Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Smik_4.2043.159ON99899845620.0
YDL031W (DBP10)3.159ON99599843290.0
Skud_4.2203.159ON1001100142290.0
Suva_4.2183.159ON1007100741330.0
NDAI0G028703.159ON99191035750.0
NCAS0C035303.159ON97790335530.0
CAGL0K01551g3.159ON96990634520.0
KAFR0C010603.159ON97390234370.0
KNAG0K011103.159ON100191234040.0
TPHA0M003303.159ON98190533850.0
Kpol_1032.113.159ON97790433310.0
KLLA0F24684g3.159ON97390033160.0
SAKL0C08778g3.159ON100392033120.0
KLTH0C08866g3.159ON97290433110.0
AEL086W3.159ON96090432730.0
Kwal_56.228043.159ON97390432470.0
ZYRO0B04972g3.159ON97990432160.0
TDEL0D046303.159ON96887731640.0
TBLA0B015903.159ON92991424430.0
KAFR0C064205.208ON7394286014e-65
KLLA0F15752g5.208ON7484085901e-63
TPHA0N007005.208ON7554135911e-63
AAL164C5.208ON7344315776e-62
KLTH0B03278g5.208ON7394465625e-60
NDAI0F027402.164ON5614025163e-55
ZYRO0B09856g2.164ON5404025111e-54
Suva_8.2578.614ON6184115132e-54
TDEL0B040606.148ON8474005205e-54
NCAS0C017208.614ON6404095117e-54
NCAS0G025602.164ON5564025067e-54
Kpol_1033.406.204ON5304285048e-54
KLLA0F01034g8.614ON6274115081e-53
CAGL0L02915g8.614ON6174115044e-53
NDAI0E015908.614ON6084105025e-53
ADL273C8.614ON6234105028e-53
Kwal_14.16536.148ON6884115058e-53
NDAI0F020106.148ON8884055129e-53
Skud_7.2046.204ON5164234941e-52
KAFR0H028208.614ON6114144991e-52
YGL078C (DBP3)6.204ON5234264932e-52
KNAG0H015208.614ON6214164973e-52
Smik_7.2056.204ON5224244913e-52
Ecym_54222.164ON5604004934e-52
KLTH0D09328g2.164ON5514024907e-52
CAGL0H03377g6.204ON5404244881e-51
KLTH0D09746g8.614ON6214154921e-51
Suva_7.1926.204ON5183994861e-51
AFL027C6.148ON8164065002e-51
KAFR0G020308.614ON6064064893e-51
TPHA0E024106.204ON5234034833e-51
ZYRO0G14960g6.148ON8314034974e-51
TDEL0A055908.614ON5974094875e-51
NDAI0E024308.614ON6614094871e-50
NDAI0I011506.204ON5233884791e-50
NCAS0D037406.204ON5193814781e-50
CAGL0I02354g5.69ON4374194722e-50
KLLA0A05203g5.69ON4354104712e-50
Ecym_22696.148ON8774114923e-50
Ecym_82988.614ON6384144833e-50
KNAG0A032808.614ON6074104813e-50
Kpol_534.316.148ON8724094913e-50
TBLA0E041008.614ON8664254833e-49
TBLA0D035206.148ON8894104843e-49
Kpol_1072.508.614ON6504114745e-49
TDEL0G009305.69ON4364074606e-49
KLTH0H05852g6.148ON8114094752e-48
YBR237W (PRP5)6.148ON8494094744e-48
Kwal_27.117348.469ON5714094616e-48
Skud_12.595.208ON7582654697e-48
SAKL0G11748g5.241ON7633994681e-47
Suva_4.4946.148ON8504084655e-47
Smik_12.555.208ON7352374615e-47
YLL008W (DRS1)5.208ON7522414626e-47
KNAG0M006606.148ON8844364648e-47
CAGL0D03124g5.208ON7252764599e-47
Suva_10.675.208ON7442404591e-46
AER301C5.69ON4354304431e-46
CAGL0K07029g6.148ON8163894611e-46
NCAS0A015505.208ON7482374563e-46
TDEL0E042105.208ON7402364554e-46
KNAG0H025205.208ON7542514545e-46
KLLA0D09504g5.241ON7703984521e-45
NDAI0C024905.208ON7712404512e-45
Kpol_534.535.208ON7522434483e-45
TBLA0C061605.208ON7572494484e-45
Ecym_13958.469ON5654004387e-45
KAFR0G034806.148ON8524094479e-45
ZYRO0B10318g5.208ON7502514412e-44
NCAS0B025708.469ON5904064317e-44
YJL033W (HCA4)5.241ON7703994352e-43
SAKL0G12760g5.208ON7372514332e-43
Kwal_33.151655.208ON7312514225e-42
SAKL0A06204g6.148ON8432464192e-41
KNAG0A041308.469ON6094034123e-41
AGL112C8.402ON6584184124e-41
TBLA0H032408.402ON7674264154e-41
SAKL0H11968g8.469ON5664014076e-41
KLLA0F10505g6.148ON8122264103e-40
KAFR0D046305.337ON4872763983e-40
ZYRO0C14234g5.337ON4942803941e-39
CAGL0L08976g8.87ON6173973972e-39
TPHA0N011306.148ON8772094032e-39
KLTH0A02244g8.87ON5984103953e-39
ZYRO0F04312g8.87ON6024053927e-39
TPHA0D019905.337ON4982413861e-38
NDAI0C042505.337ON5042643851e-38
Kwal_26.84702.164ON4253633792e-38
KNAG0B046605.337ON4942313832e-38
Ecym_73248.87ON5973963883e-38
Ecym_82615.241ON7752143933e-38
NCAS0F027905.337ON5022413815e-38
NDAI0C063008.87ON6144133849e-38
KLTH0H15686g2.384ON4394553751e-37
Skud_15.2105.643ON4824083771e-37
Smik_6.818.87ON6064103831e-37
Kpol_1005.115.337ON5062413782e-37
Smik_2.3806.148ON8502443882e-37
Skud_6.728.87ON6064183822e-37
SAKL0G09328g5.337ON5052413772e-37
KLLA0C14608g5.337ON4872313762e-37
Skud_2.3696.148ON8482453872e-37
Ecym_32175.337ON4862613762e-37
TDEL0E028905.337ON5012413762e-37
SAKL0H13574g8.402ON6684133832e-37
NCAS0H012806.148ON8872453873e-37
Smik_8.1365.337ON5012883763e-37
NCAS0J005808.87ON6114083803e-37
YHR065C (RRP3)5.337ON5012413753e-37
Suva_8.985.643ON4824083743e-37
Smik_15.2245.643ON4774083733e-37
KAFR0E016405.241ON7602013834e-37
KLTH0F08382g8.402ON6574053804e-37
TPHA0N009405.241ON7712013835e-37
Skud_8.1225.337ON5032413727e-37
Ecym_41658.402ON6584093787e-37
KLLA0E21935g2.384ON4374553689e-37
Suva_15.2545.337ON5032413711e-36
Ecym_60492.384ON4384523681e-36
TBLA0C035005.337ON5062443711e-36
Kpol_340.28.402ON6704063762e-36
CAGL0J10912g5.337ON4932413692e-36
ZYRO0C04378g8.402ON6814063762e-36
CAGL0L10021g5.643ON5044463682e-36
NCAS0B017308.614ON6182533733e-36
AAL041C5.337ON4872723664e-36
Kpol_2001.677.336ON4842083646e-36
SAKL0F11088g7.336ON4972083648e-36
NCAS0A140607.336ON5102083641e-35
Suva_16.1918.614ON6182523681e-35
ADR260C2.384ON4384523591e-35
SAKL0B02794g8.87ON5984083661e-35
Kwal_33.143255.337ON5002463622e-35
