVGELLFNTVQSADVDIRSSLYKAIVLSGGSSMYPGLPSRLEKELKQLWFSRVLHNDPSR 335
           G+ +L+  ++  +DVD+R+SL   +V++GG+S  P L  RL  EL +            R
Sbjct: 410 GIADLVQRSILDSDVDLRASLAHNVVITGGTSCIPRLNDRLMYELSK------------R 457

Query: 336 LDKFKVRIEDPPR---RKHMVFIGGAVLASIMADKDHMWLSKQEWLESG 381
           L   K RI        +++  ++GG++L S +     +W+ K+E+ E G
Sbjct: 458 LPALKFRILTTGHLREKQYQAWLGGSILTS-LGTFHQLWVGKEEYKEVG 505

>NCAS0B06060 Chr2 complement(1146248..1147741) [1494 bp, 497 aa]
           {ON} 
          Length = 497

 Score = 85.5 bits (210), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 79/293 (26%), Positives = 118/293 (40%), Gaps = 27/293 (9%)

Query: 2   DPHNPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASVTTPLKDIMIGDEAS 61
           D    +++D G+    IG +G ++P    PS  G      E + S TT  K I       
Sbjct: 12  DEITAVIIDPGSFSTNIGYSGTDYPQSILPSSYGTYKETTEGQES-TTKRKRIFSESSIQ 70

Query: 62  DVRSYLQISYPMENGIIKNWTDMELLWDYAFFEQMKLPSTSNGKILLTEPPMNPLKNREK 121
             R   +I   +ENG I +W   +  W +A   Q+ L STS    LLTEP  N ++NR+K
Sbjct: 71  IPRPDYEIKRIVENGSIMDWDAAQEQWSWALKSQLHLQSTSGIPALLTEPIWNSVENRKK 130

Query: 122 MCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLSHLTRRL 181
             E++ E  +F   Y++       +A G             T + PV + + LS  + R 
Sbjct: 131 SLEILLEGMNFEACYLSSVPTCVSFAAGRPNCLVVDIGHDTTSVSPVVDGMTLSKSSMRN 190

Query: 182 DVAGRDVT---------RHLIDLLS---RRGYAFNRTADF-------------ETVRQIK 216
            +AG+ +          R +I L S   RR     RT D+             E  ++ K
Sbjct: 191 FIAGKYINTLIEKYLQPREIIPLFSIKQRRPEFIKRTFDYTVDSSLYQYANEHEFFQECK 250

Query: 217 EKLCYVSYDLDLDTKLARETTALVESYELPDGRTIKVGQE-RFEAPECLFQPG 268
           E LC ++    L+    +  T    S E P    +    E RF   E LF P 
Sbjct: 251 ETLCQITSTGSLEKNKDQLKTISSRSIEAPWAEELVFENETRFGFGEELFVPN 303

 Score = 58.5 bits (140), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 38/120 (31%), Positives = 62/120 (51%), Gaps = 22/120 (18%)

Query: 271 DVEQP------GVGELLFNTVQSADVDIRSSLYKAIVLSGGSSMYPGLPSRLEKELKQLW 324
           D+ +P      G+ +L+++ +  +DVD+R+SL   +VL+GGSS  PGL  RL  EL +  
Sbjct: 381 DISEPTKNDIAGLADLVYSAIIKSDVDLRASLAHNVVLTGGSSSIPGLSDRLILELNR-- 438

Query: 325 FSRVLHNDPSRLDKFKVRI---EDPPRRKHMVFIGGAVLASIMADKDHMWLSKQEWLESG 381
                     RL   K RI        R++  ++GG++L S +     +W+ K E+ E G
Sbjct: 439 ----------RLPALKFRILSTGHTKERQYQAWLGGSILTS-LGTFHQLWVGKNEYNEVG 487

>KLTH0G13772g Chr7 (1188875..1190137) [1263 bp, 420 aa] {ON} similar
           to uniprot|Q12509 Saccharomyces cerevisiae YLR085C ARP6
           Nuclear actin-related protein involved in chromatin
           remodeling component of chromatin-remodeling enzyme
           complexes
          Length = 420

 Score = 84.0 bits (206), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 93/382 (24%), Positives = 151/382 (39%), Gaps = 78/382 (20%)

Query: 6   PIVLDQGTGFVKIGRAGENFPDYTFPSIV----GRPILRAEERASVTTPLKDIMIGDEAS 61
           PIV+D G+  +K G A  N P     SI     G   L  + R+     +KDI       
Sbjct: 5   PIVIDNGSYEIKFGTASSNEPFTALNSIAKDKYGNYHLSNQVRS-----IKDI------- 52

Query: 62  DVRSYLQISYPMENGIIKNWTDMELLWDYAFF-----EQMKLPSTSNGKILLTEPPMNPL 116
              S +  + P + G + +W     +WDY  F     +   L +T N  ++ +E  M   
Sbjct: 53  ---SSVTFNRPHKLGQLVSWELESQIWDYCLFNPDEFDGWSLDTTKNKHLIASESCMTLP 109

Query: 117 KNREKMCEVMFEKYDFGGVYVA-IQAVLALYAQGLXXXXXXXXXXX-------------- 161
           +  + M +V+FE+Y++  ++ A +   +   A+G                          
Sbjct: 110 ELSKNMDQVVFEEYEYDSLFKAPVPVFVPFNAEGDTTHILVAKEDADVVASDHPSDNKDY 169

Query: 162 ------------XTHIVPVYESVVLSHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRTADF 209
                        T +VPV + V      ++LD+ GR +   L + LS R Y  N   + 
Sbjct: 170 RDYELVIDSGFNCTWVVPVIKGVPYYKAVKKLDIGGRFLNGFLREALSFRHY--NVMDET 227

Query: 210 ETVRQIKEKLCYVSYDLDLDTKLARETTALVESYELPD-------------------GRT 250
             V  IKEK  ++S +   D+  +R  TA  + Y LPD                    +T
Sbjct: 228 ILVNSIKEKCLFMSPNSYFDSFQSRLKTA--KEYVLPDFSTSFQGYLRKPGQTLPEDSQT 285

Query: 251 IKVGQERFEAPECLFQPGLVDVEQPGVGELLFNTVQSADVDIRSSLYKAIVLSGGSSMYP 310
           I +  E F  PE  F P +  +  PG+ E +  ++      +R  L   +V++GG+   P
Sbjct: 286 IILQDELFAVPETFFHPEIASLLNPGIIEAILESISMLPEALRPLLVGNVVVTGGNFNIP 345

Query: 311 GLPSRLEKELKQL----WFSRV 328
              SRL  EL++     W  RV
Sbjct: 346 NFASRLATELQRQCPTDWSCRV 367

>Skud_10.132 Chr10 complement(251748..253214) [1467 bp, 488 aa] {ON}
           YJL081C (REAL)
          Length = 488

 Score = 84.0 bits (206), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 73/291 (25%), Positives = 120/291 (41%), Gaps = 36/291 (12%)

Query: 2   DPHNPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASVTTPLKDIMIGDEAS 61
           D  + +V+D G+    IG +G +FP    PS+ G+  L A+E +      + I I     
Sbjct: 12  DEISAVVIDPGSYTTNIGYSGSDFPQSILPSVYGK--LTADENSKKMFSEQSIGIP---- 65

Query: 62  DVRSYLQISYPMENGIIKNWTDMELLWDYAFFEQMKLPSTSNGKILLTEPPMNPLKNREK 121
             R   ++   +ENG++ +W   +  W +A   ++ L S S    LLTEP  N ++NR+K
Sbjct: 66  --RKDYELKPIIENGLVIDWDTAQEQWQWALRNELYLDSNSGIPALLTEPVWNSMENRKK 123

Query: 122 MCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLSHLTRRL 181
             EV+ E   F   Y+A  +    +A G               + P+ + + LS  TRR 
Sbjct: 124 SLEVLLEGMQFEACYLAPTSTCVSFAAGRPNCLVVDIGHDTCSVSPIVDGMTLSKSTRRN 183

Query: 182 DVAGRDVTRHLID-------------LLSRRGYAFNRTADFET-------------VRQI 215
            +AG+ +  HLI              +  R+     +  D++               ++ 
Sbjct: 184 FIAGKFIN-HLIQKALEPKEIIPLFAIKQRKPELIKKVFDYKVDKSLYDYANSRGFFQEC 242

Query: 216 KEKLCYVSYDLDLDTKLARETTALVESYELPDGRTIKVGQE-RFEAPECLF 265
           KE LC++     L+   A  +T    S E P    I    E R+   E LF
Sbjct: 243 KETLCHICPTKPLEEAKAELSTTTKRSIESPWNEEIIFDNETRYGFAEELF 293

 Score = 60.1 bits (144), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 36/110 (32%), Positives = 63/110 (57%), Gaps = 12/110 (10%)

Query: 273 EQPGVGELLFNTVQSADVDIRSSLYKAIVLSGGSSMYPGLPSRLEKELKQLWFSRVLHND 332
           E  G+  L+++++ S+DVD+R++L   +VL+GG+S  PGL  RL  EL ++  S      
Sbjct: 380 ELAGLAGLVYSSIMSSDVDLRATLAHNVVLTGGTSSIPGLSDRLMTELNKILPSL----- 434

Query: 333 PSRLDKFKVRIEDPPR-RKHMVFIGGAVLASIMADKDHMWLSKQEWLESG 381
                KF++      R R++  ++GG++L S +     +W+ KQE+ E G
Sbjct: 435 -----KFRILTTGHIRERQYQSWLGGSILTS-LGTFHQLWVGKQEYEEVG 478

>Suva_6.154 Chr6 (266531..268000) [1470 bp, 489 aa] {ON} YJL081C
           (REAL)
          Length = 489

 Score = 83.2 bits (204), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 73/303 (24%), Positives = 118/303 (38%), Gaps = 46/303 (15%)

Query: 2   DPHNPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERA-----SVTTPLKDIMI 56
           D  + +V+D G+    IG +G +FP    PS+ G+     + +      S+  P KD   
Sbjct: 12  DEISAVVIDPGSYTTNIGYSGSDFPQSILPSVYGKSTSDKDSKTIFSEQSIGIPRKD--- 68

Query: 57  GDEASDVRSYLQISYPMENGIIKNWTDMELLWDYAFFEQMKLPSTSNGKILLTEPPMNPL 116
                      ++   +ENG++ +W   +  W +A   ++ L S S    LLTEP  N  
Sbjct: 69  ----------YELKPIIENGLVIDWDTAQEQWQWALKNELYLDSNSGIPALLTEPVWNST 118

Query: 117 KNREKMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLSH 176
           +NR+K  EV+ E   F   Y+A  +    +A G               + P+ + + LS 
Sbjct: 119 ENRKKSLEVLLEGMQFEACYLAPTSTCVSFAAGRPNCLVVDIGHDTCSVSPIVDGMTLSK 178

Query: 177 LTRRLDVAGRDVTRHLID-------------LLSRRGYAFNRTADFET------------ 211
            TRR  +AG+ +  HLI              +  R+     +  D+E             
Sbjct: 179 STRRNFIAGKFI-NHLIKKAIEPKEIIPLFAIKQRKPKLIKKIFDYEIDQSLYEYANNRG 237

Query: 212 -VRQIKEKLCYVSYDLDLDTKLARETTALVESYELPDGRTIKVGQE-RFEAPECLFQPGL 269
             ++ KE LC++     L+   A        S E P    I    E R+   E LF P  
Sbjct: 238 FFQECKETLCHICPTKTLEEAKAELNATTKRSIETPWNEEIVFDNETRYGFAEELFLPKK 297

Query: 270 VDV 272
            D+
Sbjct: 298 DDI 300

 Score = 62.0 bits (149), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 36/112 (32%), Positives = 64/112 (57%), Gaps = 16/112 (14%)

Query: 273 EQPGVGELLFNTVQSADVDIRSSLYKAIVLSGGSSMYPGLPSRLEKELKQLWFS---RVL 329
           E  G+ +L+++++ S+DVD+R++L   +VL+GG+S  PGL  RL  EL ++  S   R+L
Sbjct: 381 EITGLADLVYSSIMSSDVDLRATLAHNVVLTGGTSSIPGLSDRLMTELNKILPSLKFRIL 440

Query: 330 HNDPSRLDKFKVRIEDPPRRKHMVFIGGAVLASIMADKDHMWLSKQEWLESG 381
               +R             R++  ++GG++L S +     +W+ KQE+ E G
Sbjct: 441 TTGHTR------------ERQYQSWLGGSILTS-LGTFHQLWVGKQEYEEVG 479

>YJL081C Chr10 complement(283802..285271) [1470 bp, 489 aa] {ON}
           ARP4Nuclear actin-related protein involved in chromatin
           remodeling, component of chromatin-remodeling enzyme
           complexes
          Length = 489

 Score = 82.0 bits (201), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 74/298 (24%), Positives = 119/298 (39%), Gaps = 36/298 (12%)

Query: 2   DPHNPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASVTTPLKDIMIGDEAS 61
           D  + +V+D G+    IG +G +FP    PS+ G+    A+E        K I       
Sbjct: 12  DEVSAVVIDPGSYTTNIGYSGSDFPQSILPSVYGK--YTADEGN------KKIFSEQSIG 63

Query: 62  DVRSYLQISYPMENGIIKNWTDMELLWDYAFFEQMKLPSTSNGKILLTEPPMNPLKNREK 121
             R   ++   +ENG++ +W   +  W +A   ++ L S S    LLTEP  N  +NR+K
Sbjct: 64  IPRKDYELKPIIENGLVIDWDTAQEQWQWALQNELYLNSNSGIPALLTEPVWNSTENRKK 123

Query: 122 MCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLSHLTRRL 181
             EV+ E   F   Y+A  +    +A G               + P+ + + LS  TRR 
Sbjct: 124 SLEVLLEGMQFEACYLAPTSTCVSFAAGRPNCLVVDIGHDTCSVSPIVDGMTLSKSTRRN 183

Query: 182 DVAGRDVTRHLID-------------LLSRRGYAFNRTADFET-------------VRQI 215
            +AG+ +  HLI              +  R+     +T D+E               ++ 
Sbjct: 184 FIAGKFI-NHLIKKALEPKEIIPLFAIKQRKPEFIKKTFDYEVDKSLYDYANNRGFFQEC 242

Query: 216 KEKLCYVSYDLDLDTKLARETTALVESYELPDGRTIKVGQE-RFEAPECLFQPGLVDV 272
           KE LC++     L+      ++    S E P    I    E R+   E LF P   D+
Sbjct: 243 KETLCHICPTKTLEETKTELSSTAKRSIESPWNEEIVFDNETRYGFAEELFLPKEDDI 300

 Score = 58.5 bits (140), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 34/109 (31%), Positives = 61/109 (55%), Gaps = 16/109 (14%)

Query: 276 GVGELLFNTVQSADVDIRSSLYKAIVLSGGSSMYPGLPSRLEKELKQLWFSRVLHNDPSR 335
           G+ +L+++++ S+DVD+R++L   +VL+GG+S  PGL  RL  EL ++            
Sbjct: 384 GLADLVYSSIMSSDVDLRATLAHNVVLTGGTSSIPGLSDRLMTELNKI------------ 431

Query: 336 LDKFKVRI---EDPPRRKHMVFIGGAVLASIMADKDHMWLSKQEWLESG 381
           L   K RI        R++  ++GG++L S +     +W+ K+E+ E G
Sbjct: 432 LPSLKFRILTTGHTIERQYQSWLGGSILTS-LGTFHQLWVGKKEYEEVG 479

>Smik_10.161 Chr10 complement(275455..276924) [1470 bp, 489 aa] {ON}
           YJL081C (REAL)
          Length = 489

 Score = 80.5 bits (197), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 74/298 (24%), Positives = 121/298 (40%), Gaps = 36/298 (12%)

Query: 2   DPHNPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASVTTPLKDIMIGDEAS 61
           D  + +V+D G+    IG +G +FP    PS+ G+    A+E        K+I       
Sbjct: 12  DEISAVVIDPGSYTTNIGYSGSDFPQSILPSVYGK--YTADEGK------KNIFSEQSIG 63

Query: 62  DVRSYLQISYPMENGIIKNWTDMELLWDYAFFEQMKLPSTSNGKILLTEPPMNPLKNREK 121
             R   ++   +++G++ +W   +  W +A   ++ L S S    LLTEP  N  +NR+K
Sbjct: 64  IPRKDYELKPIVKDGLVIDWDTAQEQWQWALKNELYLNSNSGTPALLTEPVWNSTENRKK 123

Query: 122 MCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLSHLTRRL 181
             EV+ E   F   Y+A  +    +A G               + P+ + + LS  TRR 
Sbjct: 124 SLEVLLEGMQFEACYLAPTSTCVSFAAGRPNCLVVDIGHDTCSVSPIVDGMTLSKSTRRN 183

Query: 182 DVAGRDVTRHLID-------------LLSRRGYAFNRTADFETVRQI------------- 215
            +AG+ +  HLI              +  R+     ++ ++E  + I             
Sbjct: 184 FLAGKFI-NHLIKKALEPKEIIPLFAIKQRKPELIKKSFNYEVDKSIYDYANNRGFFQEC 242

Query: 216 KEKLCYVSYDLDLDTKLARETTALVESYELPDGRTIKVGQE-RFEAPECLFQPGLVDV 272
           KE LC++     L+   A  +T    S E P    I    E R+   E LF P   DV
Sbjct: 243 KETLCHICPTKTLEETKADLSTTTKRSIESPWNEEIVFDNETRYGFAEKLFLPKEDDV 300

 Score = 60.5 bits (145), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 36/114 (31%), Positives = 63/114 (55%), Gaps = 16/114 (14%)

Query: 271 DVEQPGVGELLFNTVQSADVDIRSSLYKAIVLSGGSSMYPGLPSRLEKELKQLWFSRVLH 330
           D E  G+  L+++++ S+DVD+R++L   +VL+GG+S+ PGL  RL  EL ++       
Sbjct: 379 DNELIGLAHLVYSSIMSSDVDLRATLAHNVVLTGGTSLIPGLSDRLMTELNKI------- 431

Query: 331 NDPSRLDKFKVRI---EDPPRRKHMVFIGGAVLASIMADKDHMWLSKQEWLESG 381
                L   K RI        R++  ++GG++L S +     +W+ K+E+ E G
Sbjct: 432 -----LPSLKFRILTTGHTMERQYQSWLGGSILTS-LGTFHQLWVGKKEYEEVG 479

>Kwal_56.23832 s56 (726199..727458) [1260 bp, 419 aa] {ON} YLR085C
           (ARP6) - Actin-related protein [contig 172] FULL
          Length = 419

 Score = 77.8 bits (190), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 92/382 (24%), Positives = 146/382 (38%), Gaps = 77/382 (20%)

Query: 5   NPIVLDQGTGFVKIGRAGENFPDYTFPSIV----GRPILRAEERASVTTPLKDIMIGDEA 60
           +P+++D G+  +K G   E  P     SI     G   L  + R+     +KDI      
Sbjct: 4   SPLIIDNGSYEIKFGSGSEKEPHRALNSIAKDKYGNYHLSNQVRS-----IKDI------ 52

Query: 61  SDVRSYLQISYPMENGIIKNWTDMELLWDYAFFEQMKLPS----TSNGKILLT-EPPMNP 115
               S +  + P E G + +W     +WDY  F           T+ GK L+T E  M  
Sbjct: 53  ----SSVVFNRPHELGQLVSWELETQIWDYCLFNPDDFNGWSIDTTKGKHLITSESCMTI 108

Query: 116 LKNREKMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXX--------------- 160
            +  + M +V+FE+Y+F  ++ A   V   +  G                          
Sbjct: 109 PELSKNMDQVVFEEYEFETMFKAPVPVFVPFNTGKKSTHMLVAKEDSEVEESEVAPAKNY 168

Query: 161 -----------XXTHIVPVYESVVLSHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRTADF 209
                        + IVPV + V      ++LD+ GR +   L + LS R Y  N   + 
Sbjct: 169 NDFQLVIDSGFNCSWIVPVIKGVPYYKAVKKLDIGGRFLNGFLREALSFRHY--NVMDET 226

Query: 210 ETVRQIKEKLCYVSYDLDLDTKLARETTALVESYELPD-------------------GRT 250
             V  IKE   ++S +   ++  +R  TA  + Y LPD                    +T
Sbjct: 227 ILVNSIKENCLFMSPNAYFESFQSRSKTA--KEYVLPDFNTSFQGYLRKPGQVLPAESQT 284

Query: 251 IKVGQERFEAPECLFQPGLVDVEQPGVGELLFNTVQSADVDIRSSLYKAIVLSGGSSMYP 310
           I +  E F  PE  F P +  +   G+ E +  ++      IR  +   IV++GG+   P
Sbjct: 285 IVLQDELFAVPETFFHPEIASLLNSGIVETILESISMLPEAIRPLMVGNIVITGGNFNIP 344

Query: 311 GLPSRLEKELKQL----WFSRV 328
              SRL  EL++     W  RV
Sbjct: 345 NFASRLATELQRQCPTDWSCRV 366

>TDEL0F03850 Chr6 complement(707880..709139) [1260 bp, 419 aa] {ON}
           Anc_8.258 YLR085C
          Length = 419

 Score = 77.4 bits (189), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 81/366 (22%), Positives = 143/366 (39%), Gaps = 64/366 (17%)

Query: 6   PIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASVTTPLKDIMIGDEASDVRS 65
           P+V+D G+  VK G +  + P +   + + R    A   ++    +KDI          S
Sbjct: 5   PLVVDNGSYEVKFGYSTTSQP-FRALNALARDKFGATYLSNQINQIKDI----------S 53

Query: 66  YLQISYPMENGIIKNWTDMELLWDYAFF-----EQMKLPSTSNGKILLTEPPMNPLKNRE 120
            +    P E G + +W     +WDY FF     +   L  +    ++ +E  M   +  +
Sbjct: 54  SVSFKRPHEYGQLTSWELQSCVWDYCFFNPNEFDGFDLKDSKGQHLIASETCMTLPELSK 113

Query: 121 KMCEVMFEKYDFGGVYVA-----------IQAVLALYAQGLXXXXXXXXXXX-------- 161
            M +V+FE+Y+F  +  A            +    +  +G                    
Sbjct: 114 NMDQVVFEEYEFDSLLKAPISGFMPFSKHTENTKVISGKGDSESGTSTSETKDYEPFQMV 173

Query: 162 ------XTHIVPVYESVVLSHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQI 215
                  T +VP+ + V      ++LD+ GR +   L + LS R Y  N   +   V  I
Sbjct: 174 IDSGFNCTWVVPIIKGVPFYKAVKKLDLGGRFINGLLKETLSFRHY--NVMDETILVNNI 231

Query: 216 KEKLCYVSYDLDLDTKLARETTALVESYELPD-------------------GRTIKVGQE 256
           KEK  ++S     D+   ++ TA+   Y LPD                    +T+ +  E
Sbjct: 232 KEKCLFMSPVSYFDSFAKKDQTAV--EYVLPDFQTTFLGYVADRKNPPSKDAQTVTLRDE 289

