Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Smik_4.2053.160ON53153126670.0
Skud_4.2213.160ON53153121230.0
YDL030W (PRP9)3.160ON53053120770.0
Suva_4.2193.160ON53153119660.0
NDAI0G028903.160ON53654112401e-166
ZYRO0B04950g3.160ON50653412101e-161
NCAS0C035403.160ON51853311961e-159
TDEL0D046203.160ON51653911671e-155
Kpol_479.263.160ON51753511631e-154
KAFR0C010503.160ON50653210961e-144
TPHA0A009103.160ON52753810621e-139
SAKL0C08800g3.160ON60154110361e-134
Kwal_56.227993.160ON5315389501e-122
KLTH0C08888g3.160ON5065349471e-122
Ecym_35493.160ON5325439431e-121
CAGL0K01573g3.160ON5165469391e-120
AEL085W3.160ON5275429121e-116
KNAG0K011203.160ON5275428891e-113
KLLA0F24662g3.160ON5305326735e-81
TBLA0B016003.160ON4863262132e-17
KLTH0G12738g8.302ON43432840.11
Kwal_56.238418.302ON43232840.11
ZYRO0D06182g8.302ON43132810.29
Suva_10.1588.11ON16958770.35
AGR048C8.302ON45368800.35
YLR113W (HOG1)8.302ON43532790.42
TBLA0G001702.15ON65950790.52
Ecym_15318.11ON17138760.52
NDAI0D029004.50ON1929180780.71
Ecym_42668.302ON46468770.87
Smik_12.1738.302ON43532770.89
CAGL0M11748g8.302ON44732761.0
TDEL0F042908.302ON42732761.0
Suva_10.2028.302ON43532751.2
Skud_12.1818.302ON43132751.2
NDAI0H02820singletonON15039721.3
NDAI0C065808.11ON16969721.6
CAGL0K12804g8.11ON17238721.6
SAKL0B00704g8.11ON16938721.6
YGL020C (GET1)4.101ON23552731.7
Smik_12.1348.11ON16658711.9
KLTH0G19096g8.11ON15938711.9
ABR234C8.11ON17538712.1
YDL223C (HBT1)2.54ON104667742.2
Skud_3.1566.363ON713193742.3
Kwal_14.10648.11ON16238702.5
KLLA0F20053g8.302ON44432732.6
SAKL0H16038g8.302ON43432722.9
YCR084C (TUP1)6.363ON713193733.0
Skud_12.1398.11ON16458694.1
TBLA0H013308.302ON48132714.3
YLR074C (BUD20)8.11ON16658684.6
CAGL0J07370g2.15ON62326697.1
KLLA0D05621g8.11ON16738677.9
NDAI0B042002.175ON28461688.8
Ecym_5044na 1ON903116689.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Smik_4.205
         (531 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Smik_4.205 Chr4 (377655..379250) [1596 bp, 531 aa] {ON} YDL030W ...  1031   0.0  
Skud_4.221 Chr4 (392347..393942) [1596 bp, 531 aa] {ON} YDL030W ...   822   0.0  
YDL030W Chr4 (397537..399129) [1593 bp, 530 aa] {ON}  PRP9Subuni...   804   0.0  
Suva_4.219 Chr4 (387976..389571) [1596 bp, 531 aa] {ON} YDL030W ...   761   0.0  
NDAI0G02890 Chr7 (669498..671108) [1611 bp, 536 aa] {ON} Anc_3.1...   482   e-166
ZYRO0B04950g Chr2 complement(399973..401493) [1521 bp, 506 aa] {...   470   e-161
NCAS0C03540 Chr3 (707075..708631) [1557 bp, 518 aa] {ON} Anc_3.1...   465   e-159
TDEL0D04620 Chr4 complement(847509..849059) [1551 bp, 516 aa] {O...   454   e-155
Kpol_479.26 s479 complement(50993..52546) [1554 bp, 517 aa] {ON}...   452   e-154
KAFR0C01050 Chr3 complement(214128..215648) [1521 bp, 506 aa] {O...   426   e-144
TPHA0A00910 Chr1 (179145..180728) [1584 bp, 527 aa] {ON} Anc_3.1...   413   e-139
SAKL0C08800g Chr3 (807712..809517) [1806 bp, 601 aa] {ON} simila...   403   e-134
Kwal_56.22799 s56 complement(284859..286454) [1596 bp, 531 aa] {...   370   e-122
KLTH0C08888g Chr3 (745663..747183) [1521 bp, 506 aa] {ON} simila...   369   e-122
Ecym_3549 Chr3 complement(1038111..1039709) [1599 bp, 532 aa] {O...   367   e-121
CAGL0K01573g Chr11 (139809..141359) [1551 bp, 516 aa] {ON} simil...   366   e-120
AEL085W Chr5 (467583..469166) [1584 bp, 527 aa] {ON} Syntenic ho...   355   e-116
KNAG0K01120 Chr11 (218749..220332) [1584 bp, 527 aa] {ON} Anc_3....   347   e-113
KLLA0F24662g Chr6 complement(2292807..2294399) [1593 bp, 530 aa]...   263   5e-81
TBLA0B01600 Chr2 (352382..353842) [1461 bp, 486 aa] {ON} Anc_3.1...    87   2e-17
KLTH0G12738g Chr7 complement(1085500..1086804) [1305 bp, 434 aa]...    37   0.11 
Kwal_56.23841 s56 (732202..733500) [1299 bp, 432 aa] {ON} YLR113...    37   0.11 
ZYRO0D06182g Chr4 complement(529121..530416) [1296 bp, 431 aa] {...    36   0.29 
Suva_10.158 Chr10 complement(283475..283984) [510 bp, 169 aa] {O...    34   0.35 
AGR048C Chr7 complement(807464..808825) [1362 bp, 453 aa] {ON} S...    35   0.35 
YLR113W Chr12 (371620..372927) [1308 bp, 435 aa] {ON}  HOG1Mitog...    35   0.42 
TBLA0G00170 Chr7 complement(26304..28283) [1980 bp, 659 aa] {ON}...    35   0.52 
Ecym_1531 Chr1 complement(1094489..1095004) [516 bp, 171 aa] {ON...    34   0.52 
NDAI0D02900 Chr4 complement(679279..685068) [5790 bp, 1929 aa] {...    35   0.71 
Ecym_4266 Chr4 complement(564935..566329) [1395 bp, 464 aa] {ON}...    34   0.87 
Smik_12.173 Chr12 (351727..353034) [1308 bp, 435 aa] {ON} YLR113...    34   0.89 
CAGL0M11748g Chr13 (1168856..1170199) [1344 bp, 447 aa] {ON} hig...    34   1.0  
TDEL0F04290 Chr6 (801456..802739) [1284 bp, 427 aa] {ON} Anc_8.3...    34   1.0  
Suva_10.202 Chr10 (380079..381386) [1308 bp, 435 aa] {ON} YLR113...    33   1.2  
Skud_12.181 Chr12 (354407..355702) [1296 bp, 431 aa] {ON} YLR113...    33   1.2  
NDAI0H02820 Chr8 complement(696348..696800) [453 bp, 150 aa] {ON}      32   1.3  
NDAI0C06580 Chr3 complement(1519086..1519595) [510 bp, 169 aa] {...    32   1.6  
CAGL0K12804g Chr11 complement(1269506..1270024) [519 bp, 172 aa]...    32   1.6  
SAKL0B00704g Chr2 (65060..65569) [510 bp, 169 aa] {ON} highly si...    32   1.6  
YGL020C Chr7 complement(457163..457870) [708 bp, 235 aa] {ON}  G...    33   1.7  
Smik_12.134 Chr12 complement(261773..262273) [501 bp, 166 aa] {O...    32   1.9  
KLTH0G19096g Chr7 complement(1649335..1649814) [480 bp, 159 aa] ...    32   1.9  
ABR234C Chr2 complement(841361..841888) [528 bp, 175 aa] {ON} Sy...    32   2.1  
YDL223C Chr4 complement(57265..60405) [3141 bp, 1046 aa] {ON}  H...    33   2.2  
Skud_3.156 Chr3 complement(244873..247014) [2142 bp, 713 aa] {ON...    33   2.3  
Kwal_14.1064 s14 (178979..179467) [489 bp, 162 aa] {ON} YLR074C ...    32   2.5  
KLLA0F20053g Chr6 (1867209..1868543) [1335 bp, 444 aa] {ON} high...    33   2.6  
SAKL0H16038g Chr8 complement(1401627..1402931) [1305 bp, 434 aa]...    32   2.9  
YCR084C Chr3 complement(260311..262452) [2142 bp, 713 aa] {ON}  ...    33   3.0  
Skud_12.139 Chr12 complement(266691..267185) [495 bp, 164 aa] {O...    31   4.1  
TBLA0H01330 Chr8 complement(297718..299163) [1446 bp, 481 aa] {O...    32   4.3  
YLR074C Chr12 complement(281956..282456) [501 bp, 166 aa] {ON}  ...    31   4.6  
CAGL0J07370g Chr10 (713487..715358) [1872 bp, 623 aa] {ON} simil...    31   7.1  
KLLA0D05621g Chr4 complement(486879..487382) [504 bp, 167 aa] {O...    30   7.9  
NDAI0B04200 Chr2 (1058568..1059422) [855 bp, 284 aa] {ON} Anc_2....    31   8.8  
Ecym_5044 Chr5 complement(91778..94489) [2712 bp, 903 aa] {ON} s...    31   9.8  

>Smik_4.205 Chr4 (377655..379250) [1596 bp, 531 aa] {ON} YDL030W
           (REAL)
          Length = 531

 Score = 1031 bits (2667), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 505/531 (95%), Positives = 505/531 (95%)

Query: 1   MSFLETRRSLLEDMEIIENAIVERIRRNPELYYHYIQESSKVFPDVKLPKSSLIAENKLF 60
           MSFLETRRSLLEDMEIIENAIVERIRRNPELYYHYIQESSKVFPDVKLPKSSLIAENKLF
Sbjct: 1   MSFLETRRSLLEDMEIIENAIVERIRRNPELYYHYIQESSKVFPDVKLPKSSLIAENKLF 60

Query: 61  KIKKVKRNRKQVILQQHEISLFLRDYLEKQKSFNNINSQNYSQEDDKDLCSFDEELRQLE 120
           KIKKVKRNRKQVILQQHEISLFLRDYLEKQKSFNNINSQNYSQEDDKDLCSFDEELRQLE
Sbjct: 61  KIKKVKRNRKQVILQQHEISLFLRDYLEKQKSFNNINSQNYSQEDDKDLCSFDEELRQLE 120

Query: 121 DELKSEEENFQLDINSKRNKYALFSSSIDSSKRTNILSERARDLDLNKIFTRDEQYGEYM 180
           DELKSEEENFQLDINSKRNKYALFSSSIDSSKRTNILSERARDLDLNKIFTRDEQYGEYM
Sbjct: 121 DELKSEEENFQLDINSKRNKYALFSSSIDSSKRTNILSERARDLDLNKIFTRDEQYGEYM 180

Query: 181 ELEQFHSLWLNVFKRSDCSLLQFFDVVELFVDDKKYLLTPPMDRKNDRYMAFLIKLCKYL 240
           ELEQFHSLWLNVFKRSDCSLLQFFDVVELFVDDKKYLLTPPMDRKNDRYMAFLIKLCKYL
Sbjct: 181 ELEQFHSLWLNVFKRSDCSLLQFFDVVELFVDDKKYLLTPPMDRKNDRYMAFLIKLCKYL 240

Query: 241 ETFFFKSYALFDKEVIESSIRFDFEQSYCKGSLRSEAKGIHCPFCYKWFKTSPVFENHLT 300
           ETFFFKSYALFDKEVIESSIRFDFEQSYCKGSLRSEAKGIHCPFCYKWFKTSPVFENHLT
Sbjct: 241 ETFFFKSYALFDKEVIESSIRFDFEQSYCKGSLRSEAKGIHCPFCYKWFKTSPVFENHLT 300

Query: 301 GKIHKKNEFKRKDTVYSEYKLHRYLKYLKDEFSHTKSFVERKLVFTANERIAEMDALTQK 360
           GKIHKKNEFKRKDTVYSEYKLHRYLKYLKDEFSHTKSFVERKLVFTANERIAEMDALTQK
Sbjct: 301 GKIHKKNEFKRKDTVYSEYKLHRYLKYLKDEFSHTKSFVERKLVFTANERIAEMDALTQK 360

Query: 361 YEAPAYDPTXXXXXXXXXXXXXXXXLQEKHFFGKSFDMPLGPDGLPMPHWLYKLHGLDRE 420
           YEAPAYDPT                LQEKHFFGKSFDMPLGPDGLPMPHWLYKLHGLDRE
Sbjct: 361 YEAPAYDPTDKDGDQQKGSDQRDDQLQEKHFFGKSFDMPLGPDGLPMPHWLYKLHGLDRE 420

Query: 421 YHCEICANKVYNGRRTFERHFNEGPHLYHLRCLGIEPSLAFKGITKITEAQKLWENMQKQ 480
           YHCEICANKVYNGRRTFERHFNEGPHLYHLRCLGIEPSLAFKGITKITEAQKLWENMQKQ
Sbjct: 421 YHCEICANKVYNGRRTFERHFNEGPHLYHLRCLGIEPSLAFKGITKITEAQKLWENMQKQ 480

Query: 481 PQSATSIASSLTKLKHSRSKLPTXXXXXXXXXXGNVMSKKVFDELKKQGLV 531
           PQSATSIASSLTKLKHSRSKLPT          GNVMSKKVFDELKKQGLV
Sbjct: 481 PQSATSIASSLTKLKHSRSKLPTELELEEEDEEGNVMSKKVFDELKKQGLV 531

>Skud_4.221 Chr4 (392347..393942) [1596 bp, 531 aa] {ON} YDL030W
           (REAL)
          Length = 531

 Score =  822 bits (2123), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 401/531 (75%), Positives = 451/531 (84%)

Query: 1   MSFLETRRSLLEDMEIIENAIVERIRRNPELYYHYIQESSKVFPDVKLPKSSLIAENKLF 60
           M+ LETRRSLLED+EIIENAI  RI+RNPELYYHYIQES KVFPDVKLPK SLIAENK++
Sbjct: 1   MNVLETRRSLLEDLEIIENAIAIRIQRNPELYYHYIQESCKVFPDVKLPKPSLIAENKIY 60

Query: 61  KIKKVKRNRKQVILQQHEISLFLRDYLEKQKSFNNINSQNYSQEDDKDLCSFDEELRQLE 120
           K+KKVKRNRKQVILQQHEI LFLRDY EKQK+FN  N+    +EDDK++  F++ L++LE
Sbjct: 61  KLKKVKRNRKQVILQQHEIDLFLRDYHEKQKAFNESNNLEGVEEDDKEVDRFEQNLQELE 120

Query: 121 DELKSEEENFQLDINSKRNKYALFSSSIDSSKRTNILSERARDLDLNKIFTRDEQYGEYM 180
           + LK+E++NFQLDIN  R+KYALFSSS D SKRTNILSERARDLDLNKIFTRDEQYGEYM
Sbjct: 121 ERLKNEDDNFQLDINLTRSKYALFSSSADPSKRTNILSERARDLDLNKIFTRDEQYGEYM 180