Kwal_23.32358.402ON6764033682e-35
CAGL0L03846g2.164ON5442223632e-35
TDEL0F052608.402ON6554133672e-35
Smik_6.3188.614ON6132513652e-35
Skud_15.3708.614ON6092513652e-35
ZYRO0A10802g5.241ON7712323692e-35
NDAI0C023205.241ON7642433692e-35
KLTH0F07106g5.337ON5252413612e-35
Skud_16.1618.614ON6192513653e-35
Skud_4.967.336ON5072113603e-35
KLLA0A09669g5.40ON4972663603e-35
TPHA0D045207.336ON5022083603e-35
CAGL0I03476g7.336ON5072113594e-35
TPHA0G020502.384ON4384553554e-35
NCAS0A014005.241ON7622603674e-35
Skud_4.1712.384ON4464643554e-35
YOR204W (DED1)8.614ON6042513625e-35
KNAG0C038207.336ON5132133585e-35
Smik_15.3908.614ON6092513625e-35
SAKL0H08162g8.614ON6242723626e-35
TDEL0E038505.241ON7612623656e-35
TDEL0C021007.336ON4792113567e-35
YDL160C (DHH1)7.336ON5062113577e-35
KAFR0B015205.40ON4962773568e-35
Suva_4.867.336ON5082113578e-35
TPHA0B028508.614ON6282513618e-35
KAFR0B045602.164ON5432223588e-35
YPL119C (DBP1)8.614ON6172513609e-35
TPHA0B029302.164ON4272083529e-35
Ecym_46467.336ON4902083551e-34
Kwal_23.28835.241ON7642013641e-34
CAGL0J06908g8.614ON6042513601e-34
Kpol_1041.332.384ON4414553521e-34
TBLA0C055802.164ON5402083571e-34
Smik_4.777.336ON5062113551e-34
Kpol_1004.135.241ON7682263631e-34
Smik_13.5065.40ON5052803551e-34
YNL112W (DBP2)2.164ON5462223562e-34
Kpol_165.12.164ON4412403512e-34
NDAI0A019607.336ON5342083552e-34
TBLA0B042008.614ON6312513582e-34
CAGL0M13519g5.40ON4942423522e-34
TPHA0G025852.384ON4384553492e-34
TBLA0B088802.384ON4424103493e-34
KLTH0G07766g5.241ON7642013603e-34
AFL221C2.164ON5572643543e-34
KAFR0B009107.336ON5122113523e-34
ZYRO0F11440g7.336ON5232113523e-34
CAGL0L06908g2.384ON4394543484e-34
KNAG0A058502.384ON4494103484e-34
Ecym_22136.204ON5542403534e-34
KNAG0F026105.241ON7622243584e-34
Suva_4.1632.384ON4464603484e-34
TBLA0C006408.124ON5792533545e-34
TBLA0D034005.241ON7752013585e-34
KNAG0A046608.402ON7134113575e-34
YDL084W (SUB2)2.384ON4464103475e-34
NCAS0A039502.384ON4464603476e-34
Smik_4.1522.384ON4464103476e-34
Ecym_47755.40ON5002453496e-34
ZYRO0G08580g6.204ON5392483516e-34
TPHA0L021605.40ON4982403496e-34
ACR197W7.336ON4842083486e-34
Kpol_1058.532.384ON4424563467e-34
Skud_14.2192.164ON4352083457e-34
ZYRO0F10934g8.614ON6032513538e-34
TDEL0G014206.204ON5122443498e-34
KLLA0F23716g2.164ON5542513509e-34
TDEL0F011902.164ON5492223509e-34
TDEL0G031402.384ON4444593459e-34
KLTH0B08998g5.40ON4922443471e-33
Smik_14.2152.164ON5472223491e-33
Kwal_56.240056.204ON5332433491e-33
KLLA0C16599g7.336ON5142033481e-33
NDAI0C036005.40ON5192403481e-33
TBLA0F023607.336ON5852413501e-33
KLTH0H01562g7.336ON4912053462e-33
KNAG0I020502.164ON4232083412e-33
Suva_14.2262.164ON5432083472e-33
TDEL0C011608.87ON6033963492e-33
NCAS0E039205.69ON4371993413e-33
SAKL0H01430g5.40ON5002423443e-33
ADL024C8.124ON5692513473e-33
ACR040W5.241ON7632373513e-33
SAKL0E05148g2.384ON4684103423e-33
KAFR0F029402.384ON4434593404e-33
KLTH0H04466g6.204ON5532163455e-33
ZYRO0D07546g5.40ON4942643425e-33
Kwal_56.245887.336ON5132053435e-33
CAGL0J01045g5.241ON7652013496e-33
NDAI0E017502.384ON4503883396e-33
KAFR0B044805.69ON4351953386e-33
TDEL0G006505.40ON4852643407e-33
NCAS0F022005.40ON5082413418e-33
AGR333C5.40ON5042413418e-33
Suva_12.485.241ON7702013471e-32
Skud_8.2335.69ON4371983371e-32
Kpol_513.155.40ON5012423401e-32
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Smik_4.204
         (998 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Smik_4.204 Chr4 (374339..377335) [2997 bp, 998 aa] {ON} YDL031W ...  1761   0.0  
YDL031W Chr4 (394217..397204) [2988 bp, 995 aa] {ON}  DBP10Putat...  1672   0.0  
Skud_4.220 Chr4 (389016..392021) [3006 bp, 1001 aa] {ON} YDL031W...  1633   0.0  
Suva_4.218 Chr4 (384623..387646) [3024 bp, 1007 aa] {ON} YDL031W...  1596   0.0  
NDAI0G02870 Chr7 (664526..667501) [2976 bp, 991 aa] {ON}             1381   0.0  
NCAS0C03530 Chr3 (703955..706888) [2934 bp, 977 aa] {ON} Anc_3.159   1373   0.0  
CAGL0K01551g Chr11 (136421..139330) [2910 bp, 969 aa] {ON} highl...  1334   0.0  
KAFR0C01060 Chr3 complement(215822..218743) [2922 bp, 973 aa] {O...  1328   0.0  
KNAG0K01110 Chr11 (215540..218545) [3006 bp, 1001 aa] {ON} Anc_3...  1315   0.0  
TPHA0M00330 Chr13 complement(61976..64921) [2946 bp, 981 aa] {ON}    1308   0.0  
Kpol_1032.11 s1032 complement(27093..30026) [2934 bp, 977 aa] {O...  1287   0.0  
KLLA0F24684g Chr6 complement(2294708..2297629) [2922 bp, 973 aa]...  1281   0.0  
SAKL0C08778g Chr3 (804617..807628) [3012 bp, 1003 aa] {ON} simil...  1280   0.0  
KLTH0C08866g Chr3 (742559..745477) [2919 bp, 972 aa] {ON} highly...  1280   0.0  
AEL086W Chr5 (464521..467403) [2883 bp, 960 aa] {ON} Syntenic ho...  1265   0.0  
Kwal_56.22804 s56 complement(286570..289491) [2922 bp, 973 aa] {...  1255   0.0  
ZYRO0B04972g Chr2 complement(401735..404674) [2940 bp, 979 aa] {...  1243   0.0  
TDEL0D04630 Chr4 complement(849268..852174) [2907 bp, 968 aa] {O...  1223   0.0  
TBLA0B01590 Chr2 (349441..352230) [2790 bp, 929 aa] {ON} Anc_3.1...   945   0.0  
KAFR0C06420 Chr3 complement(1286002..1288221) [2220 bp, 739 aa] ...   236   4e-65
KLLA0F15752g Chr6 (1454735..1456981) [2247 bp, 748 aa] {ON} simi...   231   1e-63