Query: 257 RFEAPECLFQPGLVDVEQPGVGELLFNTVQSADVDIRSSLYKAIVLSGGSSMYPGLPSRL 316
            F  PE  F P +  + +PG+ E +  ++      +R  +   I+ +GG+   P  P RL
Sbjct: 290 LFSVPETFFHPEIAQLLKPGIIETILESLSLVPEPLRPLMVSNILCTGGNFNLPHFPERL 349

Query: 317 EKELKQ 322
             EL++
Sbjct: 350 ATELQR 355

>ZYRO0C01738g Chr3 (135066..136310) [1245 bp, 414 aa] {ON} similar
           to uniprot|Q12509 Saccharomyces cerevisiae YLR085C ARP6
           Nuclear actin-related protein involved in chromatin
           remodeling component of chromatin-remodeling enzyme
           complexes
          Length = 414

 Score = 76.6 bits (187), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 81/362 (22%), Positives = 142/362 (39%), Gaps = 60/362 (16%)

Query: 6   PIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASVTTPLKDIMIGDEASDVRS 65
           PIV+D G+  +K G      P   F + + R    +   ++    +KDI          S
Sbjct: 5   PIVVDNGSYEIKFGTPDLETPHRAF-NALARDKFGSYYLSNQIKTIKDI----------S 53

Query: 66  YLQISYPMENGIIKNWTDMELLWDYAFFEQ-----MKLPSTSNGKILLTEPPMNPLKNRE 120
            +    P E G + +W     +WDY FF         L  +    ++++E  M   +  +
Sbjct: 54  SVVFRRPHEFGQLTSWELESAIWDYCFFNPDEFNGFDLKDSKGQHLVVSETCMTIPELSK 113

Query: 121 KMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXX---------------------XXXXX 159
            M +V+FE+Y+F  ++ +  A  A + +                                
Sbjct: 114 NMDQVVFEEYEFASMFKSPIAGFAPFGRPSIAISGKGDDQPNRKAEPDAYEPFQLVIDVG 173

Query: 160 XXXTHIVPVYESVVLSHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKL 219
              T +VPV + +      ++LD+ GR +   L + LS R Y  N   +   V  IKE  
Sbjct: 174 FNCTWVVPVIKGIPYYKAVKKLDIGGRFLNGLLKETLSFRHY--NVMDETILVNNIKENC 231

Query: 220 CYVSYDLDLDTKLARETTALVESYELPD-------------------GRTIKVGQERFEA 260
            +VS     ++   +E TA+   Y LPD                    +T+++  E F  
Sbjct: 232 LFVSPVSYFESFKHKEQTAV--EYVLPDFQTSFLGYVKDPKKPLPQDSQTVELKDELFSV 289

Query: 261 PECLFQPGLVDVEQPGVGELLFNTVQSADVDIRSSLYKAIVLSGGSSMYPGLPSRLEKEL 320
           PE  F P +  + +PG+ E +  ++      +R  +   IV +GG+   P   +RL  EL
Sbjct: 290 PETFFHPEIPQLLKPGIIETILESLSILPEQLRPLMLGNIVCTGGNFNLPNFATRLATEL 349

Query: 321 KQ 322
           ++
Sbjct: 350 QR 351

>AFR105C Chr6 complement(625098..626537) [1440 bp, 479 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YJL081C
           (ARP4)
          Length = 479

 Score = 76.3 bits (186), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 75/295 (25%), Positives = 117/295 (39%), Gaps = 38/295 (12%)

Query: 2   DPHNPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASVTTPLKDIMIGDEAS 61
           D    +V+D G+    IG +G + P    PS  G+           T   KD +  +++ 
Sbjct: 12  DEITAVVIDPGSFTTNIGYSGTDCPQAILPSCYGK----------YTEGEKDELFSEQSI 61

Query: 62  DV-RSYLQISYPMENGIIKNWTDMELLWDYAFFEQMKLPSTSNGKILLTEPPMNPLKNRE 120
            + R   +I   ++NG + +W   E  WD+A   +++  + S    LLTEP  N  +NR+
Sbjct: 62  GLPRKDYEIHNIVQNGEVVDWEKAEKQWDWAIRSELRFETNSGMPALLTEPIWNSEENRK 121

Query: 121 KMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLSHLTRR 180
           K  EV+ E  DF   Y+   A    +A G             T + PV + + LS  + R
Sbjct: 122 KSLEVLLESMDFSACYLVPTATAVSFAMGRPTCLVVDIGHDVTSVCPVVDGMTLSKSSMR 181

Query: 181 LDVAG---RDVTRH---------LIDLLSRRGYAFNRTADFET-------------VRQI 215
             +AG    ++ R          L  +  RR     R  D+E               ++ 
Sbjct: 182 SYIAGSLLNELIRSQLAPRKVIPLFQVAQRRPVFMERKFDYEIHPSLQKFVNERQFFQEF 241

Query: 216 KEKLCYVSYDLDLDTKLARETTALVESYELPDGRTIKVGQ-ERFEAPECLFQPGL 269
           KE +  V+       K   ETT+   S E P G  +     +R E  E LF P L
Sbjct: 242 KETMLQVAPTSISKFKSEIETTS-KRSIEAPWGEELVYDSLQRLEFAEQLFTPDL 295

 Score = 59.3 bits (142), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 38/116 (32%), Positives = 68/116 (58%), Gaps = 12/116 (10%)

Query: 273 EQPGVGELLFNTVQSADVDIRSSLYKAIVLSGGSSMYPGLPSRLEKELKQLWFSRVLHND 332
           E  G+ +L+++++ S DVD+R++L   +V++GG+S  PGL  R+  EL     +R L   
Sbjct: 371 EVSGLADLIYSSIMSTDVDLRTTLSHNVVITGGTSSLPGLMDRISAEL-----NRSL--- 422

Query: 333 PSRLDKFKVRIEDPPR-RKHMVFIGGAVLASIMADKDHMWLSKQEWLESGPASMAK 387
           P+   KF++      R R++  ++GG++LAS +     +W+ KQE+ E G   + K
Sbjct: 423 PAL--KFRMLTSGQLRERQYQGWLGGSILAS-LGTFHQLWVGKQEYAEVGADRLLK 475

>KLLA0F19063g Chr6 complement(1756529..1757776) [1248 bp, 415 aa]
           {ON} similar to uniprot|Q12509 Saccharomyces cerevisiae
           YLR085C ARP6 Nuclear actin-related protein involved in
           chromatin remodeling component of chromatin-remodeling
           enzyme complexes
          Length = 415

 Score = 75.9 bits (185), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 83/379 (21%), Positives = 146/379 (38%), Gaps = 62/379 (16%)

Query: 7   IVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASVTTPLKDIMIGDEASDVRSY 66
           +V+D G+  +K G +G + P      +      R    ++ T  ++DI          S 
Sbjct: 6   LVIDNGSYEIKFGESGWDQPLRALNCLTKDKYSRFH-LSNQTKKMRDI----------SQ 54

Query: 67  LQISYPMENGIIKNWTDMELLWDYAFFEQMKL-------PSTSNGKILLTEPPMNPLKNR 119
             I  P E G + +W     +WDY F+ +            T +  ++++E  M   +  
Sbjct: 55  ALIRRPHELGQLVSWELESEVWDYCFYNEDDFHWNLTHDNDTKDHHLVVSETLMTIPELS 114

Query: 120 EKMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXX------------------X 161
           + M +V+FE+YDF  ++    A    + QG                              
Sbjct: 115 KNMDQVIFEEYDFKSMFKGPVAQYIPFYQGQYQDDAMTAAEDKKTSSYKDFQLVIDSGFN 174

Query: 162 XTHIVPVYESVVLSHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCY 221
            T  VP+ + V      ++LD+ GR +T  L + +S R Y  N   +   V  IKE+  +
Sbjct: 175 CTWAVPIIKGVPYYKAIKKLDIGGRFLTGLLQETISFRHY--NVMEETILVNNIKEQCTF 232

Query: 222 V---SYDLDLDTKLARETTALVESYELP---------------DGRTIKVGQERFEAPEC 263
           V   SY      K+  +   ++  ++                 D +T+ +  E F  PE 
Sbjct: 233 VPPESYFSSFHNKMNTKVEYVLPDFQTSFLGYVKKPGKEKLTDDAQTLLLTDEVFSVPET 292

Query: 264 LFQPGLVDVEQPGVGELLFNTVQSADVDIRSSLYKAIVLSGGSSMYPGLPSRLEKELKQL 323
            F P +  + +PG+ E +   +      +R  L   IV +GG+   P    RL+ EL++ 
Sbjct: 293 FFHPEIAQILKPGIVETILECINMCPEVVRPLLVANIVCTGGNFNIPNFHERLQTELQRQ 352

Query: 324 ----WFSRVLHNDPSRLDK 338
               W  +V  + P   DK
Sbjct: 353 CPIDWSCKV--HSPQEKDK 369

>KAFR0B02700 Chr2 complement(543626..544888) [1263 bp, 420 aa] {ON}
           Anc_8.258 YLR085C
          Length = 420

 Score = 74.7 bits (182), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 86/371 (23%), Positives = 143/371 (38%), Gaps = 72/371 (19%)

Query: 6   PIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASVTTPLKDIMIGDEASDVRS 65
           P+V+D G+  VK G A    P Y   + +      A   ++    +KDI          S
Sbjct: 5   PVVIDNGSYRVKFGPASLEAP-YCALNAIANDKYDASYLSNQIKSIKDI----------S 53

Query: 66  YLQISYPMENGIIKNWTDMELLWDYAF-----FEQMKLPSTSNGKILLTEPPMNPLKNRE 120
            + I  P   G + +W    L+WDY       F    +  T +  ++ +E  M   +  +
Sbjct: 54  SVSIKRPHTLGQLTSWEMQTLIWDYCLYNPDEFNGFNIGDTKSKHLITSETCMTLPELGK 113

Query: 121 KMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXX----------------------- 157
            M +V+FE+Y+FG +   +++ +A Y   L                              
Sbjct: 114 NMDQVIFEEYEFGSL---MKSPVAGYMPFLRNTKDQIIIGERDTEPFVETPSTEEYRDFQ 170

Query: 158 ----XXXXXTHIVPVYESVVLSHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRTADFETVR 213
                    T I+PV + +      ++LD+ GR +   L + LS R Y  N   +   V 
Sbjct: 171 LVVDSGFNCTWIIPVIKGIPYYKAVKKLDIGGRFLNGLLKETLSFRHY--NVMDETILVN 228

Query: 214 QIKEKLCYVSYDLDLDTKLARETTALVESYELPDGRT----------------------I 251
            IKEK  +VS     D+   ++ T+    Y LPD +T                      I
Sbjct: 229 NIKEKCLFVSPASYFDSFKNKDITS--REYVLPDFQTSFLGYVRPSNEQGKPLPEDSQSI 286

Query: 252 KVGQERFEAPECLFQPGLVDVEQPGVGELLFNTVQSADVDIRSSLYKAIVLSGGSSMYPG 311
            +  E F  PE  F P +  + +PG+ E +  ++      IR  +   I+  GG+   P 
Sbjct: 287 TLKDELFAVPETFFHPEISQILKPGLVETILESLSMIPEVIRPLMVSNIMCIGGNFNLPH 346

Query: 312 LPSRLEKELKQ 322
             SR+ KEL++
Sbjct: 347 FASRVAKELQR 357

>SAKL0H17138g Chr8 (1515123..1516382) [1260 bp, 419 aa] {ON} highly
           similar to uniprot|Q74ZV8 Ashbya gossypii AGR091W ARP6
           Actin-like protein ARP6 and similar to uniprot|Q12509
           Saccharomyces cerevisiae YLR085C ARP6 Nuclear actin-
           related protein involved in chromatin remodeling
           component of chromatin-remodeling enzyme complexes
          Length = 419

 Score = 74.7 bits (182), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 83/370 (22%), Positives = 143/370 (38%), Gaps = 72/370 (19%)

Query: 6   PIVLDQGTGFVKIGRAGENFPDYTFPSIV----GRPILRAEERASVTTPLKDIMIGDEAS 61
           PI++D G+  VK G A  + P     ++     G P L     ++  + LKDI       
Sbjct: 5   PIIIDNGSYEVKFGPATNSTPFRALNALARDKYGNPHL-----SNQVSRLKDI------- 52

Query: 62  DVRSYLQISYPMENGIIKNWTDMELLWDYAFFE----QMKLPSTSNGKILLTEPPMNPLK 117
              S +Q   P E G + +W     +WDY  +       ++ +T    ++L+E  M+  +
Sbjct: 53  ---SNVQFRRPHELGQLTSWELQSCIWDYCLYNPDEFNWEIGNTKGKHLVLSEMCMSMPE 109

Query: 118 NREKMCEVMFEKYDFGGVYVA-IQAVLALYAQGLXXXXXXXXXXX--------------- 161
             +   +V+FE+Y+FG  +   +   +    Q L                          
Sbjct: 110 LSKGTDQVVFEEYEFGSCFKGPVAGFVPFNWQALEHNMIYAKEDSVYRKDSTGERNEYND 169

Query: 162 ----------XTHIVPVYESVVLSHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRTADFET 211
                      T +VP+ + +      ++LD+ GR +   L + LS R Y  N   +   
Sbjct: 170 FQLVIDSGFNCTWVVPIVKGIPYYKAIKKLDIGGRFLNGFLKETLSFRHY--NVMDETIL 227

Query: 212 VRQIKEKLCYVSYDLDLDTKLARETTALVESYELPD-------------------GRTIK 252
           V  IKEK  ++S     ++   +E T     Y LPD                    +TIK
Sbjct: 228 VNNIKEKCLFMSPVSYFNSFQKKEDTT--AEYVLPDFQTSFQGYVKQQKQKIPEDSQTIK 285

Query: 253 VGQERFEAPECLFQPGLVDVEQPGVGELLFNTVQSADVDIRSSLYKAIVLSGGSSMYPGL 312
           +  E F  PE  F P +  + +PG+ E +  ++      IR  +    V++GG+      
Sbjct: 286 LYDELFSIPETFFHPEIASLLKPGIVETILESISMLPEAIRPLMVSNTVVTGGNFNIRNF 345

Query: 313 PSRLEKELKQ 322
             RL  EL++
Sbjct: 346 ARRLATELQR 355

>Kpol_543.36 s543 complement(80922..82205) [1284 bp, 427 aa] {ON}
           complement(80922..82205) [1284 nt, 428 aa]
          Length = 427

 Score = 73.9 bits (180), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 83/376 (22%), Positives = 148/376 (39%), Gaps = 72/376 (19%)

Query: 4   HNPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASVTTPLKDIMIGDEASDV 63
            NPIV+D G+  VK G +    P+    ++  +    A   ++    +KDI         
Sbjct: 3   QNPIVIDNGSYEVKFGYSDAKVPNRALNAL-AKDKYGAWYLSNQMNNIKDI--------- 52

Query: 64  RSYLQISYPMENGIIKNWTDMELLWDYAFFEQMKLPS-----TSNGKILLTEPPMNPLKN 118
            S + I  P E G + +W     +WDY FF   + P+     T    ++++E  M   + 
Sbjct: 53  -SSVTIRRPHELGQLVSWELEGTVWDYCFFNPDEFPNFNLKETKGHHLVVSETCMTLPEL 111

Query: 119 REKMCEVMFEKYDFGGVYVAIQA--------------------------VLALYAQGLXX 152
              M +VMFE+Y+F  ++ +  A                          +  + +Q +  
Sbjct: 112 SANMDQVMFEEYEFESLFKSPVAGFVPFLNLQDNMKMICGKGDDVMGDLISNMDSQNIKN 171

Query: 153 -----XXXXXXXXXXTHIVPVYESVVLSHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRTA 207
                          T I+P+ + V      +++++ GR +     + +S R Y  + T 
Sbjct: 172 PYSDFNLVIDSGFNCTWIIPIIKGVPYYKAVKKMEMGGRFLNGLFKETISYRHY--DVTD 229

Query: 208 DFETVRQIKEKLCYVSYDLDLDTKLARETTALVESYELPDGRTIKVG------------- 254
           +   V  IKEK  ++S    +D+   ++  ++   Y LPD +T  +G             
Sbjct: 230 ETILVNNIKEKCLFMSPTSYMDSFKNKDRYSV--DYVLPDFQTSFIGYVKDKKSNSQLPE 287

Query: 255 --------QERFEAPECLFQPGLVDVEQPGVGELLFNTVQSADVDIRSSLYKAIVLSGGS 306
                    E F  PE +F P +  + +PG+ E +  ++      IR  L   IV  GG+
Sbjct: 288 NSQVITLTDELFSVPETIFHPEMAKLLKPGIVETILESLSIVPETIRPLLVNNIVCVGGN 347

Query: 307 SMYPGLPSRLEKELKQ 322
              P   SRL  EL++
Sbjct: 348 FNMPNFGSRLATELQR 363

>KNAG0B01920 Chr2 complement(362300..363817) [1518 bp, 505 aa] {ON}
           Anc_1.287 YJL081C
          Length = 505

 Score = 73.9 bits (180), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 55/206 (26%), Positives = 89/206 (43%), Gaps = 20/206 (9%)

Query: 2   DPHNPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASVTTPLKDIMIGDEAS 61
           D  + +V+D G+    IG +G + P    PS  G    +   + S     K     DE++
Sbjct: 12  DEISAVVIDPGSYSTNIGYSGTDCPHSILPSRYGS--FKKTNKDSGDEDTK----SDESA 65

Query: 62  DVRSYL-------------QISYPMENGIIKNWTDMELLWDYAFFEQMKLPSTSNGKILL 108
             R+++             +I   +ENG + +W   +  W++A   ++ L ST     LL
Sbjct: 66  TKRAHIFSEQSLGLPRKDYEIKTIVENGAVTDWDAAQEQWEWALKNELFLESTKGIPALL 125

Query: 109 TEPPMNPLKNREKMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPV 168
           TEP  N  KNR+K  E + E  +F   Y+A  +    +A G               + PV
Sbjct: 126 TEPVWNTKKNRKKSLETLLESMNFEACYLAPTSTCVSFATGRANCLVVDIGHDTCSVSPV 185

Query: 169 YESVVLSHLTRRLDVAGRDVTRHLID 194
            + + LS  TRR   AG+ +  HLI+
Sbjct: 186 VDGMTLSKSTRRSFFAGKYIN-HLIE 210

 Score = 57.8 bits (138), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 35/109 (32%), Positives = 60/109 (55%), Gaps = 16/109 (14%)

Query: 276 GVGELLFNTVQSADVDIRSSLYKAIVLSGGSSMYPGLPSRLEKELKQLWFSRVLHNDPSR 335
           G+ +L+ +++ ++DVD+R+SL   + L+GG+S+ PGL  RL  EL             +R
Sbjct: 400 GLADLVHSSIMASDVDLRASLAHNVQLTGGTSLIPGLSDRLMLELN------------AR 447

Query: 336 LDKFKVRI---EDPPRRKHMVFIGGAVLASIMADKDHMWLSKQEWLESG 381
           L   K RI        R++  ++GG+VL S +     +W+ +QE+ E G
Sbjct: 448 LPALKFRILTTGHKKEREYQSWLGGSVLTS-LGTFHQLWVGRQEYEEVG 495

>Ecym_4312 Chr4 (671413..672648) [1236 bp, 411 aa] {ON} similar to
           Ashbya gossypii AGR091W
          Length = 411

 Score = 73.2 bits (178), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 85/358 (23%), Positives = 149/358 (41%), Gaps = 54/358 (15%)

Query: 6   PIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASVTTPLKDIMIGDEASDVRS 65
           PI++D G+  +K G +    P Y   + + R       R  ++  +K I    E S+   
Sbjct: 4   PIIIDNGSYEIKFGPSSLKSP-YRALNCLAR---DKYGRYHLSNQMKQIR---EVSNC-- 54

Query: 66  YLQISYPMENGIIKNWTDMELLWDYAFFEQ----MKLPSTSNGKILLTEPPMNPLKNREK 121
              +  P E G + +W   E +WDY  F        L  + +  ++++E  M+  +  + 
Sbjct: 55  --HVRRPFELGQLVSWELEEHIWDYCLFNSDEFSWDLKDSKDVDLIVSETCMSIPEISKH 112

Query: 122 MCEVMFEKYDFGGV-------YVAIQ--AVLALY-AQGL----------XXXXXXXXXXX 161
           M +V+FE+Y+FG +       Y+     A   +Y + GL                     
Sbjct: 113 MDQVVFEEYEFGSLMKCPVAQYIPFDNMADYKVYGSDGLPVVRKKDDYNDFQLVVDSGFN 172

Query: 162 XTHIVPVYESVVLSHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCY 221
            T ++PV + V      ++LD+ GR +T  L + +S R Y  N   +      IKE+ C+
Sbjct: 173 CTWVIPVIKGVPYYKAVKKLDIGGRFLTGLLKETVSFRHY--NLMDETILANNIKEQCCF 230

Query: 222 ---VSY--------DLDLDTKLARETTALVESYELP------DGRTIKVGQERFEAPECL 264
              VSY        +  +D  L    T+L+     P      D +T+ +  E F  PE  
Sbjct: 231 MPPVSYFDSFQKKAETRIDYVLPDFQTSLIGYVRQPKQAIPEDSQTLNLEDELFTIPETF 290

Query: 265 FQPGLVDVEQPGVGELLFNTVQSADVDIRSSLYKAIVLSGGSSMYPGLPSRLEKELKQ 322
           F P + ++ +PG+ E +  ++      IR  +   I + GG+       SRL  EL++
Sbjct: 291 FHPEIANILKPGLIETVLESISMLPELIRPLMVSNIAVIGGNFNISNFASRLATELQR 348

>Kpol_282.4 s282 (8483..9988) [1506 bp, 501 aa] {ON} (8483..9988)
           [1506 nt, 502 aa]
          Length = 501

 Score = 72.8 bits (177), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 67/278 (24%), Positives = 111/278 (39%), Gaps = 36/278 (12%)

Query: 2   DPHNPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRA---------EERASVTTPLK 52
           D  + +V+D G+    IG +G + P    PS  G   L+          EE ++     K
Sbjct: 12  DEISAVVIDPGSFTTNIGYSGTDCPQAILPSYYGEISLKEVASEGNEEIEENSASNNKSK 71

Query: 53  DIMIGDEASDVRSYLQISYPMENGIIKNWTDMELLWDYAFFEQMKLPSTSNGKILLTEPP 112
            I      +  R+  +I   ++NG + +W   +  WD+A    + L S S     LTEP 
Sbjct: 72  KIFGEQSINYPRADYEIKPIVKNGEVIDWDGAQEQWDWALKNALYLESNSGIPAFLTEPI 131

Query: 113 MNPLKNREKMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESV 172
            N ++NR+K  EV+ E   F   Y++       +A G               + PV + +
Sbjct: 132 WNTVENRKKSLEVLLEGLQFEACYLSPTPTCISFASGRPNCLVVDIGHDVASVSPVIDGM 191