Query: 181 ELEQFHSLWLNVFKRSDCSLLQFFDVVELFVDDKKYLLTPPMDRKNDRYMAFLIKLCKYL 240
           EL+QFH LWLNV +RSDCSLLQFF+++ELFVDDKK+LLTPPMDRKNDRYM FL++L KYL
Sbjct: 181 ELDQFHYLWLNVIRRSDCSLLQFFNILELFVDDKKFLLTPPMDRKNDRYMDFLMRLSKYL 240

Query: 241 ETFFFKSYALFDKEVIESSIRFDFEQSYCKGSLRSEAKGIHCPFCYKWFKTSPVFENHLT 300
           ETFFFKSY LFDKE++E+SI  DFE SYCKG +RSEAKGI+CPFC KWFKT PVFENHL+
Sbjct: 241 ETFFFKSYVLFDKEMVENSIESDFENSYCKGLVRSEAKGIYCPFCSKWFKTFPVFENHLS 300

Query: 301 GKIHKKNEFKRKDTVYSEYKLHRYLKYLKDEFSHTKSFVERKLVFTANERIAEMDALTQK 360
           GK HKKNE KRK+TVYSEYKLHRYLKYLKDEF HT+SF+ERKL FTANER+AEMD+LT+K
Sbjct: 301 GKNHKKNEAKRKNTVYSEYKLHRYLKYLKDEFFHTRSFIERKLAFTANERMAEMDSLTEK 360

Query: 361 YEAPAYDPTXXXXXXXXXXXXXXXXLQEKHFFGKSFDMPLGPDGLPMPHWLYKLHGLDRE 420
           YEAPAYD T                LQEK  FGKSFDMPLGPDGLPMP+WLYKLHGLDRE
Sbjct: 361 YEAPAYDHTEGEGDGQCDAGRKGDLLQEKQPFGKSFDMPLGPDGLPMPYWLYKLHGLDRE 420

Query: 421 YHCEICANKVYNGRRTFERHFNEGPHLYHLRCLGIEPSLAFKGITKITEAQKLWENMQKQ 480
           Y CEICAN+VYNGRRTFERHFNE  HLYHLRCLGIEPS AFKGITKI E QKLW+++Q Q
Sbjct: 421 YPCEICANRVYNGRRTFERHFNEEAHLYHLRCLGIEPSPAFKGITKIAEVQKLWKDIQNQ 480

Query: 481 PQSATSIASSLTKLKHSRSKLPTXXXXXXXXXXGNVMSKKVFDELKKQGLV 531
            +S +S A +LTK   S+ KLPT          GNVMSKKV+DELKKQGLV
Sbjct: 481 HRSGSSTAVALTKKSPSQPKLPTGLELEEEDEEGNVMSKKVYDELKKQGLV 531

>YDL030W Chr4 (397537..399129) [1593 bp, 530 aa] {ON}  PRP9Subunit
           of the SF3a splicing factor complex, required for
           spliceosome assembly; acts after the formation of the U1
           snRNP-pre-mRNA complex
          Length = 530

 Score =  804 bits (2077), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 398/531 (74%), Positives = 449/531 (84%), Gaps = 1/531 (0%)

Query: 1   MSFLETRRSLLEDMEIIENAIVERIRRNPELYYHYIQESSKVFPDVKLPKSSLIAENKLF 60
           M+ LETRRSLLE+MEIIENAI ERI+RNPELYYHYIQESSKVFPD KLP+SSLIAENK++
Sbjct: 1   MNLLETRRSLLEEMEIIENAIAERIQRNPELYYHYIQESSKVFPDTKLPRSSLIAENKIY 60

Query: 61  KIKKVKRNRKQVILQQHEISLFLRDYLEKQKSFNNINSQNYSQEDDKDLCSFDEELRQLE 120
           K KKVKR RKQ+ILQQHEI++FLRDY EKQ++FN IN    +QEDDKDL +F+ +L+QLE
Sbjct: 61  KFKKVKRKRKQIILQQHEINIFLRDYQEKQQTFNKINRPEETQEDDKDLPNFERKLQQLE 120

Query: 121 DELKSEEENFQLDINSKRNKYALFSSSIDSSKRTNILSERARDLDLNKIFTRDEQYGEYM 180
            ELK+E+ENF+LDINSK++KYALFSSS D S+RTNILS+RARDLDLN+IFTRDEQYGEYM
Sbjct: 121 KELKNEDENFELDINSKKDKYALFSSSSDPSRRTNILSDRARDLDLNEIFTRDEQYGEYM 180

Query: 181 ELEQFHSLWLNVFKRSDCSLLQFFDVVELFVDDKKYLLTPPMDRKNDRYMAFLIKLCKYL 240
           ELEQFHSLWLNV KR DCSLLQF D++ELF+DD+KYLLTPPMDRKNDRYMAFL+KL KY+
Sbjct: 181 ELEQFHSLWLNVIKRGDCSLLQFLDILELFLDDEKYLLTPPMDRKNDRYMAFLLKLSKYV 240

Query: 241 ETFFFKSYALFDKEVIESSIRFDFEQSYCKGSLRSEAKGIHCPFCYKWFKTSPVFENHLT 300
           ETFFFKSYAL D   +E+ I+ DFE SYC+GSLRSEAKGI+CPFC +WFKTS VFE+HL 
Sbjct: 241 ETFFFKSYALLDAAAVENLIKSDFEHSYCRGSLRSEAKGIYCPFCSRWFKTSSVFESHLV 300

Query: 301 GKIHKKNEFKRKDTVYSEYKLHRYLKYLKDEFSHTKSFVERKLVFTANERIAEMDALTQK 360
           GKIHKKNE KR++ VYSEYKLHRYLKYL DEFS T+SFVERKL FTANER+AEMD LTQK
Sbjct: 301 GKIHKKNESKRRNFVYSEYKLHRYLKYLNDEFSRTRSFVERKLAFTANERMAEMDILTQK 360

Query: 361 YEAPAYDPTXXXXXXXXXXXXXXXXLQEKHFFGKSFDMPLGPDGLPMPHWLYKLHGLDRE 420
           YEAPAYD T                LQE+H  GKSFDMPLGPDGLPMP+WLYKLHGLDRE
Sbjct: 361 YEAPAYDSTEKEGAEQVDGEQRDGQLQEEHLSGKSFDMPLGPDGLPMPYWLYKLHGLDRE 420

Query: 421 YHCEICANKVYNGRRTFERHFNEGPHLYHLRCLGIEPSLAFKGITKITEAQKLWENMQKQ 480
           Y CEIC+NKVYNGRRTFERHFNE  H+YHLRCLGIEPS  FKGITKI EAQ+LW+NMQ Q
Sbjct: 421 YRCEICSNKVYNGRRTFERHFNEERHIYHLRCLGIEPSSVFKGITKIKEAQELWKNMQGQ 480

Query: 481 PQSATSIASSLTKLKHSRSKLPTXXXXXXXXXXGNVMSKKVFDELKKQGLV 531
            Q  TSIA+   K   S+ K+PT          GNVMSKKV+DELKKQGLV
Sbjct: 481 SQ-LTSIAAVPPKPNPSQLKVPTELELEEEDEEGNVMSKKVYDELKKQGLV 530

>Suva_4.219 Chr4 (387976..389571) [1596 bp, 531 aa] {ON} YDL030W
           (REAL)
          Length = 531

 Score =  761 bits (1966), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 384/531 (72%), Positives = 441/531 (83%)

Query: 1   MSFLETRRSLLEDMEIIENAIVERIRRNPELYYHYIQESSKVFPDVKLPKSSLIAENKLF 60
           M FLET+RSLLED+EIIENAI ERI+RNPELYY YI E+ K+FPD+K P+ SL++ENK++
Sbjct: 1   MDFLETKRSLLEDLEIIENAITERIQRNPELYYRYILEAGKLFPDIKQPRPSLVSENKIY 60

Query: 61  KIKKVKRNRKQVILQQHEISLFLRDYLEKQKSFNNINSQNYSQEDDKDLCSFDEELRQLE 120
           K+KK KRNRKQVILQQHEI LFLRDY EKQ+  N IN     QED+KDL SF+++L++LE
Sbjct: 61  KLKKNKRNRKQVILQQHEIDLFLRDYKEKQRLINEINIPQDVQEDEKDLRSFEQKLQELE 120

Query: 121 DELKSEEENFQLDINSKRNKYALFSSSIDSSKRTNILSERARDLDLNKIFTRDEQYGEYM 180
           +ELK+E+EN+QLDIN KR +YALFSSS + SKRTNILSERARD+DLN++FTRDEQYGEYM
Sbjct: 121 EELKNEQENYQLDINLKRGRYALFSSSAEPSKRTNILSERARDIDLNRLFTRDEQYGEYM 180

Query: 181 ELEQFHSLWLNVFKRSDCSLLQFFDVVELFVDDKKYLLTPPMDRKNDRYMAFLIKLCKYL 240
           ELEQFHSLWLNV KR DCSLLQFFD VELFVDDKKYLL PPMDRKNDRYM+FL+KL +Y+
Sbjct: 181 ELEQFHSLWLNVIKRGDCSLLQFFDTVELFVDDKKYLLAPPMDRKNDRYMSFLMKLSEYV 240

Query: 241 ETFFFKSYALFDKEVIESSIRFDFEQSYCKGSLRSEAKGIHCPFCYKWFKTSPVFENHLT 300
           E+FF+KSYALF+KEV+E  I+ DF+ SYC+G L+SE+KGI+CP CYKWFKT  VFENH+ 
Sbjct: 241 ESFFYKSYALFEKEVVEGLIKSDFDNSYCRGILKSESKGIYCPLCYKWFKTQAVFENHIP 300

Query: 301 GKIHKKNEFKRKDTVYSEYKLHRYLKYLKDEFSHTKSFVERKLVFTANERIAEMDALTQK 360
           GK HKKNE KRK  VYSEYKLHRYL+ LKDE  HTKSFVERKL FTANER+ EMD+LTQK
Sbjct: 301 GKNHKKNEAKRKRIVYSEYKLHRYLRLLKDELFHTKSFVERKLAFTANERMVEMDSLTQK 360

Query: 361 YEAPAYDPTXXXXXXXXXXXXXXXXLQEKHFFGKSFDMPLGPDGLPMPHWLYKLHGLDRE 420
           YEAPAYD T                LQEKH FGKSFDMPLGPDGLPMP+WLYKLHGLDRE
Sbjct: 361 YEAPAYDATEREDDGKGGGEQKDDKLQEKHLFGKSFDMPLGPDGLPMPYWLYKLHGLDRE 420

Query: 421 YHCEICANKVYNGRRTFERHFNEGPHLYHLRCLGIEPSLAFKGITKITEAQKLWENMQKQ 480
           Y CEICAN++YNGRRTFERHFNE  HLYHLRCLGIEPS  FKGITKI EAQ+LW+N Q Q
Sbjct: 421 YPCEICANRIYNGRRTFERHFNEETHLYHLRCLGIEPSSVFKGITKIAEAQRLWKNTQSQ 480

Query: 481 PQSATSIASSLTKLKHSRSKLPTXXXXXXXXXXGNVMSKKVFDELKKQGLV 531
           PQ  +SIA+   + K S++KLP           GNVMSKKV+DELKKQGLV
Sbjct: 481 PQFVSSIAAVPAEKKLSQTKLPAGMELEEEDEQGNVMSKKVYDELKKQGLV 531

>NDAI0G02890 Chr7 (669498..671108) [1611 bp, 536 aa] {ON} Anc_3.160
           YDL030W
          Length = 536

 Score =  482 bits (1240), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 250/541 (46%), Positives = 341/541 (63%), Gaps = 23/541 (4%)

Query: 4   LETRRSLLEDMEIIENAIVERIRRNPELYYHYIQESSKVFPDVK---LPKSSLIAENKLF 60
           LE RRSLLED+EIIENAI  R +RNPELYY  +++ S++FP  +   LP  S++  NK++
Sbjct: 6   LEKRRSLLEDLEIIENAISTRFQRNPELYYSNLKKVSELFPSKQVEELPTHSIMTNNKIY 65

Query: 61  KIKKVKRNRKQVILQQHEISLFLRDYLEKQKSFNNINSQ-NYSQEDDKDLCSFD-EELRQ 118
           K KK+KRNRKQ+ LQQHEISLF++D+  KQK    +  + N+  + +K+      EE + 
Sbjct: 66  KTKKLKRNRKQIALQQHEISLFIKDFFSKQKELETLTREANFKAKKNKEEILLPVEEFKD 125

Query: 119 LEDELKSEEEN-----FQLDINSKRNKYALFSSSIDSSKRTNILSERARDLDLNKIFTRD 173
           +  E+   + N      +L+IN K NKY++FS+S++ S  + ILS RA DLD+N IF+ +
Sbjct: 126 ILSEINEADGNENGNRRELEINDKINKYSMFSNSLNKSHPSTILSSRASDLDINSIFSLE 185

Query: 174 EQYGEYMELEQFHSLWLNVFKRSDCSLLQFFDVVELFVDDKKYLLTPPMDRKNDRYMAFL 233
           EQYGEY+ L  +++ WLNV K+ D + LQF +++++F DDK+Y++ PPMDRKN+ YM +L
Sbjct: 186 EQYGEYLALNPYYTEWLNVVKKEDLTFLQFLNMLKIFQDDKRYIVQPPMDRKNEPYMKYL 245

Query: 234 IKLCKYLETFFFKSYALFDKEVIESSIRFDFEQSYCKGSLRSEAKGIHCPFCYKWFKTSP 293
            + C YLE+FF + Y L D       ++ +F +S  K  L +E KG  C  C KWFKT  
Sbjct: 246 QRYCSYLESFFERKYPLIDSRYTSRELKKEFNKSIIK-PLENEKKGFFCKTCCKWFKTLT 304

Query: 294 VFENHLTGKIHKKNEFKRKDTVYSEYKLHRYLKYLKDEFSHTKSFVERKLVFTANERIAE 353
           VFE+HL G+ H K+  KR   +Y+EYK HRY   LK+E   T  FVERK+ FT  ERI E
Sbjct: 305 VFESHLNGQKHIKSYNKRVQGLYAEYKTHRYSMLLKEEHQSTCEFVERKMAFTVEERITE 364

Query: 354 MDALTQKYEAPAYDPTXXXXXXXXXXXXXXXXLQE---KHFFGKSFDMPLGPDGLPMPHW 410
           M  L +  +APAYD                  L+          S +MPLGPDGLPMP W
Sbjct: 365 MKRLAEICKAPAYDVNEKEGDENNTELNVKDNLKNDGASAMLSGSINMPLGPDGLPMPFW 424