TPHA0N00700 Chr14 (157186..159453) [2268 bp, 755 aa] {ON} Anc_5....   232   1e-63
AAL164C Chr1 complement(55223..57427) [2205 bp, 734 aa] {ON} Syn...   226   6e-62
KLTH0B03278g Chr2 complement(257395..259614) [2220 bp, 739 aa] {...   221   5e-60
NDAI0F02740 Chr6 complement(670654..671051,672039..673326) [1686...   203   3e-55
ZYRO0B09856g Chr2 complement(769104..769462,770138..771401) [162...   201   1e-54
Suva_8.257 Chr8 (461776..463632) [1857 bp, 618 aa] {ON} YOR204W ...   202   2e-54
TDEL0B04060 Chr2 complement(724075..726618) [2544 bp, 847 aa] {O...   204   5e-54
NCAS0C01720 Chr3 complement(317951..319873) [1923 bp, 640 aa] {O...   201   7e-54
NCAS0G02560 Chr7 (457574..458852,459621..460012) [1671 bp, 556 a...   199   7e-54
Kpol_1033.40 s1033 complement(104203..105795) [1593 bp, 530 aa] ...   198   8e-54
KLLA0F01034g Chr6 (93422..95305) [1884 bp, 627 aa] {ON} similar ...   200   1e-53
CAGL0L02915g Chr12 complement(342831..344684) [1854 bp, 617 aa] ...   198   4e-53
NDAI0E01590 Chr5 complement(315658..317484) [1827 bp, 608 aa] {O...   197   5e-53
ADL273C Chr4 complement(225068..226939) [1872 bp, 623 aa] {ON} S...   197   8e-53
Kwal_14.1653 s14 complement(406891..408957) [2067 bp, 688 aa] {O...   199   8e-53
NDAI0F02010 Chr6 (492540..495206) [2667 bp, 888 aa] {ON} Anc_6.148    201   9e-53
Skud_7.204 Chr7 complement(363553..365103) [1551 bp, 516 aa] {ON...   194   1e-52
KAFR0H02820 Chr8 (537121..538956) [1836 bp, 611 aa] {ON} Anc_8.6...   196   1e-52
YGL078C Chr7 complement(360288..361859) [1572 bp, 523 aa] {ON}  ...   194   2e-52
KNAG0H01520 Chr8 complement(267709..269574) [1866 bp, 621 aa] {O...   196   3e-52
Smik_7.205 Chr7 complement(354693..356261) [1569 bp, 522 aa] {ON...   193   3e-52
Ecym_5422 Chr5 complement(868686..869065,869897..871199) [1683 b...   194   4e-52
KLTH0D09328g Chr4 complement(773449..773837,774557..775823) [165...   193   7e-52
CAGL0H03377g Chr8 complement(313755..315377) [1623 bp, 540 aa] {...   192   1e-51
KLTH0D09746g Chr4 (805863..807728) [1866 bp, 621 aa] {ON} simila...   194   1e-51
Suva_7.192 Chr7 complement(353138..354694) [1557 bp, 518 aa] {ON...   191   1e-51
AFL027C Chr6 complement(386001..388451) [2451 bp, 816 aa] {ON} S...   197   2e-51
KAFR0G02030 Chr7 complement(428516..430336) [1821 bp, 606 aa] {O...   192   3e-51
TPHA0E02410 Chr5 (512919..514490) [1572 bp, 523 aa] {ON} Anc_6.2...   190   3e-51
ZYRO0G14960g Chr7 (1201495..1203990) [2496 bp, 831 aa] {ON} simi...   196   4e-51
TDEL0A05590 Chr1 (980392..982185) [1794 bp, 597 aa] {ON} Anc_8.6...   192   5e-51
NDAI0E02430 Chr5 complement(503901..505886) [1986 bp, 661 aa] {O...   192   1e-50
NDAI0I01150 Chr9 (278832..280403) [1572 bp, 523 aa] {ON} Anc_6.204    189   1e-50
NCAS0D03740 Chr4 complement(694809..696368) [1560 bp, 519 aa] {O...   188   1e-50
CAGL0I02354g Chr9 (209279..210592) [1314 bp, 437 aa] {ON} highly...   186   2e-50
KLLA0A05203g Chr1 complement(462167..463474) [1308 bp, 435 aa] {...   186   2e-50
Ecym_2269 Chr2 complement(527849..530482) [2634 bp, 877 aa] {ON}...   194   3e-50
Ecym_8298 Chr8 (605258..607174) [1917 bp, 638 aa] {ON} similar t...   190   3e-50
KNAG0A03280 Chr1 complement(416099..417922) [1824 bp, 607 aa] {O...   189   3e-50
Kpol_534.31 s534 complement(73551..76169) [2619 bp, 872 aa] {ON}...   193   3e-50
TBLA0E04100 Chr5 (1032727..1035327) [2601 bp, 866 aa] {ON} Anc_8...   190   3e-49
TBLA0D03520 Chr4 (873710..876379) [2670 bp, 889 aa] {ON} Anc_6.1...   191   3e-49
Kpol_1072.50 s1072 complement(115009..116961) [1953 bp, 650 aa] ...   187   5e-49
TDEL0G00930 Chr7 complement(186836..188146) [1311 bp, 436 aa] {O...   181   6e-49
KLTH0H05852g Chr8 complement(514352..516787) [2436 bp, 811 aa] {...   187   2e-48
YBR237W Chr2 (691969..694518) [2550 bp, 849 aa] {ON}  PRP5RNA he...   187   4e-48
Kwal_27.11734 s27 complement(923899..925614) [1716 bp, 571 aa] {...   182   6e-48
Skud_12.59 Chr12 (122973..125249) [2277 bp, 758 aa] {ON} YLL008W...   185   7e-48
SAKL0G11748g Chr7 complement(998525..1000816) [2292 bp, 763 aa] ...   184   1e-47
Suva_4.494 Chr4 (862220..864772) [2553 bp, 850 aa] {ON} YBR237W ...   183   5e-47
Smik_12.55 Chr12 (118743..120950) [2208 bp, 735 aa] {ON} YLL008W...   182   5e-47
YLL008W Chr12 (131729..133987) [2259 bp, 752 aa] {ON}  DRS1Nucle...   182   6e-47
KNAG0M00660 Chr13 complement(107772..110426) [2655 bp, 884 aa] {...   183   8e-47
CAGL0D03124g Chr4 complement(321029..323206) [2178 bp, 725 aa] {...   181   9e-47
Suva_10.67 Chr10 (136688..138922) [2235 bp, 744 aa] {ON} YLL008W...   181   1e-46
AER301C Chr5 complement(1188485..1189792) [1308 bp, 435 aa] {ON}...   175   1e-46
CAGL0K07029g Chr11 complement(690501..692951) [2451 bp, 816 aa] ...   182   1e-46
NCAS0A01550 Chr1 complement(302857..305103) [2247 bp, 748 aa] {O...   180   3e-46
TDEL0E04210 Chr5 complement(786151..788373) [2223 bp, 740 aa] {O...   179   4e-46
KNAG0H02520 Chr8 complement(463527..465791) [2265 bp, 754 aa] {O...   179   5e-46
KLLA0D09504g Chr4 complement(801783..804095) [2313 bp, 770 aa] {...   178   1e-45