Query: 173 VLSHLTRRLDVAGRDVTRHLIDLL------------SRRGYAFNRTADFE---------- 210
            LS  + R  ++GR +   + + L             R+     +T DF           
Sbjct: 192 TLSKSSMRNFISGRFINEKIKEFLKPREIIPLFEVKQRKPEFIKKTFDFPIHQSVYDYAN 251

Query: 211 ---TVRQIKEKLCYVSYDLDLDTKLARETTALVE-SYE 244
                ++ KE LC ++    LD K+A E  +L + SYE
Sbjct: 252 DHGIFQECKETLCQIAPTAALD-KMAPELESLAKRSYE 288

 Score = 62.8 bits (151), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 40/117 (34%), Positives = 65/117 (55%), Gaps = 18/117 (15%)

Query: 275 PGVGELLFNTVQSADVDIRSSLYKAIVLSGGSSMYPGLPSR----LEKELKQLWFSRVLH 330
           PG+ +L+ +++ + DVD+R+SL   IVL+GG+S  PG   R    L K+L  L F RVL 
Sbjct: 395 PGIVDLIESSIMATDVDLRASLAHNIVLTGGTSCIPGFSDRLMLELNKKLPALKF-RVLT 453

Query: 331 NDPSRLDKFKVRIEDPPRRKHMVFIGGAVLASIMADKDHMWLSKQEWLESGPASMAK 387
              +R             R++  ++GG++L+S +     +W+ KQE+ ESG   + K
Sbjct: 454 TGQTR------------ERQYQAWLGGSILSS-LGTFHQLWVGKQEYEESGADRLLK 497

>Suva_14.281 Chr14 complement(511583..513850) [2268 bp, 755 aa] {ON}
           YNL059C (REAL)
          Length = 755

 Score = 73.2 bits (178), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 60/234 (25%), Positives = 100/234 (42%), Gaps = 10/234 (4%)

Query: 2   DPHNPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASVTTPLKDIMIGDEAS 61
           DPH PI +D G+  ++ G   +  P + FP+++ +   R  +     T + +  + D+A 
Sbjct: 35  DPHVPIAIDFGSSKLRAGFVNQAAPTHIFPNVLTK--FRDRKLNKNFTFVGNDTLLDQA- 91

Query: 62  DVRSYLQISYPMENGIIKNWTDMELLWDYAFFEQMKLPSTS-NGKILLTEPPMNPLKNRE 120
            VRS  Q   P +   + NW   E + DY F      P+      ILLTE        R 
Sbjct: 92  -VRS--QSRSPFDGPFVTNWNFTEEIMDYTFHHLGVSPNNGVRNPILLTERMATVQSQRA 148

Query: 121 KMCEVMFEKYDFGGVYVAIQAVLALYAQ---GLXXXXXXXXXXXXTHIVPVYESVVLSHL 177
              ++MFE Y+  GV   I ++   Y Q   G             T+++PV +   +   
Sbjct: 149 NWYQIMFETYNVPGVTFGIDSLYGFYNQNTSGNKTGLVIDCGHEDTNVIPVVDGTGVLTD 208

Query: 178 TRRLDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLDLDTK 231
            +R++  GR    +L DL++ +   F     +     + +  CYVS + D D K
Sbjct: 209 AKRINWGGRQAVDYLSDLMALKYPYFPTKLSYLQYETMYQDYCYVSPNYDEDIK 262

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 42/154 (27%), Positives = 67/154 (43%), Gaps = 28/154 (18%)

Query: 241 ESYELPDGRTIKVGQERFEAPECLFQPGLVDVEQPGVGEL----LFNTVQSADVDIRSS- 295
           +S  + +   + +  ER   PE +FQP L   +Q G+ EL    L     S    + S+ 
Sbjct: 602 DSENIHEQHQMHLNVERIRVPEVVFQPTLGGQDQAGICELSETILLKKFGSQPGKLSSTS 661

Query: 296 --LYKAIVLSGGSSMYPGLPSRLEKELKQLW-----FSRVLHNDPSRLDKFKVRIEDPPR 348
             +   + ++GG+S  PGL  R+ +E  +       FS  + +DPS LD +K        
Sbjct: 662 LDMVNNVFITGGNSKVPGLRERIVREFTEFLPVGTNFSVNMSSDPS-LDAWK-------- 712

Query: 349 RKHMVFIGGAVLASIMADKDHMWLSKQEWLESGP 382
                  G A LA    +     +SK+E+ E GP
Sbjct: 713 -------GMAALAQNKEEYKKTVISKKEYEEYGP 739

>TPHA0A01830 Chr1 (369897..371162) [1266 bp, 421 aa] {ON} Anc_8.258
           YLR085C
          Length = 421

 Score = 72.0 bits (175), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 79/367 (21%), Positives = 144/367 (39%), Gaps = 65/367 (17%)

Query: 6   PIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASVTTPLKDIMIGDEASDVRS 65
           P+++D G+  +K G + +  P +   + + +        ++    +KDI          S
Sbjct: 5   PLLIDNGSYEIKFGYSNQETP-FVALNALAKDKYETYYLSNQINNIKDI----------S 53

Query: 66  YLQISYPMENGIIKNWTDMELLWDYAF-----FEQMKLPSTSNGKILLTEPPMNPLKNRE 120
            + I  P + G + +W     +WDY F     F+  ++   S   ++LTE PM   +   
Sbjct: 54  SVSIKRPHQLGQLVSWELEHEIWDYCFYNGDDFKGFEVNEDSENHLVLTETPMTLPELSR 113

Query: 121 KMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTH---------------- 164
              +V+FE+Y F  +Y A  A    + +              T+                
Sbjct: 114 NTDQVVFEEYGFDSLYKAPAANFIPFIKNDDNSFIRLSGKSKTYLDGSKENNYQDFNLVI 173

Query: 165 --------IVPVYESVVLSHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIK 216
                   I+P+ + V      +++D+ GR +   L + +S R Y  + T +   V  IK
Sbjct: 174 DSGYNCSWIIPMIKGVPYYKAVKKMDMGGRFLNGLLKETISYRHY--DVTDESMLVNNIK 231

Query: 217 EKLCYVSYDLDLDTKLARETTALVESYELPDGRTIKVG---------------------Q 255
           E   ++S  +       ++    VE Y LPD +T  +G                      
Sbjct: 232 ENCMFIS-PVSYIESFKKKALTKVE-YVLPDFQTSFMGYVRDMKKHSTLPEHSQSIILED 289

Query: 256 ERFEAPECLFQPGLVDVEQPGVGELLFNTVQSADVDIRSSLYKAIVLSGGSSMYPGLPSR 315
           E F  PE  F P + +V +PG+ E +  ++      +RS +   IV +GG+   P   SR
Sbjct: 290 ELFSVPEGFFHPEMANVLKPGIIETILESLFILPESLRSLMVNNIVCTGGNFNIPNFGSR 349

Query: 316 LEKELKQ 322
           +  EL++
Sbjct: 350 IYTELQK 356

>AGR091W Chr7 (907238..908470) [1233 bp, 410 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YLR085C (ARP6)
          Length = 410

 Score = 70.9 bits (172), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 82/362 (22%), Positives = 142/362 (39%), Gaps = 63/362 (17%)

Query: 6   PIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASVTTPLKDIMIGDEASDVRS 65
           P++++ G+  +K G A    P Y   + + R        ++    ++DI          S
Sbjct: 4   PLLMENGSYEIKFGPANLETP-YRARNCLTRDRYGRYHLSNQMDQIRDI----------S 52

Query: 66  YLQISYPMENGIIKNWTDMELLWDYAFFE----QMKLPSTSNGKILLTEPPMNPLKNREK 121
           +  I  P E G + +W   E +WDY  F       +L  + +  ++ +E  M   +  + 
Sbjct: 53  HCHIRRPSELGQLISWELEEQIWDYCLFNPDEFGWELKDSKDVDLIASETCMTIPEISKN 112

Query: 122 MCEVMFEKYDFGGVYVAIQAVLALYAQGL-------------------XXXXXXXXXXXX 162
           M +V+FE+Y+FG +     A    + +                                 
Sbjct: 113 MDQVVFEEYEFGSMMKCPVAQFVPFDRARDYDIVGGAGEVVEAKSGYNNFQLVVDSGFNC 172

Query: 163 THIVPVYESVVLSHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCY- 221
           T ++PV + V     T++LD+ GR +   L + +S R Y  N   +   +  IKE+ C+ 
Sbjct: 173 TWVMPVIKGVPYYKATKKLDIGGRFLNGLLKETISFRHY--NVMDETILINNIKEQCCFM 230

Query: 222 --VSYDLDLDTKLARETTALVESYELPDGRTIKVG-------------------QERFEA 260
             VSY    D+   +E T +   Y LPD +T  +G                    E F  
Sbjct: 231 PPVSY---FDSFQRKEETRV--EYILPDFQTSLIGYVRQPKQAIPKTSQILRLEDELFTV 285

Query: 261 PECLFQPGLVDVEQPGVGELLFNTVQSADVDIRSSLYKAIVLSGGSSMYPGLPSRLEKEL 320
           PE  F P + ++ +PG+ E +   V      +R  L   IV  GG+       +RL  EL
Sbjct: 286 PETFFHPEISNILKPGLVETILECVSMVPEVLRPLLVSNIVAVGGNFNIANFATRLATEL 345

Query: 321 KQ 322
           ++
Sbjct: 346 QR 347

>KAFR0A01560 Chr1 complement(311746..313203) [1458 bp, 485 aa] {ON}
           Anc_1.287 YJL081C
          Length = 485

 Score = 70.9 bits (172), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 75/306 (24%), Positives = 115/306 (37%), Gaps = 48/306 (15%)

Query: 2   DPHNPIVLDQGTGFVKIGRAGENFPDYTFPSIVGR------PILRAEE---RASVTTPLK 52
           D  + +V+D G+    IG +G + P    PS  G       P  + ++     S+  P K
Sbjct: 12  DEISAVVIDPGSYSTNIGYSGTDCPQAILPSCYGDYTNTDDPEGKKKKVFSEQSICIPRK 71

Query: 53  DIMIGDEASDVRSYLQISYPMENGIIKNWTDMELLWDYAFFEQMKLPSTSNGKILLTEPP 112
           D              +I   +ENG++ +W   +  W +A   Q+ L S S    LLTEP 
Sbjct: 72  D-------------YEIKPIVENGVVIDWDAAQEQWSWALENQLYLRSNSGIPALLTEPI 118

Query: 113 MNPLKNREKMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESV 172
            N ++NR+K  E++ E  DF   Y+A       +  G               + PV + +
Sbjct: 119 WNTVENRKKSLELLLEGMDFEACYLASTPTCVSFGTGRSSCLVVDLGHDTCSVSPVVDGM 178

Query: 173 VLSHLTRRLDVAGRDVTRHLIDLLS------------RRGYAFNRTADFET--------- 211
            LS  T+R   AG  +   + + +S            RR     +  +F           
Sbjct: 179 TLSKSTKRNFFAGGYLNELIKNYISPEKIIPLFAIDKRRPELKKKVFEFPVHESLYKYAN 238

Query: 212 ----VRQIKEKLCYVSYDLDLDTKLARETTALVESYELPDGRTIKVGQE-RFEAPECLFQ 266
                ++ KE LC V+    LD   +   T    S E P    I    E R+   E LF 
Sbjct: 239 DRGIFQECKETLCQVAAPSTLDKMKSELATVAKRSIETPWTEEIIFDNETRYGFAEQLFL 298

Query: 267 PGLVDV 272
           P   DV
Sbjct: 299 PRKEDV 304

 Score = 58.5 bits (140), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 35/109 (32%), Positives = 60/109 (55%), Gaps = 16/109 (14%)

Query: 276 GVGELLFNTVQSADVDIRSSLYKAIVLSGGSSMYPGLPSRLEKELKQLWFSRVLHNDPSR 335
           GV +L+ +++ ++DVD+R++L   +VL+GG+S  PGL  RL  EL             SR
Sbjct: 380 GVADLVHSSIMASDVDLRATLAHNVVLTGGTSTIPGLSDRLMAELN------------SR 427

Query: 336 LDKFKVRI---EDPPRRKHMVFIGGAVLASIMADKDHMWLSKQEWLESG 381
           L   K R+        R++  ++GG+VL S +     +W+ K+E+ + G
Sbjct: 428 LPALKFRMITTGHTRERQYQSWLGGSVLTS-LGTFHQLWVGKEEYQDVG 475

>Skud_14.272 Chr14 complement(502920..505187) [2268 bp, 755 aa] {ON}
           YNL059C (REAL)
          Length = 755

 Score = 70.9 bits (172), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 58/234 (24%), Positives = 100/234 (42%), Gaps = 10/234 (4%)

Query: 2   DPHNPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASVTTPLKDIMIGDEAS 61
           DPH PI +D G+  ++ G   +  P + FP+++ +   R  +     T + +  + D+A 
Sbjct: 35  DPHLPIAIDFGSSRLRAGFVNQATPTHIFPNVLTK--FRDRKLNKNFTFVGNDTLLDQA- 91

Query: 62  DVRSYLQISYPMENGIIKNWTDMELLWDYAFFEQMKLPSTS-NGKILLTEPPMNPLKNRE 120
            VRS  Q   P +   + NW   E + DY F     LP+   +  ILLTE        R 
Sbjct: 92  -VRS--QSRSPFDGPFVTNWNFTEEIMDYTFHHLGVLPNNGISNPILLTERMATVQSQRA 148

Query: 121 KMCEVMFEKYDFGGVYVAIQAVLALYAQ---GLXXXXXXXXXXXXTHIVPVYESVVLSHL 177
              +++FE Y+  GV   I ++ + Y     G             T +VP+ +   +   
Sbjct: 149 NWYQILFETYNVPGVTFGIDSLYSFYNNNPSGNKTGLVIDCSHEDTSVVPIVDGAGILTD 208

Query: 178 TRRLDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLDLDTK 231
            +R++  G     +L DL++ +   F     +     + +  CYVS + D D K
Sbjct: 209 AKRINWGGHQAVDYLNDLMALKYPYFPTKMSYLQYETMYQDYCYVSPNYDEDIK 262

 Score = 40.8 bits (94), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 41/149 (27%), Positives = 65/149 (43%), Gaps = 18/149 (12%)

Query: 241 ESYELPDGRTIKVGQERFEAPECLFQPGLVDVEQPGVGEL----LFNTVQSADVDIRSS- 295
           +S  + +   + +  ER   PE +FQP +   +Q G+ EL    L     S    + S+ 
Sbjct: 602 DSENIHEQHQMHLNVERIRVPEVVFQPTMGGQDQAGICELSETILMKKFGSQRGKLSSTS 661

Query: 296 --LYKAIVLSGGSSMYPGLPSRLEKELKQLWFSRVLHNDPSRLDKFKVRIEDPPRRKHMV 353
             +   I+++GG++  PGL  R+ KE  +  F  V  N         V I   P      
Sbjct: 662 LDMVNNILITGGNAKVPGLRERIVKEFTE--FLPVGTN-------VAVNISSNPSLD--A 710

Query: 354 FIGGAVLASIMADKDHMWLSKQEWLESGP 382
           + G A LA   A+     +SK+E+ E GP
Sbjct: 711 WRGMAALARNKAEYKKTVISKEEYEEYGP 739

>KLTH0H09702g Chr8 complement(835255..836700) [1446 bp, 481 aa] {ON}
           similar to uniprot|P80428 Saccharomyces cerevisiae
           YJL081C ARP4 Nuclear actin-related protein involved in
           chromatin remodeling component of chromatin-remodeling
           enzyme complexes
          Length = 481

 Score = 70.5 bits (171), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 50/198 (25%), Positives = 83/198 (41%), Gaps = 7/198 (3%)

Query: 2   DPHNPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASVTTPLKDIMIGDEAS 61
           D  + +V+D G+    IG +G + P    PS  G+     +E          IM      
Sbjct: 12  DEISAVVIDPGSYSTNIGYSGTDSPQLNIPSCYGQYTAGGKEGQKSFNDQFMIM------ 65

Query: 62  DVRSYLQISYPMENGIIKNWTDMELLWDYAFFEQMKLPSTSNGKILLTEPPMNPLKNREK 121
             R   +I   +ENG + +W   +  W +A  +++K  S       LTE   NP +NR+K
Sbjct: 66  -PRPDFEIKRILENGCVVDWEAAQEQWAWAIRDELKFESFKGTPAFLTEAIWNPEENRKK 124

Query: 122 MCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLSHLTRRL 181
             EV+ E  +F   Y+A  A    +A G               + PV + + LS  + R 
Sbjct: 125 SLEVLLEGMEFEACYIAPTATCTSFAMGRPTCLVLDIGHDVASVCPVVDGMTLSKSSTRN 184

Query: 182 DVAGRDVTRHLIDLLSRR 199
            +AG+ + + + + L  R
Sbjct: 185 FLAGKLLNKLIENHLKPR 202

 Score = 53.9 bits (128), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 34/115 (29%), Positives = 59/115 (51%), Gaps = 16/115 (13%)

Query: 276 GVGELLFNTVQSADVDIRSSLYKAIVLSGGSSMYPGLPSRLEKELKQLWFSRVLHNDPSR 335
           G+ +L+   + + DVD+R++L   +V++GGSS  PGL  RL  EL +            +
Sbjct: 376 GLADLVNTAITATDVDLRATLAHNLVVTGGSSSIPGLTDRLMTELNK------------K 423

Query: 336 LDKFKVRIEDPPR---RKHMVFIGGAVLASIMADKDHMWLSKQEWLESGPASMAK 387
           L   K RI        R+   ++GG++L+S +     +W+ +QE+ E G   + K
Sbjct: 424 LPALKFRILTSGHLRERQSRAWLGGSILSS-LGTFHQLWVGRQEYEEVGAERLLK 477

>KLLA0D02288g Chr4 complement(194724..196286) [1563 bp, 520 aa] {ON}
           similar to uniprot|P80428 Saccharomyces cerevisiae
           YJL081C ARP4 Nuclear actin-related protein involved in
           chromatin remodeling component of chromatin-remodeling
           enzyme complexes
          Length = 520

 Score = 70.1 bits (170), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 54/194 (27%), Positives = 85/194 (43%), Gaps = 13/194 (6%)

Query: 2   DPHNPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASVTTPLKDIMIGDEAS 61
           D  N IV+D G+    IG +G + P    PS  G          +V T      I +E  
Sbjct: 12  DEINAIVIDPGSFVTNIGYSGTDCPQSIMPSSYG----------NVETDGDTKRIFNEQP 61

Query: 62  DV--RSYLQISYPMENGIIKNWTDMELLWDYAFFEQMKLPSTSNGKILLTEPPMNPLKNR 119
            +  R+ ++I   +EN  I +W   +  W+YA    +K  S     +LLTEP  N   +R
Sbjct: 62  LLFPRAGMEIKPIVENSTIVDWDRAQEQWEYALNTDLKFESNKGTPVLLTEPIWNSEASR 121

Query: 120 EKMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLSHLTR 179
           +K  E++ E  +F   Y+A  +    +A G             + + PV + + LS  + 
Sbjct: 122 KKSLEILLESMEFEACYLAANSSAVSFAMGRPTCLVVDIGHDVSTVSPVIDGMTLSKSST 181

Query: 180 RLDVAGRDVTRHLI 193
           R  VAG+ +  HLI
Sbjct: 182 RNYVAGKYLN-HLI 194

 Score = 55.5 bits (132), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 38/119 (31%), Positives = 64/119 (53%), Gaps = 18/119 (15%)

Query: 273 EQPGVGELLFNTVQSADVDIRSSLYKAIVLSGGSSMYPGLPSR----LEKELKQLWFSRV 328
           E  G+ +L+  ++  ADVD+R++L   +VL+GG+S  PGL  R    L K L  L F R+
Sbjct: 412 EVAGIVDLINKSMMEADVDLRATLAHNVVLTGGTSKIPGLSDRIMHELNKSLPALKF-RM 470

Query: 329 LHNDPSRLDKFKVRIEDPPRRKHMVFIGGAVLASIMADKDHMWLSKQEWLESGPASMAK 387
           L +   R             R++  ++GG++LAS +     +W+ ++E+ E GP  + K
Sbjct: 471 LSSGHLR------------ERQYQGWLGGSILAS-LGTFHQLWVGREEYEEVGPERLLK 516

>CAGL0M03201g Chr13 complement(364771..366252) [1482 bp, 493 aa]
           {ON} similar to uniprot|P80428 Saccharomyces cerevisiae
           YJL081c ACT3 protein Actin-like protein ARP4
          Length = 493

 Score = 70.1 bits (170), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 52/203 (25%), Positives = 81/203 (39%), Gaps = 6/203 (2%)

Query: 2   DPHNPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERAS-----VTTPLKDIMI 56
           D    +++D G+    IG AG + P    PS  G  I  AEE  S      T   + +  
Sbjct: 12  DEITAVIIDPGSYTTNIGYAGTDCPQSILPSSFGE-IHEAEESTSEDNTEKTRKTRKVFS 70

Query: 57  GDEASDVRSYLQISYPMENGIIKNWTDMELLWDYAFFEQMKLPSTSNGKILLTEPPMNPL 116
                  R   ++   +ENG + +W      W +A   ++ + S      +LTEP  N  
Sbjct: 71  EQSIPIPRPDYEVKRVVENGQVCDWDSAVEQWSWALRNELHIESNRGIPAMLTEPLWNSK 130

Query: 117 KNREKMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLSH 176
           +NR K  E++ E  +F   Y+   +    +A G               + PV + + LS 
Sbjct: 131 ENRSKSLEILLEGMEFEACYLTATSTAVSFATGRPNSLIVDIGHDIASVTPVIDGMSLSK 190

Query: 177 LTRRLDVAGRDVTRHLIDLLSRR 199
            TR    AGR + + L D L  R
Sbjct: 191 STRCNHFAGRFLNKLLTDYLKPR 213

 Score = 59.7 bits (143), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 39/112 (34%), Positives = 64/112 (57%), Gaps = 16/112 (14%)

Query: 273 EQPGVGELLFNTVQSADVDIRSSLYKAIVLSGGSSMYPGLPSRLEKELKQLWFS---RVL 329
           E PG+ +L+ +++ S DVDIR+SL   +V++GGSS  PGL  R+  EL   + +   RVL
Sbjct: 385 ELPGIVDLISSSISSCDVDIRASLAHNLVITGGSSTIPGLSDRILNELNMKFPALKFRVL 444

Query: 330 HNDPSRLDKFKVRIEDPPRRKHMVFIGGAVLASIMADKDHMWLSKQEWLESG 381
               S        IE    R++  ++GG++L+S +     +W+ K+E+ E G
Sbjct: 445 ATGQS--------IE----RQYQSWLGGSILSS-LGTFHQLWIGKKEYEEVG 483

>TDEL0D01550 Chr4 complement(305973..307415) [1443 bp, 480 aa] {ON}
           Anc_1.287 YJL081C
          Length = 480

 Score = 69.7 bits (169), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 69/292 (23%), Positives = 110/292 (37%), Gaps = 42/292 (14%)