Query: 411 LYKLHGLDREYHCEICANKVYNGRRTFERHFNEGPHLYHLRCLGIEPSLAFKGITKITEA 470
           LYKL GLD  Y CEIC+N+++ GRRTF++HF E  H+YHLRCLGIEP+ AFKG+TKI EA
Sbjct: 425 LYKLQGLDVSYPCEICSNQIFKGRRTFDKHFTEATHIYHLRCLGIEPTPAFKGVTKIEEA 484

Query: 471 QKLWENMQKQPQSATSIASSLTKLKHSRSKLPTXXXXXXXXXXGNVMSKKVFDELKKQGL 530
           Q+LW NM+           ++   K     +P           GN+M++KV+DELKKQGL
Sbjct: 485 QRLWNNMKN---------DTIMGDKKFIETIPDKMAIEVEDKEGNIMTQKVYDELKKQGL 535

Query: 531 V 531
            
Sbjct: 536 A 536

>ZYRO0B04950g Chr2 complement(399973..401493) [1521 bp, 506 aa] {ON}
           similar to uniprot|P19736 Saccharomyces cerevisiae
           YDL030W PRP9 Subunit of the SF3a splicing factor complex
           required for spliceosome assembly
          Length = 506

 Score =  470 bits (1210), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 248/534 (46%), Positives = 334/534 (62%), Gaps = 31/534 (5%)

Query: 1   MSFLETRRSLLEDMEIIENAIVERIRRNPELYYHYIQESSKVFPDVKLPKSSLIAENKLF 60
           M+ LETRR LLE +EIIE+AI +R  RNPELYY  I +   +   ++LP ++ +A N+++
Sbjct: 1   MTTLETRRQLLEGLEIIEDAISQRFGRNPELYYSNITKQVLIDGGIELPSTTAMAVNRIY 60

Query: 61  KIKKVKRNRKQVILQQHEISLFLRDYLEKQKSFNNINSQNYSQEDDKDLCSFDEELRQLE 120
           K K+ KR+RKQ++ QQHEI+LFL   L+KQK  + +N     ++   +  +FD+  R+  
Sbjct: 61  KSKRTKRSRKQLVTQQHEINLFLSQALDKQKELSGVNGTVDVEDYRDEEINFDK-FREAV 119

Query: 121 DELKS---EEENFQLDINSKRNKYALFSSSIDSSKRTNILSERARDLDLNKIFTRDEQYG 177
           D++ S   ++E   LDIN     + +FS++   S    ILSE ARDLDLN+IFTRDEQYG
Sbjct: 120 DQINSKYEDQEGLALDINENIVNHEMFSATFSKS---TILSESARDLDLNQIFTRDEQYG 176

Query: 178 EYMELEQFHSLWLNVFKRSDCSLLQFFDVVELFVDDKKYLLTPPMDRKNDRYMAFLIKLC 237
           + ++LE+FHS WLNV KR+DCS LQFFDV++ F+D  +YLL+PPMDRKN+RY  FLI+L 
Sbjct: 177 DLLDLEKFHSQWLNVIKRADCSYLQFFDVLQKFLDPSEYLLSPPMDRKNERYGQFLIELF 236

Query: 238 KYLETFFFKSYALFDKEVIESSIRFDFEQSYCKGSLRSEAKGIHCPFCYKWFKTSPVFEN 297
           +Y+E FF K Y L +  ++   +  DFE+ Y +  +     G++C  C KWFKT  VF++
Sbjct: 237 QYVEQFFAKVYVLVNSTILSQRMESDFEE-YLRMPIYKSNHGLYCVACGKWFKTPTVFQS 295

Query: 298 HLTGKIHKKNEFKRKDTVYSEYKLHRYLKYLKDEFSHTKSFVERKLVFTANERIAEMDAL 357
           HLTGK H+ N  KR   + +EYKLHRYLK L+ +   T+ FVERK+ FT  ER+ EM  L
Sbjct: 296 HLTGKHHRNNRDKRFTKLQAEYKLHRYLKILQGQLERTRGFVERKMAFTTEERMEEMSRL 355

Query: 358 TQKYEAPAYDPTXXXXXXXXXXXXXXXXLQEKHFFGKSFDMPLGPDGLPMPHWLYKLHGL 417
            + YE P Y P                   EK   G   ++PLG DGLP+P WLYKL GL
Sbjct: 356 ARIYEGPDYAPDEKEIEEKEDSVDTP---SEKKMNG-GIELPLGLDGLPIPLWLYKLQGL 411

Query: 418 DREYHCEICANKVYNGRRTFERHFNEGPHLYHLRCLGIEPSLAFKGITKITEAQKLWENM 477
           D  Y CEIC N+ Y GRR FERHF E  HL+HL+CLGIE S AF+ IT I EAQ LW+ +
Sbjct: 412 DVTYSCEICGNQTYRGRRMFERHFTEPTHLFHLKCLGIEASDAFRSITSIEEAQNLWKRI 471

Query: 478 QKQPQSATSIASSLTKLKHSRSKLPTXXXXXXXXXXGNVMSKKVFDELKKQGLV 531
                S  +  SS                       GNVM+++V++ELKKQGLV
Sbjct: 472 -----SGNNTTSS--------------RDIEVEDEEGNVMTQQVYEELKKQGLV 506

>NCAS0C03540 Chr3 (707075..708631) [1557 bp, 518 aa] {ON} Anc_3.160
           YDL030W
          Length = 518

 Score =  465 bits (1196), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 252/533 (47%), Positives = 338/533 (63%), Gaps = 20/533 (3%)

Query: 1   MSFLETRRSLLEDMEIIENAIVERIRRNPELYYHYIQESSKVFP-DVKLPKSSLIAENKL 59
           +  LE +R+LLED+E+IE+AI +R +RNPELYY  I + S +    +  P  S  + NK+
Sbjct: 2   VPLLEKKRNLLEDLEVIEDAIAKRFQRNPELYYDNITKLSILTNLSIDTPAESNKSNNKI 61

Query: 60  FKIKKVKRNRKQVILQQHEISLFLRDYLEKQKSFNNINSQNYSQEDDKDLCSFDEELRQL 119
           +K KK+KR+RKQ +LQQ EI++FL+D+ E+++   ++  +   ++D+  L +F   ++ +
Sbjct: 62  YKRKKLKRSRKQFVLQQQEINIFLKDFEERRRVLLDLGKETV-KDDNITLETFKTMIQDI 120

Query: 120 EDELKSEEENFQLDINSKRNKYALFSSSIDSSKRTNILSERARDLDLNKIFTRDEQYGEY 179
             +  S E    L IN K  +YA+FS+SI  SK  NILS+R   LD+NK F+R+EQYG+Y
Sbjct: 121 NAKKSSSE---VLPINQKITRYAMFSASISESKPNNILSQRCAGLDINKYFSREEQYGQY 177

Query: 180 MELEQFHSLWLNVFKRSDCSLLQFFDVVELFVDDKKYLLTPPMDRKNDRYMAFLIKLCKY 239
           M+ E F+  WLNV K  D +LLQF +++ +F+D++KYL  PPMDRKN+RYM FL  LC Y
Sbjct: 178 MDFENFYLEWLNVVKTGDVTLLQFLNLLRVFMDEEKYLTHPPMDRKNNRYMKFLESLCSY 237

Query: 240 LETFFFKSYALFDKEVIESSIRFDFEQSYCKGSLRSEAKGIHCPFCYKWFKTSPVFENHL 299
           +E+FFF+ YAL +K  I S I   F + Y K       KG +C  C KWFKT  VF NH+
Sbjct: 238 VESFFFRKYALINKSAITSQIESQFTE-YIKEPTEHSVKGQYCKACAKWFKTESVFVNHI 296

Query: 300 TGKIHKKNEFKRKDTVYSEYKLHRYLKYLKDEFSHTKSFVERKLVFTANERIAEMDALTQ 359
            GK H KNE +RK+ + SEYKLHR+   L++EF  T  F+E K+  TA+ER+ EM  LT+
Sbjct: 297 PGKNHIKNEKQRKNALLSEYKLHRFFFLLQEEFKETYEFIEMKMALTADERMEEMKRLTE 356

Query: 360 KYEAPAY--DPTXXXXXXXXXXXXXXXXLQEKHFFGKSFDMPLGPDGLPMPHWLYKLHGL 417
            YE PAY  D                   + +     SFDMPLGPDGLPMP WLYKL GL
Sbjct: 357 NYEKPAYSSDEKEGDENNADLEHDEQRSGKGQGLLEGSFDMPLGPDGLPMPFWLYKLQGL 416

Query: 418 DREYHCEICANKVYNGRRTFERHFNEGPHLYHLRCLGIEPSLAFKGITKITEAQKLWENM 477
           D EY CEIC+N+++ GRR FE+HF    H YHLRCLGIEPS  FKGITKI EAQKLW ++
Sbjct: 417 DVEYPCEICSNQIFKGRRAFEKHFTAPTHQYHLRCLGIEPSSMFKGITKIKEAQKLWVDI 476

Query: 478 QKQPQSATSIASSLTKLKHSRSKLPTXXXXXXXXXXGNVMSKKVFDELKKQGL 530
             Q  S+  + SS+                      GNVMSKK++DELKKQGL
Sbjct: 477 NSQKNSSKPMVSSI------------ELQVEVEDSVGNVMSKKLYDELKKQGL 517

>TDEL0D04620 Chr4 complement(847509..849059) [1551 bp, 516 aa] {ON}
           Anc_3.160 YDL030W
          Length = 516

 Score =  454 bits (1167), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 239/539 (44%), Positives = 332/539 (61%), Gaps = 31/539 (5%)

Query: 1   MSFLETRRSLLEDMEIIENAIVERIRRNPELYYHYIQESSKVFPDVKLPKSSLIA--ENK 58
           M+ LE+RRS LED+E+IE +I  R  RNP LYY Y+Q+ + +  D+ L  S   A   N+
Sbjct: 1   MNTLESRRSHLEDLEVIEQSIASRFERNPGLYYGYLQKRA-LIDDIPLSSSITNAYNANR 59

Query: 59  LFKIKKVKRNRKQVILQQHEISLFLRDYLEKQKSFNNINS--QNYSQEDDKDLCS-FDEE 115
           ++K K+ KRNRKQ +LQQHEI LFL++ + K +   ++      +S  D++     F + 
Sbjct: 60  IYKAKRSKRNRKQFVLQQHEIDLFLQESMRKLRDLGSLKGPVNTHSLRDEEATFEIFKQN 119

Query: 116 LRQLEDELKS-EEENFQLDINSKRNKYALFSSSIDSSKRTNILSERARDLDLNKIFTRDE 174
           L +++D+ K    ++   D+N + +K+A+FS+    SK   ILS  A++L LN +F+R+E
Sbjct: 120 LEEIKDKYKDLGSDSLFSDVNEEISKHAMFSALTTDSKPVTILSRSAKNLRLNDVFSREE 179

Query: 175 QYGEYMELEQFHSLWLNVFKRSDCSLLQFFDVVELFVDDKKYLLTPPMDRKNDRYMAFLI 234
           QYGEY++L++FHS WLNV + ++C+LLQF+ ++E F+DD++Y+L PPMDRKN RY  FL+
Sbjct: 180 QYGEYLDLDRFHSSWLNVIRSTECTLLQFYSILEKFLDDRQYILAPPMDRKNGRYAEFLV 239

Query: 235 KLCKYLETFFFKSYALFDKEVIESSIRFDFEQSYCKGSLRSEAKGIHCPFCYKWFKTSPV 294
           ++  YLE FF K+  L +   +E  I+ +F +S     L +  KG +C  C KWFK   V
Sbjct: 240 EISNYLEKFFQKANVLLNHTKLERRIQSEFSRSLAT-PLHTGGKGFYCIACCKWFKVPTV 298

Query: 295 FENHLTGKIHKKNEFKRKDTVYSEYKLHRYLKYLKDEFSHTKSFVERKLVFTANERIAEM 354
           F++HLTGK HK N  KR   + +EYKLHRYL  L +EF  T+ F ERK+ FTA ER+ EM
Sbjct: 299 FDSHLTGKHHKNNLSKRSKHLQAEYKLHRYLTLLSEEFRRTREFTERKVAFTAEERMQEM 358

Query: 355 DALTQKYEAPAYDPTXXXXXXXXXXXXXXXXLQEKHFFGKSFDMPLGPDGLPMPHWLYKL 414
             L   Y AP Y P                 L +    G SFD+PLG DGLP+P+WLYKL
Sbjct: 359 ARLNHDYHAPDYGPD---EKEQEDPDSNKAELDKNSALGGSFDLPLGADGLPIPYWLYKL 415

Query: 415 HGLDREYHCEICANKVYNGRRTFERHFNEGPHLYHLRCLGIEPSLAFKGITKITEAQKLW 474
            GLD EY CEIC N+ Y GRR FE+HF E  H +HL+CLGIEPS+ FKGIT I EAQ LW
Sbjct: 416 QGLDVEYSCEICTNQTYKGRRAFEKHFLEPTHTFHLKCLGIEPSITFKGITGIQEAQDLW 475

Query: 475 ENM--QKQPQSATSIASSLTKLKHSRSKLPTXXXXXXXXXXGNVMSKKVFDELKKQGLV 531
                + +PQ+   I   +                      GNV+++KV+ ELKKQGLV
Sbjct: 476 RQTSSRNRPQTQKKIDLEV------------------EDQEGNVLTQKVYQELKKQGLV 516

>Kpol_479.26 s479 complement(50993..52546) [1554 bp, 517 aa] {ON}
           complement(50993..52546) [1554 nt, 518 aa]
          Length = 517

 Score =  452 bits (1163), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 244/535 (45%), Positives = 337/535 (62%), Gaps = 22/535 (4%)

Query: 1   MSFLETRRSLLEDMEIIENAIVERIRRNPELYYHYIQESSKVFPDVKLPKSSLI--AENK 58
           MS++E  RSLLED+E+IE+AI +R +RNPE+YY+Y Q+ + +    +  K+ +   + N+
Sbjct: 1   MSYIENVRSLLEDIEVIEDAISKRFQRNPEVYYYYSQQLNDINGGGEETKTVVSNRSSNR 60

Query: 59  LFKIKKVKRNRKQVILQQHEISLFLRDYLEKQKSFNNINSQNYSQEDDK-DLCSFDEELR 117
           ++K +K KR+RKQVILQQ+E + F++D   K    N I   N ++E +   L  + E + 
Sbjct: 61  IYKSRKHKRDRKQVILQQYETNEFIKDIRSK---LNEIREINVTKESNGIKLDRYVELMG 117

Query: 118 QLEDELK-SEEENFQLDINSKRNKYALFSSSIDSSKRTNILSERARDLDLNKIFTRDEQY 176
            ++ + + S  +N QL IN    +Y++F+SS   +K  NILS++ + L++N  FTRDEQY
Sbjct: 118 SIDTKYEDSVSDNQQLPINKTIFQYSMFTSSNSKNKPNNILSDKCKYLEINDYFTRDEQY 177