NDAI0C02490 Chr3 complement(570276..572591) [2316 bp, 771 aa] {O...   178   2e-45
Kpol_534.53 s534 (137204..139462) [2259 bp, 752 aa] {ON} (137204...   177   3e-45
TBLA0C06160 Chr3 (1494579..1496852) [2274 bp, 757 aa] {ON} Anc_5...   177   4e-45
Ecym_1395 Chr1 complement(818424..820121) [1698 bp, 565 aa] {ON}...   173   7e-45
KAFR0G03480 Chr7 (718012..720570) [2559 bp, 852 aa] {ON} Anc_6.1...   176   9e-45
ZYRO0B10318g Chr2 complement(808717..810969) [2253 bp, 750 aa] {...   174   2e-44
NCAS0B02570 Chr2 (429423..431195) [1773 bp, 590 aa] {ON} Anc_8.469    170   7e-44
YJL033W Chr10 (383837..386149) [2313 bp, 770 aa] {ON}  HCA4Putat...   172   2e-43
SAKL0G12760g Chr7 complement(1088344..1090557) [2214 bp, 737 aa]...   171   2e-43
Kwal_33.15165 s33 (987878..990073) [2196 bp, 731 aa] {ON} YLL008...   167   5e-42
SAKL0A06204g Chr1 complement(560276..562807) [2532 bp, 843 aa] {...   166   2e-41
KNAG0A04130 Chr1 (559075..560904) [1830 bp, 609 aa] {ON} Anc_8.4...   163   3e-41
AGL112C Chr7 complement(495879..497855) [1977 bp, 658 aa] {ON} S...   163   4e-41
TBLA0H03240 Chr8 complement(787863..790166) [2304 bp, 767 aa] {O...   164   4e-41
SAKL0H11968g Chr8 (1022452..1024152) [1701 bp, 566 aa] {ON} simi...   161   6e-41
KLLA0F10505g Chr6 complement(966736..969174) [2439 bp, 812 aa] {...   162   3e-40
KAFR0D04630 Chr4 complement(909161..910624) [1464 bp, 487 aa] {O...   157   3e-40
ZYRO0C14234g Chr3 complement(1116350..1117834) [1485 bp, 494 aa]...   156   1e-39
CAGL0L08976g Chr12 complement(981008..982861) [1854 bp, 617 aa] ...   157   2e-39
TPHA0N01130 Chr14 complement(237020..239653) [2634 bp, 877 aa] {...   159   2e-39
KLTH0A02244g Chr1 (190077..191873) [1797 bp, 598 aa] {ON} simila...   156   3e-39
ZYRO0F04312g Chr6 complement(366863..368671) [1809 bp, 602 aa] {...   155   7e-39
TPHA0D01990 Chr4 complement(411607..413103) [1497 bp, 498 aa] {O...   153   1e-38
NDAI0C04250 Chr3 (968216..969730) [1515 bp, 504 aa] {ON} Anc_5.337    152   1e-38
Kwal_26.8470 s26 complement(798445..799722) [1278 bp, 425 aa] {O...   150   2e-38
KNAG0B04660 Chr2 complement(900857..902341) [1485 bp, 494 aa] {O...   152   2e-38
Ecym_7324 Chr7 complement(689228..691021) [1794 bp, 597 aa] {ON}...   154   3e-38
Ecym_8261 Chr8 complement(528229..530556) [2328 bp, 775 aa] {ON}...   155   3e-38
NCAS0F02790 Chr6 (561303..562811) [1509 bp, 502 aa] {ON} Anc_5.337    151   5e-38
NDAI0C06300 Chr3 complement(1459510..1461354) [1845 bp, 614 aa] ...   152   9e-38
KLTH0H15686g Chr8 complement(1353647..1354725,1354841..1355081) ...   149   1e-37
Skud_15.210 Chr15 complement(374410..375858) [1449 bp, 482 aa] {...   149   1e-37
Smik_6.81 Chr6 complement(152467..154287) [1821 bp, 606 aa] {ON}...   152   1e-37
Kpol_1005.11 s1005 complement(18157..19677) [1521 bp, 506 aa] {O...   150   2e-37
Smik_2.380 Chr2 (678057..680609) [2553 bp, 850 aa] {ON} YBR237W ...   154   2e-37
Skud_6.72 Chr6 complement(140844..142664) [1821 bp, 606 aa] {ON}...   151   2e-37
SAKL0G09328g Chr7 (797795..799312) [1518 bp, 505 aa] {ON} highly...   149   2e-37
KLLA0C14608g Chr3 (1276354..1277817) [1464 bp, 487 aa] {ON} high...   149   2e-37
Skud_2.369 Chr2 (660665..663211) [2547 bp, 848 aa] {ON} YBR237W ...   153   2e-37
Ecym_3217 Chr3 complement(411925..413385) [1461 bp, 486 aa] {ON}...   149   2e-37
TDEL0E02890 Chr5 (550708..552213) [1506 bp, 501 aa] {ON} Anc_5.3...   149   2e-37
SAKL0H13574g Chr8 (1161196..1163202) [2007 bp, 668 aa] {ON} simi...   152   2e-37
NCAS0H01280 Chr8 complement(243749..246412) [2664 bp, 887 aa] {O...   153   3e-37
Smik_8.136 Chr8 complement(202825..204330) [1506 bp, 501 aa] {ON...   149   3e-37
NCAS0J00580 Chr10 (87108..88943) [1836 bp, 611 aa] {ON} Anc_8.87      150   3e-37
YHR065C Chr8 complement(227532..229037) [1506 bp, 501 aa] {ON}  ...   149   3e-37
Suva_8.98 Chr8 complement(177272..178720) [1449 bp, 482 aa] {ON}...   148   3e-37
Smik_15.224 Chr15 complement(380539..381972) [1434 bp, 477 aa] {...   148   3e-37
KAFR0E01640 Chr5 complement(335123..337405) [2283 bp, 760 aa] {O...   152   4e-37
KLTH0F08382g Chr6 (724794..726767) [1974 bp, 657 aa] {ON} simila...   150   4e-37
TPHA0N00940 Chr14 (202770..205085) [2316 bp, 771 aa] {ON} Anc_5....   152   5e-37
Skud_8.122 Chr8 complement(200848..202359) [1512 bp, 503 aa] {ON...   147   7e-37
Ecym_4165 Chr4 (350595..352571) [1977 bp, 658 aa] {ON} similar t...   150   7e-37
KLLA0E21935g Chr5 (1959770..1961083) [1314 bp, 437 aa] {ON} high...   146   9e-37
Suva_15.254 Chr15 complement(429201..430712) [1512 bp, 503 aa] {...   147   1e-36
Ecym_6049 Chr6 (94618..95934) [1317 bp, 438 aa] {ON} similar to ...   146   1e-36
TBLA0C03500 Chr3 complement(835236..836756) [1521 bp, 506 aa] {O...   147   1e-36
Kpol_340.2 s340 complement(3233..5245) [2013 bp, 670 aa] {ON} co...   149   2e-36
CAGL0J10912g Chr10 (1063600..1065081) [1482 bp, 493 aa] {ON} hig...   146   2e-36
ZYRO0C04378g Chr3 complement(342717..344762) [2046 bp, 681 aa] {...   149   2e-36
CAGL0L10021g Chr12 complement(1076197..1077711) [1515 bp, 504 aa...   146   2e-36
NCAS0B01730 Chr2 complement(286249..288105) [1857 bp, 618 aa] {O...   148   3e-36