Query: 7   IVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASVTTPLKDIMIGDEASDVRSY 66
           +V+D G+    IG +G + P    PS  G      E+ A      K I         R  
Sbjct: 17  VVIDPGSFSTNIGFSGTDCPQAILPSCYGEQKAETEDNAP-----KKIFAEQSIGIPRPD 71

Query: 67  LQISYPMENGIIKNWTDMELLWDYAFFEQMKLPSTSNGKILLTEPPMNPLKNREKMCEVM 126
            +I   ++N ++ +W   E  W +A  + + L S S    LLTEP  N L+N+ K  E++
Sbjct: 72  YEIKPIVQNSMVVDWDAAEEQWSWALKDILYLNSNSGIPALLTEPIWNTLENKTKSLEIL 131

Query: 127 FEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLSHLTRRLDVAGR 186
            E   F   Y++       +A G             T + PV + + LS  T R  +AG 
Sbjct: 132 LESLQFEACYLSSTPTCVSFASGRPNCLVVDLGHDTTSVSPVVDGMTLSKSTMRNFLAGN 191

Query: 187 DVTR------------HLIDLLSRRGYAFNRTADFET-------------VRQIKEKLCY 221
            +               L ++  R+     +T D++              +++ KE LC 
Sbjct: 192 CINELIKKPLKGKDLVPLFEIAQRKPEFKKKTFDYQIHPSLYNYANSRGFLQECKETLCQ 251

Query: 222 VS------YDLDLDTKLARETTALVESYELPDGRTIKVGQERFEAPECLFQP 267
           V+       D  L++   R   A      + D +T      RF   E LF P
Sbjct: 252 VAPSPLDKMDSQLESMAKRSIEAPWAEELVFDNKT------RFGFAEQLFAP 297

 Score = 57.8 bits (138), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 35/110 (31%), Positives = 58/110 (52%), Gaps = 16/110 (14%)

Query: 276 GVGELLFNTVQSADVDIRSSLYKAIVLSGGSSMYPGLPSRLEKELKQLWFSRVLHNDPSR 335
           G  +L+  ++ ++DVD+R++L   IVL+GG+S  PG   RL  EL +            +
Sbjct: 375 GAADLVNASILASDVDLRATLAHNIVLTGGTSSIPGFSDRLMSELNK------------K 422

Query: 336 LDKFKVRIEDPPR---RKHMVFIGGAVLASIMADKDHMWLSKQEWLESGP 382
           L   K RI        R++  ++GG++L S +     +W+ KQE+ E GP
Sbjct: 423 LPALKFRILTTGHLRERQYQAWLGGSILTS-LGSFHQLWVGKQEYEEVGP 471

>TPHA0I01030 Chr9 complement(236150..237661) [1512 bp, 503 aa] {ON}
           Anc_1.287 YJL081C
          Length = 503

 Score = 68.9 bits (167), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 61/263 (23%), Positives = 104/263 (39%), Gaps = 40/263 (15%)

Query: 7   IVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASVTTPLKDIMIGDE-ASDVR- 64
           +V+D G+    IG +G ++P    PS  G      +++A    P +      E AS ++ 
Sbjct: 17  VVIDPGSFTTNIGFSGSDYPQSILPSCYGAITEIEDQQADHNKPDESAANNTENASKIKI 76

Query: 65  ----SYLQISYP---------MENGIIKNWTDMELLWDYAFFEQMKLPSTSNGKILLTEP 111
               +   + YP         ++NG + +W   +  W +A   ++ L S      LLTEP
Sbjct: 77  RKVFNEQSVGYPRANYEIKPIVQNGEVVDWDAAQEQWSWALENELFLKSNEGVPALLTEP 136

Query: 112 PMNPLKNREKMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYES 171
             N ++NR+K  EV+ E   F   Y++       +A G               + PV + 
Sbjct: 137 IWNTVENRKKSLEVLLEGMGFEACYLSATPTCVSFAAGRSNCLVVDIGHDIISVSPVVDG 196

Query: 172 VVLSHLTRRLDVAGRDVTRHLIDLL------------SRRGYAFNRTADFE--------- 210
           +  S  TRR  ++G+ +   + D L             R+     +T DF          
Sbjct: 197 MTFSKSTRRNVISGKYLNVLINDFLKPREIVPLFEIKQRKPTLVKKTFDFPIHDSLKTYA 256

Query: 211 ----TVRQIKEKLCYVSYDLDLD 229
                 ++IKE LC VS +  L+
Sbjct: 257 NDRGIYQEIKEALCRVSPNSSLE 279

 Score = 65.1 bits (157), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 40/111 (36%), Positives = 64/111 (57%), Gaps = 18/111 (16%)

Query: 275 PGVGELLFNTVQSADVDIRSSLYKAIVLSGGSSMYPGLPSR----LEKELKQLWFSRVLH 330
           PG+ +L+ +++ +ADVD+R+SL   +VL+GG+S  PGL  R    L K L  L F RVL 
Sbjct: 397 PGIVDLIESSINAADVDLRTSLAHNVVLTGGTSCIPGLSDRILLELNKRLPALKF-RVLA 455

Query: 331 NDPSRLDKFKVRIEDPPRRKHMVFIGGAVLASIMADKDHMWLSKQEWLESG 381
           N  +R             R++  ++GG++L+S +     +W+ KQE+ E G
Sbjct: 456 NGQTR------------ERQYQSWLGGSILSS-LGTFHQLWVGKQEYEEIG 493

>TBLA0D05360 Chr4 (1321243..1323033) [1791 bp, 596 aa] {ON}
           Anc_1.287 YJL081C
          Length = 596

 Score = 68.9 bits (167), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 62/237 (26%), Positives = 97/237 (40%), Gaps = 29/237 (12%)

Query: 64  RSYLQISYPMENGIIKNWTDMELLWDYAFFEQMKLPSTSNGKILLTEPPMNPLKNREKMC 123
           RS  Q+   +ENG++ +W   E  W +A  E++ + S      LLTEP  N ++NR+K  
Sbjct: 156 RSDYQVKRIIENGMVADWDIAEEQWSWALREKLYMDSFKGIPALLTEPVWNTVQNRKKSL 215

Query: 124 EVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLSHLTRRLDV 183
           EV+ EK +F   Y+        +A G               + PV + + L+   RR   
Sbjct: 216 EVLLEKMEFEACYLTTIPTNVSFAAGKPNCLVVDVGHDTCSVSPVIDGMTLTKSVRRNFF 275

Query: 184 AGRDVTRHLIDLL------------------SRRGYAFN-------RTADFETVRQIKEK 218
           AGR + R L + +                   R+ + FN          D +  ++ KE 
Sbjct: 276 AGRYLNRLLENYIKPREIIPLFMVEKRRPEFKRKIFDFNIDPSVISYANDHQFFQECKET 335

Query: 219 LC--YVSYDLDLDTKLARETTALVESYELPDGRTIKVGQ-ERFEAPECLFQPGLVDV 272
           LC  Y +     + K   E++A   S E P G  I+     RF   E LF P   ++
Sbjct: 336 LCQIYPNNSFLANVKDELESSA-KRSIEAPWGEKIEFDNMTRFGFAEELFNPNESNI 391

 Score = 66.6 bits (161), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 39/116 (33%), Positives = 64/116 (55%), Gaps = 16/116 (13%)

Query: 275 PGVGELLFNTVQSADVDIRSSLYKAIVLSGGSSMYPGLPSRLEKELKQLWFSRVLHNDPS 334
           PG+ +L+  TV S+DVD+R++L   ++L+GG+S+ PGL  RL  EL +            
Sbjct: 490 PGIADLVEATVNSSDVDLRATLAHNVILTGGTSLIPGLADRLMYELNK------------ 537

Query: 335 RLDKFKVRIEDPPR---RKHMVFIGGAVLASIMADKDHMWLSKQEWLESGPASMAK 387
           +L   K RI        RK+  ++GG++L S +     +W+ K+E+ E GP  + K
Sbjct: 538 KLPALKFRILSSGHRRERKYQAWLGGSILTS-LGTFHQLWVGKREYEEVGPDRLLK 592

>Smik_12.144 Chr12 complement(280513..281829) [1317 bp, 438 aa] {ON}
           YLR085C (REAL)
          Length = 438

 Score = 67.8 bits (164), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 82/390 (21%), Positives = 140/390 (35%), Gaps = 92/390 (23%)

Query: 6   PIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPI--LRAEERASVTTPLKDIMIGDEASDV 63
           PIV+D G+  +K G           PS   +P   L A  +    T      + +   ++
Sbjct: 5   PIVIDNGSYEIKFG-----------PSTNEKPFRALNALAKDKFGTS----YLSNHIKNI 49

Query: 64  RSYLQISY--PMENGIIKNWTDMELLWDYAFFEQMK-----LPSTSNGKILLTEPPMNPL 116
           +    +++  P E G +  W     +WDY FF  ++     L       ++ +E  M   
Sbjct: 50  KDISSVTFRRPHELGQLTLWELESCIWDYCFFNPIEFDGFDLKEGKGHHLVASESCMTLP 109

Query: 117 KNREKMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXX---------------- 160
           +  +   +V+FE+Y+F  ++ +  A    + +                            
Sbjct: 110 ELSKHADQVIFEEYEFDSLFKSPVAAFVPFTKSYKSKMKAISGKDEDADIVVSKSNEADM 169

Query: 161 --------------------------XXTHIVPVYESVVLSHLTRRLDVAGRDVTRHLID 194
                                       T I+PV + +      ++LDV GR +T  L +
Sbjct: 170 PSNNPRDTQKFDSDYHDFQLVIDSGFNCTWIIPVLKGIPYYKAVKKLDVGGRFLTGLLKE 229

Query: 195 LLSRRGYAFNRTADFETVRQIKEKLCYVSYDLDLDTKLARETTALVESYELPD------- 247
            LS R Y  N   +   V  IKEK  +VS     D+   ++  AL   Y LPD       
Sbjct: 230 TLSFRHY--NMMDETILVNNIKEKCLFVSPVSYFDSFKVKDKHAL--EYVLPDFQTSFLG 285

Query: 248 ---------------GRTIKVGQERFEAPECLFQPGLVDVEQPGVGELLFNTVQSADVDI 292
                           +TI +  E F  PE  F P +  + +PG+ E +  ++      +
Sbjct: 286 YVRNRRKENSPLAEDAQTITLTDELFTIPETFFHPEIAQITKPGIVEAILESLSMLPEIV 345

Query: 293 RSSLYKAIVLSGGSSMYPGLPSRLEKELKQ 322
           R  +   IV +GG+   P    RL  EL++
Sbjct: 346 RPLMVGNIVCTGGNFNLPNFAQRLAAELQR 375

>Smik_14.267 Chr14 complement(493008..495275) [2268 bp, 755 aa] {ON}
           YNL059C (REAL)
          Length = 755

 Score = 68.2 bits (165), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 58/241 (24%), Positives = 102/241 (42%), Gaps = 12/241 (4%)

Query: 2   DPHNPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASVTTPLKDIMIGDEAS 61
           DP  PI +D G+  ++ G   ++ P + FP+++ +   R  +     T + +  + D+A 
Sbjct: 35  DPQLPIAIDFGSSKLRAGFVNQSAPTHVFPNVLTK--FRDRKLNKNFTFVGNDTLLDQA- 91

Query: 62  DVRSYLQISYPMENGIIKNWTDMELLWDYAFFEQMKLPSTS-NGKILLTEPPMNPLKNRE 120
            VRS  Q   P +   + NW   E + DY F     +P    +  ILLTE        R 
Sbjct: 92  -VRS--QSKSPFDGPFVTNWNFTEEILDYTFHHLGIVPENGISNPILLTERMATVQSQRA 148

Query: 121 KMCEVMFEKYDFGGVYVAIQAVLALYA---QGLXXXXXXXXXXXXTHIVPVYESVVLSHL 177
              +++FE Y+  GV   I ++   Y     G             T+++P+ +   +   
Sbjct: 149 NWYQILFETYNVPGVTFGIDSLYGFYNYYPSGKQTGLVIDCGHEDTNVIPIVDGAGILTD 208

Query: 178 TRRLDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVS--YDLDLDTKLARE 235
            +R++  G     +L DL++ +   F     +     + +  CYVS  YD D+D  L  E
Sbjct: 209 AKRINWGGHQAVDYLNDLMALKYPYFPTKMSYLQYETMYQDYCYVSRNYDEDVDKILTLE 268

Query: 236 T 236
            
Sbjct: 269 N 269

 Score = 36.6 bits (83), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 36/154 (23%), Positives = 62/154 (40%), Gaps = 28/154 (18%)

Query: 241 ESYELPDGRTIKVGQERFEAPECLFQPGLVDVEQPGVGELL-------FNTVQSADVDIR 293
           +S  + +   + +  ER   PE +FQP +   +Q G+ EL        F +         
Sbjct: 602 DSENIHEQHQMHLNVERTRVPEIVFQPTMGGQDQAGICELAETILLKKFGSQPGKLSQTS 661

Query: 294 SSLYKAIVLSGGSSMYPGLPSRLEKELKQLW-----FSRVLHNDPSRLDKFKVRIEDPPR 348
             +   + ++GG++  PGL  R+ KE           +  + +DPS LD +K        
Sbjct: 662 IDMANNVFITGGNAKVPGLKERIVKEFTGFLPVGTNININMSSDPS-LDAWK-------- 712

Query: 349 RKHMVFIGGAVLASIMADKDHMWLSKQEWLESGP 382
                  G A LA    +     +S++E+ E GP
Sbjct: 713 -------GMAALAQNEEEYKRTIISRKEYEEYGP 739

>KNAG0G02010 Chr7 complement(447621..448895) [1275 bp, 424 aa] {ON}
           Anc_8.258 YLR085C
          Length = 424

 Score = 67.4 bits (163), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 85/383 (22%), Positives = 142/383 (37%), Gaps = 75/383 (19%)

Query: 6   PIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASVTTPLKDIMIGDEASDVRS 65
           P V+D G+  +K G A    P +   + + +    A   ++    ++DI          S
Sbjct: 3   PFVIDNGSYEIKFGHANLVTP-FRANNGIAKDKYGASYLSNHMKTIRDI----------S 51

Query: 66  YLQISYPMENGIIKNWTDMELLWDYAFFEQMKLP------STSNGKILLTEPPMNPLKNR 119
              I  P E G + +W     +WDY  +   +        +T    ++LTE      +  
Sbjct: 52  SATIRRPHELGQLVSWELEGCIWDYCLYNPDEFDGFHLGDNTREQDLILTETCFTLPELS 111

Query: 120 EKMCEVMFEKYDFGGVY----------------------------VAIQAVLALYAQGLX 151
           +   +V+FE+Y+F  ++                            V      A   +   
Sbjct: 112 KNSDQVVFEEYEFATMFKSPASGFMPFANLIGNKNMEHLCGKDTAVNTDYTTATTKEYRD 171

Query: 152 XXXXXXXXXXXTHIVPVYESVVLSHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRTADFET 211
                      T +VP+ + V      +++D+ GR +   L + LS R Y  N   +   
Sbjct: 172 FQLVIDSGFNCTWVVPIIKGVPFYKAIKKMDIGGRFLNGLLKETLSFRHY--NMMDETIL 229

Query: 212 VRQIKEKLCYVSYDLDLDTKLARETTALVESYELPDGRT--------------------- 250
           +  IKEK  +VS     D+   ++  A+   Y LPD +T                     
Sbjct: 230 LNNIKEKCLFVSPVSYFDSFKTKQQQAV--EYVLPDFQTSFLGYLVDESNRKGIDRGSVQ 287

Query: 251 -IKVGQERFEAPECLFQPGLVDVEQPGVGELLFNTVQSADVDIRSSLYKAIVLSGGSSMY 309
            I +  ERF  PE  F P + ++ +PG+ E +   +      +R  L   IV  GG+   
Sbjct: 288 TITLTDERFAVPETFFHPEMANILKPGLVETILEAISMVPEPLRPILVSNIVCVGGNFKL 347

Query: 310 PGLPSRLEKEL-KQL---WFSRV 328
           P + SRL  EL +QL   W  RV
Sbjct: 348 PHMSSRLTSELQRQLPTDWTCRV 370

>ZYRO0G21428g Chr7 (1766725..1768176) [1452 bp, 483 aa] {ON} highly
           similar to uniprot|P80428 Saccharomyces cerevisiae
           YJL081C ARP4 Nuclear actin-related protein involved in
           chromatin remodeling component of chromatin- remodeling
           enzyme complexes
          Length = 483

 Score = 67.4 bits (163), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 46/193 (23%), Positives = 76/193 (39%)

Query: 7   IVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASVTTPLKDIMIGDEASDVRSY 66
           +V+D G+    IG +G + P    PS  G                  +      +  R  
Sbjct: 17  VVIDPGSFTTNIGYSGTDCPQAILPSCYGHHKTNENADGDDEKSKPKVFAEQSLTFPRPD 76

Query: 67  LQISYPMENGIIKNWTDMELLWDYAFFEQMKLPSTSNGKILLTEPPMNPLKNREKMCEVM 126
            +I   +ENG++ +W   +  WD+A    + L S      L+TE   N ++N+ K  EV+
Sbjct: 77  YEIKPIVENGLVVDWDAAQEQWDWALRNVLHLESNKGVPALMTESIWNTMENKTKSLEVL 136

Query: 127 FEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLSHLTRRLDVAGR 186
            E  DF   Y++       +A G                 PV + + LS  TRR  ++G+
Sbjct: 137 LETLDFEACYISSTPTCVSFATGRPNCLVVDVGHDTASSSPVVDGMTLSRSTRRNFISGK 196

Query: 187 DVTRHLIDLLSRR 199
            V + +   L  R
Sbjct: 197 FVDQLIGKYLQPR 209

 Score = 60.8 bits (146), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 42/147 (28%), Positives = 72/147 (48%), Gaps = 22/147 (14%)

Query: 244 ELPDGRTIKVGQERFEAPECLFQPGLVDVEQ------PGVGELLFNTVQSADVDIRSSLY 297
           E P+G     G+++    E   + G   +E        G+ +L+ +++ SADVD+R++L 
Sbjct: 340 EKPNGEETPSGEDQASTSETTNEHGKRPMEDSESSELAGISDLVHSSITSADVDLRATLA 399

Query: 298 KAIVLSGGSSMYPGLPSRLEKELKQLWFSRVLHNDPSRLDKFKVRIEDPPR---RKHMVF 354
             IVL+GGSS  PG   RL  EL +            +L   K R+        R++  +
Sbjct: 400 HNIVLTGGSSSVPGFSDRLMNELTK------------KLPALKFRVLTTGHLRERQYQSW 447

Query: 355 IGGAVLASIMADKDHMWLSKQEWLESG 381
           +GG++L S +     +W+ K+E+ E G
Sbjct: 448 LGGSILTS-LGSFHQLWVGKREYEEVG 473

>CAGL0L12166g Chr12 complement(1308681..1309946) [1266 bp, 421 aa]
           {ON} similar to uniprot|Q12509 Saccharomyces cerevisiae
           YLR085c Actin-related protein
          Length = 421

 Score = 67.0 bits (162), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 81/373 (21%), Positives = 140/373 (37%), Gaps = 66/373 (17%)

Query: 1   MDPHNPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASVTTPLKDIMIGDEA 60
           M     IV+D G+  VK G A E  P     ++       A+++  VT       + ++ 
Sbjct: 1   MTADQAIVIDNGSYQVKFGLASEVRPRVALNAL-------AKDKYGVT------HLSNQV 47

Query: 61  SDVRSYLQISY--PMENGIIKNWTDMELLWDYAFFE----QMKLPSTSNGKILLTEPPMN 114
            +++    + +  P E G + +W     +WDY  +      +   S  N  ++L+E  M 
Sbjct: 48  QNIKDISSVVFRRPHELGQLTSWELESCIWDYCLYNPDEFGIDWQSLENRHVVLSETCMT 107

Query: 115 PLKNREKMCEVMFEKYDFGGVYVA-IQAVLALYAQGLXXXXXXXXX-------------- 159
             +  +   +V+FE+Y+   +Y A   A +  Y                           
Sbjct: 108 LPELSKNTDQVLFEEYEVDSLYKAPTAAYIPFYTTNENIKTISGKSDHGELDIEEKIEAG 167

Query: 160 -------------XXXTHIVPVYESVVLSHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRT 206
                           T ++P+ + V      ++LDV GR +   L + +S R Y  N  
Sbjct: 168 KEYNDFSLVIDSGFNCTWVIPIVKGVPYYKAVKKLDVGGRFLNGLLKETISFRHY--NVM 225

Query: 207 ADFETVRQIKEKLCYV---SYDLDLDTKLARETTALVESYE-------------LPDGRT 250
            +   V  IKE+  YV   SY      K   +   ++  ++             LPD   
Sbjct: 226 DESILVNNIKEQCLYVDPVSYFEAFKAKGKNKIDFVLPDFQTSFQGYVRDPKTALPDNAQ 285

Query: 251 I-KVGQERFEAPECLFQPGLVDVEQPGVGELLFNTVQSADVDIRSSLYKAIVLSGGSSMY 309
           I  +  ERF  PE  F P +    +PG+ E +  ++      +R  +   IV  GG+   
Sbjct: 286 ILTLTDERFSVPEAFFHPEISQSLKPGIIETVLESIYMLPELLRPLMASNIVCMGGNFNL 345

Query: 310 PGLPSRLEKELKQ 322
           PG   RL  EL++
Sbjct: 346 PGFTDRLVSELQR 358

>NCAS0B04990 Chr2 complement(916170..917432) [1263 bp, 420 aa] {ON}
           Anc_8.258 YLR085C
          Length = 420

 Score = 66.6 bits (161), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 87/382 (22%), Positives = 143/382 (37%), Gaps = 76/382 (19%)

Query: 5   NPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASVTTPLKDIMIGDEASDVR 64
           +PI +D G+  +K G    + P         R I      A          + ++  +++
Sbjct: 4   SPIAIDNGSYEIKFGTTDLSSP--------YRAI-----NAFAIDKYHTTYLSNQIKNIK 50

Query: 65  SYLQISY--PMENGIIKNWTDMELLWDYAFFEQMKLPSTS----NGKILL-TEPPMNPLK 117
               +++  P E G + +W     +WDYA F   + P        GK L+ +E  M   +
Sbjct: 51  DITSVTFRRPHELGQLTSWELESSIWDYALFNPDEFPGFDLNDLKGKHLIASETCMTLPE 110

Query: 118 NREKMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXX----------------- 160
             + M +V+FE+Y+F   Y +  A    +A                              
Sbjct: 111 LSKNMDQVVFEEYEFDSYYKSSIAGFIQFADDKNTKIISGKTEEDISLDSVNQVREKEYN 170

Query: 161 ----------XXTHIVPVYESVVLSHLTRRLDVAGRDVTRHLIDLLSRRGY-AFNRTADF 209
                       T I+PV + V      ++LD+ GR +   L + LS R Y   + T   
Sbjct: 171 DYQLVIDSGFNCTWIIPVIKGVPYYKAVKKLDIGGRFLDGLLKETLSFRHYDVMDETI-- 228