Query: 177 GEYMELEQFHSLWLNVFKRSDCSLLQFFDVVELFVDDKKYLLTPPMDRKNDRYMAFLIKL 236
           GEY+ELE+F++ WLNV K ++CS+LQ+  ++E F+D  +Y+L PPMDRKN+RY+ FL  +
Sbjct: 178 GEYLELERFYNNWLNVIKSANCSILQYMSIIEKFLDSAQYILQPPMDRKNERYLKFLEII 237

Query: 237 CKYLETFFFKSYALFDKEVIESSIRFDFEQSYCKGSLRSEAKGIHCPFCYKWFKTSPVFE 296
             YL +F  K+Y L D E     +++D+E   C  SL  + KG  C  C KWFKT  VFE
Sbjct: 238 ETYLTSFIKKTYVLIDWEEEAEVLKYDYEIE-CTKSLMKQGKGNFCRLCGKWFKTESVFE 296

Query: 297 NHLTGKIHKKNEFKRKDTVYSEYKLHRYLKYLKDEFSHTKSFVERKLVFTANERIAEMDA 356
           NHL GK H KN  K  D  + E+K+HR L +L  EF  TK F+ERKL FT++ERI E+D 
Sbjct: 297 NHLPGKNHVKNYKKYYDEYFIEFKIHRILNWLSKEFEETKLFLERKLAFTSDERIKEIDR 356

Query: 357 LTQKYEAPAYDPTXXXXXXXXXXXXXXXXLQEKHFFGKSFDMPLGPDGLPMPHWLYKLHG 416
           +T+ YE PAY                     +      SFDMPLGPDGLPMP+WLYKL G
Sbjct: 357 MTEVYERPAYSVGEPEEGKPNENSSKTSS-NKNDIINGSFDMPLGPDGLPMPYWLYKLQG 415

Query: 417 LDREYHCEICANKVYNGRRTFERHFNEGPHLYHLRCLGIEPSLAFKGITKITEAQKLWEN 476
           LD  Y CEICAN +Y GRRTFE+HF+E  H YHLRCLGIEPS AFKGI  I EA  LW  
Sbjct: 416 LDMTYKCEICANTIYKGRRTFEKHFSETTHNYHLRCLGIEPSSAFKGIVSIKEATDLWGT 475

Query: 477 MQKQPQSATSIASSLTKLKHSRSKLPTXXXXXXXXXXGNVMSKKVFDELKKQGLV 531
           M  + +S+          KH+ S              GNV+SK++++ELKKQGL+
Sbjct: 476 MNVKDKSS----------KHAES---NNYEIEVEDKEGNVLSKEIYEELKKQGLL 517

>KAFR0C01050 Chr3 complement(214128..215648) [1521 bp, 506 aa] {ON}
           Anc_3.160 YDL030W
          Length = 506

 Score =  426 bits (1096), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 237/532 (44%), Positives = 333/532 (62%), Gaps = 27/532 (5%)

Query: 1   MSFLETRRSLLEDMEIIENAIVERIRRNPELYYHYIQE-SSKVFPDVKLPKSSLIAENKL 59
           M+ LE +R L ED+E+IE+AI +R++RNPELYY+Y+++ SS     +++P S  I  N++
Sbjct: 1   MANLEEKRDLCEDLEVIEDAIAKRLQRNPELYYNYLEKLSSFEKHSLEVPSSIDIKNNRV 60

Query: 60  FKIKKVKRNRKQVILQQHEISLFLRDYLEKQKSFNNINSQNYSQEDDKDLCSFDEELRQL 119
           +K KK KR++KQ++ QQHEI LF+ DY  KQK  N +  +  + +   D+  F   + + 
Sbjct: 61  YKSKKAKRSKKQIVAQQHEIRLFIEDYTNKQKGLNMLMKRKDTTQISSDIGDFITSITEN 120

Query: 120 EDELKSEEENFQLDINSKRNKYALFSSSIDSSKRTNILSERARDLDLNKIFTRDEQYGEY 179
           +  +KS        +  K + Y++FS+S   + + +ILS+RA DLD+N+ FTRDEQ+GE 
Sbjct: 121 KSHVKSS-------LKDKIDYYSMFSAS---TTQKSILSKRAADLDINQTFTRDEQFGEC 170

Query: 180 MELEQFHSLWLNVFKRSDCSLLQFFDVVELFVDDKKYLLTPPMDRKNDRYMAFLIKLCKY 239
           M+LE+FH++WL+V K    SLL FF V+E F+D K YL +P MDRKN RY  F+  +  Y
Sbjct: 171 MDLERFHNVWLSVVKDDSYSLLDFFRVIESFLDTKSYLKSPHMDRKNQRYQEFIKTISGY 230

Query: 240 LETFFFKSYALFDKEVIESSIRFDFEQSYCKGSLRSEAKGIHCPFCYKWFKTSPVFENHL 299
           +E+FFFK + L DKE + + ++ DF   Y    L ++  G  C  C K FKT  VF+NHL
Sbjct: 231 VESFFFKKFCLIDKEYVNARLQQDF-ILYLDNPLNNQ-NGFFCVACNKSFKTKSVFDNHL 288

Query: 300 TGKIHKKNEFKRKDTVYSEYKLHRYLKYLKDEFSHTKSFVERKLVFTANERIAEMDALTQ 359
            GK HK+N  KR++++ SEYKL+R+L  L+ EF++TK F ERK+ FTANER  E++ L  
Sbjct: 289 PGKQHKRNVDKRRNSLISEYKLYRFLNLLRTEFNNTKEFTERKISFTANERREELERLNN 348

Query: 360 KYEAPAYDPTXXXXXXXXXXXXXXXXLQEKHFFGKSFDMPLGPDGLPMPHWLYKLHGLDR 419
           +Y AP Y                      +      F+MPLGPDG+PMP WLYKL GLD 
Sbjct: 349 EYNAPVYGSEEQEEGDEEHDEYASKN-GNRSILDGLFNMPLGPDGVPMPFWLYKLQGLDV 407

Query: 420 EYHCEICANKVYNGRRTFERHFNEGPHLYHLRCLGIEPSLAFKGITKITEAQKLWENMQK 479
            Y+CEIC+N+ + GRR FERHFNE  H YHLRCLGI PS  F GIT ITEAQ LW+++Q 
Sbjct: 408 SYYCEICSNREFKGRRAFERHFNEKTHQYHLRCLGITPSPTFVGITAITEAQTLWDHIQ- 466

Query: 480 QPQSATSIASSLTKLKHSRSKLPTXXXXXXXXXXGNVMSKKVFDELKKQGLV 531
                     S  K K    K+            GNV+++KV+D+LK+QGL+
Sbjct: 467 ----------STQKKKAPSGKIDM--DIEVEDADGNVLTRKVYDDLKRQGLL 506

>TPHA0A00910 Chr1 (179145..180728) [1584 bp, 527 aa] {ON} Anc_3.160
           YDL030W
          Length = 527

 Score =  413 bits (1062), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 242/538 (44%), Positives = 338/538 (62%), Gaps = 18/538 (3%)

Query: 1   MSFLETRRSLLEDMEIIENAIVERIRRNPELYYHYIQESSKVF-PDVKLPKSSLIAENKL 59
           MS +E RRSLLED+E+IE++I +R +RNPELYY Y +   KV  PD+ LP  ++   NK+
Sbjct: 1   MSNIEERRSLLEDLEVIESSITKRFQRNPELYYKYQEGLKKVVDPDIDLPSKTVRNTNKI 60

Query: 60  FKIKKVKRNRKQVILQQHEISLFLRDYLEKQKSFNNINSQNYSQEDDK--DLCSFDEELR 117
           +K +K KR RKQ++LQQ+EI+ FL DY  K+K        + S+  DK  D   F+E L 
Sbjct: 61  YKTRKHKRKRKQILLQQYEINEFLDDYRRKEKQLMK-QKLDISEFRDKGADFVKFEELLE 119

Query: 118 QLEDELKSEEENF--QLDINSKRNKYALFSSSIDSSKRTNILSERARDLDLNKIFTRDEQ 175
            + +E  ++ E     L +  K++KYA+FSSSI+ +   NILS+R++ LDLN  F+++EQ
Sbjct: 120 SINNEYNNQNEETPTNLKLLDKKDKYAMFSSSININSPNNILSKRSQLLDLNNYFSKEEQ 179

Query: 176 YGEYMELEQFHSLWLNVFKRSDCSLLQFFDVVELFVDDKKYLLTPPMDRKNDRYMAFLIK 235
           YGE + LEQF+S WLNV K +DCS+L++  ++ +F+D  +++L  PMDRKN RY+ F+  
Sbjct: 180 YGEILNLEQFYSSWLNVVKTADCSILKYILMLNVFLDKDEFILNSPMDRKNLRYVDFIRI 239

Query: 236 LCKYLETFFFKSYALFDKEVIESSIRFDFEQSYCKGSLRSEAKGIHCPFCYKWFKTSPVF 295
           L KY E++  K Y L +    ++ ++  FE+ Y    +  E KG  C  C KWFK S V+
Sbjct: 240 LSKYFESYLEKRYILNNWINFKTELKKSFEK-YSIKPIVKEKKGYLCISCGKWFKNSNVY 298

Query: 296 ENHLTGKIHKKNEFKRKDTVYSEYKLHRYLKYLKDEFSHTKSFVERKLVFTANERIAEMD 355
           + HL GK H+K+   RK  +Y+EYKLHR + YLK EF  +K+++ERKL FT  ER  E+ 
Sbjct: 299 DGHLKGKQHEKHYSNRKMFLYNEYKLHRIINYLKYEFDESKAYMERKLAFTNTERNNELK 358

Query: 356 ALTQKYEAPAY--DPTXXXXXXXXXXXXXXXXLQEKHFFGKSFDMPLGPDGLPMPHWLYK 413
            LT+KYE PAY  D                   ++++   KSF+MPLGPDG+P+P WLYK
Sbjct: 359 LLTKKYEEPAYNKDEPENTDKYEEDDNSMSNAAEDRN---KSFNMPLGPDGMPIPLWLYK 415

Query: 414 LHGLDREYHCEICANKVYNGRRTFERHFNEGPHLYHLRCLGIEPSLAFKGITKITEAQKL 473
           L GLD +Y+CEIC NK Y GR+ +E HF+E  H  HL  LGI+ S AFKGIT I EA+ L
Sbjct: 416 LQGLDIKYNCEICGNKEYQGRKAYENHFSELTHTSHLYFLGIQYSKAFKGITSIAEAKSL 475

Query: 474 WENMQKQPQSATSIASSLTKLKHSRSKLPTXXXXXXXXXXGNVMSKKVFDELKKQGLV 531
           W +M     SA S ++       + +KL            GNVMSKK++DELKKQ LV
Sbjct: 476 WSSMHASNGSAASFSN------QNNTKLAMTEDIEVEDSEGNVMSKKIYDELKKQNLV 527

>SAKL0C08800g Chr3 (807712..809517) [1806 bp, 601 aa] {ON} similar
           to uniprot|P19736 Saccharomyces cerevisiae YDL030W PRP9
           Subunit of the SF3a splicing factor complex required for
           spliceosome assembly
          Length = 601

 Score =  403 bits (1036), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 217/541 (40%), Positives = 314/541 (58%), Gaps = 23/541 (4%)

Query: 1   MSFLETRRSLLEDMEIIENAIVERIRRNPELYYHYIQESSKV-------FPDVKLPKSSL 53
           M  LE +RS+LE +E+IENAI ERIRRNPELYY Y +E   V        P V    +S 
Sbjct: 74  MEILEAKRSVLERLEVIENAISERIRRNPELYYSYYEEQRLVDKENHGLLPPVP---ASD 130

Query: 54  IAENKLFKIKKVKRNRKQVILQQHEISLFLRDYLEKQKSFNNINSQNYSQEDDKDLCSFD 113
           I+ N++  +KK +R+RKQ++LQQHEI  FL +Y   Q+    ++     ++D +      
Sbjct: 131 ISANRIHSVKKSRRSRKQIVLQQHEIDRFLEEY---QREVARLHGIKLDKDDSESAAPDF 187

Query: 114 EELRQLEDELKS---EEENFQLDINSKRNKYALFSSSIDSSKRTNILSERARDLDLNKIF 170
           E+L +   + KS   +E      ++ +  ++++FSSS  + K  +ILS R RDLD+N++F
Sbjct: 188 EQLEKAVKDAKSRYADESRTLAGVDVESVEHSMFSSSTSTHK--DILSTRGRDLDMNRLF 245

Query: 171 TRDEQYGEYMELEQFHSLWLNVFKRSDCSLLQFFDVVELFVDDKKYLLTPPMDRKNDRYM 230
            RDE YGE++ LE FH  WLN+ K    + LQF +VVE+FV D  YL+ P ++R + +Y 
Sbjct: 246 ARDEHYGEFLLLEPFHHEWLNIVKDGSVTALQFMNVVEMFVSDA-YLVAPAVNRGSKKYQ 304

Query: 231 AFLIKLCKYLETFFFKSYALFDKEVIESSIRFDFEQSYCKGSLRSEAKGIHCPFCYKWFK 290
            F+  L  Y+  FF K+Y L +   +   +   F++ Y +  +  E KG+ C  C +WFK
Sbjct: 305 DFVGSLLGYMSEFFRKTYPLVNHSTLGRRLAALFDE-YLRAPVADETKGLFCIPCGRWFK 363

Query: 291 TSPVFENHLTGKIHKKNEFKRKDTVYSEYKLHRYLKYLKDEFSHTKSFVERKLVFTANER 350
              V+++HL+GK H KN  K    + +EYKLH+Y   L    ++T++FVER    TA+ER
Sbjct: 364 LETVYKSHLSGKKHSKNLAKGDGHLLAEYKLHKYCGLLVQTIANTRAFVERNRALTADER 423

Query: 351 IAEMDALTQKYEAPAYDPTXXXXXXXXXXXXXXXXLQEKHFFGKSFDMPLGPDGLPMPHW 410
             E++ L ++YEAPAY                     E    G  F++PLGPDG P+P+W
Sbjct: 424 AQELERLAKEYEAPAYSQHETEDAAREKQQKREPETDEG---GNPFNLPLGPDGYPIPYW 480

Query: 411 LYKLHGLDREYHCEICANKVYNGRRTFERHFNEGPHLYHLRCLGIEPSLAFKGITKITEA 470
           LYKL GLD EY CEIC+N  Y GRR FE+HF+E  H++ LRCLGIEPS  FKGITKI EA
Sbjct: 481 LYKLQGLDIEYSCEICSNHTYKGRRYFEKHFSEARHIFGLRCLGIEPSATFKGITKIQEA 540

Query: 471 QKLWENMQKQPQSATSIASSLTKLKHSRSKLPTXXXXXXXXXXGNVMSKKVFDELKKQGL 530
           + LW  +Q    +     +  +    + +              GNVMS+K++ ELK+QGL
Sbjct: 541 KDLWARIQTSVATGVGAGAIASAATAAATPSTAKLEIEVEDEEGNVMSEKLYHELKRQGL 600

Query: 531 V 531
           +
Sbjct: 601 L 601

>Kwal_56.22799 s56 complement(284859..286454) [1596 bp, 531 aa] {ON}
           YDL030W (PRP9) - RNA splicing factor [contig 184] FULL
          Length = 531