AAL041C Chr1 complement(270739..272202) [1464 bp, 487 aa] {ON} S...   145   4e-36
Kpol_2001.67 s2001 (185153..186607) [1455 bp, 484 aa] {ON} (1851...   144   6e-36
SAKL0F11088g Chr6 complement(866571..868064) [1494 bp, 497 aa] {...   144   8e-36
NCAS0A14060 Chr1 (2765451..2766983) [1533 bp, 510 aa] {ON} Anc_7...   144   1e-35
Suva_16.191 Chr16 complement(333913..335769) [1857 bp, 618 aa] {...   146   1e-35
ADR260C Chr4 complement(1152257..1153573) [1317 bp, 438 aa] {ON}...   142   1e-35
SAKL0B02794g Chr2 complement(266645..268441) [1797 bp, 598 aa] {...   145   1e-35
Kwal_33.14325 s33 (619599..621101) [1503 bp, 500 aa] {ON} YHR065...   144   2e-35
Kwal_23.3235 s23 (209691..211721) [2031 bp, 676 aa] {ON} YDR194C...   146   2e-35
CAGL0L03846g Chr12 complement(443677..444047,445148..446411) [16...   144   2e-35
TDEL0F05260 Chr6 complement(983324..985291) [1968 bp, 655 aa] {O...   145   2e-35
Smik_6.318 Chr6 (498013..499854) [1842 bp, 613 aa] {ON} YPL119C ...   145   2e-35
Skud_15.370 Chr15 (661915..663744) [1830 bp, 609 aa] {ON} YOR204...   145   2e-35
ZYRO0A10802g Chr1 complement(869465..871780) [2316 bp, 771 aa] {...   146   2e-35
NDAI0C02320 Chr3 (527244..529538) [2295 bp, 764 aa] {ON} Anc_5.241    146   2e-35
KLTH0F07106g Chr6 (618637..620214) [1578 bp, 525 aa] {ON} highly...   143   2e-35
Skud_16.161 Chr16 complement(295968..297827) [1860 bp, 619 aa] {...   145   3e-35
Skud_4.96 Chr4 complement(166027..167550) [1524 bp, 507 aa] {ON}...   143   3e-35
KLLA0A09669g Chr1 complement(847036..848529) [1494 bp, 497 aa] {...   143   3e-35
TPHA0D04520 Chr4 (985683..987191) [1509 bp, 502 aa] {ON} Anc_7.3...   143   3e-35
CAGL0I03476g Chr9 complement(294849..296372) [1524 bp, 507 aa] {...   142   4e-35
TPHA0G02050 Chr7 (420332..421648) [1317 bp, 438 aa] {ON} Anc_2.3...   141   4e-35
NCAS0A01400 Chr1 (274080..276368) [2289 bp, 762 aa] {ON} Anc_5.241    145   4e-35
Skud_4.171 Chr4 (300716..302056) [1341 bp, 446 aa] {ON} YDL084W ...   141   4e-35
YOR204W Chr15 (722911..724725) [1815 bp, 604 aa] {ON}  DED1ATP-d...   144   5e-35
KNAG0C03820 Chr3 complement(748934..750475) [1542 bp, 513 aa] {O...   142   5e-35
Smik_15.390 Chr15 (672576..674405) [1830 bp, 609 aa] {ON} YOR204...   144   5e-35
SAKL0H08162g Chr8 complement(702292..704166) [1875 bp, 624 aa] {...   144   6e-35
TDEL0E03850 Chr5 complement(723551..725836) [2286 bp, 761 aa] {O...   145   6e-35
TDEL0C02100 Chr3 complement(362760..364199) [1440 bp, 479 aa] {O...   141   7e-35
YDL160C Chr4 complement(170410..171930) [1521 bp, 506 aa] {ON}  ...   142   7e-35
KAFR0B01520 Chr2 (286962..288452) [1491 bp, 496 aa] {ON} Anc_5.4...   141   8e-35
Suva_4.86 Chr4 complement(158173..159699) [1527 bp, 508 aa] {ON}...   142   8e-35
TPHA0B02850 Chr2 complement(650888..652774) [1887 bp, 628 aa] {O...   143   8e-35
KAFR0B04560 Chr2 complement(947248..947615,948264..949527) [1632...   142   8e-35
YPL119C Chr16 complement(324411..326264) [1854 bp, 617 aa] {ON} ...   143   9e-35
TPHA0B02930 Chr2 (666924..668207) [1284 bp, 427 aa] {ON} Anc_6.1...   140   9e-35
Ecym_4646 Chr4 complement(1259564..1261036) [1473 bp, 490 aa] {O...   141   1e-34
Kwal_23.2883 s23 complement(58087..60381) [2295 bp, 764 aa] {ON}...   144   1e-34
CAGL0J06908g Chr10 complement(662041..663855) [1815 bp, 604 aa] ...   143   1e-34
Kpol_1041.33 s1041 complement(82855..84180) [1326 bp, 441 aa] {O...   140   1e-34
TBLA0C05580 Chr3 (1351338..1352610,1353450..1353799) [1623 bp, 5...   142   1e-34
Smik_4.77 Chr4 complement(147172..148692) [1521 bp, 506 aa] {ON}...   141   1e-34
Kpol_1004.13 s1004 (25289..27595) [2307 bp, 768 aa] {ON} (25289....   144   1e-34
Smik_13.506 Chr13 complement(832760..834277) [1518 bp, 505 aa] {...   141   1e-34
YNL112W Chr14 (413639..414911,415914..416281) [1641 bp, 546 aa] ...   141   2e-34
Kpol_165.1 s165 complement(441..1766) [1326 bp, 441 aa] {ON} com...   139   2e-34
NDAI0A01960 Chr1 complement(436462..438066) [1605 bp, 534 aa] {O...   141   2e-34
TBLA0B04200 Chr2 complement(970057..971952) [1896 bp, 631 aa] {O...   142   2e-34
CAGL0M13519g Chr13 complement(1330802..1332286) [1485 bp, 494 aa...   140   2e-34
TPHA0G02585 Chr7 (535997..537313) [1317 bp, 438 aa] {ON}              139   2e-34
TBLA0B08880 Chr2 complement(2108994..2110322) [1329 bp, 442 aa] ...   139   3e-34
KLTH0G07766g Chr7 complement(626094..628388) [2295 bp, 764 aa] {...   143   3e-34
AFL221C Chr6 complement(22711..23108,23775..25050) [1674 bp, 557...   140   3e-34
KAFR0B00910 Chr2 complement(168186..169724) [1539 bp, 512 aa] {O...   140   3e-34
ZYRO0F11440g Chr6 (939613..941184) [1572 bp, 523 aa] {ON} highly...   140   3e-34
CAGL0L06908g Chr12 complement(779554..780873) [1320 bp, 439 aa] ...   138   4e-34
KNAG0A05850 Chr1 (873957..875306) [1350 bp, 449 aa] {ON} Anc_2.3...   138   4e-34
Ecym_2213 Chr2 (419873..421537) [1665 bp, 554 aa] {ON} similar t...   140   4e-34
KNAG0F02610 Chr6 complement(488956..491244) [2289 bp, 762 aa] {O...   142   4e-34
Suva_4.163 Chr4 (294691..296031) [1341 bp, 446 aa] {ON} YDL084W ...   138   4e-34
TBLA0C00640 Chr3 (129301..131040) [1740 bp, 579 aa] {ON} Anc_8.1...   140   5e-34