Query: 210 ETVRQIKEKLCYVSYDLDLDTKLARETTALVESYELPD-------------------GRT 250
             V  IKE   +VS     D+   +  TA+   Y LP+                    +T
Sbjct: 229 -LVNNIKENCLFVSPTSYFDSFKNKNETAV--EYVLPNFQTTFLGHVRDKTKPLPENTQT 285

Query: 251 IKVGQERFEAPECLFQPGLVDVEQPGVGELLFNTVQSADVDIRSSLYKAIVLSGGSSMYP 310
           IK+  E F  PE  F P +  + +PG+ E +  ++      +R  L   +V +GG+   P
Sbjct: 286 IKLYDELFSVPETFFHPEIARILKPGLVETILESLSMVPELLRPLLVGNLVCTGGNFNLP 345

Query: 311 GLPSRLEKEL-KQL---WFSRV 328
              +RL  EL +QL   W  R 
Sbjct: 346 HFATRLTSELQRQLPTDWICRT 367

>NDAI0B01960 Chr2 complement(477552..478871) [1320 bp, 439 aa] {ON}
           Anc_8.258 YLR085C
          Length = 439

 Score = 65.5 bits (158), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 63/243 (25%), Positives = 103/243 (42%), Gaps = 31/243 (12%)

Query: 163 THIVPVYESVVLSHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYV 222
           T I+P+ + V      ++LD+ GR +T  L + LS R Y  +   +   V  IKEK  +V
Sbjct: 201 TWIIPMIKGVPYYKAIKKLDIGGRFLTGLLKETLSFRHY--DLMDETLLVNNIKEKCLFV 258

Query: 223 SYDLDLDTKLARETTAL-----------------VESYELPDG-RTIKVGQERFEAPECL 264
           S     D+  A+E T++                  +S  LP+G + +K+  E F  PE  
Sbjct: 259 SPTSYFDSFKAKEETSVEYILPDISSSYLGYTRENKSKPLPEGSQVVKLYDELFSVPETF 318

Query: 265 FQPGLVDVEQPGVGELLFNTVQSADVDIRSSLYKAIVLSGGSSMYPGLPSRLEKELKQLW 324
           F P +  + +PG+ E +  ++      +R  L   IV +GG+   P   +RL  EL+   
Sbjct: 319 FHPEISRILKPGIVETILESLSMIPEILRPLLVANIVCTGGNFNLPHFAARLAAELQ--- 375

Query: 325 FSRVLHNDPSRLDKFKVRIEDPPRRKHMVFIGGAVLASIMADKDHMWLSKQEWLESGPAS 384
             R L  D      +  RI  P +   +         +         +SK+E+ E GP  
Sbjct: 376 --RQLPTD------WTCRISVPKKECELFSWKSMCQFANTDSYKKTRISKEEYYEHGPDW 427

Query: 385 MAK 387
           + K
Sbjct: 428 LTK 430

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 35/141 (24%), Positives = 67/141 (47%), Gaps = 16/141 (11%)

Query: 6   PIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASVTTPLKDIMIGDEASDVRS 65
           P+VLD G+  +K G +    P   + ++ G  + +    A ++  +K I    E S+V  
Sbjct: 5   PLVLDNGSYEIKFGLSNSERP---YRALNGFAVDKYGS-AYLSNQMKKIQ---EVSEV-- 55

Query: 66  YLQISYPMENGIIKNWTDMELLWDYAF-----FEQMKLPSTSNGKILLTEPPMNPLKNRE 120
              +  P E G + +W     +WDY       F+  +L  +    ++++EP M   +  +
Sbjct: 56  --TLRRPHELGQLTSWELESCIWDYCLYNPDEFDGFELGGSGKKHLIVSEPCMTLPELSK 113

Query: 121 KMCEVMFEKYDFGGVYVAIQA 141
            M +V+FE+Y+F  ++ A  A
Sbjct: 114 NMDQVIFEEYEFDSLFKAPTA 134

>KLTH0G09482g Chr7 complement(789233..791470) [2238 bp, 745 aa] {ON}
           similar to uniprot|P53946 Saccharomyces cerevisiae
           YNL059C ARP5 Nuclear actin-related protein involved in
           chromatin remodeling component of chromatin-remodeling
           enzyme complexes
          Length = 745

 Score = 64.3 bits (155), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 53/228 (23%), Positives = 93/228 (40%), Gaps = 11/228 (4%)

Query: 2   DPHNPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASVTTPLKDIMIGDEAS 61
           DP+ PI +D G+  V+ G   ++ P + F + + R   R + R           IG++ +
Sbjct: 34  DPNVPIAIDFGSSEVRAGFGNQDQPSHIFTNRISRWRDRRKNRNLT-------FIGNDTN 86

Query: 62  -DVRSYLQISYPMENGIIKNWTDMELLWDYAFFE-QMKLPSTSNGKILLTEPPMNPLKNR 119
            D+    Q   P +  I+ NW   E + +Y F    +      +  IL+TE        R
Sbjct: 87  LDLSVRSQAKSPYDGAIVSNWDYTEEIMEYTFHHLGVNGNDGVSNPILMTEKLATLQSQR 146

Query: 120 EKMCEVMFEKYDFGGVYVAIQAVLALYAQ--GLXXXXXXXXXXXXTHIVPVYESVVLSHL 177
           E   +++FE +    V   I ++ + YA                 TH++PV     +   
Sbjct: 147 ENWYQLLFECFGVPQVTFGIDSLFSFYANNDATASGLVINSGNEDTHVIPVMNGKGVLSE 206

Query: 178 TRRLDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYD 225
            +R++  GR    +L +LL+ +   F         + + E  CYVS D
Sbjct: 207 AKRINWGGRQSVEYLSNLLALKYPYFPIKPSTHQFQSLYEDFCYVSVD 254

 Score = 39.7 bits (91), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 22/87 (25%), Positives = 41/87 (47%), Gaps = 7/87 (8%)

Query: 241 ESYELPDGRTIKVGQERFEAPECLFQPGLVDVEQPGVGELL-------FNTVQSADVDIR 293
           +S  + +   + +  ER   PE +FQP +  ++Q GV E+        F + +S   +  
Sbjct: 594 DSENINEQHQMHLNVERIRVPEVIFQPSMAGLDQAGVTEICETNFLKKFGSTRSQLSEGS 653

Query: 294 SSLYKAIVLSGGSSMYPGLPSRLEKEL 320
             L   + L+GG+   PG+  R+ +E 
Sbjct: 654 KKLAANVFLTGGNMRLPGVRERIVREF 680

>Kwal_14.2377 s14 complement(733179..734624) [1446 bp, 481 aa] {ON}
           YJL081C (ARP4) - 54.8 kDa actin-related protein [contig
           225] FULL
          Length = 481

 Score = 63.9 bits (154), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 46/185 (24%), Positives = 77/185 (41%), Gaps = 7/185 (3%)

Query: 2   DPHNPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASVTTPLKDIMIGDEAS 61
           D  + +V+D G+    IG +G + P    PS  G+     +E         D  +G    
Sbjct: 12  DEISAVVIDPGSYSTNIGYSGTDSPQINIPSSYGQYTGGEKEGKK---SFNDQFMGM--- 65

Query: 62  DVRSYLQISYPMENGIIKNWTDMELLWDYAFFEQMKLPSTSNGKILLTEPPMNPLKNREK 121
             R   +I   +E+G + +W   +  W +A  +++K  S       LTE   N  +NR+K
Sbjct: 66  -ARPDFEIKRILEDGCVVDWEAAQEQWTWAIRDELKFGSFKGTPAFLTEAIWNSEENRKK 124

Query: 122 MCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLSHLTRRL 181
             EV+ E  +F   Y+A  A    +A G               + PV + + LS  + R 
Sbjct: 125 SLEVLLEGMEFEACYIAPTATCVSFAMGRPTCLVVDIGHDVASVCPVVDGMTLSKSSTRN 184

Query: 182 DVAGR 186
            +AG+
Sbjct: 185 FLAGK 189

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 33/115 (28%), Positives = 56/115 (48%), Gaps = 16/115 (13%)

Query: 276 GVGELLFNTVQSADVDIRSSLYKAIVLSGGSSMYPGLPSRLEKELKQLWFSRVLHNDPSR 335
           G+  L+   +   DVD+R++L   +V++GGSS   GL  RL  EL +            +
Sbjct: 376 GLANLVNTAIMETDVDLRATLAHNLVVTGGSSSILGLADRLMTELNK------------K 423

Query: 336 LDKFKVRIEDPPR---RKHMVFIGGAVLASIMADKDHMWLSKQEWLESGPASMAK 387
           L   K RI        R+   ++GG++L+S +     +W+ +QE+ E G   + K
Sbjct: 424 LPALKFRILTSGHLRERQSRAWLGGSILSS-LGTFHQLWVGRQEYEEVGAERLLK 477

>Skud_12.153 Chr12 complement(284046..285362) [1317 bp, 438 aa] {ON}
           YLR085C (REAL)
          Length = 438

 Score = 63.5 bits (153), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 50/182 (27%), Positives = 79/182 (43%), Gaps = 26/182 (14%)

Query: 163 THIVPVYESVVLSHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYV 222
           T I+PV + +      ++LD+ GR +T  L + LS R Y  N   +   V  +KEK  +V
Sbjct: 198 TWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLSFRHY--NMMDETILVNNVKEKCLFV 255

Query: 223 SYDLDLDTKLARETTALVESYELPD----------------------GRTIKVGQERFEA 260
           S     D+  A++  AL   Y LPD                       +TI +  E F  
Sbjct: 256 SPVSYFDSFKAKDKHAL--EYVLPDFQTSFIGYVRNPREENSPLPEDAQTIALTDELFTI 313

Query: 261 PECLFQPGLVDVEQPGVGELLFNTVQSADVDIRSSLYKAIVLSGGSSMYPGLPSRLEKEL 320
           PE  F P +  + +PG+ E +  ++      +R  +   IV +GG+   P    RL  EL
Sbjct: 314 PETFFHPEISQITKPGIVEAILESLSMLPEIVRPLMVGNIVCTGGNFNLPNFAQRLAAEL 373

Query: 321 KQ 322
           ++
Sbjct: 374 QR 375

>SAKL0D05874g Chr4 complement(479873..481366) [1494 bp, 497 aa] {ON}
           similar to uniprot|P80428 Saccharomyces cerevisiae
           YJL081C ARP4 Nuclear actin-related protein involved in
           chromatin remodeling component of chromatin-remodeling
           enzyme complexes
          Length = 497

 Score = 63.2 bits (152), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 62/277 (22%), Positives = 107/277 (38%), Gaps = 32/277 (11%)

Query: 7   IVLDQGTGFVKIGRAGENFPDYTFPSIVGRPI-----LRAEERASVTTPLKDIMIGDEAS 61
           +V+D G+    IG +G + P  T PS  G+ I        +E+      LK  +  +++ 
Sbjct: 17  VVIDPGSYTTNIGYSGTDCPQVTLPSRYGQYISEEEEKDEQEQQEDDRKLKQKVFSEQSI 76

Query: 62  DV-RSYLQISYPMENGIIKNWTDMELLWDYAFFEQMKLPSTSNGKILLTEPPMNPLKNRE 120
            + R+  QI   + NG + +W   +  W +A   ++   ST      LTEP  N  +NR+
Sbjct: 77  GLPRNNYQIKPIVRNGSVIDWDSAQEQWSWAIQHELHFESTKGMPAFLTEPIWNTEENRK 136

Query: 121 KMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLSHLTRR 180
           K  EV+ E  +F   +++       +A G               + PV + + LS  +  
Sbjct: 137 KSLEVLLENMEFEACFLSPTPTCVSFAMGRPTCLVVDIGHDVCSVSPVVDGMTLSKSSTS 196

Query: 181 LDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLDLDTKLARETTALV 240
             +AG      L++ L  +     +T     + Q         +D ++D  L        
Sbjct: 197 NFIAG-----SLLNALLSKQLDPKKTVPLFQIAQRHPNFIPKKFDFEVDPSL-------- 243

Query: 241 ESYELPDGRTIKVGQERF---EAPECLFQPGLVDVEQ 274
                      K G ER+   E  E LFQ     +E+
Sbjct: 244 ----------FKFGNERWFFQECKETLFQVAPATLEK 270

 Score = 55.8 bits (133), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 33/118 (27%), Positives = 64/118 (54%), Gaps = 16/118 (13%)

Query: 273 EQPGVGELLFNTVQSADVDIRSSLYKAIVLSGGSSMYPGLPSRLEKELKQLWFSRVLHND 332
           E  G+ +L+++++ + DVD+R++L   +V++GG+S  PGL  R+  EL +          
Sbjct: 389 EIAGLTDLIYSSIMATDVDLRATLAHNVVVTGGTSSIPGLTDRIMAELNK---------- 438

Query: 333 PSRLDKFKVRIEDP---PRRKHMVFIGGAVLASIMADKDHMWLSKQEWLESGPASMAK 387
              L   K R+        R++  ++GG++L+S +     +W+ KQE+ E G + + K
Sbjct: 439 --SLPALKFRMLTSGHLKERQYQSWLGGSILSS-LGTFHQLWVGKQEYEEVGASRLLK 493

>Ecym_6330 Chr6 (632900..634342) [1443 bp, 480 aa] {ON} similar to
           Ashbya gossypii AFR105C
          Length = 480

 Score = 63.2 bits (152), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 50/184 (27%), Positives = 77/184 (41%), Gaps = 8/184 (4%)

Query: 2   DPHNPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASVTTPLKDIMIGDEAS 61
           D    I++D G+    IG +G + P    PS  G+ I   EE+ S+     +  IG    
Sbjct: 12  DEITAIIIDPGSFNTNIGYSGTDCPQAILPSCYGQYI-NDEEKPSL---FNEQSIGLPRK 67

Query: 62  DVRSYLQISYPMENGIIKNWTDMELLWDYAFFEQMKLPSTSNGKILLTEPPMNPLKNREK 121
           D     +I   + +G + +W   +  W++A    +   S      LLTEP  N   NR+K
Sbjct: 68  D----YEIKEIVRSGEVVDWDKAQEQWEWAIKSVLLFESNKGLPALLTEPIWNSEDNRKK 123

Query: 122 MCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLSHLTRRL 181
             EV+ E  DF   Y+   A    +A G             T + PV + + LS  + R 
Sbjct: 124 SLEVLLEGMDFEACYLTPTATAVSFAMGRPTCLVVDIGHDITSVSPVIDGMTLSKSSMRS 183

Query: 182 DVAG 185
            +AG
Sbjct: 184 FIAG 187

 Score = 58.5 bits (140), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 38/119 (31%), Positives = 65/119 (54%), Gaps = 18/119 (15%)

Query: 273 EQPGVGELLFNTVQSADVDIRSSLYKAIVLSGGSSMYPGLPSR----LEKELKQLWFSRV 328
           E  G+ +L+ +++ S DVD+R++L   +V++GGSS  PGL  R    L K L  L F R+
Sbjct: 372 EISGLADLIHSSIMSTDVDLRTTLAHNVVITGGSSSIPGLTDRILAELNKSLPALKF-RM 430

Query: 329 LHNDPSRLDKFKVRIEDPPRRKHMVFIGGAVLASIMADKDHMWLSKQEWLESGPASMAK 387
           L +  +R             +++  ++GG++LAS +     +W+ KQE+ E G   + K
Sbjct: 431 LTSGQAR------------EKQYQSWLGGSILAS-LGTFHQLWVGKQEYAEVGADRLLK 476

>YNL059C Chr14 complement(512668..514935) [2268 bp, 755 aa] {ON}
           ARP5Nuclear actin-related protein involved in chromatin
           remodeling, component of chromatin-remodeling enzyme
           complexes
          Length = 755

 Score = 62.4 bits (150), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 56/234 (23%), Positives = 98/234 (41%), Gaps = 14/234 (5%)

Query: 2   DPHNPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASVTTPLKDIMIGDEAS 61
           +P +PI +D G+  ++ G      P + FP+ + +   R  +     T + +  + D+A 
Sbjct: 35  NPQSPIAIDFGSSKLRAGFVNHATPTHIFPNALTK--FRDRKLNKNFTFVGNDTLLDQA- 91

Query: 62  DVRSYLQISYPMENGIIKNWTDMELLWDYAFFEQMKLPSTSNG---KILLTEPPMNPLKN 118
            VRS  Q   P +   + NW   E + DY F     +P   NG    ILLTE        
Sbjct: 92  -VRS--QSRSPFDGPFVTNWNLTEEILDYTFHHLGVVPD--NGIPNPILLTERLATVQSQ 146

Query: 119 REKMCEVMFEKYDFGGVYVAIQAVLALYA---QGLXXXXXXXXXXXXTHIVPVYESVVLS 175
           R    +++FE Y+  GV   I ++ + Y     G             T+++PV +   + 
Sbjct: 147 RTNWYQILFETYNVPGVTFGIDSLFSFYNYNPSGNKTGLVISCGHEDTNVIPVVDGAGIL 206

Query: 176 HLTRRLDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLDLD 229
              +R++  G     +L DL++ +   F     +     + +  CYVS + D D
Sbjct: 207 TDAKRINWGGHQAVDYLNDLMALKYPYFPTKMSYLQYETMYKDYCYVSRNYDED 260

 Score = 37.7 bits (86), Expect = 0.051,   Method: Compositional matrix adjust.
 Identities = 37/154 (24%), Positives = 62/154 (40%), Gaps = 28/154 (18%)

Query: 241 ESYELPDGRTIKVGQERFEAPECLFQPGLVDVEQPGVGEL-------LFNTVQSADVDIR 293
           +S  + +   + +  ER   PE +FQP +   +Q G+ EL        F +         
Sbjct: 602 DSENIHEQHQMHLNVERIRVPEVIFQPTMGGQDQAGICELSETILLKKFGSQPGKLSQTS 661

Query: 294 SSLYKAIVLSGGSSMYPGLPSRLEKELKQLW-----FSRVLHNDPSRLDKFKVRIEDPPR 348
             +   ++++GG++  PGL  R+ KE           +  + +DPS LD +K        
Sbjct: 662 IDMVNNVLITGGNAKVPGLKERIVKEFTGFLPTGTNITVNMSSDPS-LDAWK-------- 712

Query: 349 RKHMVFIGGAVLASIMADKDHMWLSKQEWLESGP 382
                  G A LA          +SK+E+ E GP
Sbjct: 713 -------GMAALARNEEQYRKTVISKKEYEEYGP 739

>Suva_10.169 Chr10 complement(305734..307050) [1317 bp, 438 aa] {ON}
           YLR085C (REAL)
          Length = 438

 Score = 60.8 bits (146), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 49/182 (26%), Positives = 78/182 (42%), Gaps = 26/182 (14%)

Query: 163 THIVPVYESVVLSHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYV 222
           T I+PV + +      ++LD+ GR +T  L + LS R Y  N   +   V  IKEK  +V
Sbjct: 198 TWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLSFRHY--NMMDETILVNNIKEKCLFV 255

Query: 223 SYDLDLDTKLARETTALVESYELPDGRTIKVG----------------------QERFEA 260
           S     D+  ++    L   Y LPD +T  +G                       E F  
Sbjct: 256 SPTSYFDSFKSKNKHVL--EYVLPDFQTSFIGYVRHPNEEDSPLPTDAQSITLTDELFTI 313

Query: 261 PECLFQPGLVDVEQPGVGELLFNTVQSADVDIRSSLYKAIVLSGGSSMYPGLPSRLEKEL 320
           PE  F P +  + +PG+ E +  ++      +R  +   IV +GG+   P    RL +EL
Sbjct: 314 PETFFHPEISQIIKPGIVEAILESLSMLPEIVRPLMIGNIVCTGGNFNLPNFAQRLAREL 373

Query: 321 KQ 322
           ++
Sbjct: 374 QR 375

>YLR085C Chr12 complement(300673..301989) [1317 bp, 438 aa] {ON}
           ARP6Actin-related protein that binds nucleosomes; a
           component of the SWR1 complex, which exchanges histone
           variant H2AZ (Htz1p) for chromatin-bound histone H2A
          Length = 438

 Score = 60.5 bits (145), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 49/182 (26%), Positives = 78/182 (42%), Gaps = 26/182 (14%)

Query: 163 THIVPVYESVVLSHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYV 222
           T I+PV + +      ++LD+ GR +T  L + LS R Y  N   +   V  IKE+  +V
Sbjct: 198 TWIIPVLKGIPYYKAVKKLDIGGRFLTGLLKETLSFRHY--NMMDETILVNNIKEQCLFV 255

Query: 223 SYDLDLDTKLARETTALVESYELPDGRT----------------------IKVGQERFEA 260
           S     D+   ++  AL   Y LPD +T                      I +  E F  
Sbjct: 256 SPVSYFDSFKTKDKHAL--EYVLPDFQTSFLGYVRNPRKENVPLPEDAQIITLTDELFTI 313

Query: 261 PECLFQPGLVDVEQPGVGELLFNTVQSADVDIRSSLYKAIVLSGGSSMYPGLPSRLEKEL 320
           PE  F P +  + +PG+ E +  ++      +R  +   IV +GG+   P    RL  EL
Sbjct: 314 PETFFHPEISQITKPGIVEAILESLSMLPEIVRPLMVGNIVCTGGNFNLPNFAQRLAAEL 373

Query: 321 KQ 322
           ++
Sbjct: 374 QR 375

 Score = 32.7 bits (73), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 32/153 (20%), Positives = 61/153 (39%), Gaps = 24/153 (15%)

Query: 6   PIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPI--LRAEERASVTTPLKDIMIGDEASDV 63
           PIV+D G+  +K G           PS   +P   L A  +    T      + +   ++
Sbjct: 5   PIVIDNGSYEIKFG-----------PSTNKKPFRALNALAKDKFGTS----YLSNHIKNI 49

Query: 64  RSYLQISY--PMENGIIKNWTDMELLWDYAF-----FEQMKLPSTSNGKILLTEPPMNPL 116
           +    I++  P E G +  W     +WDY       F+   L       ++ +E  M   
Sbjct: 50  KDISSITFRRPHELGQLTLWELESCIWDYCLFNPSEFDGFDLKEGKGHHLVASESCMTLP 109

Query: 117 KNREKMCEVMFEKYDFGGVYVAIQAVLALYAQG 149
           +  +   +V+FE+Y+F  ++ +  AV   + + 
Sbjct: 110 ELSKHADQVIFEEYEFDSLFKSPVAVFVPFTKS 142

>KAFR0J01160 Chr10 (212425..214680) [2256 bp, 751 aa] {ON} Anc_2.248
           YNL059C
          Length = 751

 Score = 60.8 bits (146), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 58/232 (25%), Positives = 99/232 (42%), Gaps = 11/232 (4%)

Query: 6   PIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASVTTPLKDIMIGDEASDVRS 65
           PI +D G+  V+ G    + P + FP+ + R   R  + +   T + + ++ D+   VRS
Sbjct: 38  PIAIDFGSYEVRAGYTSSSIPSHIFPNKLTRH--RDRKLSKTFTFIGNDVLLDQT--VRS 93