 Score =  370 bits (950), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 210/538 (39%), Positives = 304/538 (56%), Gaps = 38/538 (7%)

Query: 1   MSFLETRRSLLEDMEIIENAIVERIRRNPELYYHYIQESSKVFPDVKLPKSSLIAEN--K 58
           M   E+ RS LE++E+IE AI  R+RRNPE++Y  + E   +  D K+   + I +N  K
Sbjct: 25  MVTYESSRSTLEELELIEGAIAARLRRNPEIFYRNVDELKLITGDAKVDDYAEIEKNSNK 84

Query: 59  LFKIKKVKRNRKQVILQQHEISLFLRDYLEKQKSFNNI--NSQNYSQEDDKDLCSFDEEL 116
           ++ ++K KR RKQ++ Q+HEI LFL +Y +K +S  N+  + + Y Q  D  +  F E +
Sbjct: 85  IYSVRKTKRTRKQILAQEHEIQLFLEEYRKKSESLRNVEFDLRRY-QVTDGSVDGFLEHI 143

Query: 117 RQLEDELKSEEENFQLDINSKRNKYALFSSSIDSSKRTNILSERARDLDLNKIFTRDEQY 176
             +  E+         DI+     Y +FS+S  ++ R +ILS++AR LD+N  FTR+EQY
Sbjct: 144 ETINSEVPD-------DIDDSMENYTMFSNS--TAARRDILSKKARALDINAKFTREEQY 194

Query: 177 GEYMELEQFHSLWLNVFKRSDCSLLQFFDVVELFVDDKKYLLTPPMDRKNDRYMAFLIKL 236
           GE+++LE FH  WL+V K    SLLQF   +E F   K++LLTP ++R + RY  F+  L
Sbjct: 195 GEFLDLEPFHQQWLSVVKDGSVSLLQFLGEIEKFTT-KRFLLTPAVNRGSARYQDFVKAL 253

Query: 237 CKYLETFFFKSYALFDKEVIESSIRFDFEQSYCKGSLRSEA---KGIHCPFCYKWFKTSP 293
             YL+ +  ++Y L D + I + I    + +YC      E     G+ C  C K FK   
Sbjct: 254 LCYLQDYLMRAYPLQDWDKIHAEI----QATYCDYKSHPEEAGDSGLFCIPCDKTFKAET 309

Query: 294 VFENHLTGKIHKKNEFKRKDTVYSEYKLHRYLKYLKDEFSHTKSFVERKLVFTANERIAE 353
           V+  HLTGK H  N  K+ + +  EYKLH    YL  E   T+ FVERKL FT  ER  E
Sbjct: 310 VYLAHLTGKKHINNMNKKDEFLAQEYKLHMLCCYLVQELVRTREFVERKLAFTPEERRQE 369

Query: 354 MDALTQKYEAPAYDPTXXXXXXXXXXXXXXXXLQEKHFFGKSFDMPLGPDGLPMPHWLYK 413
           M+ LT  YE+P Y                    QE      SFD+PLGPDG P+P+WLYK
Sbjct: 370 MERLTTVYESPVYGEQEQEDIAEADQKPTTN--QEDSTPEPSFDLPLGPDGFPIPYWLYK 427

Query: 414 LHGLDREYHCEICANKVYNGRRTFERHFNEGPHLYHLRCLGIEPSLAFKGITKITEAQKL 473
           L GLD EY CE+C N +Y GRR F++HF E  H++ L+ LG++PS +FKG+T I + ++L
Sbjct: 428 LQGLDIEYPCEVCGNLIYKGRRQFDKHFTEQRHIFGLKRLGVDPSPSFKGVTSIDDVKQL 487

Query: 474 WENMQKQPQSATSIASSLTKLKHSRSKLPTXXXXXXXXXXGNVMSKKVFDELKKQGLV 531
           W +++   +++ +      +                    GNVMSKKV++ELKKQGL+
Sbjct: 488 WAHLRSSSKASNAAGPKFEEEIEDEE--------------GNVMSKKVYEELKKQGLI 531

>KLTH0C08888g Chr3 (745663..747183) [1521 bp, 506 aa] {ON} similar
           to uniprot|P19736 Saccharomyces cerevisiae YDL030W PRP9
           Subunit of the SF3a splicing factor complex required for
           spliceosome assembly
          Length = 506

 Score =  369 bits (947), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 211/534 (39%), Positives = 309/534 (57%), Gaps = 31/534 (5%)

Query: 1   MSFLETRRSLLEDMEIIENAIVERIRRNPELYYHYIQESSKVFPDVKLP--KSSLIAENK 58
           M   E  R+ LE++E+IENA+  R+RRNPE++Y  I E   V    +     SS  + NK
Sbjct: 1   MKTYEDARATLEELELIENAVTSRLRRNPEIFYRNIDEVDLVEHSGRFDHIPSSQKSANK 60

Query: 59  LFKIKKVKRNRKQVILQQHEISLFLRDYLEKQKSFNNIN-SQNYSQEDDKDLCSFDEELR 117
           ++ +KK +R+RKQ++ Q+HEI  FL  YL+  +S   +    +  + D+  +    E + 
Sbjct: 61  VYTVKKSRRSRKQILAQEHEIKSFLSQYLKDCQSLGRVEFDMSEYRVDNGSVNKLLEHIE 120

Query: 118 QLEDELKSEEENFQLDINSKRNKYALFSSSIDSSKRTNILSERARDLDLNKIFTRDEQYG 177
           +++ E+  +++ F        ++YA+FSSS  S+K  NI+S +A++LD+N  FTRDEQYG
Sbjct: 121 RIK-EIHPKDDEFG-------DQYAMFSSSTPSNK--NIISRKAQNLDINSYFTRDEQYG 170

Query: 178 EYMELEQFHSLWLNVFKRSDCSLLQFFDVVELFVDDKKYLLTPPMDRKNDRYMAFLIKLC 237
           EY++LE FH  WL+V K  D +LLQF   VE F D ++YLL P ++R + RY  F+  L 
Sbjct: 171 EYLDLEPFHQKWLSVVKNGDVTLLQFLSEVEKFTD-QRYLLQPAVNRNSSRYREFVASLH 229

Query: 238 KYLETFFFKSYALFDKEVIESSIRFDFEQSYCKGSLRSEAKGIHCPFCYKWFKTSPVFEN 297
            YL  +  ++Y L   ++I +  +  +  +  K  + S   G+ C  C K FKT  V+  
Sbjct: 230 HYLSDYAARAYPLLSWDLIHAKAQELYHTNVAK-PIPSGESGVFCIPCDKRFKTDTVYNA 288

Query: 298 HLTGKIHKKNEFKRKDTVYSEYKLHRYLKYLKDEFSHTKSFVERKLVFTANERIAEMDAL 357
           HL GK H  N  K    +  E+ LH + +YL  E + T+ FVERKL FT  ER  E++ L
Sbjct: 289 HLPGKRHVGNLHKNSSFLTQEHSLHIFCRYLSRELARTREFVERKLAFTTEERTQELERL 348

Query: 358 TQKYEAPAYDPTXXXXXXXXXXXXXXXXLQEKHFFGKSFDMPLGPDGLPMPHWLYKLHGL 417
           T  Y++P Y                    +E      S ++PLGPDG P+P+WLYKL GL
Sbjct: 349 TDIYDSPVYGRQEQEDAQEDENKETED--KEDSVLDSSMNLPLGPDGFPIPYWLYKLQGL 406

Query: 418 DREYHCEICANKVYNGRRTFERHFNEGPHLYHLRCLGIEPSLAFKGITKITEAQKLWENM 477
           D EY CE+C N VYNGRR F++HF E  H++ LR LGIEPS +FKG+TKI +A++LW ++
Sbjct: 407 DIEYPCELCGNFVYNGRRQFDKHFGEQRHVFGLRRLGIEPSASFKGVTKIDDAKQLWSHL 466

Query: 478 QKQPQSATSIASSLTKLKHSRSKLPTXXXXXXXXXXGNVMSKKVFDELKKQGLV 531
           +    +++   SS  KL+                  GNVMSKKV+DELKKQGL+
Sbjct: 467 R---STSSGRVSSEGKLE-----------VEVEDEDGNVMSKKVYDELKKQGLL 506

>Ecym_3549 Chr3 complement(1038111..1039709) [1599 bp, 532 aa] {ON}
           similar to Ashbya gossypii AEL085W
          Length = 532

 Score =  367 bits (943), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 209/543 (38%), Positives = 314/543 (57%), Gaps = 23/543 (4%)

Query: 1   MSFLETRRSLLEDMEIIENAIVERIRRNPELYYHYIQESSKVFPDVK----LPKSSLIAE 56
           MS LE +R++LE++E+IE+AI +RI RNPE++Y YI E S V  D K    +P   + A 
Sbjct: 1   MSLLEEKRAILEELELIEDAISDRIARNPEVFYSYIHELSIVNSDEKVLSNIPNVDITA- 59

Query: 57  NKLFKIKKVKRNRKQVILQQHEISLFLRDYLEKQKSFNNINSQNYSQ--EDDKDLCSFDE 114
           N+++ IKK KR+RKQ++LQQHEIS FL  YL+  K  N   + N  +  + +++   F +
Sbjct: 60  NRVYMIKKSKRSRKQILLQQHEISKFLSYYLKNVKKLNGYKNDNVDEFKDHNQNFELFRD 119

Query: 115 ELRQLEDEL--KSEEENFQLDINSKRNKYALFSSSIDSSKRTNILSERARDLDLNKIFTR 172
           ++++++++   +S  E F   + +++ +Y +FS+S  + ++ +ILS   + +D+NK F+ 
Sbjct: 120 QIQRIKEKYAEESNSEAFDASLEARKYQYTMFSNS--NHQKKDILSLEGQSIDINKKFSW 177

Query: 173 DEQYGEYMELEQFHSLWLNVFKRSDCSLLQFFDVVELFVDDKKYLLTPPMDRKNDRYMAF 232
           +E YGEY+ L+Q+H  +LN+ K ++ SLLQF   ++ F D   +L  PP+DR +  Y  F
Sbjct: 178 EEHYGEYLHLDQYHQEYLNIVKNANVSLLQFIGFLQTFCD-HGHLKNPPVDRNSKIYHGF 236

Query: 233 LIKLCKYLETFFFKSYALFDKEVIESSIRFDFEQSYCKGSLRSEAKGIHCPFCYKWFKTS 292
           L +L KY+ +FF  ++ L +    +  I+  F + Y    +   ++G  C  C KWFK  
Sbjct: 237 LERLLKYVNSFFESAFPLINHVQFQKRIKNSFVE-YTSTPIEDSSRGCLCVACGKWFKAI 295

Query: 293 PVFENHLTGKIHKKNEFKRKDTVYSEYKLHRYLKYLKDEFSHTKSFVERKLVFTANERIA 352
            V+ +HL G+ H  N   R+ ++  EY L      L  E   TKSFVERK  FT  ERI 
Sbjct: 296 TVYTSHLQGRKHLNNLKCRRRSLMVEYTLQNLFTCLNKELVSTKSFVERKYAFTVEERIQ 355

Query: 353 EMDALTQKYEAPAYDPTXXXXXXXXXXXXXXXXLQEKHFFGKSFDMPLGPDGLPMPHWLY 412
           E+  L   Y A AY                              ++PLGPDG P+P+WLY
Sbjct: 356 ELAKLRDAYNANAYGDHEREDSQEDLSVSSSKETPPDD--NNPLNLPLGPDGYPIPYWLY 413

Query: 413 KLHGLDREYHCEICANKVYNGRRTFERHFNEGPHLYHLRCLGIEPSLAFKGITKITEAQK 472
           KL GLD EY CEIC N +Y GRR FERHF+E  H Y LRCLGIEP+  FKGI+KI++AQ 
Sbjct: 414 KLQGLDIEYTCEICGNHLYKGRRVFERHFHEQRHTYGLRCLGIEPTSTFKGISKISDAQI 473

Query: 473 LWENMQKQPQ----SATSIASSLTKLKHSRSKLPTXXXXXXXXXXGNVMSKKVFDELKKQ 528
           LW  ++        SAT   ++ ++   + +KL            GNVMS +V+++LKKQ
Sbjct: 474 LWSRLKNNSHLNSASATYPDATSSRAVVTNNKLEI----EMEDEDGNVMSHRVYEDLKKQ 529

Query: 529 GLV 531
           GL+
Sbjct: 530 GLL 532

>CAGL0K01573g Chr11 (139809..141359) [1551 bp, 516 aa] {ON} similar
           to uniprot|P19736 Saccharomyces cerevisiae YDL030w
           Pre-mRNA splicing factor PRP9
          Length = 516

 Score =  366 bits (939), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 215/546 (39%), Positives = 310/546 (56%), Gaps = 50/546 (9%)

Query: 4   LETRRSLLEDMEIIENAIVERIRRNPELYYHYIQESSKVFPDVKLPKSSLIAE---NKLF 60
           L+T RSLLED+E+IE+AI  R +RNPELYY Y      +  D+  PK  L  +   NK++
Sbjct: 3   LDTVRSLLEDIEVIEDAISSRFQRNPELYYDYRIHLEGIRDDI--PKLGLDDDRMVNKIY 60

Query: 61  KIKKVKRNRKQVILQQHEISLFLRDYLEKQKSF----NNINSQNYSQEDDKDLCSFDEEL 116
           K +K KR  KQ   QQ+EI+ FL D  +K K      N + S     +D +  C F E L
Sbjct: 61  KARKHKRTLKQKRTQQYEINTFLDDIFKKNKYILKVRNQLKSDGLKYKDSE--CKF-ELL 117

Query: 117 RQL-----------EDELKSEEENFQLDINSKRNKYALFSSSIDSSKRTNILSERARDLD 165
           ++L           +D +     +  LDI+   N+Y +   ++ + K   ++SER   LD
Sbjct: 118 KKLLGDEPTEDEDEDDSISKSNSSRLLDIDETINRYNM---NLGNGK---LVSERCSLLD 171

Query: 166 LNKIFTRDEQYGEYMELEQFHSLWLNVFKRSDCSLLQFFDVVELFVDDKKYLLTPPMDRK 225
           +N IF +DEQ G  ++ E  +  WLN+ K    +  +F   +E F+DDKKYLL P MDRK
Sbjct: 172 INTIFQKDEQDGFIIDFEPLYRRWLNIVKDGTLTYPKFISNLEKFIDDKKYLLDPVMDRK 231

Query: 226 NDRYMAFLIKLCKYLETFFFKSYALFDKEVIESSIRFDFEQSYCKGSLRSEAKGIHCPFC 285
              Y  F+++ C ++ET +FK   L ++E I+  +  DFE    K ++ +E+   +C +C
Sbjct: 232 TKGYCEFVVEACDFVETQYFKRNILLNEEQIKGKLHRDFENHVTK-AIITESGIYYCLYC 290