TBLA0D03400 Chr4 (844529..846856) [2328 bp, 775 aa] {ON} Anc_5.2...   142   5e-34
KNAG0A04660 Chr1 (663566..665707) [2142 bp, 713 aa] {ON} Anc_8.4...   142   5e-34
YDL084W Chr4 (305237..306577) [1341 bp, 446 aa] {ON}  SUB2Compon...   138   5e-34
NCAS0A03950 Chr1 (799925..801265) [1341 bp, 446 aa] {ON} Anc_2.384    138   6e-34
Smik_4.152 Chr4 (281728..283068) [1341 bp, 446 aa] {ON} YDL084W ...   138   6e-34
Ecym_4775 Chr4 (1507889..1509391) [1503 bp, 500 aa] {ON} similar...   139   6e-34
ZYRO0G08580g Chr7 complement(695127..696746) [1620 bp, 539 aa] {...   139   6e-34
TPHA0L02160 Chr12 complement(448305..449801) [1497 bp, 498 aa] {...   139   6e-34
ACR197W Chr3 (695405..696859) [1455 bp, 484 aa] {ON} Syntenic ho...   138   6e-34
Kpol_1058.53 s1058 complement(136863..138191) [1329 bp, 442 aa] ...   137   7e-34
Skud_14.219 Chr14 (403781..405088) [1308 bp, 435 aa] {ON} YNL112...   137   7e-34
ZYRO0F10934g Chr6 (890412..892223) [1812 bp, 603 aa] {ON} simila...   140   8e-34
TDEL0G01420 Chr7 (287165..288703) [1539 bp, 512 aa] {ON} Anc_6.2...   139   8e-34
KLLA0F23716g Chr6 complement(2215454..2215845,2216857..2218129) ...   139   9e-34
TDEL0F01190 Chr6 (211677..212937,213454..213842) [1650 bp, 549 a...   139   9e-34
TDEL0G03140 Chr7 (587922..589256) [1335 bp, 444 aa] {ON} Anc_2.3...   137   9e-34
KLTH0B08998g Chr2 complement(731722..733200) [1479 bp, 492 aa] {...   138   1e-33
Smik_14.215 Chr14 (393283..394555,395537..395907) [1644 bp, 547 ...   139   1e-33
Kwal_56.24005 s56 complement(809954..811555) [1602 bp, 533 aa] {...   139   1e-33
KLLA0C16599g Chr3 (1453655..1455199) [1545 bp, 514 aa] {ON} simi...   138   1e-33
NDAI0C03600 Chr3 complement(826718..828277) [1560 bp, 519 aa] {O...   138   1e-33
TBLA0F02360 Chr6 (582109..583866) [1758 bp, 585 aa] {ON} Anc_7.3...   139   1e-33
KLTH0H01562g Chr8 complement(140915..142390) [1476 bp, 491 aa] {...   137   2e-33
KNAG0I02050 Chr9 complement(399547..399554,399758..401021) [1272...   135   2e-33
Suva_14.226 Chr14 (410416..411691,412742..413097) [1632 bp, 543 ...   138   2e-33
TDEL0C01160 Chr3 complement(198802..200613) [1812 bp, 603 aa] {O...   139   2e-33
NCAS0E03920 Chr5 complement(769305..770618) [1314 bp, 437 aa] {O...   135   3e-33
SAKL0H01430g Chr8 (149724..151226) [1503 bp, 500 aa] {ON} highly...   137   3e-33
ADL024C Chr4 complement(657270..658979) [1710 bp, 569 aa] {ON} S...   138   3e-33
ACR040W Chr3 (431343..433634) [2292 bp, 763 aa] {ON} Syntenic ho...   139   3e-33
SAKL0E05148g Chr5 complement(419901..420979,421045..421372) [140...   136   3e-33
KAFR0F02940 Chr6 (582057..583388) [1332 bp, 443 aa] {ON} Anc_2.3...   135   4e-33
KLTH0H04466g Chr8 (399689..401350) [1662 bp, 553 aa] {ON} simila...   137   5e-33
ZYRO0D07546g Chr4 (657145..658629) [1485 bp, 494 aa] {ON} highly...   136   5e-33
Kwal_56.24588 s56 (1065225..1066766) [1542 bp, 513 aa] {ON} YDL1...   136   5e-33
CAGL0J01045g Chr10 (101282..103579) [2298 bp, 765 aa] {ON} highl...   139   6e-33
NDAI0E01750 Chr5 complement(346153..347505) [1353 bp, 450 aa] {O...   135   6e-33
KAFR0B04480 Chr2 complement(929008..930315) [1308 bp, 435 aa] {O...   134   6e-33
TDEL0G00650 Chr7 (132659..134116) [1458 bp, 485 aa] {ON} Anc_5.4...   135   7e-33
NCAS0F02200 Chr6 (438960..440486) [1527 bp, 508 aa] {ON} Anc_5.40     135   8e-33
AGR333C Chr7 complement(1353154..1354668) [1515 bp, 504 aa] {ON}...   135   8e-33
Suva_12.48 Chr12 (66743..69055) [2313 bp, 770 aa] {ON} YJL033W (...   138   1e-32
Skud_8.233 Chr8 (413556..414869) [1314 bp, 437 aa] {ON} YHR169W ...   134   1e-32
Kpol_513.15 s513 complement(41334..42839) [1506 bp, 501 aa] {ON}...   135   1e-32
CAGL0K02387g Chr11 (216795..218492) [1698 bp, 565 aa] {ON} highl...   136   1e-32
Kwal_23.4288 s23 (654900..656378) [1479 bp, 492 aa] {ON} YMR290C...   135   1e-32
NDAI0B00900 Chr2 complement(209012..210322) [1311 bp, 436 aa] {O...   133   1e-32
Skud_7.100 Chr7 (187842..189518) [1677 bp, 558 aa] {ON} YGL171W ...   135   2e-32
KLTH0H08646g Chr8 (750413..752113) [1701 bp, 566 aa] {ON} highly...   135   2e-32
Skud_13.463 Chr13 complement(823646..825163) [1518 bp, 505 aa] {...   134   2e-32
Smik_10.239 Chr10 (380101..382413) [2313 bp, 770 aa] {ON} YJL033...   137   2e-32
YMR290C Chr13 complement(850074..851591) [1518 bp, 505 aa] {ON} ...   134   3e-32
Suva_13.480 Chr13 complement(832037..833554) [1518 bp, 505 aa] {...   134   3e-32
KNAG0F02050 Chr6 (392126..393727) [1602 bp, 533 aa] {ON} Anc_6.2...   134   3e-32
ZYRO0A08272g Chr1 (665522..666853) [1332 bp, 443 aa] {ON} highly...   132   4e-32
KLLA0C15499g Chr3 complement(1345201..1346715) [1515 bp, 504 aa]...   133   5e-32
YHR169W Chr8 (442181..443476) [1296 bp, 431 aa] {ON}  DBP8ATPase...   132   5e-32
AFL080W Chr6 (288205..289812) [1608 bp, 535 aa] {ON} Syntenic ho...   133   5e-32
Smik_8.253 Chr8 (419155..420468) [1314 bp, 437 aa] {ON} YHR169W ...   132   6e-32
Suva_15.369 Chr15 (648232..649545) [1314 bp, 437 aa] {ON} YHR169...   131   7e-32
KLTH0H00638g Chr8 complement(64621..65922) [1302 bp, 433 aa] {ON...   131   7e-32