Query: 66  YLQISYPMENGIIKNWTDMELLWDYAFFEQMKLPSTSNGKILLTEPPMNPLKN-REKMCE 124
             Q   P +   I NW  +E +  Y F     +   S    L+   P+  L++ R+   E
Sbjct: 94  --QSKSPFDGSFIANWDYVEDIMQYTFNHLGVVGDNSVRNPLIINEPLGSLQSQRKNWYE 151

Query: 125 VMFEKYDFGGVYVAIQAVLALYA--QGLXXXXXXXXXXXXTHIVPVYESVVLSHLTRRLD 182
           ++FE +    V   I  +   YA  +G             T ++PV +   +    +R++
Sbjct: 152 LLFECFHLPNVSFGIDGMFGFYANNEGNQDGIVINCSNEETDVIPVVDGRGVLTDAKRIN 211

Query: 183 VAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDL--DLDTKL 232
             GR    +L DL+S +   F         +Q+    CYVS D   D+DT L
Sbjct: 212 WGGRQAVDYLSDLMSLKYPYFPSKLSTFQYQQMYTNYCYVSPDYSNDIDTML 263

 Score = 40.4 bits (93), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 28/87 (32%), Positives = 42/87 (48%), Gaps = 7/87 (8%)

Query: 241 ESYELPDGRTIKVGQERFEAPECLFQPGLVDVEQPGVGEL----LFNTVQSADVDIRSS- 295
           +S  + +   + +  ER   PE LFQP +   +Q G+ EL    L N   S   ++  + 
Sbjct: 599 DSENIHEQHQLHLNVERIRVPEILFQPIIGGQDQAGISELCETILSNKFGSKPRELSETS 658

Query: 296 --LYKAIVLSGGSSMYPGLPSRLEKEL 320
             + K I L+GG S  PGL  R+ KE 
Sbjct: 659 LGMAKNIWLTGGHSKLPGLRERIVKEF 685

>ZYRO0A01584g Chr1 complement(130119..132365) [2247 bp, 748 aa] {ON}
           highly similar to uniprot|P53946 Saccharomyces
           cerevisiae YNL059C ARP5 Nuclear actin-related protein
           involved in chromatin remodeling component of chromatin-
           remodeling enzyme complexes
          Length = 748

 Score = 60.5 bits (145), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 44/139 (31%), Positives = 65/139 (46%), Gaps = 28/139 (20%)

Query: 256 ERFEAPECLFQPGLVDVEQPGVGELL-------FNTVQSADVDIRSSLYKAIVLSGGSSM 308
           ER   PE LFQP +   +Q G+ EL        F + Q    D+ +S+ + + ++GG++ 
Sbjct: 611 ERIRVPEVLFQPNMGGEDQAGIPELCETLLLRKFGSTQRQLSDVSTSMAQNVWITGGNAK 670

Query: 309 YPGLPSRLEKELKQLW-----FSRVLHNDPSRLDKFKVRIEDPPRRKHMVFIGGAVLASI 363
            PGL  R+ KE  +       FS     DPS LD ++               G A LA  
Sbjct: 671 LPGLRERIVKEFSEFLPSGSPFSIRKSQDPS-LDAWR---------------GMAKLAQN 714

Query: 364 MADKDHMWLSKQEWLESGP 382
             D  H +++KQE+LE GP
Sbjct: 715 TEDFKHGYITKQEYLEYGP 733

 Score = 53.9 bits (128), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 56/242 (23%), Positives = 105/242 (43%), Gaps = 21/242 (8%)

Query: 2   DPHNPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASVTTPLKDIMIGDEAS 61
           +P+ PI +D G+  ++ G   +  P + FP+ + R   R  + A   T      IG++ S
Sbjct: 34  NPNVPIAIDFGSSKLRAGYVNDPNPSHIFPNRLTR--YRDRKLAKTMT-----FIGNDTS 86

Query: 62  -DVRSYLQISYPMENGIIKNWTDMELLWDYAFFEQMKLPSTSNGKI----LLTEPPMNPL 116
            D    +Q     +  ++ NW  +E   +Y F     L   +NG I    ++ E      
Sbjct: 87  LDQAVRVQAKSAFDGPLVTNWDYVEDTLEYTF---NHLGVAANGGISNPLVINERLATIQ 143

Query: 117 KNREKMCEVMFEKYDFGGVYVAIQAVLALYAQG--LXXXXXXXXXXXXTHIVPVYESVVL 174
             R    +++FE +D  GV   I ++   Y                  T+++PV +   +
Sbjct: 144 SQRANWYQILFECFDVPGVTFGIDSLFGFYHNSGPNSTGLVIGCGNEDTNVIPVVDGKGV 203

Query: 175 SHLTRRLDVAGRDVTRHLIDLLS-RRGYAFNRTADFETVRQIKEKLCYV--SYDLDLDTK 231
              ++R++  G   T +L +L+S +  Y   + + F+  + + E  CYV  SYD +L+  
Sbjct: 204 LTESKRINWGGNQATEYLTNLMSLKYPYFPTKLSPFQ-YKTMYEDYCYVSQSYDEELEKY 262

Query: 232 LA 233
           L+
Sbjct: 263 LS 264

>NCAS0G03050 Chr7 complement(560525..562756) [2232 bp, 743 aa] {ON}
           Anc_2.117 YHR129C
          Length = 743

 Score = 59.3 bits (142), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 55/228 (24%), Positives = 93/228 (40%), Gaps = 15/228 (6%)

Query: 6   PIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASVTTPLKDIMIGDEAS-DVR 64
           PI +D G+  ++ G   ++ P + FP+ + R   R   +           IG++ S D  
Sbjct: 38  PIAIDFGSSQIRAGYTNQSTPSHIFPNRLTRYRDRKINKTFT-------FIGNDVSLDQA 90

Query: 65  SYLQISYPMENGIIKNWTDMELLWDYAFFEQMKLPSTS-NGKILLTEPPMNPLKNREKMC 123
              Q   P +  II NW  +E +  Y F     +     +  ILLTE        R    
Sbjct: 91  IRTQSKSPFDGSIITNWDYVEDIMQYIFNHLGVVGHNGVSNPILLTEKLATLQSQRSNWY 150

Query: 124 EVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXX----XXXXXXTHIVPVYESVVLSHLTR 179
           +++FE +D   V + I ++ A Y  GL                T ++PV E   +    +
Sbjct: 151 QLLFECFDIPEVTLGIDSMFAFY--GLNERSSTGLVIDCGNEETDVIPVVEGAGMLTDAK 208

Query: 180 RLDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLD 227
           R++  GR    +L DLL+ +   F         +++ +  CYV+ D D
Sbjct: 209 RINWGGRQAVDYLNDLLTLKYPYFPTKLSTAQYQRVYQDYCYVAKDYD 256

 Score = 37.4 bits (85), Expect = 0.073,   Method: Compositional matrix adjust.
 Identities = 22/72 (30%), Positives = 34/72 (47%), Gaps = 7/72 (9%)

Query: 256 ERFEAPECLFQPGLVDVEQPGVGELL-------FNTVQSADVDIRSSLYKAIVLSGGSSM 308
           ER   PE LFQP +   +Q G+ EL        F + Q        ++   + ++GG+S 
Sbjct: 614 ERIRVPEILFQPSMGGQDQAGIIELCETILTKKFGSEQRKLSPTALAMANNLWITGGNSK 673

Query: 309 YPGLPSRLEKEL 320
            PG+  R+ KE 
Sbjct: 674 LPGMKERIVKEF 685

>NDAI0D01060 Chr4 complement(238631..240892) [2262 bp, 753 aa] {ON}
           Anc_2.248 YNL059C
          Length = 753

 Score = 58.9 bits (141), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 53/234 (22%), Positives = 92/234 (39%), Gaps = 17/234 (7%)

Query: 2   DPHNPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASVTTPLKDIMIGDEAS 61
           +P  PI +D G+  V+ G   E  P + FP+ + R   R   +    T       G++ S
Sbjct: 34  NPEIPIAIDFGSSTVRAGYTNEARPSHIFPTKLTRYRDRKINKTFTFT-------GNDCS 86

Query: 62  ---DVRSYLQISYPMENGIIKNWTDMELLWDYAFFEQMKLPSTS-NGKILLTEPPMNPLK 117
               +RS  Q+  P +  +I NW  +E +  Y F     +P       I++TE       
Sbjct: 87  LDQTIRS--QMKSPFDGALITNWDYVEDILQYTFNHLGVVPDHGVQNPIIITEKLATIQS 144

Query: 118 NREKMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTH----IVPVYESVV 173
            R    +++FE Y+       I ++ A Y                +H    I+P+ +   
Sbjct: 145 QRSNWYQLLFETYNVPKATFGIDSLFAFYNNNNGSATSTGMVIDCSHEETNIIPIVDGQG 204

Query: 174 LSHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLD 227
           +    +R++  GR    +L +LL+ +   F           + +  CYVS D D
Sbjct: 205 ILTDAKRINWGGRHAIDYLSNLLALKYPYFPTKLSSYQYESMYQNFCYVSQDYD 258

 Score = 47.4 bits (111), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 39/149 (26%), Positives = 64/149 (42%), Gaps = 18/149 (12%)

Query: 241 ESYELPDGRTIKVGQERFEAPECLFQPGLVDVEQPGVGEL-------LFNTVQSADVDIR 293
           +S ++     I +  ER   PE +FQP +  ++Q G+ EL        F +      ++ 
Sbjct: 601 DSEDIHQQHQIHLNVERIRVPEIVFQPSMGGLDQAGIAELSETILLRKFGSEPKHLSELS 660

Query: 294 SSLYKAIVLSGGSSMYPGLPSRLEKELKQLWFSRVLHNDPSRLDKFKVRIEDPPRRKHMV 353
            ++   I L+GG+S  PGL  R+ KE ++               +F V +   P      
Sbjct: 661 LTMANNIWLTGGNSKIPGLRERIVKEFREFLPVNT---------QFNVNMTSDP--TFDA 709

Query: 354 FIGGAVLASIMADKDHMWLSKQEWLESGP 382
           + G A LA    D     +SK+E+ E GP
Sbjct: 710 WNGMAKLAQNETDYKKTIISKKEYEEYGP 738

>KLLA0F03421g Chr6 complement(321000..323243) [2244 bp, 747 aa] {ON}
           similar to uniprot|P53946 Saccharomyces cerevisiae
           YNL059C ARP5 Nuclear actin-related protein involved in
           chromatin remodeling component of chromatin-remodeling
           enzyme complexes
          Length = 747

 Score = 56.6 bits (135), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 53/202 (26%), Positives = 87/202 (43%), Gaps = 15/202 (7%)

Query: 2   DPHNPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASVTTPLKDIMIGDEAS 61
           +P+ PI LD G+  V+ G   ++ P + FP+     I+R +ER  +   L    IG++ S
Sbjct: 37  NPNTPIALDFGSYEVRAGFTSQDTPSHVFPT----KIVRYKER-KIQKAL--TFIGNDCS 89

Query: 62  ---DVRSYLQISYPMENGIIKNWTDMELLWDYAFFEQMKLPSTS-NGKILLTEPPMNPLK 117
               VRS+ +   P +  +I NW  ME +  Y F      P+   +  ++LTE       
Sbjct: 90  LDNAVRSHSR--SPYDGSLITNWEYMEDMLSYTFHHLGVQPNDGISNPMILTEKMATVQA 147

Query: 118 NREKMCEVMFEKYDFGGVYVAIQAVLALYAQGL--XXXXXXXXXXXXTHIVPVYESVVLS 175
            R    +++FE Y    V   I  + + YA                 T+I+PV +   + 
Sbjct: 148 QRSNWYQLLFECYGIPQVTFGIDGLFSFYANNSPDSTGLIINSGHEDTNIIPVIKGKGIL 207

Query: 176 HLTRRLDVAGRDVTRHLIDLLS 197
              +R+D  G     +L  LLS
Sbjct: 208 SEAKRIDWGGNQSIDYLKSLLS 229

 Score = 35.4 bits (80), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 21/72 (29%), Positives = 33/72 (45%), Gaps = 7/72 (9%)

Query: 256 ERFEAPECLFQPGLVDVEQPGVGELL-------FNTVQSADVDIRSSLYKAIVLSGGSSM 308
           ER  APE +FQP +  ++Q G+ EL        F +  S        +   I ++GG++ 
Sbjct: 611 ERIRAPEVIFQPSMGGLDQAGIAELADGILTKKFGSGSSKLSQQCLDMASNIFITGGNTK 670

Query: 309 YPGLPSRLEKEL 320
            P L  R+  E 
Sbjct: 671 IPNLRERIVNEF 682

>TBLA0H01460 Chr8 complement(323962..325290) [1329 bp, 442 aa] {ON}
           Anc_8.258 YLR085C
          Length = 442

 Score = 56.2 bits (134), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 48/180 (26%), Positives = 77/180 (42%), Gaps = 24/180 (13%)

Query: 163 THIVPVYESVVLSHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYV 222
           T I+PV + +      +++D+ GR +T  L + LS R Y  N T +   V  IKEK  +V
Sbjct: 204 TWIIPVIKGIPYYKAIKKMDIGGRFLTGLLKETLSFRHY--NVTDETILVNNIKEKCLFV 261

Query: 223 SYDLDLDTKLARETTALVESYELPDGRT--------------------IKVGQERFEAPE 262
           +     ++   +  TA+   Y LPD  T                    I +  E F   E
Sbjct: 262 APKSYAESFKLKNKTAV--EYVLPDFHTTFMGYIKDNSKTKLPDNAQLITLKDELFSVTE 319

Query: 263 CLFQPGLVDVEQPGVGELLFNTVQSADVDIRSSLYKAIVLSGGSSMYPGLPSRLEKELKQ 322
            +F P +  + +PG+ E +  ++      IR  +   IV  GG+   P    RL  EL++
Sbjct: 320 TIFHPEISRILKPGIIETIIESLSMLPEVIRPLMVNNIVCIGGNFNLPNFSKRLTSELQR 379

 Score = 43.5 bits (101), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 29/138 (21%), Positives = 62/138 (44%), Gaps = 20/138 (14%)

Query: 6   PIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASVTTPLKDIMIGDEASDVRS 65
           PIV+D G+  +K G +    P   F +I           A        + + ++   ++ 
Sbjct: 5   PIVIDNGSYEIKFGVSNSRIP---FRAI----------NAIAKDKYNTVYLSNQIKGIKD 51

Query: 66  YLQISY--PMENGIIKNWTDMELLWDYAF-----FEQMKLPSTSNGKILLTEPPMNPLKN 118
              +++  P E G + +W     +WDY F     F+  +L  TS   ++++E  ++  + 
Sbjct: 52  ISSVNFRRPYELGQLTSWELESAIWDYCFYNPEEFDGFQLEDTSKKHLVISETCLSLPEF 111

Query: 119 REKMCEVMFEKYDFGGVY 136
              +  ++FE+Y++G +Y
Sbjct: 112 SRNIDHIIFEEYNYGSIY 129

>TBLA0E03860 Chr5 complement(969721..972000) [2280 bp, 759 aa] {ON}
           Anc_2.248 YNL059C
          Length = 759

 Score = 56.6 bits (135), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 61/244 (25%), Positives = 102/244 (41%), Gaps = 23/244 (9%)

Query: 2   DPHN-----PIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASVTTPLKDIMI 56
           DP N     PI +D G+  VK G   ++ P + F + + R   R  + A   T      I
Sbjct: 29  DPSNYGPDIPIAIDFGSYNVKAGYTNQSLPTHVFTNKLTR--YRDRKLAKTMT-----FI 81

Query: 57  GDEAS-DVRSYLQISYPMENGIIKNWTDMELLWDYAFFE---QMKLPSTSNGKILLTEPP 112
           G++ + D    +Q   P +   I NW   E ++DY       Q    S SN  I+LTE  
Sbjct: 82  GNDTNLDQPLRIQAKRPYDGLFIANWEYAEEIFDYTLHHLGVQTTNGSISN-PIILTEKM 140

Query: 113 MNPLKNREKMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXX----XXXXXXTHIVPV 168
                 R    +++FE +D       + ++ A Y                    T+IVP+
Sbjct: 141 ACLQSQRANWYQLLFETFDVPSATFGLDSLYAFYNNCANPFESDGLVINCGHEDTNIVPI 200

Query: 169 YESVVLSHLTRRLDVAGRDVTRHLIDLLS-RRGYAFNRTADFETVRQIKEKLCYVSYDLD 227
            +   +    +R++  GR  T +L  LL+ +  Y   + ++F+  + + E  CYVS + +
Sbjct: 201 VQGKGILTEAKRINWGGRHSTEYLSSLLTLKYPYFPTKLSEFQ-YQTMYEDFCYVSPNYN 259

Query: 228 LDTK 231
            D K
Sbjct: 260 EDIK 263

 Score = 48.1 bits (113), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 42/147 (28%), Positives = 62/147 (42%), Gaps = 28/147 (19%)

Query: 251 IKVGQERFEAPECLFQPGLVDVEQPGVGEL-------LFNTVQSADVDIRSSLYKAIVLS 303
           I +  ER   PE +FQP +   +Q G+ EL        FN+       I   +   + L+
Sbjct: 617 IHMNVERIRVPEVMFQPSIGGCDQAGISELSETLFLRKFNSSPRKLSSISERMLNNVWLT 676

Query: 304 GGSSMYPGLPSRLEKELKQLW-----FSRVLHNDPSRLDKFKVRIEDPPRRKHMVFIGGA 358
           GG +  PGL  R+ KE  +        S  + NDPS LD +K               G A
Sbjct: 677 GGHAKLPGLKERIVKEYTEFLPVGTKMSINISNDPS-LDTWK---------------GMA 720

Query: 359 VLASIMADKDHMWLSKQEWLESGPASM 385
            LAS       + ++K+++ E GP  M
Sbjct: 721 KLASNTDYLKKIQVTKKDYEEYGPEYM 747

>TDEL0C04140 Chr3 (732580..734829) [2250 bp, 749 aa] {ON} Anc_2.248
           YNL059C
          Length = 749

 Score = 55.8 bits (133), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 55/233 (23%), Positives = 100/233 (42%), Gaps = 11/233 (4%)

Query: 3   PHNPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASVTTPLKDIMIGDEASD 62
           P  PI +D G+  ++ G      P + F + + R   R  +     T + + +  D+A  
Sbjct: 35  PDVPIAVDFGSNQLRAGLINRATPSHVFTNRITR--FRDRKLMKTMTFIGNDVNLDQA-- 90

Query: 63  VRSYLQISYPMENGIIKNWTDMELLWDYAFFEQMKLPSTS-NGKILLTEPPMNPLKNREK 121
           VR+  Q   P +  ++ NW  +E + +Y F      P+   +  IL+TE        R  
Sbjct: 91  VRA--QSKSPFDGPMVTNWDYVEDILEYTFNHLGSTPNNGISNPILVTERLATLQTQRSS 148

Query: 122 MCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXX--XXXXXXXXTHIVPVYESVVLSHLTR 179
             +V+FE ++  GV   I ++ A Y                  T+I+PV +   +    +
Sbjct: 149 WYQVLFECFNVPGVTFGIDSLFAYYQNTTANSTGLVIGCGNEDTNIIPVVDGQGMLTEAK 208

Query: 180 RLDVAGRDVTRHLIDLLS-RRGYAFNRTADFETVRQIKEKLCYVSYDLDLDTK 231
           R++  G     +L +L++ +  Y   + ++F   R + E  CYVS D D + K
Sbjct: 209 RINWGGSQAADYLTNLMTLKYPYFPTKLSNFH-YRTMYEDYCYVSQDYDEELK 260

 Score = 47.0 bits (110), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 41/134 (30%), Positives = 57/134 (42%), Gaps = 18/134 (13%)

Query: 256 ERFEAPECLFQPGLVDVEQPGVGELL-------FNTVQSADVDIRSSLYKAIVLSGGSSM 308
           ER   PE  FQP +   +Q GV EL        F         I S + K + ++GG++ 
Sbjct: 612 ERIRVPEVFFQPTMCGEDQAGVSELCERVLLSKFGASPRQMSSITSEMAKNVWVTGGNAK 671

Query: 309 YPGLPSRLEKELKQLWFSRVLHNDPSRLDKFKVRIEDPPRRKHMVFIGGAVLASIMADKD 368
            PGL  R+ KE     F+  L  + S    F V I   P      + G A  A    D  
Sbjct: 672 IPGLRERIVKE-----FTGFLPVNTS----FNVNISSDPSLD--AWRGMAKYAQNETDYK 720

Query: 369 HMWLSKQEWLESGP 382
             ++SK+E+ E GP
Sbjct: 721 KSFISKKEYEEYGP 734

>Kwal_23.4848 s23 complement(892162..894399) [2238 bp, 745 aa] {ON}
           YNL059C (ARP5) - Actin-related protein [contig 5] FULL
          Length = 745

 Score = 53.9 bits (128), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 49/229 (21%), Positives = 93/229 (40%), Gaps = 13/229 (5%)

Query: 2   DPHNPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASVTTPLKDIMIGDEAS 61
           +P   I +D G+  V+ G   +  P + FP+ + R   R   R           IG++ +
Sbjct: 34  NPETAIAIDFGSSEVRAGYGNQERPSHIFPNRIARWRDRKLNRNLT-------FIGNDTN 86

Query: 62  -DVRSYLQISYPMENGIIKNWTDMELLWDYAFFEQMKLPSTSN--GKILLTEPPMNPLKN 118
            D+    Q   P +  ++ NW   E + +Y F   + +  T      I++TE        
Sbjct: 87  LDLSVRSQSRSPYDGALVTNWDYTEDIMEYTFH-HLGVKGTDGIPNPIIMTEKLGALHSQ 145

Query: 119 REKMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXX--XXXXXXXXTHIVPVYESVVLSH 176
           R+   +++FE +    V   + ++ + YA                 THI+PV +   +  
Sbjct: 146 RDNWYQLLFECFGAPQVTFGLDSLFSFYANNDASASGLVISSGNEDTHIIPVVDGKGVLG 205

Query: 177 LTRRLDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYD 225
             +R++  GR    +L +LL+ +   F         + + ++ CYVS D
Sbjct: 206 EAKRINWGGRQSVDYLSNLLALKYPYFPIKPSTHQFKALYDEFCYVSPD 254

 Score = 34.3 bits (77), Expect = 0.68,   Method: Compositional matrix adjust.
 Identities = 24/90 (26%), Positives = 44/90 (48%), Gaps = 7/90 (7%)

Query: 241 ESYELPDGRTIKVGQERFEAPECLFQPGLVDVEQPGVGELL-------FNTVQSADVDIR 293
           +S ++     + +  ER   PE +FQP +  ++Q G+ E+        F + +S    I 
Sbjct: 594 DSEDINQQHQMHLNVERIRVPEVIFQPSMGGLDQAGIIEICETNFLKKFGSSRSELSSIS 653