Query: 286 YKWFKTSPVFENHLTGKIHKKNEFKRKDTVYSEYKLHRYLKYLKDEFSHTKSFVERKLVF 345
            K F ++ ++++H TGK H K+     D+  +E+KLH Y+  +++EF +TK +V+RK+ F
Sbjct: 291 DKMFNSAHIYDSHRTGKAHSKSVSNYHDSFRAEFKLHVYVSCMREEFENTKEYVDRKMAF 350

Query: 346 TANERIAEMDALTQKYEAPAYDPTXXXXXXXXXXXXXXXXLQEKHFFGKSFDMPLGPDGL 405
           T  ER+ EM+ LTQ+Y  P YDPT                 + K   G   DMPLGPDGL
Sbjct: 351 TNKERLEEMEKLTQEYHRPVYDPTEKEGDVEEDNSKSKTKDELKEMLGLGEDMPLGPDGL 410

Query: 406 PMPHWLYKLHGLDREYHCEICANKVYNGRRTFERHFNEGPHLYHLRCLGIEPSLAFKGIT 465
           P+P+WLYKL GLD    CEIC N+VY G + F++HF+   H YHL+CLGIEPS AF+GIT
Sbjct: 411 PIPYWLYKLQGLDVGQECEICGNQVYKGHKNFDKHFSGPTHTYHLKCLGIEPSSAFQGIT 470

Query: 466 KITEAQKLWENMQKQPQSATSIASSLTKLKHSRSKLPTXXXXXXXXXXGNVMSKKVFDEL 525
           KI EAQ LW+ MQ+   +   +A  +                      GNVMSK +++EL
Sbjct: 471 KIKEAQALWKQMQR--NTTQELAEEV------------------EDKEGNVMSKDIYEEL 510

Query: 526 KKQGLV 531
           KKQGLV
Sbjct: 511 KKQGLV 516

>AEL085W Chr5 (467583..469166) [1584 bp, 527 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDL030W (PRP9)
          Length = 527

 Score =  355 bits (912), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 213/542 (39%), Positives = 308/542 (56%), Gaps = 26/542 (4%)

Query: 1   MSFLETRRSLLEDMEIIENAIVERIRRNPELYYHYIQESSKVFPDVKLPKS---SLIAEN 57
           MS LE +R++LE++E+IE AI  RI RNPE+YY Y++E   V PD K+  +     I  N
Sbjct: 1   MSSLEEKRAILEELEVIEGAISARIERNPEIYYSYLKELQLVNPDEKVLDNISKDDINSN 60

Query: 58  KLFKIKKVKRNRKQVILQQHEISLFLRDYLEKQKSFNNINSQNYSQEDDKDLC--SFDEE 115
           +++  KK +R+RKQ+ILQQHEI+ FL+ Y ++ K  N   S +     D ++   +F+ +
Sbjct: 61  RIYVNKKARRSRKQLILQQHEIARFLQRYWKQVKRLNAFKSDDIESLRDPNMNFETFEAD 120

Query: 116 LRQLEDELKSEEENFQLDINS---KRNKYALFSSSIDSSKRTNILSERARDLDLNKIFTR 172
           +++L+ E ++E  + +  I+S   KR +Y++FS+S  S     ILS   + +D+NK+F  
Sbjct: 121 IKELQ-ERQAEGADSESAISSLERKRREYSMFSAS--SGADQTILSNVGQFIDVNKLFMW 177

Query: 173 DEQYGEYMELEQFHSLWLNVFKRSDCSLLQFFDVVELFVDDKKYLLTPPMDRKNDRYMAF 232
           +E YGEY+ LE+ H  WLNV K    +LLQF   +E F     YL  PP+DR + RY  F
Sbjct: 178 EEHYGEYLFLERLHQDWLNVVKDGSVTLLQFIAFLESFAG-TGYLTAPPVDRNSKRYQVF 236

Query: 233 LIKLCKYLETFFFKSYALFDKEVIESSIRFDFEQSYCKGSLRSEAKGIHCPFCYKWFKTS 292
           + KL  YLE  F  +Y L +  ++E+ I   FE SY    +    +G+ C  C K FK  
Sbjct: 237 IQKLVTYLEGAFRNTYPLLNHRLLENRISQSFE-SYIANPVEDPPRGLLCIACGKHFKVG 295

Query: 293 PVFENHLTGKIHKKNEFKRKDTVYSEYKLHRYLKYLKDEFSHTKSFVERKLVFTANERIA 352
            VF  HL GK H ++   +  T+ +E+ LH  + YL     +T++ VERK  FT+ ER  
Sbjct: 296 TVFAGHLLGKKHAQSVTTKVATLRAEHTLHYLVIYLATSIENTRALVERKYAFTSGERNR 355

Query: 353 EMDALTQKYEAPAYDPTXXXXXXXXXXXXXXXXLQEKHFFGKSFDMPLGPDGLPMPHWLY 412
           EM  +   Y+APAY                     + +      ++PLGP G P+P+WLY
Sbjct: 356 EMATIRDAYDAPAYSSGEPEDVIETPQQQQNAHPDDVN----PLNLPLGPMGYPIPYWLY 411

Query: 413 KLHGLDREYHCEICANKVYNGRRTFERHFNEGPHLYHLRCLGIEPSLAFKGITKITEAQK 472
           KL GLD EY CEICAN VY GRR     F   P  Y LRCLGIEPS AFK I  I EAQ+
Sbjct: 412 KLQGLDIEYACEICANHVYKGRRISNAIFRTAP-CYGLRCLGIEPSPAFKDIYNIAEAQQ 470

Query: 473 LWENMQKQ--PQS-ATSIASSLTKLKHSRSKLPTXXXXXXXXXXGNVMSKKVFDELKKQG 529
           L++++Q    P   AT  A +++   ++R KL            GNVM+ +V+++LKKQG
Sbjct: 471 LFQSLQSSTGPAGLATRRAGAISSSANTR-KLEV----EVEDEDGNVMTHQVYEDLKKQG 525

Query: 530 LV 531
           L+
Sbjct: 526 LL 527

>KNAG0K01120 Chr11 (218749..220332) [1584 bp, 527 aa] {ON} Anc_3.160
           YDL030W
          Length = 527

 Score =  347 bits (889), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 199/542 (36%), Positives = 295/542 (54%), Gaps = 31/542 (5%)

Query: 4   LETRRSLLEDMEIIENAIVERIRRNPELYYHYIQESSKVF----PDVKLPKSSLIAENKL 59
           L+ R SL+  +EI+E+AI  R +RNP LYY+ +    K+     P V  P    + +NK+
Sbjct: 3   LDERVSLIRQLEILEDAIAARFQRNPALYYNSVPMLKKLTMQAEPKV-CPPQDHVTKNKV 61

Query: 60  FKIKKVKRNRKQVILQQHEISLFLRDYLEKQKSFNNINSQNYSQEDDKDLCSFDEELRQL 119
           ++++K  R  KQV  QQHEI LFL+D  +     +        +   K+L  F   +  L
Sbjct: 62  YRVEKSARKVKQVATQQHEIKLFLQDRTDILNKLSRAQESGPGESQYKNLDEFKTAINGL 121

Query: 120 EDELKSEEENFQLDINSKRNKYALFSSSIDSSKRTNILSERARDLDLNKIFTRDEQYGEY 179
            +    +    Q    S++++YA+FSSSI+    TNILS RA +LD+N IF R+EQYG Y
Sbjct: 122 TESNIPKRSGLQ----SEKDQYAMFSSSIEKPP-TNILSARALELDINAIFNREEQYGTY 176

Query: 180 MELEQFHSLWLNVFKRSDCSLLQFFDVVE---LFVDDK-KYLLTPPMDRKNDRYMAFLIK 235
           ++LE +H +WL + K    ++LQ+ + +E   L  DDK  YL +PP+DR N +Y+ FL +
Sbjct: 177 IQLENYHPMWLELMKEPSVTVLQYLESLERMFLNADDKTSYLTSPPIDRDNKQYLRFLER 236

Query: 236 LCKYLETFFFKSYALFDKEVIESSIRFDFEQSYCKGSLRSEAKGIHCPFCYKWFKTSPVF 295
           L  YL+T+  K + L D+ ++E  +   F+  Y    + ++     CP C K ++   +F
Sbjct: 237 LGLYLKTYIAKKFPLIDQHLVEDYLLDHFKNRYVNKPVSTDQNTQFCPVCDKRYEGMQLF 296

Query: 296 ENHLTGKIHKKNEFKRKDTVYSEYKLHRYLKYLKDEFSHTKSFVERKLVFTANERIAEMD 355
            +HL  K H +   KR   + +E+++  YL  L  EF  +K+F+ERKL FT  ER  E+ 
Sbjct: 297 NDHLLNKFHAQQRGKRLPLLQAEFRVSVYLTALSKEFKDSKNFMERKLAFTYAERQEELQ 356

Query: 356 ALTQKYEAPAYDPTX------XXXXXXXXXXXXXXXLQEKHFFGKSFDMPLGPDGLPMPH 409
            LT +YEAP Y+P                        Q         +MPLGPDG+P+P 
Sbjct: 357 RLTTEYEAPNYNPALEHEDNPAETDKNKNGKTHSENKQTAELESMFTNMPLGPDGMPIPL 416

Query: 410 WLYKLHGLDREYHCEICANKVYNGRRTFERHFNEGPHLYHLRCLGIEPSLAFKGITKITE 469
           WLYKL GLD +Y CEIC N  + GRR +++HF+E  H Y L+CLGI  S AF GI  I E
Sbjct: 417 WLYKLQGLDVKYTCEICGNAEFKGRRAYQKHFHEPLHEYRLKCLGITRSKAFDGIALIEE 476

Query: 470 AQKLWENMQKQPQSATSIASSLTKLKHSRSKLPTXXXXXXXXXXGNVMSKKVFDELKKQG 529
           AQ+LW  +  +  SA + +    KL+                  GNVMS+ V+ +LK+QG
Sbjct: 477 AQELWAKISGKSTSARAGSDDSLKLE-----------IEVEDEDGNVMSQTVYQDLKRQG 525

Query: 530 LV 531
           L+
Sbjct: 526 LL 527

>KLLA0F24662g Chr6 complement(2292807..2294399) [1593 bp, 530 aa]
           {ON} similar to uniprot|P19736 Saccharomyces cerevisiae
           YDL030W PRP9 Subunit of the SF3a splicing factor complex
           required for spliceosome assembly
          Length = 530

 Score =  263 bits (673), Expect = 5e-81,   Method: Compositional matrix adjust.
 Identities = 180/532 (33%), Positives = 284/532 (53%), Gaps = 16/532 (3%)

Query: 5   ETRRSLLEDMEIIENAIVERIRRNPELYYHYIQESSKVFPDV-KLPKSSLIAENKLFKIK 63
           E RR +LE++E+IE+AI  R+RRNPE++Y + +    +  +   +PK  + A N++++ K
Sbjct: 10  EERRKILEELEVIEDAISSRLRRNPEIFYRFNEALHNLGVEAWAVPKLDVSA-NRIYRSK 68

Query: 64  KVKRNRKQVILQQHEISLFLRDYLEKQKSFNNINSQNYSQEDDKDLCSFDEELRQLEDEL 123
           K KR+RKQ+  Q++EI+LFL  Y    KS           E  +D  +  E+   +  E+
Sbjct: 69  KSKRSRKQIKAQEYEIALFLGRYRRLLKSLQKHKLSEEHLEYFRDTNASFEQFETVTTEV 128

Query: 124 KSEEENFQLDINSKRNKYALFSSSIDSSKRTNILSERARDLDLNKIFTRDEQYGEYMELE 183
              + N +  +  K + Y +FS    +SK  NI+S   + +DL++ F RDE +G Y++L 
Sbjct: 129 LEGQVNSRSLVEVKSD-YEMFSGPQAASK--NIISPIGQIIDLSRNFARDENFGTYLDLS 185

Query: 184 QFHSLWLNVFKRSDCSLLQFFDVVELFVDDKKYLLTPPMDRKNDRYMAFLIKLCKYLETF 243
           +    WLN+ KR+D ++L F  ++E F +   YLL P +DR    Y   + +L KY + +
Sbjct: 186 EQFKKWLNIIKRADLTILSFLKMLESF-ETYDYLLNPSLDRDTKEYNQLVTELLKYYKAY 244

Query: 244 FFKSYALFDKEVIESSIRFDFEQSYCKGSLRS---EAKGIHCPFCYKWFKTSPVFENHLT 300
           + K+Y L DKE++  +I   F++    G   S   E+  ++     +WF +   F  H+ 
Sbjct: 245 YSKAYPLVDKEILSKTIHNGFDKYVRTGITESPSKESGKMYSVVFNRWFDSQSEFNTHVQ 304

Query: 301 GKIHKKNEFKRKDTVYSEYKLHRYLKYLKDEFSHTKSFVERKLVFTANERIAEMDALTQK 360
            +       + +  +  EY  H + K+L     +T SF ERKL FT  E   E++ L ++
Sbjct: 305 TEQFNIALSRNRKRLMKEYTFHCFSKFLSKVLQNTISFTERKLAFTDEEFTEELEKLQEQ 364

Query: 361 YEAPAYDPTXXXXXXXXXXXXXXXXLQEKHFFGKSFDMPLGPDGLPMPHWLYKLHGLDRE 420
           YE+P Y                    +E       +++PLGPDG P+P WL K+ GLD +
Sbjct: 365 YESPIYAKDESEDKPSYIDNAEDTAQKESMDPTNPYNLPLGPDGFPIPRWLIKVQGLDVK 424

Query: 421 YHCEICANKVYNGRRTFERHFNEGPHLYHLRCLGIEPSLAFKGITKITEAQKLWENMQ-K 479
           Y CEIC N++Y+GRR FE+HF    H   L+ LGI PSLAFK +T I E  +LW+ +Q K
Sbjct: 425 YVCEICGNQIYHGRREFEKHFPLKKHSEGLKSLGITPSLAFKDVTTIVEVTELWKALQAK 484

Query: 480 QPQSATSIASSLTKLKHSRSKLPTXXXXXXXXXXGNVMSKKVFDELKKQGLV 531
               +    S ++ +K     L T          GNVMS +V++ELKKQGL+
Sbjct: 485 STLKSGEPFSKISTVKEPEMVLET------EDNEGNVMSVQVYEELKKQGLL 530

>TBLA0B01600 Chr2 (352382..353842) [1461 bp, 486 aa] {ON} Anc_3.160
           YDL030W
          Length = 486

 Score = 86.7 bits (213), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 82/326 (25%), Positives = 136/326 (41%), Gaps = 37/326 (11%)

Query: 164 LDLNKIFTRD--EQYGEYMELEQFHSLWLN-VFKR----SDCSLLQFFD-VVELFVDDKK 215
           +D+N ++ RD  E+YG  + L++F++LW+  + KR    S  +L++F+  V + F+ D+ 
Sbjct: 112 IDINSVY-RDPEEEYGTSISLDRFYNLWIGHLTKRKTSESPPTLVEFYGQVTKQFLHDRW 170