NDAI0B02410 Chr2 complement(602541..604256) [1716 bp, 571 aa] {O...   134   8e-32
Skud_10.189 Chr10 (351797..354109) [2313 bp, 770 aa] {ON} YJL033...   135   8e-32
YGL171W Chr7 (182390..184084) [1695 bp, 564 aa] {ON}  ROK1RNA-de...   133   8e-32
KNAG0D02780 Chr4 complement(504774..506204) [1431 bp, 476 aa] {O...   131   1e-31
SAKL0E10670g Chr5 complement(888829..889205,889934..891281) [172...   133   1e-31
SAKL0H02178g Chr8 complement(211451..212758) [1308 bp, 435 aa] {...   130   1e-31
Suva_7.92 Chr7 (178376..180052) [1677 bp, 558 aa] {ON} YGL171W (...   132   1e-31
NCAS0B04630 Chr2 (845866..847557) [1692 bp, 563 aa] {ON} Anc_8.124    132   2e-31
Ecym_8358 Chr8 (719978..721687) [1710 bp, 569 aa] {ON} similar t...   132   3e-31
TBLA0C06780 Chr3 complement(1636223..1637713) [1491 bp, 496 aa] ...   130   3e-31
Kpol_1062.5 s1062 complement(10370..11665) [1296 bp, 431 aa] {ON...   129   3e-31
KAFR0C02220 Chr3 complement(439704..441239) [1536 bp, 511 aa] {O...   130   4e-31
TBLA0B07950 Chr2 complement(1884315..1885496) [1182 bp, 393 aa] ...   128   5e-31
Smik_7.100 Chr7 (177395..179068) [1674 bp, 557 aa] {ON} YGL171W ...   130   6e-31
ZYRO0E02530g Chr5 (197126..198796) [1671 bp, 556 aa] {ON} highly...   130   7e-31
TPHA0H01160 Chr8 (257728..259029) [1302 bp, 433 aa] {ON} Anc_5.6...   128   1e-30
Kwal_56.24760 s56 (1136947..1138248) [1302 bp, 433 aa] {ON} YHR1...   128   1e-30
KNAG0D02250 Chr4 (387478..389160) [1683 bp, 560 aa] {ON} Anc_8.1...   130   1e-30
KLLA0C17424g Chr3 (1529941..1531680) [1740 bp, 579 aa] {ON} simi...   129   2e-30
Kpol_274.7 s274 complement(11790..13502) [1713 bp, 570 aa] {ON} ...   129   2e-30
SAKL0H20218g Chr8 (1770946..1772670) [1725 bp, 574 aa] {ON} simi...   128   4e-30
KLTH0E10890g Chr5 complement(976948..978717) [1770 bp, 589 aa] {...   128   4e-30
TBLA0B05050 Chr2 (1191456..1192997) [1542 bp, 513 aa] {ON} Anc_6...   127   5e-30
TPHA0D00940 Chr4 complement(186966..188678) [1713 bp, 570 aa] {O...   128   5e-30
KLLA0C15433g Chr3 complement(1339439..1341058) [1620 bp, 539 aa]...   127   8e-30
ZYRO0A02948g Chr1 (240353..242026) [1674 bp, 557 aa] {ON} simila...   127   9e-30
SAKL0A04752g Chr1 (434100..435749) [1650 bp, 549 aa] {ON} simila...   126   1e-29
Ecym_5095 Chr5 (213368..214684) [1317 bp, 438 aa] {ON} similar t...   124   1e-29
KAFR0D01120 Chr4 complement(222704..224536) [1833 bp, 610 aa] {O...   127   2e-29
TDEL0F01090 Chr6 (196968..198623) [1656 bp, 551 aa] {ON} Anc_8.1...   126   2e-29
NCAS0A05470 Chr1 (1077464..1079413) [1950 bp, 649 aa] {ON} Anc_6...   126   4e-29
KAFR0E02810 Chr5 complement(567875..569581) [1707 bp, 568 aa] {O...   125   4e-29
KLLA0E14367g Chr5 (1268901..1270691) [1791 bp, 596 aa] {ON} simi...   125   4e-29
Suva_10.374 Chr10 complement(655832..657616) [1785 bp, 594 aa] {...   124   1e-28
KAFR0B02030 Chr2 complement(397276..398991) [1716 bp, 571 aa] {O...   124   1e-28
Skud_4.505 Chr4 complement(903103..904917) [1815 bp, 604 aa] {ON...   124   1e-28
TBLA0D02800 Chr4 (686898..688661) [1764 bp, 587 aa] {ON} Anc_8.4...   124   1e-28
ZYRO0C11660g Chr3 (912287..913594) [1308 bp, 435 aa] {ON} highly...   122   1e-28
CAGL0K11198g Chr11 complement(1087381..1089129) [1749 bp, 582 aa...   123   2e-28
KNAG0H01370 Chr8 complement(243799..244995) [1197 bp, 398 aa] {O...   120   2e-28
Smik_4.490 Chr4 complement(893394..895157) [1764 bp, 587 aa] {ON...   123   2e-28
YDR243C Chr4 complement(948518..950284) [1767 bp, 588 aa] {ON}  ...   123   2e-28
KLLA0A10659g Chr1 complement(927059..928255) [1197 bp, 398 aa] {...   120   3e-28
TDEL0B01670 Chr2 (297786..299525) [1740 bp, 579 aa] {ON}              122   4e-28
YLR276C Chr12 complement(695046..696830) [1785 bp, 594 aa] {ON} ...   122   4e-28
Suva_2.409 Chr2 complement(727948..729717) [1770 bp, 589 aa] {ON...   122   5e-28
Smik_12.355 Chr12 complement(633462..635246) [1785 bp, 594 aa] {...   121   8e-28
TPHA0C01860 Chr3 (425216..427039) [1824 bp, 607 aa] {ON} Anc_8.4...   121   9e-28
Ecym_4755 Chr4 complement(1469426..1470622) [1197 bp, 398 aa] {O...   118   1e-27
KAFR0A04960 Chr1 (981797..983572) [1776 bp, 591 aa] {ON} Anc_6.7...   121   1e-27
Skud_12.359 Chr12 complement(636149..637930) [1782 bp, 593 aa] {...   120   2e-27
Kwal_23.5125 s23 complement(1024642..1026438) [1797 bp, 598 aa] ...   120   2e-27
SAKL0D03960g Chr4 complement(321960..323156) [1197 bp, 398 aa] {...   117   2e-27
Kpol_1058.43 s1058 complement(121252..123075) [1824 bp, 607 aa] ...   120   2e-27
NDAI0A05860 Chr1 complement(1331381..1332580) [1200 bp, 399 aa] ...   115   7e-27
Suva_14.394 Chr14 (676747..678666) [1920 bp, 639 aa] {ON} YNR038...   119   8e-27
YFL002C Chr6 complement(145114..146934) [1821 bp, 606 aa] {ON}  ...   118   9e-27
TPHA0M00900 Chr13 (175733..176935) [1203 bp, 400 aa] {ON} Anc_3....   115   1e-26
ZYRO0A03476g Chr1 complement(277585..278784) [1200 bp, 399 aa] {...   115   1e-26
KNAG0L00410 Chr12 complement(57484..59325) [1842 bp, 613 aa] {ON...   118   1e-26
ZYRO0B05852g Chr2 (468295..470550) [2256 bp, 751 aa] {ON} simila...   118   1e-26
AGL004C Chr7 complement(715482..717410) [1929 bp, 642 aa] {ON} S...   118   2e-26