Query: 294 SSLYKAIVLSGGSSMYPGLPSRLEKELKQL 323
            SL   + L+GG+   PG+  R+ +E + L
Sbjct: 654 RSLASNVFLTGGNMRLPGMRERVVREFRGL 683

>SAKL0E08602g Chr5 (702206..704449) [2244 bp, 747 aa] {ON} similar
           to uniprot|P53946 Saccharomyces cerevisiae YNL059C ARP5
           Nuclear actin-related protein involved in chromatin
           remodeling component of chromatin-remodeling enzyme
           complexes
          Length = 747

 Score = 53.9 bits (128), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 51/230 (22%), Positives = 93/230 (40%), Gaps = 11/230 (4%)

Query: 2   DPHNPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASVTTPLKDIMIGDEAS 61
           DP+ PI +D G+  V+ G   ++ P + FP+ + R   R   +           +G++ +
Sbjct: 34  DPNVPIAIDFGSSEVRAGYTNQSLPSHVFPTRLTRHRDRKINKTFT-------FVGNDTN 86

Query: 62  DVRSY-LQISYPMENGIIKNWTDMELLWDYAFFEQMKLPSTS-NGKILLTEPPMNPLKNR 119
             ++   Q   P +  +I NW  +E + +Y F     +     +  ILLTE        R
Sbjct: 87  LEQTLRTQSRSPFDGPMITNWDYVEDMMEYTFNHLGVVGHDGISNPILLTEKMATLQSQR 146

Query: 120 EKMCEVMFEKYDFGGVYVAIQAVLALYA--QGLXXXXXXXXXXXXTHIVPVYESVVLSHL 177
               ++MFE +    +   I ++ + +A  Q              T+++PV     +   
Sbjct: 147 SNWYQLMFECFGVPKLTFGIDSLFSYFANNQSDSTGLVISSGNEDTNVIPVVCGKGILSE 206

Query: 178 TRRLDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLD 227
            +R++  GR    +  +LLS +   F         + I    CYVS D D
Sbjct: 207 AKRINWGGRHSVEYTTNLLSLKYPYFPTKLVSSQFQSIYHDFCYVSRDYD 256

 Score = 39.3 bits (90), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 35/139 (25%), Positives = 62/139 (44%), Gaps = 28/139 (20%)

Query: 256 ERFEAPECLFQPGLVDVEQPGVGEL----LFNTVQSADVDIRS---SLYKAIVLSGGSSM 308
           ER   PE +FQP +  ++Q G+ EL    + N   S+   + S    +   + L+GG+  
Sbjct: 610 ERIRVPEVIFQPPMGGLDQAGIIELSETIIMNKFGSSRRQLSSVSQEMANNVFLTGGNVR 669

Query: 309 YPGLPSRLEKELKQLW-----FSRVLHNDPSRLDKFKVRIEDPPRRKHMVFIGGAVLASI 363
            PGL  R+ +E  +       ++  + +DP+ +D +K               G A  A  
Sbjct: 670 VPGLRDRIVREFTEFLPVGTKYNIKVASDPA-IDAWK---------------GMAKFAQS 713

Query: 364 MADKDHMWLSKQEWLESGP 382
             D    +++K+E+ E GP
Sbjct: 714 STDYKGSYVTKKEYEEYGP 732

>TPHA0C03160 Chr3 complement(699424..701691) [2268 bp, 755 aa] {ON}
           Anc_2.248 YNL059C
          Length = 755

 Score = 51.6 bits (122), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 44/134 (32%), Positives = 62/134 (46%), Gaps = 18/134 (13%)

Query: 256 ERFEAPECLFQPGLVDVEQPGVGEL-------LFNTVQSADVDIRSSLYKAIVLSGGSSM 308
           ER   PE LFQP +   +Q G+ EL        F +  S   D   ++ K + ++GG + 
Sbjct: 618 ERPRVPEILFQPRMGGCDQAGIIELSETMLLKKFGSKPSKLSDQAEAMAKNVWITGGHAQ 677

Query: 309 YPGLPSRLEKELKQLWFSRVLHNDPSRLDKFKVRIEDPPRRKHMVFIGGAVLASIMADKD 368
            PGL +R+ KE     F+  L ND     KF V I   P      + G A  +S  AD  
Sbjct: 678 LPGLKTRIVKE-----FTSFLPNDA----KFSVNISKHPSLD--AWKGMAKFSSDDADFK 726

Query: 369 HMWLSKQEWLESGP 382
              +SK+E+ E GP
Sbjct: 727 SSLISKKEYEEYGP 740

 Score = 51.2 bits (121), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 56/232 (24%), Positives = 95/232 (40%), Gaps = 19/232 (8%)

Query: 2   DPHNPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASVTTPLKDIMIGDEAS 61
           D   PI +D GT  VK G   +  P + FP+ + R   R  + +   T      IG++ +
Sbjct: 35  DSSIPIAIDFGTCSVKAGYVNKADPAFNFPTRLTR--FRDRKMSRTMT-----FIGNDTN 87

Query: 62  -DVRSYLQISYPMENGIIKNWTDMELLWDYAFFEQMKLPSTSNGKI----LLTEPPMNPL 116
            D     Q   P +   + NW   E + +Y F     L  T+N  I    ++TE      
Sbjct: 88  LDYAVRSQSKTPFDGPFVTNWEYAEDILEYTF---KHLGVTANHGISNPLIMTEKLATLQ 144

Query: 117 KNREKMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXX--XXXXXTHIVPVYESVVL 174
             R    +++FE ++   V   I  V A YA                 T+++P+ +   +
Sbjct: 145 SQRANWYQLLFETFNTSNVSFGIDNVFAFYANTDKHSSGLVFGLNNQDTNVIPIIDGKPV 204

Query: 175 SHLTRRLDVAGRDVTRHLIDLLS-RRGYAFNRTADFETVRQIKEKLCYVSYD 225
              T+R++  G     +L DL++ +  Y   +  +F+     K+  CYVS D
Sbjct: 205 LTDTKRINWGGSQSVGYLSDLMTLKYPYFPTKLTEFQYETLYKD-YCYVSPD 255

>CAGL0J10054g Chr10 complement(985402..987666) [2265 bp, 754 aa]
           {ON} highly similar to uniprot|P53946 Saccharomyces
           cerevisiae YNL059c ARP5 Actin-related protein
          Length = 754

 Score = 49.7 bits (117), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 48/231 (20%), Positives = 89/231 (38%), Gaps = 9/231 (3%)

Query: 2   DPHNPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASVTTPLKDIMIGDEAS 61
           DP+ PI +D G+  ++ G    + P + FP+   +       R   T      +  D   
Sbjct: 38  DPNIPIAIDFGSYELRAGYTNISRPSHIFPNRFSK------YRDRKTNKYLPCIGYDTWL 91

Query: 62  DVRSYLQISYPMENGIIKNWTDMELLWDYAFFEQMKLPSTS-NGKILLTEPPMNPLKNRE 120
           D  +  Q   P +  ++ NW  +E +  Y F      P       I++ E        R 
Sbjct: 92  DQTTRSQARSPFDGPLVVNWDMVEDILQYTFHHLGVQPDNGVTNPIIINEKLACLQSQRS 151

Query: 121 KMCEVMFEKYDFGGVYVAIQAVLALYAQ--GLXXXXXXXXXXXXTHIVPVYESVVLSHLT 178
              + +FE +    V +A++ +LA Y    G             T+++P+ E   +    
Sbjct: 152 NWYQTLFESFGVPKVSMAVEGMLAFYGHNGGSSTGIVIDCGYEDTNVIPIVEGQGMMLDA 211

Query: 179 RRLDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLDLD 229
           +R++  G     +L +LL  +   F     +    ++ +  CYVS D + D
Sbjct: 212 KRINWGGHSSIDYLSNLLYLKYPYFPTKLSYLQYEKMYKDYCYVSQDYETD 262

 Score = 41.2 bits (95), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 39/148 (26%), Positives = 63/148 (42%), Gaps = 18/148 (12%)

Query: 241 ESYELPDGRTIKVGQERFEAPECLFQPGLVDVEQPGVGELL-------FNTVQSADVDIR 293
           +S  + +   + +  ER   PE +FQP L   +Q G+ E+        F +         
Sbjct: 602 DSENIHEQHQMHINVERIRVPEVMFQPILGGQDQAGITEICETIITKKFGSTPRNLSQQS 661

Query: 294 SSLYKAIVLSGGSSMYPGLPSRLEKELKQLWFSRVLHNDPSRLDKFKVRIEDPPRRKHMV 353
             + K + L GG++  PGL SR+ KE     F+  L +D     K  V I + P     V
Sbjct: 662 LDMAKNVWLVGGNAQVPGLKSRVVKE-----FTEFLPSDT----KINVNISEAPTLD--V 710

Query: 354 FIGGAVLASIMADKDHMWLSKQEWLESG 381
           + G   LA+   D     ++ +E+ E G
Sbjct: 711 WNGMYRLANTEEDYQRTIVTSEEYDECG 738

>Kpol_1003.16 s1003 complement(43655..45904) [2250 bp, 749 aa] {ON}
           complement(43655..45904) [2250 nt, 750 aa]
          Length = 749

 Score = 47.4 bits (111), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 48/235 (20%), Positives = 92/235 (39%), Gaps = 15/235 (6%)

Query: 6   PIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASVTTPLKDIMIGDEAS-DVR 64
           PI +D G+  +K G   ++ P   FP+ + R   R   R           IG++ S D  
Sbjct: 39  PIAIDFGSNTLKAGYTNQDVPSLVFPTRLTRFRDRRLNRTMT-------FIGNDISLDQA 91

Query: 65  SYLQISYPMENGIIKNWTDMELLWDYAFFEQMKLPSTS-NGKILLTEPPMNPLKNREKMC 123
              Q   P +  ++ NW  ++ + +Y F     L     +  ++ +E        R +  
Sbjct: 92  VRAQSKSPFDGSMVTNWEYIDEMLEYTFKHLGVLGDNGISNPLIFSEKLAVVQAQRSQWY 151

Query: 124 EVMFEKYDFGGVYVAIQAVLALYAQGLXXXX--XXXXXXXXTHIVPVYESVVLSHLTRRL 181
           +++FE ++       I    A +A                 T+++P+   V      +R+
Sbjct: 152 QLLFETFNISKATFGIDNQFAFFANNSIDSTGLMIGCNNEDTNVIPIVNGVASLQECKRI 211

Query: 182 DVAGRDVTRHLIDLLS-RRGYAFNRTADFETVRQIKEKLCYVS--YDLDLDTKLA 233
           +  G     ++ +LLS +  Y   +  D +  +++    CYVS  Y  D+D  L 
Sbjct: 212 NWGGNHAVSYMNNLLSLKYPYFPTKLTDLQ-YQKLYHDYCYVSPDYSADIDKYLT 265

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 25/72 (34%), Positives = 34/72 (47%), Gaps = 7/72 (9%)

Query: 256 ERFEAPECLFQPGLVDVEQPGVGELL-------FNTVQSADVDIRSSLYKAIVLSGGSSM 308
           ER   PE LFQP +   +Q GV EL        F +  +        +   I LSGG++ 
Sbjct: 613 ERIRVPEVLFQPTMGGCDQAGVAELCETILLKKFGSSPNQLSKTAEDMANNIWLSGGNAK 672

Query: 309 YPGLPSRLEKEL 320
            PGL +R+ KE 
Sbjct: 673 VPGLKNRIVKEF 684

>KNAG0I01860 Chr9 (364390..366651) [2262 bp, 753 aa] {ON} Anc_2.248
           YNL059C
          Length = 753

 Score = 46.6 bits (109), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 49/231 (21%), Positives = 90/231 (38%), Gaps = 18/231 (7%)

Query: 2   DPHNPIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASVTTPLKDIMIGDEA- 60
           DP+  I +D G+  ++ G   +N P Y FP+ + +   R  ++           IG++  
Sbjct: 34  DPNARIAIDFGSYNIRAGYTNQNTPSYIFPTRLTKHRDRKLQKTFT-------FIGNDTL 86

Query: 61  --SDVRSYLQISYPMENGIIKNWTDMELLWDYAFFEQMKLPSTSNG---KILLTEPPMNP 115
               +RS  Q   P +  ++ NW  +E + +Y F       S +NG    +++ E     
Sbjct: 87  LDQTIRS--QSKSPFDGTLLTNWDYVEDMLEYTFHHLG--VSGNNGVSNPLIINERLACL 142

Query: 116 LKNREKMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXX-XXXXXXXXXTHIVPVYESVVL 174
              R    +++FE +D   V   I ++ + Y                 T ++P+     +
Sbjct: 143 QSQRNSWYQLLFETFDLPEVSFGIDSLFSFYGNSTKEDGLVINCGNEETDVIPIVGGRGI 202

Query: 175 SHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYD 225
               +R++  G   T  L  LL+ +   F          Q+ E  CY S D
Sbjct: 203 LSECKRINWGGSQSTNFLSSLLTLKYPYFPAKLSTLQYTQMYEDYCYTSPD 253

 Score = 43.5 bits (101), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 36/144 (25%), Positives = 62/144 (43%), Gaps = 28/144 (19%)

Query: 251 IKVGQERFEAPECLFQPGLVDVEQPGVGELL-------FNTVQSADVDIRSSLYKAIVLS 303
           + +  ER   PE LF+P +   +Q G+ EL        F +         S +   + ++
Sbjct: 608 LHLNTERIRVPEILFEPSIAGQDQAGIAELCETILLKKFGSKPGNLSAASSRMVNNVWIT 667

Query: 304 GGSSMYPGLPSRLEKELKQLW-----FSRVLHNDPSRLDKFKVRIEDPPRRKHMVFIGGA 358
           GG++  PG+ +R+ KE  +        S  +  DPS LD +K               G A
Sbjct: 668 GGNARIPGIKNRIVKEFTEFLPAGTPLSVHMSEDPS-LDAWK---------------GMA 711

Query: 359 VLASIMADKDHMWLSKQEWLESGP 382
            LA+   D  +  ++++E+ E GP
Sbjct: 712 KLANNETDYKNTAVTRKEYEEYGP 735

>ADL253C Chr4 complement(255550..257805) [2256 bp, 751 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YNL059C
           (ARP5)
          Length = 751

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 51/229 (22%), Positives = 91/229 (39%), Gaps = 17/229 (7%)

Query: 6   PIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASVTTPLKDIMIGDEASDVRS 65
           PI +D G+  V+ G      P   FP+ + R   R   +AS T        G +AS +R+
Sbjct: 42  PIAIDFGSYEVRAGYVANKEPALVFPTRLARYRDR---KASRTYTFVGRDTGLDAS-IRT 97

Query: 66  YLQISYPMENGIIKNWTDMELLWDYAFFE-QMKLPSTSNGKILLTEPPMNPLKNREKMCE 124
             Q   P +  ++ NW  ++ +  Y F    ++        ++LTE        R    E
Sbjct: 98  --QSRSPFDGPMVTNWDYVDDMLAYTFHHLGVRGGGGVPNAVVLTERLATLQSQRANWYE 155

Query: 125 VMFEKYDFGGVYVAIQAVLALYAQ------GLXXXXXXXXXXXXTHIVPVYESVVLSHLT 178
           +++E Y+   V   I ++ + Y +      GL            T +VPV +   +    
Sbjct: 156 LLYEAYNLQEVTFGIDSLFSFYGERGPGSTGL----VVSSGNEDTCVVPVVDGRGVVSEA 211

Query: 179 RRLDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLD 227
           +R++  G+    +L  LL+ +   F           I  + CYV+ D +
Sbjct: 212 KRINWGGQQAVDYLTGLLALKYPYFPTKLSGSQFETIYREHCYVAEDFE 260

 Score = 40.0 bits (92), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 22/87 (25%), Positives = 43/87 (49%), Gaps = 7/87 (8%)

Query: 241 ESYELPDGRTIKVGQERFEAPECLFQPGLVDVEQPGVGELL-------FNTVQSADVDIR 293
           +S  + +   + +  ER   PE +FQP +  ++Q GV EL        F++ + A     
Sbjct: 599 DSENIHEQHQMHINVERIRVPEVIFQPSIGGLDQAGVVELCETVLLKKFDSSRRALSATC 658

Query: 294 SSLYKAIVLSGGSSMYPGLPSRLEKEL 320
             + K + ++GG++  PG+  R+ +E 
Sbjct: 659 EKMAKNVFITGGNTKLPGIRERIVREF 685

>Ecym_3285 Chr3 complement(539184..541424) [2241 bp, 746 aa] {ON}
           similar to Ashbya gossypii ADL253C
          Length = 746

 Score = 40.0 bits (92), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 21/72 (29%), Positives = 37/72 (51%), Gaps = 7/72 (9%)

Query: 256 ERFEAPECLFQPGLVDVEQPGVGELL-------FNTVQSADVDIRSSLYKAIVLSGGSSM 308
           ER   PE +FQP +  ++Q G+ EL        F + +    +I   + K I ++GG++ 
Sbjct: 609 ERIRVPEVIFQPSIGGLDQAGIVELCETLLLKKFGSNRRELSEISKMMAKNIFITGGNAK 668

Query: 309 YPGLPSRLEKEL 320
            PG+  R+ +E 
Sbjct: 669 LPGIRERVVREF 680

 Score = 38.9 bits (89), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 47/229 (20%), Positives = 83/229 (36%), Gaps = 17/229 (7%)

Query: 6   PIVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASVTTPLKDIMIGDEAS-DVR 64
           PI +D G+  V+ G   +  P   F + + R   R   R           +G++ + D  
Sbjct: 38  PIAIDFGSYEVRAGYVNQGDPALVFTNRLARYRDRKASRTYT-------FVGNDTNLDQS 90

Query: 65  SYLQISYPMENGIIKNWTDMELLWDYAFFEQMKLPSTSNGKI----LLTEPPMNPLKNRE 120
              Q   P +  +I NW  ++ +  Y F     L    NG +    L+TE        R 
Sbjct: 91  IRTQSKSPFDGSMITNWDYVDDILAYTFHH---LDVRGNGGVPNPVLITERMAALQSQRS 147

Query: 121 KMCEVMFEKYDFGGVYVAIQAVLALYAQG--LXXXXXXXXXXXXTHIVPVYESVVLSHLT 178
              E++FE Y+   V   I ++ + Y +                T ++PV     +    
Sbjct: 148 NWYELLFECYNLQKVTFGIDSLFSFYGEHPPGTTGIAINSGNEDTSVIPVVNGKGILTEA 207

Query: 179 RRLDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLD 227
           +R++  G+    +L  LLS +   F           +    CY S + +
Sbjct: 208 KRINWGGQQSVGYLNGLLSLKYPYFPTKLVNNQFESMYRDFCYFSTNFE 256

>SAKL0H17358g Chr8 complement(1535040..1535975) [936 bp, 311 aa]
           {ON} weakly similar to uniprot|Q04549 Saccharomyces
           cerevisiae YDR106W ARP10 Actin-related protein
          Length = 311

 Score = 39.3 bits (90), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 39/241 (16%), Positives = 99/241 (41%), Gaps = 24/241 (9%)

Query: 83  DMELLWD--YAFFEQMKLPSTSNGKILLTEPPMNPLKNREKMCEVMFEKYDFGGVYVAIQ 140
           D E LW   Y  +    + + S+ K+++ E  + PL  +E +C+V+ ++     +     
Sbjct: 37  DEEFLWRLFYKCYHDELMVAPSSTKVVIIENVLLPLNCKELLCQVLLKRLLVSSIVFVPD 96

Query: 141 AVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLSHLTRRLDVAGRDVTRHLIDLLSRRG 200
            ++  ++ G+              +VP+ +  +L + +   + AG+ +  +L ++L    
Sbjct: 97  VLMTCFSSGVKDGLVIDVGWEYVAVVPILDLRILDNWSHISNKAGKFLYDNLKEILPPG- 155

Query: 201 YAFNRTADFETVRQIKEKLCYVSYDLDLDTKLARETTALVESYELPDGRTIKVGQERFEA 260
                                   D+ +   +A E     +  E+   + ++ G  +   
Sbjct: 156 ---------------------TDLDILVPQIMACEGDKDFQYREISITKEVRNGFLKKTI 194

Query: 261 PECLFQPGLVDVEQPGVGELLFNTVQSADVDIRSSLYKAIVLSGGSSMYPGLPSRLEKEL 320
                 P   D ++  + +++  T++   VD++  ++  ++++G +S  PG   +L KE+
Sbjct: 195 GHFDEDPLEYDDDELPISQVVLKTLKDLPVDVKKRVFPHLMITGLASNIPGFKMKLLKEV 254

Query: 321 K 321
           K
Sbjct: 255 K 255

>NCAS0A14720 Chr1 (2903450..2904907) [1458 bp, 485 aa] {ON}
           Anc_7.448 YPR034W
          Length = 485

 Score = 37.7 bits (86), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 35/197 (17%), Positives = 76/197 (38%), Gaps = 5/197 (2%)

Query: 7   IVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASVTTPLKDIMIGDEASDVRSY 66
           +V+  GT     G    + P    P++  +     +++      L DI       D   Y
Sbjct: 11  VVIQNGTNTTLAGFNNVDLPQCVIPTVYIQDN-STQKKIFGNFELLDIASSRSNDDAGRY 69

Query: 67  LQISYPMENGIIKNWTDMELLWDYAFFEQMKLPSTSNGKILLTEPPMNPLKNR---EKMC 123
              +    NG+  NW  ++  W+Y + E +K  S     +++T P  N   +    +K  
Sbjct: 70  EVFTIFDRNGLPYNWDALKEQWEYIYREVLKCNS-DEYPLVITIPSANKDVDEIILKKYF 128

Query: 124 EVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLSHLTRRLDV 183
           E+ FE ++   + + I+ +    + G              ++ P+ +  V+ H   +   
Sbjct: 129 ELAFETFNVPVLQIIIEPLAVALSLGKSSSLVVNLGASGCNVTPIVDGTVIKHAVMKSKY 188

Query: 184 AGRDVTRHLIDLLSRRG 200
            G  +   ++++L  +G
Sbjct: 189 GGDFLDFQIVNILQEKG 205

>Kpol_543.10 s543 complement(25137..27767) [2631 bp, 876 aa] {ON}
           complement(25137..27767) [2631 nt, 877 aa]
          Length = 876

 Score = 38.1 bits (87), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 48/217 (22%), Positives = 86/217 (39%), Gaps = 22/217 (10%)

Query: 67  LQISYPMENGIIKNWTDMELLWDYAFF---EQMKLPSTSNGKILLTEPPMNPLKNREKMC 123
           L +  P  + + +  +D+  L++YA     E +        K++L  P +    + E + 
Sbjct: 406 LNLDSPYYSSLPELLSDVTRLFEYALTKRDESITQAQIQQCKVILVIPDLFEKSHIETLY 465

Query: 124 EVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXX-XXXTHIVPVYESVVLSHLTRRLD 182
            ++ ++  F  V +  +++ A Y  G+             T I  V E  VL +   +LD
Sbjct: 466 RILLKEMQFQAVAIMQESLAACYGAGISTASCIVNIGATQTTIACVDEGTVLENSLIKLD 525