Query: 216 YLLT--PPMDRKNDRYMAFLIKLCKYLETFFFK---------SYALFDKEVIESSIRFDF 264
              T  PP         + +  + +YL  F  +         S A+  +     ++    
Sbjct: 171 IDETAFPP---------SLIAGMLEYLTGFQERVDIVKPQDSSAAITRRLRRHIALSSSS 221

Query: 265 EQSYCKGSLRSEAKGIHCPFCY-KWFKTSPVFENHLTGKIHKKNEFKRKDTVYSEYKLHR 323
             S    +       + C  C  K F T  VF +HL    H K E  R   +     +  
Sbjct: 222 CSSSSSSASSPSPWPLTCIVCGPKKFATEQVFHHHLNSNRHLKREASRLPIMIPIQSVRE 281

Query: 324 YLKYLKDEFSHTKSFVERKLVFTANERIAEMDALTQKYEAPAYDPTXXXXXXXXXXXXXX 383
            L+ L  E +   + VER+L  T  ER AE  A  Q+                       
Sbjct: 282 KLQTLAAELASGAARVERQLNMTPQERFAE-HAAQQRIRTAVQGRGGGDTTATPSATPSA 340

Query: 384 XXLQEKHFFGKSFDMPLGPDGLPMPHWLYKLHGLDREYHCEICANKVYNGRRTFERHFNE 443
                      + ++    DG  +P WLY+L GL   + CE+C  + ++GR  +ERHF  
Sbjct: 341 TPAATTPASASTVEV----DGRHVPRWLYRLQGLSSIFTCELCDGREFHGRTRYERHFTS 396

Query: 444 GPHLYHLRCLGI--EPSLAFKGITKI 467
             H   L CLG+  E  + F+G+ K+
Sbjct: 397 TQHRTRLVCLGVPAEQHVQFRGLGKL 422

>KLTH0G12738g Chr7 complement(1085500..1086804) [1305 bp, 434 aa]
           {ON} highly similar to uniprot|P32485 Saccharomyces
           cerevisiae YLR113W HOG1 Mitogen-activated protein kinase
           involved in osmoregulation via three independent
           osmosensors mediates the recruitment and activation of
           RNA Pol II at Hot1p-dependent promoters localization
           regulated by Ptp2p and Ptp3p
          Length = 434

 Score = 37.0 bits (84), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 16/32 (50%), Positives = 21/32 (65%)

Query: 338 FVERKLVFTANERIAEMDALTQKYEAPAYDPT 369
            +E+ LVF  N+RI   DAL+  Y AP +DPT
Sbjct: 278 LLEKMLVFDPNKRITAADALSHPYLAPYHDPT 309

>Kwal_56.23841 s56 (732202..733500) [1299 bp, 432 aa] {ON} YLR113W
           (HOG1) - mitogen-activated protein kinase (MAP kinase)
           [contig 171] FULL
          Length = 432

 Score = 37.0 bits (84), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 16/32 (50%), Positives = 21/32 (65%)

Query: 338 FVERKLVFTANERIAEMDALTQKYEAPAYDPT 369
            +E+ LVF  N+RI   DAL+  Y AP +DPT
Sbjct: 278 LLEKMLVFDPNKRITAADALSHPYLAPYHDPT 309

>ZYRO0D06182g Chr4 complement(529121..530416) [1296 bp, 431 aa] {ON}
           uniprot|O93982 Zygosaccharomyces rouxii HOG1 Mitogen-
           activated protein kinase HOG1
          Length = 431

 Score = 35.8 bits (81), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 16/32 (50%), Positives = 19/32 (59%)

Query: 338 FVERKLVFTANERIAEMDALTQKYEAPAYDPT 369
            +ER LVF   +RI   DAL   Y AP +DPT
Sbjct: 278 LLERMLVFDPKKRITAADALVHPYLAPYHDPT 309

>Suva_10.158 Chr10 complement(283475..283984) [510 bp, 169 aa] {ON}
           YLR074C (REAL)
          Length = 169

 Score = 34.3 bits (77), Expect = 0.35,   Method: Composition-based stats.
 Identities = 17/58 (29%), Positives = 31/58 (53%), Gaps = 8/58 (13%)

Query: 281 HCPFCYKWFKTSPVFENHLTGKIHKKNEFKRKDTVYSE--------YKLHRYLKYLKD 330
           +C  C K+ +T+   + HL GK+HK+   + K   Y++        Y L+++L  +KD
Sbjct: 50  YCIHCAKYMETAIALKTHLKGKVHKRRVKELKGVPYTQEVSDAAAGYNLNKFLDRVKD 107

>AGR048C Chr7 complement(807464..808825) [1362 bp, 453 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR113W
           (HOG1)
          Length = 453

 Score = 35.4 bits (80), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 25/68 (36%), Positives = 32/68 (47%), Gaps = 11/68 (16%)

Query: 313 DTVYSEYKL-------HRYLKYLKDEFSHTKS----FVERKLVFTANERIAEMDALTQKY 361
           DT+ SE  L       HR      + F + K      +E+ LVF   +RI   DALT  Y
Sbjct: 248 DTICSENTLKFVTSLPHRDPVPFTERFKNLKPDAVDLLEKMLVFDPKKRITAGDALTHPY 307

Query: 362 EAPAYDPT 369
            AP +DPT
Sbjct: 308 LAPYHDPT 315

>YLR113W Chr12 (371620..372927) [1308 bp, 435 aa] {ON}
           HOG1Mitogen-activated protein kinase involved in
           osmoregulation; acts via three independent osmosensors;
           mitophagy-specific regulator; mediates the recruitment
           and activation of RNA Pol II at Hot1p-dependent
           promoters; localization regulated by Ptp2p and Ptp3p
          Length = 435

 Score = 35.0 bits (79), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 15/32 (46%), Positives = 19/32 (59%)

Query: 338 FVERKLVFTANERIAEMDALTQKYEAPAYDPT 369
            +E+ LVF   +RI   DAL   Y AP +DPT
Sbjct: 278 LLEKMLVFDPKKRITAADALAHPYSAPYHDPT 309

>TBLA0G00170 Chr7 complement(26304..28283) [1980 bp, 659 aa] {ON}
           Anc_2.15 YNL227C
          Length = 659

 Score = 35.0 bits (79), Expect = 0.52,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 27/50 (54%), Gaps = 2/50 (4%)

Query: 263 DFEQSYCKGSLRSEAKGI--HCPFCYKWFKTSPVFENHLTGKIHKKNEFK 310
           D +Q     +L  E + I   C  C K FK+    ENHL+ ++HKKN +K
Sbjct: 334 DIDQFKESSTLAGEEEVIVYECDICNKIFKSLKQLENHLSTRMHKKNVYK 383

>Ecym_1531 Chr1 complement(1094489..1095004) [516 bp, 171 aa] {ON}
           similar to Ashbya gossypii ABR234C
          Length = 171

 Score = 33.9 bits (76), Expect = 0.52,   Method: Composition-based stats.
 Identities = 14/38 (36%), Positives = 23/38 (60%)

Query: 281 HCPFCYKWFKTSPVFENHLTGKIHKKNEFKRKDTVYSE 318
           +C  C K+F+T+   + HL GKIHK+   + K   Y++
Sbjct: 50  YCIHCAKYFETAVALKTHLKGKIHKRRVKELKGVPYTQ 87

>NDAI0D02900 Chr4 complement(679279..685068) [5790 bp, 1929 aa] {ON}
            Anc_4.50 YLR305C
          Length = 1929

 Score = 34.7 bits (78), Expect = 0.71,   Method: Compositional matrix adjust.
 Identities = 46/180 (25%), Positives = 88/180 (48%), Gaps = 18/180 (10%)

Query: 9    SLLEDMEIIENAIVERIRRNPELYYHYIQESSKVFPDVKLPKSSLIAENKLFKIKKVKRN 68
            +LL+ +  + +++V+      E +Y +I + S+V  ++ LP SS+   + L K+ K+ + 
Sbjct: 917  TLLDLLTALFDSVVDCETNKFEPHYKFILKHSRV--EILLPGSSMWRTSALSKLHKIAKQ 974

Query: 69   RKQVILQQ--HEISLFLRDYLEKQKSFNNINSQNY----SQEDDKDLCSFDEELRQLE-- 120
              Q+IL +   +  + L+ Y+    ++N + + +Y    + E    + S D EL +LE  
Sbjct: 975  WVQIILNKSAQDTKILLQTYVSDLNTYNIMANVDYGISFAMELAGMVLSADVELSKLEFR 1034

Query: 121  -DELKSEEENFQLDINSKRNKY----ALFSSSIDSSKRTNILSERARD-LDLN-KIFTRD 173
              E  +    F +  +S R+KY    A+ SS  D      +LS   R  LD   K+ ++D
Sbjct: 1035 GPERPNTVAKF-ISQHSWRSKYLVDTAMVSSQQDIVDELGLLSNTIRGKLDTGIKVVSKD 1093

>Ecym_4266 Chr4 complement(564935..566329) [1395 bp, 464 aa] {ON}
           similar to Ashbya gossypii AGR048C
          Length = 464

 Score = 34.3 bits (77), Expect = 0.87,   Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 31/68 (45%), Gaps = 11/68 (16%)

Query: 313 DTVYSEYKL-------HRYLKYLKDEFSHTKS----FVERKLVFTANERIAEMDALTQKY 361
           DT+ SE  L       HR      + F + K      +E+ LVF   +RI   DAL   Y
Sbjct: 242 DTICSENTLKFVTSLPHRDPVPFTERFKNLKPDAVDLLEKMLVFDPKKRITAADALAHPY 301

Query: 362 EAPAYDPT 369
            AP +DPT
Sbjct: 302 LAPYHDPT 309

>Smik_12.173 Chr12 (351727..353034) [1308 bp, 435 aa] {ON} YLR113W
           (REAL)
          Length = 435

 Score = 34.3 bits (77), Expect = 0.89,   Method: Compositional matrix adjust.
 Identities = 15/32 (46%), Positives = 19/32 (59%)

Query: 338 FVERKLVFTANERIAEMDALTQKYEAPAYDPT 369
            +E+ LVF   +RI   DAL   Y AP +DPT
Sbjct: 278 LLEKMLVFDPKKRITAADALAHPYLAPYHDPT 309

>CAGL0M11748g Chr13 (1168856..1170199) [1344 bp, 447 aa] {ON} highly
           similar to uniprot|P32485 Saccharomyces cerevisiae
           YLR113w HOG1
          Length = 447

 Score = 33.9 bits (76), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 15/32 (46%), Positives = 19/32 (59%)

Query: 338 FVERKLVFTANERIAEMDALTQKYEAPAYDPT 369
            +E+ LVF   +RI   DAL   Y AP +DPT
Sbjct: 278 LLEKMLVFDPKKRITAADALAHPYLAPYHDPT 309

>TDEL0F04290 Chr6 (801456..802739) [1284 bp, 427 aa] {ON} Anc_8.302
           YLR113W
          Length = 427

 Score = 33.9 bits (76), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 15/32 (46%), Positives = 19/32 (59%)

Query: 338 FVERKLVFTANERIAEMDALTQKYEAPAYDPT 369
            +E+ LVF   +RI   DAL   Y AP +DPT
Sbjct: 278 LLEKMLVFDPKKRITAADALVHPYLAPYHDPT 309

>Suva_10.202 Chr10 (380079..381386) [1308 bp, 435 aa] {ON} YLR113W
           (REAL)
          Length = 435

 Score = 33.5 bits (75), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 14/32 (43%), Positives = 19/32 (59%)

Query: 338 FVERKLVFTANERIAEMDALTQKYEAPAYDPT 369
            +E+ LVF   +R+   DAL   Y AP +DPT
Sbjct: 278 LLEKMLVFDPKKRVTAADALAHPYLAPYHDPT 309

>Skud_12.181 Chr12 (354407..355702) [1296 bp, 431 aa] {ON} YLR113W
           (REAL)
          Length = 431

 Score = 33.5 bits (75), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 14/32 (43%), Positives = 19/32 (59%)

Query: 338 FVERKLVFTANERIAEMDALTQKYEAPAYDPT 369
            +E+ LVF   +R+   DAL   Y AP +DPT
Sbjct: 278 LLEKMLVFDPKKRVTAADALAHPYLAPYHDPT 309

>NDAI0H02820 Chr8 complement(696348..696800) [453 bp, 150 aa] {ON} 
          Length = 150

 Score = 32.3 bits (72), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 17/39 (43%), Positives = 30/39 (76%), Gaps = 4/39 (10%)

Query: 93  FNNINSQNYSQEDDKDLCSFDEELRQLEDELKSEEENFQ 131
           F++I+++  S   DKD+ +FD+E+ +L+D+L  EEE+FQ
Sbjct: 47  FDDISTEKQS---DKDIVTFDDEMSKLKDKL-MEEESFQ 81

>NDAI0C06580 Chr3 complement(1519086..1519595) [510 bp, 169 aa] {ON}
           Anc_8.11 YLR074C
          Length = 169

 Score = 32.3 bits (72), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 19/69 (27%), Positives = 38/69 (55%), Gaps = 10/69 (14%)

Query: 281 HCPFCYKWFKTSPVFENHLTGKIHKKNEFKRKDTVYSE--------YKLHRYLKYLKDEF 332
           +C  C K+F+T+   + HL  K+HK+   + K   Y++        Y L+++L  +++  
Sbjct: 50  YCIHCAKYFETAIALKTHLKTKVHKRRVKELKGVPYTQEVADAAAGYNLNKFLNRVQE-- 107

Query: 333 SHTKSFVER 341
            ++KS VE+
Sbjct: 108 INSKSGVEK 116

>CAGL0K12804g Chr11 complement(1269506..1270024) [519 bp, 172 aa]
           {ON} similar to uniprot|Q08004 Saccharomyces cerevisiae
           YLR074c
          Length = 172

 Score = 32.3 bits (72), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 13/38 (34%), Positives = 22/38 (57%)

Query: 281 HCPFCYKWFKTSPVFENHLTGKIHKKNEFKRKDTVYSE 318
           +C  C K+F+T    + HL GKIH++   + K   Y++
Sbjct: 50  YCIHCAKYFETGIALKTHLKGKIHRRRVKELKSIPYTQ 87

>SAKL0B00704g Chr2 (65060..65569) [510 bp, 169 aa] {ON} highly
           similar to gnl|GLV|KLLA0D05621g Kluyveromyces lactis
           KLLA0D05621g and similar to YLR074C uniprot|Q08004
           Saccharomyces cerevisiae YLR074C BUD20 Protein involved
           in bud-site selection diploid mutants display a random
           budding pattern instead of the wild-type bipolar pattern
          Length = 169

 Score = 32.3 bits (72), Expect = 1.6,   Method: Composition-based stats.
 Identities = 13/38 (34%), Positives = 23/38 (60%)

Query: 281 HCPFCYKWFKTSPVFENHLTGKIHKKNEFKRKDTVYSE 318
           +C  C K+F+T+   + HL GK+HK+   + K   Y++
Sbjct: 50  YCIHCAKYFETAMALKTHLKGKVHKRRVKELKGVPYTQ 87