Query: 183 VAGRDVTRHLIDLLSRRGYAF-----NRTADFETVRQIKEKLCYVSY-DLDLDTKL---- 232
             G D+TR     L    + F     + T  +    Q+K+   Y ++ D ++  +L    
Sbjct: 526 YGGDDITRLFTLFLLENNFPFQDLDLDSTHGWTLAEQLKKN--YATFEDANMTVQLYNFV 583

Query: 233 ARETTALVESYELPDGRTIKVGQERFEAPECLFQPGL 269
            R    + E YE       KV  E   AP  LF P +
Sbjct: 584 KRIPGKVSEKYEF------KVFDEVILAPLALFYPDI 614

>KLLA0F11913g Chr6 complement(1094612..1095373) [762 bp, 253 aa]
           {ON} weakly similar to uniprot|Q04549 Saccharomyces
           cerevisiae YDR106W ARP10 Actin-related protein
          Length = 253

 Score = 35.8 bits (81), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 15/98 (15%), Positives = 44/98 (44%)

Query: 91  AFFEQMKLPSTSNGKILLTEPPMNPLKNREKMCEVMFEKYDFGGVYVAIQAVLALYAQGL 150
           ++F  + + ++   KI+++EP    +  ++++C+V+F +     +      + A    G+
Sbjct: 47  SWFHDILMYNSKGVKIVISEPLWLSILRKQRLCKVLFGRLKVNSICFVPNCLAAFIGAGI 106

Query: 151 XXXXXXXXXXXXTHIVPVYESVVLSHLTRRLDVAGRDV 188
                       T ++P+++  +L   +R   +   +V
Sbjct: 107 RNGLYIEVNSKNTELIPIFDGRILDSYSRSSKLGSDNV 144

>Kpol_520.11 s520 complement(26673..28139) [1467 bp, 488 aa] {ON}
           complement(26673..28139) [1467 nt, 489 aa]
          Length = 488

 Score = 36.2 bits (82), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 69/360 (19%), Positives = 143/360 (39%), Gaps = 52/360 (14%)

Query: 1   MDPHNP--IVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASVTTPLKDIM--I 56
           MD  N   +V+  GT     G +    P    PS      L+ ++ + V     D+M  +
Sbjct: 1   MDLSNSKCVVIHNGTSTTIAGFSNSEIPKCIIPS----SYLKKKDGSFVFGTF-DMMDSL 55

Query: 57  GDEASDVRSYLQISYPMENGIIKNWTDMELLWDYAFFEQMKLPSTSNGKILLTEPPM--- 113
            DE ++   +  +   +  G+  NW  +E  W+Y F +Q+K   T    +L+T P     
Sbjct: 56  EDEGAESDIFTIVDSQL--GVPYNWEALEKQWEYIFEKQLKCDPTE-LPVLITIPSSISK 112

Query: 114 -NPLKNR--EKMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYE 170
              ++N+  E+ C++ FEK+    + +  +++      G             + + P+ +
Sbjct: 113 NEDIENKVIEQYCKIAFEKFKIPYLQIVNESLSISLGLGKKTSLVIDISGSGSSVTPIVD 172

Query: 171 SVVLSH---------------LTRRLDVAGRDVTRHLID----LLSRRGY--AFNRTADF 209
            V++ +               + ++      D+   + +     +S   +   F +T   
Sbjct: 173 GVIIKNGIVKSKYGGDFLDYQIIKKFSTIDEDLEEEMTNSSNIWVSSNSWIKNFKKTMLQ 232

Query: 210 ETVRQIKEKLCYVSYDLDLDTKLARETT---------ALVESYELPDGRTIKV-GQERFE 259
            T +++++   Y    L L  +L  + +         ++ + Y     +T+    +E ++
Sbjct: 233 VTDKKLQDVEKYYEEQLRLQAELQNQGSITSVGTNPLSVKKEYLYRSRKTVTFESRELYQ 292

Query: 260 APECLFQPGLVDVE---QPGVGELLFNTVQSADVDIRSSLYKAIVLSGGSSMYPGLPSRL 316
             E LFQP L   +     G+GEL++ ++ SA +    +   A    GGSS   G  S +
Sbjct: 293 FGEYLFQPQLASEQYNRDDGLGELIYRSITSAAMGNMPAAVAASNNIGGSSGATGGDSNV 352

>Ecym_3505 Chr3 complement(941314..942231) [918 bp, 305 aa] {ON}
           similar to Ashbya gossypii AGR099C
          Length = 305

 Score = 35.8 bits (81), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 53/280 (18%), Positives = 112/280 (40%), Gaps = 49/280 (17%)

Query: 105 KILLTEPPMNPLKNREKMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTH 164
           KI++ E  +  +  ++++C V+ ++     V      ++A  A G+            T 
Sbjct: 61  KIVILENVLLDVPKKKRLCHVLLDRLMVSSVVFLPDILMACVAGGVTDAIVVDIGWENTV 120

Query: 165 IVPVYESVVLSHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSY 224
           + P+ +  +L        +  + +        S+    F    + + VR IK        
Sbjct: 121 VAPIMDMRILEQHMGISKIGAKWIG-------SKLSSTFEIDGE-KIVRMIK-------- 164

Query: 225 DLDLDTKLARETTALVESYELPDGRTIKVGQERFEAPECLFQPGLVDVEQPGVGELLFNT 284
              LDT +       +E  ++ D   I     + + PEC       D+++  +  L+  +
Sbjct: 165 ---LDTDINCNGVQ-IEWRDIEDCMEILWNINK-QDPEC-------DIDEFPIISLVLES 212

Query: 285 VQSADVDIRSSLYKAIVLSGGSSMYPGLPSRLEKELKQLWFSRVLHNDPSRLDKFKVRIE 344
           ++   +D++S + + +++ GG S   GL  RL + L      R  H +   ++  K    
Sbjct: 213 IKQLPIDVKSKVLQNVIIIGGLSKIQGLKERLIENL------RYAHTNARGINILK---- 262

Query: 345 DPPRRKHMVFIGGAVLA--SIM-ADKDHMWLSKQEWLESG 381
                   V+ GG++    S+M  D D M ++++E+  SG
Sbjct: 263 --------VWQGGSIYTYHSLMHNDLDQMEVNREEFKSSG 294

>TBLA0H02800 Chr8 (655357..656811) [1455 bp, 484 aa] {ON} Anc_2.593
           YMR033W
          Length = 484

 Score = 35.8 bits (81), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 58/302 (19%), Positives = 107/302 (35%), Gaps = 62/302 (20%)

Query: 72  PMENGIIKNWTDMELLWDYAFFEQMKLPSTSNGKIL---LTEPPMNPLKNR-------EK 121
           P+ENG+I N    +    Y +   +K     N        T  P+  L N        E 
Sbjct: 66  PIENGMIINLEAFQEFLKYIYISLLKQKHDENADSFEYSFTNIPLLLLNNHKWSQFQMES 125

Query: 122 MCEVMFEKYDFGGVYVAIQAVLALYAQ-GLXXXXXXXXXXXXTHIVPVYESVVLSHLTRR 180
           +   +FEK    G+ +   ++ A Y+   L            T IVP+ +   ++HL+  
Sbjct: 126 ITNFVFEKLKLNGLMLLPISLGASYSMVSLQNCCIIDIGLNHTDIVPIVDYTTINHLSNT 185

Query: 181 LDVAGRDVTRHLIDLL-------------------------SRRGYAFNRTADFETVRQI 215
           L+  G  +   L  LL                         +   + FN      T  + 
Sbjct: 186 LNYGGSYINTILQKLLPELNDQQIEDLKKSPIFEVLTEDEKNDSAFDFNNPITTSTKNKD 245

Query: 216 KEKLCYVSYDLDLDTKLARETTALVE----------------SYELPDGRTIKVGQERFE 259
            +   +    +    K  RE  A  E                +++  +G  IK+G++RF+
Sbjct: 246 DDDADFDVASIINSGKDTREILAEREKKNQKKSLPNSQLEFNTFKDNNGNQIKIGKQRFQ 305

Query: 260 APECLFQPGLVDVEQPGVGELLFNTV-QSADVDIRSSLYKAIVLSGGSSMYPGLPSRLEK 318
             + L Q          +   + +T+ Q  D+  + ++++ IV+ G +S+  G    L  
Sbjct: 306 GCDELIQK---------ISTRVGHTINQLEDLSKQRAIWENIVIVGNTSLITGFKEALLN 356

Query: 319 EL 320
           +L
Sbjct: 357 QL 358

>NDAI0A01300 Chr1 complement(280662..282359) [1698 bp, 565 aa] {ON}
           Anc_7.448 YPR034W
          Length = 565

 Score = 35.8 bits (81), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 38/197 (19%), Positives = 76/197 (38%), Gaps = 9/197 (4%)

Query: 7   IVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASVTTPLKDIM-IGDEASDVRS 65
           IV+ QGT     G    + P    PS      +  ++   +   L D++ I     D   
Sbjct: 13  IVIQQGTNTTIAGFNNSDLPQCVIPSTY----IYDKQEDKMIFGLYDMLDIATSLEDADR 68

Query: 66  YLQISYPMENGIIKNWTDMELLWDYAFFEQMKLPSTSNGKILLTEPPMNPLKNR---EKM 122
           Y   +   +NGI  NW  +E  W+Y F + ++  S     +++T P M    +    EK 
Sbjct: 69  YEVFTILDKNGIPYNWEALEQQWNYLFNDVLRC-SPEEYPLVITIPSMKKEIDGEVLEKY 127

Query: 123 CEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLSHLTRRLD 182
             ++FE++ F    + ++ +    + G               + P+ +  V+ +      
Sbjct: 128 FSLVFERFKFPVFQIILEPLAITLSLGKSSGLVIDMGSSGCRVTPIIDGTVIKNAVLSSK 187

Query: 183 VAGRDVTRHLIDLLSRR 199
             G  +   +I+ L ++
Sbjct: 188 YGGAFLDYQIIETLQKK 204

>KAFR0K02150 Chr11 (441832..443304) [1473 bp, 490 aa] {ON} Anc_7.448
           YPR034W
          Length = 490

 Score = 34.7 bits (78), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 26/115 (22%), Positives = 48/115 (41%), Gaps = 4/115 (3%)

Query: 74  ENGIIKNWTDMELLWDYAFFEQMKLPSTSNGKILLTEPPMN---PLKNREKMCEVMFEKY 130
           ENG+  NW  +E  W Y F  ++K  S     +++T P M     L+  E+  ++ F K+
Sbjct: 70  ENGVPYNWEALERQWKYIFENELKCKS-DEFPLVITVPIMKDAVALRVMERYFDLAFNKF 128

Query: 131 DFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLSHLTRRLDVAG 185
           +   + V I+ +    + G              ++ PV +  V  +   +   AG
Sbjct: 129 NVPVLQVIIEPLAIALSMGKSSALVVDLGSSSCNVTPVIDGTVAKNSVLKSKYAG 183

>Skud_15.304 Chr15 complement(543860..546511) [2652 bp, 883 aa] {ON}
           YOR141C (REAL)
          Length = 883

 Score = 34.7 bits (78), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 33/139 (23%), Positives = 56/139 (40%), Gaps = 4/139 (2%)

Query: 67  LQISYPMENGIIKNWTDMELLWDYAFF-EQMKLPST--SNGKILLTEPPMNPLKNREKMC 123
             I+ P    + +  +D+  L +YA   E + + ST  +  K++L  P +    + E   
Sbjct: 410 FNINSPYYESLAELISDVTKLLEYALASETLNVKSTKFNQYKVVLVIPDVFKKNHVETFI 469

Query: 124 EVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXX-XXXTHIVPVYESVVLSHLTRRLD 182
            V+  +  F  V V  +++   Y  G+             T I  V E  VL H    L+
Sbjct: 470 RVLLTELQFQAVAVIQESLATCYGAGISTSTCVVNIGATETRIACVDEGTVLEHSAVTLN 529

Query: 183 VAGRDVTRHLIDLLSRRGY 201
             G D+TR    LL +  +
Sbjct: 530 YGGDDITRLFALLLLQSDF 548

>KLLA0F26455g Chr6 (2450871..2453462) [2592 bp, 863 aa] {ON} similar
           to uniprot|P36016 Saccharomyces cerevisiae YKL073W LHS1
           Molecular chaperone of the endoplasmic reticulum lumen
           involved in polypeptide translocation and folding member
           of the Hsp70 family localizes to the lumen of the ER
           regulated by the unfolded protein response pathway
          Length = 863

 Score = 33.1 bits (74), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 41/168 (24%), Positives = 74/168 (44%), Gaps = 19/168 (11%)

Query: 183 VAGRDVTRHLIDLLSRRGYAFN---RTADFETVRQIKEKLCYVSYDLDLDTKLARETTAL 239
           ++G  ++  ++DLL       N   RT  FE+    K KL   +    L      + +  
Sbjct: 264 LSGSVLSLAIVDLLENDFLESNPNIRTEQFESDASAKAKLVQAAEKAKLVLSANSDASIS 323

Query: 240 VES--YELPDGRTIKVGQ-ERF--EAPECLFQPGLVDVEQPGVGELLFNTVQSADVDIRS 294
           +ES  ++L    TI   + E F  E    + +P L  +E P  G+ L       D+D   
Sbjct: 324 IESLYHDLDFKTTITRAKFEEFVAELQSVVIEPILSTLESPLNGKAL----NVKDLD--- 376

Query: 295 SLYKAIVLSGGSSMYPGLPSRLEKELKQLWFSRVLHNDPSRLDKFKVR 342
               +++L+GGS+  P +  +LE  L     S+ +++D S ++   +R
Sbjct: 377 ----SVILTGGSTRVPFVKKQLENHLGASLISKNVNSDESAVNGAAIR 420

>Smik_15.320 Chr15 complement(551333..553954) [2622 bp, 873 aa] {ON}
           YOR141C (REAL)
          Length = 873

 Score = 33.1 bits (74), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 29/128 (22%), Positives = 50/128 (39%), Gaps = 4/128 (3%)

Query: 67  LQISYPMENGIIKNWTDMELLWDYAFFEQ---MKLPSTSNGKILLTEPPMNPLKNREKMC 123
             I+ P    + +  +D+  L +YA   +   +K    +  K++L  P +    + E   
Sbjct: 400 FNINSPYYKSLAELISDVTKLLEYALKSETLNVKPAKFNQYKVVLVIPDIFKKSHIETFI 459

Query: 124 EVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXX-XXXTHIVPVYESVVLSHLTRRLD 182
            V+  +  F  V +  +++   Y  G+             T I  V E  VL H    LD
Sbjct: 460 RVLLTELQFQAVAIIQESLATCYGAGISTSTCVVNIGASETRIACVDEGTVLEHSAITLD 519

Query: 183 VAGRDVTR 190
             G D+TR
Sbjct: 520 YGGDDITR 527

>YOR141C Chr15 complement(589942..592587) [2646 bp, 881 aa] {ON}
           ARP8Nuclear actin-related protein involved in chromatin
           remodeling, component of chromatin-remodeling enzyme
           complexes; has mRNA binding activity
          Length = 881

 Score = 32.3 bits (72), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 22/87 (25%), Positives = 34/87 (39%), Gaps = 1/87 (1%)

Query: 105 KILLTEPPMNPLKNREKMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXX-XXXT 163
           K++L  P +    + E    V+  +  F  V +  +++   Y  G+             T
Sbjct: 449 KVVLVIPDIFKKSHVETFIRVLLTELQFQAVAIIQESLATCYGAGISTSTCVVNIGAAET 508

Query: 164 HIVPVYESVVLSHLTRRLDVAGRDVTR 190
            I  V E  VL H    LD  G D+TR
Sbjct: 509 RIACVDEGTVLEHSAITLDYGGDDITR 535

>ACR184C Chr3 complement(669411..670616) [1206 bp, 401 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPR034W
           (ARP7)
          Length = 401

 Score = 31.6 bits (70), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 35/154 (22%), Positives = 60/154 (38%), Gaps = 39/154 (25%)

Query: 255 QERFEAPECLFQPGLVDVE---QPGVGELLFNTVQSADVDIRSS---------------- 295
           ++ +  PE LF P  V  E     G+ +L+   ++     I SS                
Sbjct: 256 KQCYRIPESLFDPSSVSPEFDSADGLSDLVGKAIKKCAASITSSNGSAAQPAAAGLPSAT 315

Query: 296 -------LYKAIVLSGGSSMYPGLPSRLEKELKQLW--FSRVLHNDPSRLDKFKVRIEDP 346
                  L   +V+ GG+S+  GL  RL  +L   +  +    +  P+ +D         
Sbjct: 316 PEQIHAALLTNVVIIGGTSLLQGLEQRLVNDLSLQFPQYKLSTYATPAHVD--------- 366

Query: 347 PRRKHMVFIGGAVLASIMADKDHMWLSKQEWLES 380
             R+   + GG  +  +   K   W++KQE+LES
Sbjct: 367 --RQLQSWQGGVNMCHLPDWKLGSWVTKQEYLES 398

>ADR128C Chr4 complement(934445..937048) [2604 bp, 867 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YKL073W
           (LHS1)
          Length = 867

 Score = 30.8 bits (68), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 13/44 (29%), Positives = 26/44 (59%)

Query: 299 AIVLSGGSSMYPGLPSRLEKELKQLWFSRVLHNDPSRLDKFKVR 342
           A++L+GGSS  P +  RL K + +   S+ ++ D + ++   +R
Sbjct: 373 AVILTGGSSRVPSVQDRLAKCVGEALISKSVNADEAAVNGVAIR 416

>KAFR0E02530 Chr5 (516623..519151) [2529 bp, 842 aa] {ON} Anc_5.477
           YOR141C
          Length = 842

 Score = 30.8 bits (68), Expect = 7.6,   Method: Compositional matrix adjust.
 Identities = 37/173 (21%), Positives = 65/173 (37%), Gaps = 17/173 (9%)

Query: 105 KILLTEPPMNPLKNREKMCEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXX-XXXT 163
           K +L  P +    + E+M  ++  +  F  V +  +++   Y  G+             T
Sbjct: 382 KAILVIPDLFEKSHVEEMIRLLLTELPFNAVAIIQESLATCYGAGISTSTCVVNVGASET 441

Query: 164 HIVPVYESVVLSHLTRRLDVAGRDVTRHLIDLLSRRGYAFN-----RTADFETVRQIKEK 218
            +  + E VVL +    L+  G D+TR    LL    + +        A +     +K++
Sbjct: 442 SVSCIDEGVVLENSLINLNYGGDDITRLFSVLLKMNNFPYQDWNVESIAGWNIAETLKKQ 501

Query: 219 LCYVSYDLDLDTKLA----RETTALVESYELPDGRTIKVGQERFEAPECLFQP 267
           +  +  D D+  +L+    R      E YE       K   E   AP  LF P
Sbjct: 502 IVTLQ-DADVTVQLSNFMKRVFNEPTEKYEF------KTFDEVMLAPLALFAP 547

>SAKL0D00594g Chr4 complement(48583..49875,50031..50132) [1395 bp,
           464 aa] {ON} highly similar to uniprot|P54839
           Saccharomyces cerevisiae YML126C ERG13
           3-hydroxy-3-methylglutaryl-CoA (HMG-CoA) synthase,
           catalyzes the formation of HMG-CoA from acetyl-CoA and
           acetoacetyl-CoA; involved in the second step in
           mevalonate biosynthesis
          Length = 464

 Score = 30.4 bits (67), Expect = 8.3,   Method: Compositional matrix adjust.
 Identities = 48/199 (24%), Positives = 78/199 (39%), Gaps = 14/199 (7%)

Query: 83  DMELLWDYAFFE--QMKLPSTSNGKILLTEPPMNPLKNREKMCEVMFEKYDFGGVYVAIQ 140
           D+   +DY  F     KL + S G++L  +   NP    E   E+   +Y+       I+
Sbjct: 258 DVAKFFDYNVFHVPTCKLVTKSYGRLLYNDFRANPQLYPEVDAELAKAEYNASLTDKNIE 317

Query: 141 AVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLSHLTRRLDVAGRDVTR-HLIDLLSRR 199
                 A+ L            T+   +Y   V S L   L   G D  +   I L S  
Sbjct: 318 KTFVGVAKPLHKDRVAPSLIVPTNTGNMYTGSVYSSLASLLFFVGSDALQGKRIGLFS-- 375

Query: 200 GYAFNRTADFETVRQIKEKLCYVSYDLDLDTKLARETTALVESYELPDGRTIKVGQERFE 259
            Y     A   + + + + + Y++  LDLD KL    T   E YE    + I++ ++   
Sbjct: 376 -YGSGLAASLFSCKVVGD-IKYITDVLDLDNKLNGRKTETPEDYE----KAIQLREDAHL 429

Query: 260 APECLFQP-GLVDVEQPGV 277
             +  F P G +++ QPG 
Sbjct: 430 QKQ--FAPKGSIELLQPGT 446

>YPR034W Chr16 (639525..640958) [1434 bp, 477 aa] {ON}
           ARP7Component of both the SWI/SNF and RSC chromatin
           remodeling complexes; actin-related protein involved in
           transcriptional regulation
          Length = 477

 Score = 30.4 bits (67), Expect = 9.2,   Method: Compositional matrix adjust.
 Identities = 34/183 (18%), Positives = 73/183 (39%), Gaps = 8/183 (4%)

Query: 7   IVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASVTTPLKDIMIGDEASDVRSY 66
           +V+  G+     G +    P    PS     I R +E            + D A++ R+ 
Sbjct: 8   VVIHNGSHRTVAGFSNVELPQCIIPSSY---IKRTDEGGEAEFIFGTYNMIDAAAEKRNG 64

Query: 67  LQISYPMEN-GIIKNWTDMELLWDYAFFEQMKLPSTSNGKILLTEPPMN---PLKNREKM 122
            ++   +++ G+  NW  +E+ W Y +  Q+K+ S     +++T P  N    +   E+ 
Sbjct: 65  DEVYTLVDSQGLPYNWDALEMQWRYLYDTQLKV-SPEELPLVITMPATNGKPDMAILERY 123

Query: 123 CEVMFEKYDFGGVYVAIQAVLALYAQGLXXXXXXXXXXXXTHIVPVYESVVLSHLTRRLD 182
            E+ F+K +     + I+ +    + G              ++ P+ + +V+ +   R  
Sbjct: 124 YELAFDKLNVPVFQIVIEPLAIALSMGKSSAFVIDIGASGCNVTPIIDGIVVKNAVVRSK 183

Query: 183 VAG 185
             G
Sbjct: 184 FGG 186

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.320    0.138    0.410 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 40,480,556
Number of extensions: 1659051
Number of successful extensions: 3977
Number of sequences better than 10.0: 171
Number of HSP's gapped: 3635
Number of HSP's successfully gapped: 252
Length of query: 391
Length of database: 53,481,399
Length adjustment: 112
Effective length of query: 279
Effective length of database: 40,638,807
Effective search space: 11338227153
Effective search space used: 11338227153
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 67 (30.4 bits)