>YGL020C Chr7 complement(457163..457870) [708 bp, 235 aa] {ON}
           GET1Subunit of the GET complex; involved in insertion of
           proteins into the ER membrane; required for the
           retrieval of HDEL proteins from the Golgi to the ER in
           an ERD2 dependent fashion and for normal mitochondrial
           morphology and inheritance
          Length = 235

 Score = 32.7 bits (73), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 36/52 (69%), Gaps = 4/52 (7%)

Query: 91  KSFNN-INSQ-NYSQ--EDDKDLCSFDEELRQLEDELKSEEENFQLDINSKR 138
           K FNN I++Q NY++  ++++ L S D+E+  L+DE++SE + FQ  ++  R
Sbjct: 53  KEFNNSISAQDNYAKWTKNNRKLDSLDKEINNLKDEIQSENKAFQAHLHKLR 104

>Smik_12.134 Chr12 complement(261773..262273) [501 bp, 166 aa] {ON}
           YLR074C (REAL)
          Length = 166

 Score = 32.0 bits (71), Expect = 1.9,   Method: Composition-based stats.
 Identities = 15/58 (25%), Positives = 31/58 (53%), Gaps = 8/58 (13%)

Query: 281 HCPFCYKWFKTSPVFENHLTGKIHKKNEFKRKDTVYSE--------YKLHRYLKYLKD 330
           +C  C K+ +T+   + HL GK+HK+   + K   Y++        Y L+++L  +++
Sbjct: 50  YCIHCAKYMETAIALKTHLKGKVHKRRVKELKSVPYTQEVSDAAAGYNLNKFLNRVQE 107

>KLTH0G19096g Chr7 complement(1649335..1649814) [480 bp, 159 aa]
           {ON} highly similar to uniprot|Q08004 Saccharomyces
           cerevisiae YLR074C BUD20 Protein involved in bud-site
           selection diploid mutants display a random budding
           pattern instead of the wild-type bipolar pattern
          Length = 159

 Score = 32.0 bits (71), Expect = 1.9,   Method: Composition-based stats.
 Identities = 13/38 (34%), Positives = 22/38 (57%)

Query: 281 HCPFCYKWFKTSPVFENHLTGKIHKKNEFKRKDTVYSE 318
           +C  C K+F+T    + HL GK+HK+   + K   Y++
Sbjct: 50  YCIHCAKYFETGVALKTHLKGKVHKRRVKELKGVPYTQ 87

>ABR234C Chr2 complement(841361..841888) [528 bp, 175 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR074C
           (BUD20)
          Length = 175

 Score = 32.0 bits (71), Expect = 2.1,   Method: Composition-based stats.
 Identities = 12/38 (31%), Positives = 22/38 (57%)

Query: 281 HCPFCYKWFKTSPVFENHLTGKIHKKNEFKRKDTVYSE 318
           +C  C K+F+T    + HL GK+HK+   + +   Y++
Sbjct: 65  YCIHCAKYFETPAALKTHLKGKVHKRRVKELRGVPYTQ 102

>YDL223C Chr4 complement(57265..60405) [3141 bp, 1046 aa] {ON}
           HBT1Substrate of the Hub1p ubiquitin-like protein that
           localizes to the shmoo tip (mating projection); mutants
           are defective for mating projection formation, thereby
           implicating Hbt1p in polarized cell morphogenesis
          Length = 1046

 Score = 33.1 bits (74), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 20/67 (29%), Positives = 39/67 (58%), Gaps = 3/67 (4%)

Query: 122 ELKSEEENFQLDINSKRNKYALFSSSIDSSKRTNILSERARDLDLNKIFTRDEQYG-EYM 180
           +  S+  N  +D+ S R++      S D++ R N++S   +D D+N+  T+  QYG +Y+
Sbjct: 548 QAGSQNTNNNIDM-SPRHEAEWSGLSNDATTRNNVVSPAMKDEDMNEDSTKPHQYGLDYL 606

Query: 181 -ELEQFH 186
            ++E +H
Sbjct: 607 DDVEDYH 613

>Skud_3.156 Chr3 complement(244873..247014) [2142 bp, 713 aa] {ON}
           YCR084C (REAL)
          Length = 713

 Score = 33.1 bits (74), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 43/193 (22%), Positives = 76/193 (39%), Gaps = 26/193 (13%)

Query: 55  AENKLFKIKKVKRNRKQVILQQHEISLFLRDYLEKQKSFNNINSQNYSQEDDKDLCSFDE 114
           AE++L +I  ++  +  +ILQ HE  ++  DY               S   D+ +  +D 
Sbjct: 462 AEDRLIRIWDIENRKIVMILQGHEQDIYSLDYFPSGDKL-------VSGSGDRTVRIWDL 514

Query: 115 ELRQLEDELKSEEENFQLDINSKRNKYALFSSSIDSSKR-----TNILSERA-------- 161
              Q    L  E+    + ++    KY + + S+D + R     T  L ER         
Sbjct: 515 RTGQCSLTLSIEDGVTTVAVSPGDGKY-IAAGSLDRAVRVWDSETGFLVERLDSENESGT 573

Query: 162 --RDLDLNKIFTRDEQYGEYMELEQFHSLW--LNVFKRSDCSLLQFFDVVELFVDDKKYL 217
             +D   + +FTRD Q      L++   LW   N   +SD            ++  K ++
Sbjct: 574 GHKDSVYSVVFTRDGQSVVSGSLDRSVKLWNLQNANNKSDSKTPNSGTCEVTYIGHKDFV 633

Query: 218 LTPPMDRKNDRYM 230
           L+     +ND Y+
Sbjct: 634 LSVAT-TQNDEYI 645

>Kwal_14.1064 s14 (178979..179467) [489 bp, 162 aa] {ON} YLR074C
           (BUD20) -  [contig 244] FULL
          Length = 162

 Score = 31.6 bits (70), Expect = 2.5,   Method: Composition-based stats.
 Identities = 13/38 (34%), Positives = 22/38 (57%)

Query: 281 HCPFCYKWFKTSPVFENHLTGKIHKKNEFKRKDTVYSE 318
           +C  C K+F+T    + HL GK+HK+   + K   Y++
Sbjct: 50  YCIHCAKYFETRIALKTHLKGKVHKRRVKELKGVPYTQ 87

>KLLA0F20053g Chr6 (1867209..1868543) [1335 bp, 444 aa] {ON} highly
           similar to uniprot|P32485 Saccharomyces cerevisiae
           YLR113W HOG1 Mitogen-activated protein kinase involved
           in osmoregulation
          Length = 444

 Score = 32.7 bits (73), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 14/32 (43%), Positives = 19/32 (59%)

Query: 338 FVERKLVFTANERIAEMDALTQKYEAPAYDPT 369
            +E+ LVF   +RI   DAL   Y +P +DPT
Sbjct: 277 LLEKMLVFDPKKRITAADALAHPYLSPYHDPT 308

>SAKL0H16038g Chr8 complement(1401627..1402931) [1305 bp, 434 aa]
           {ON} highly similar to uniprot|P32485 Saccharomyces
           cerevisiae YLR113W HOG1 Mitogen-activated protein kinase
           involved in osmoregulation via three independent
           osmosensors mediates the recruitment and activation of
           RNA Pol II at Hot1p-dependent promoters localization
           regulated by Ptp2p and Ptp3p
          Length = 434

 Score = 32.3 bits (72), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 14/32 (43%), Positives = 19/32 (59%)

Query: 338 FVERKLVFTANERIAEMDALTQKYEAPAYDPT 369
            +E+ LVF   +RI   DAL   Y +P +DPT
Sbjct: 278 LLEKMLVFDPKKRITAADALAHPYLSPYHDPT 309

>YCR084C Chr3 complement(260311..262452) [2142 bp, 713 aa] {ON}
           TUP1General repressor of transcription, forms complex
           with Cyc8p, involved in the establishment of repressive
           chromatin structure through interactions with histones
           H3 and H4, appears to enhance expression of some genes
          Length = 713

 Score = 32.7 bits (73), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 43/193 (22%), Positives = 76/193 (39%), Gaps = 26/193 (13%)

Query: 55  AENKLFKIKKVKRNRKQVILQQHEISLFLRDYLEKQKSFNNINSQNYSQEDDKDLCSFDE 114
           AE++L +I  ++  +  +ILQ HE  ++  DY               S   D+ +  +D 
Sbjct: 462 AEDRLIRIWDIENRKIVMILQGHEQDIYSLDYFPSGDKL-------VSGSGDRTVRIWDL 514

Query: 115 ELRQLEDELKSEEENFQLDINSKRNKYALFSSSIDSSKR-----TNILSERA-------- 161
              Q    L  E+    + ++    KY + + S+D + R     T  L ER         
Sbjct: 515 RTGQCSLTLSIEDGVTTVAVSPGDGKY-IAAGSLDRAVRVWDSETGFLVERLDSENESGT 573

Query: 162 --RDLDLNKIFTRDEQYGEYMELEQFHSLW--LNVFKRSDCSLLQFFDVVELFVDDKKYL 217
             +D   + +FTRD Q      L++   LW   N   +SD            ++  K ++
Sbjct: 574 GHKDSVYSVVFTRDGQSVVSGSLDRSVKLWNLQNANNKSDSKTPNSGTCEVTYIGHKDFV 633

Query: 218 LTPPMDRKNDRYM 230
           L+     +ND Y+
Sbjct: 634 LSVAT-TQNDEYI 645

>Skud_12.139 Chr12 complement(266691..267185) [495 bp, 164 aa] {ON}
           YLR074C (REAL)
          Length = 164

 Score = 31.2 bits (69), Expect = 4.1,   Method: Composition-based stats.
 Identities = 15/58 (25%), Positives = 31/58 (53%), Gaps = 8/58 (13%)

Query: 281 HCPFCYKWFKTSPVFENHLTGKIHKKNEFKRKDTVYSE--------YKLHRYLKYLKD 330
           +C  C K+ +T+   + HL GK+HK+   + K   Y++        Y L+++L  +++
Sbjct: 50  YCIHCAKYMETAIALKTHLKGKVHKRRVKELKGVPYTQEVSDAAAGYNLNKFLDRVQE 107

>TBLA0H01330 Chr8 complement(297718..299163) [1446 bp, 481 aa] {ON}
           Anc_8.302 YLR113W
          Length = 481

 Score = 32.0 bits (71), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 13/32 (40%), Positives = 19/32 (59%)

Query: 338 FVERKLVFTANERIAEMDALTQKYEAPAYDPT 369
            +E+ L+F   +RI   DAL   Y AP +DP+
Sbjct: 278 LLEKMLIFDPKKRITASDALAHPYLAPYHDPS 309

>YLR074C Chr12 complement(281956..282456) [501 bp, 166 aa] {ON}
           BUD20Protein involved in bud-site selection; diploid
           mutants display a random budding pattern instead of the
           wild-type bipolar pattern
          Length = 166

 Score = 30.8 bits (68), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 14/58 (24%), Positives = 31/58 (53%), Gaps = 8/58 (13%)

Query: 281 HCPFCYKWFKTSPVFENHLTGKIHKKNEFKRKDTVYSE--------YKLHRYLKYLKD 330
           +C  C K+ +T+   + HL GK+HK+   + +   Y++        Y L+++L  +++
Sbjct: 50  YCIHCAKYMETAIALKTHLKGKVHKRRVKELRGVPYTQEVSDAAAGYNLNKFLNRVQE 107

>CAGL0J07370g Chr10 (713487..715358) [1872 bp, 623 aa] {ON} similar
           to uniprot|P53863 Saccharomyces cerevisiae YNL227c
          Length = 623

 Score = 31.2 bits (69), Expect = 7.1,   Method: Compositional matrix adjust.
 Identities = 12/26 (46%), Positives = 16/26 (61%)

Query: 282 CPFCYKWFKTSPVFENHLTGKIHKKN 307
           C  C K FK+    ENH+  K+HK+N
Sbjct: 365 CFICKKSFKSEKQLENHIKTKLHKRN 390

>KLLA0D05621g Chr4 complement(486879..487382) [504 bp, 167 aa] {ON}
           similar to uniprot|Q08004 Saccharomyces cerevisiae
           YLR074C BUD20 Protein involved in bud-site selection
           diploid mutants display a random budding pattern instead
           of the wild-type bipolar pattern
          Length = 167

 Score = 30.4 bits (67), Expect = 7.9,   Method: Composition-based stats.
 Identities = 13/38 (34%), Positives = 22/38 (57%)

Query: 281 HCPFCYKWFKTSPVFENHLTGKIHKKNEFKRKDTVYSE 318
           +C  C K+F+T+   + HL  KIHK+   + K   Y++
Sbjct: 50  YCIHCAKYFETAYALKTHLKTKIHKRRVKELKGVPYTQ 87

>NDAI0B04200 Chr2 (1058568..1059422) [855 bp, 284 aa] {ON} Anc_2.175
           YOR106W
          Length = 284

 Score = 30.8 bits (68), Expect = 8.8,   Method: Compositional matrix adjust.
 Identities = 18/61 (29%), Positives = 35/61 (57%)

Query: 5   ETRRSLLEDMEIIENAIVERIRRNPELYYHYIQESSKVFPDVKLPKSSLIAENKLFKIKK 64
           ETR+ +  D+  + N + +RI  N   + +   E SK++ D K+ K+ LI+  + ++ +K
Sbjct: 63  ETRKKIEYDLIPLCNELRDRIDDNQPTWQNTFHEGSKLYNDFKILKTELISVERSYETQK 122

Query: 65  V 65
           V
Sbjct: 123 V 123

>Ecym_5044 Chr5 complement(91778..94489) [2712 bp, 903 aa] {ON}
           similar to Ashbya gossypii ADR375W
          Length = 903

 Score = 30.8 bits (68), Expect = 9.8,   Method: Compositional matrix adjust.
 Identities = 26/116 (22%), Positives = 57/116 (49%), Gaps = 17/116 (14%)

Query: 20  AIVERIRRNPELYYHYIQESSKVF-PDVKLPKSSLIAENKLFKIKKVK-------RNRKQ 71
           A +  I+ N  +Y+ ++   + ++  DV  P+S +   NK+F++  +K       +N   
Sbjct: 622 AFICIIQCNYGIYFPWMDPDNHIYETDVSNPQSLVYGSNKVFRLLCLKQEVFPLIKNWVT 681

Query: 72  VILQQHEISLFLRDYLEKQKSFNNINSQNYSQEDDKDLCSFDEELRQLEDELKSEE 127
           ++++  E+  F+ +  E+ K+       N++  D KD+    E LR + +   S+E
Sbjct: 682 MVIKTQELYRFVSNNRERAKNM------NWASSDMKDI---KEALRPVSETGSSDE 728

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.320    0.136    0.398 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 57,346,933
Number of extensions: 2695990
Number of successful extensions: 14351
Number of sequences better than 10.0: 344
Number of HSP's gapped: 15100
Number of HSP's successfully gapped: 358
Length of query: 531
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 417
Effective length of database: 40,409,475
Effective search space: 16850751075
Effective search space used: 16850751075
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 68 (30.8 bits)