TPHA0D00770 Chr4 (155185..157002) [1818 bp, 605 aa] {ON} Anc_8.8...   117   2e-26
NCAS0A10430 Chr1 (2073293..2074492) [1200 bp, 399 aa] {ON} Anc_3...   114   2e-26
SAKL0A08118g Chr1 (718720..720564) [1845 bp, 614 aa] {ON} highly...   117   3e-26
KAFR0E01160 Chr5 (232985..234202) [1218 bp, 405 aa] {ON} Anc_3.2...   114   3e-26
KLLA0C04576g Chr3 complement(417217..419001) [1785 bp, 594 aa] {...   116   4e-26
ACR253C Chr3 complement(802236..803426) [1191 bp, 396 aa] {ON} S...   113   4e-26
NCAS0D02940 Chr4 complement(558088..559923) [1836 bp, 611 aa] {O...   116   4e-26
TPHA0K01120 Chr11 (235339..237153) [1815 bp, 604 aa] {ON} Anc_6....   116   5e-26
TBLA0E03420 Chr5 (846796..849024) [2229 bp, 742 aa] {ON} Anc_3.1...   116   6e-26
Kpol_1036.3 s1036 complement(10496..11695) [1200 bp, 399 aa] {ON...   113   6e-26
CAGL0M06567g Chr13 complement(679126..680325) [1200 bp, 399 aa] ...   112   7e-26
Suva_6.59 Chr6 complement(110278..112098) [1821 bp, 606 aa] {ON}...   115   1e-25
TBLA0I01860 Chr9 (418583..419746) [1164 bp, 387 aa] {ON} Anc_3.2...   112   1e-25
Kwal_56.23291 s56 complement(479073..480842) [1770 bp, 589 aa] {...   114   2e-25
CAGL0A03652g Chr1 complement(373100..375301) [2202 bp, 733 aa] {...   115   2e-25
NCAS0I02320 Chr9 (437124..439319) [2196 bp, 731 aa] {ON} Anc_3.1...   114   3e-25
KLTH0C07964g Chr3 complement(679877..681073) [1197 bp, 398 aa] {...   111   3e-25
KNAG0K00400 Chr11 (69795..71093) [1299 bp, 432 aa] {ON} Anc_5.69...   111   3e-25
Ecym_5196 Chr5 complement(405570..406760) [1191 bp, 396 aa] {ON}...   111   3e-25
YDR021W Chr4 (486804..488003) [1200 bp, 399 aa] {ON}  FAL1Nucleo...   111   3e-25
KLTH0F05610g Chr6 complement(483243..484433) [1191 bp, 396 aa] {...   110   3e-25
AER408W Chr5 (1418694..1419890) [1197 bp, 398 aa] {ON} Syntenic ...   110   3e-25
NDAI0C05120 Chr3 complement(1191160..1193046) [1887 bp, 628 aa] ...   113   4e-25
TPHA0B03040 Chr2 complement(690810..692000) [1191 bp, 396 aa] {O...   110   4e-25
KLTH0G15224g Chr7 (1332767..1334557) [1791 bp, 596 aa] {ON} high...   112   6e-25
Suva_2.171 Chr2 (297542..298741) [1200 bp, 399 aa] {ON} YDR021W ...   110   6e-25
Kpol_1007.10 s1007 complement(17289..19106) [1818 bp, 605 aa] {O...   112   6e-25
TDEL0G03990 Chr7 (726319..728085) [1767 bp, 588 aa] {ON} Anc_6.7...   112   7e-25
Smik_4.255 Chr4 (467483..468682) [1200 bp, 399 aa] {ON} YDR021W ...   109   8e-25
Skud_4.273 Chr4 (477488..478687) [1200 bp, 399 aa] {ON} YDR021W ...   109   9e-25
KLLA0A05731g Chr1 (536243..537433) [1191 bp, 396 aa] {ON} highly...   109   1e-24
YBR142W Chr2 (528317..530638) [2322 bp, 773 aa] {ON}  MAK5Essent...   112   1e-24
ZYRO0D14388g Chr4 complement(1218001..1219752) [1752 bp, 583 aa]...   110   2e-24
Smik_2.282 Chr2 (512869..515271) [2403 bp, 800 aa] {ON} YBR142W ...   112   2e-24
Skud_2.270 Chr2 (496096..498402) [2307 bp, 768 aa] {ON} YBR142W ...   111   2e-24
Kwal_33.14000 s33 complement(477253..478443) [1191 bp, 396 aa] {...   108   3e-24
KNAG0K01980 Chr11 (405216..407381) [2166 bp, 721 aa] {ON} Anc_3....   111   3e-24
TDEL0D03760 Chr4 complement(689455..690651) [1197 bp, 398 aa] {O...   108   3e-24
KNAG0F03020 Chr6 complement(572005..573801) [1797 bp, 598 aa] {O...   110   3e-24
NDAI0I01960 Chr9 (457199..459025) [1827 bp, 608 aa] {ON} Anc_6.73     110   4e-24
TBLA0C00690 Chr3 complement(136694..138508) [1815 bp, 604 aa] {O...   110   4e-24
CAGL0F05577g Chr6 (559705..561705) [2001 bp, 666 aa] {ON} simila...   110   4e-24
Suva_4.392 Chr4 (697442..699823) [2382 bp, 793 aa] {ON} YBR142W ...   110   5e-24
SAKL0C06336g Chr3 complement(584406..585599) [1194 bp, 397 aa] {...   107   6e-24
YOR046C Chr15 complement(414459..415907) [1449 bp, 482 aa] {ON} ...   108   7e-24
KAFR0G01440 Chr7 complement(319146..321305) [2160 bp, 719 aa] {O...   109   1e-23
Smik_10.94 Chr10 complement(151257..152444) [1188 bp, 395 aa] {O...   106   1e-23
Smik_11.321 Chr11 (544869..546056) [1188 bp, 395 aa] {ON} YKR059...   106   1e-23
TDEL0D05010 Chr4 (911771..914023) [2253 bp, 750 aa] {ON} Anc_3.1...   109   1e-23
KNAG0B03010 Chr2 (582008..583489) [1482 bp, 493 aa] {ON} Anc_5.6...   107   1e-23
Skud_10.76 Chr10 complement(128551..129738) [1188 bp, 395 aa] {O...   106   1e-23
Suva_11.294 Chr11 (539139..540329) [1191 bp, 396 aa] {ON} YKR059...   105   2e-23
Skud_11.295 Chr11 (536422..537711) [1290 bp, 429 aa] {ON} YKR059...   106   2e-23
CAGL0F04983g Chr6 complement(507217..509004) [1788 bp, 595 aa] {...   107   2e-23
Suva_6.218 Chr6 (395411..396601) [1191 bp, 396 aa] {ON} YJL138C ...   105   2e-23
KAFR0B06170 Chr2 complement(1271195..1273066) [1872 bp, 623 aa] ...   107   3e-23
Kpol_1036.17 s1036 (45392..47683) [2292 bp, 763 aa] {ON} (45392....   107   4e-23
KLLA0C11253g Chr3 complement(967067..969457) [2391 bp, 796 aa] {...   107   4e-23
TDEL0H00930 Chr8 complement(152864..154051) [1188 bp, 395 aa] {O...   104   4e-23
Kwal_34.15835 s34 (79657..80592) [936 bp, 311 aa] {ON} YOR204W (...   102   5e-23
ZYRO0D03058g Chr4 complement(237526..238713) [1188 bp, 395 aa] {...   104   5e-23
YJL138C Chr10 complement(153504..154691) [1188 bp, 395 aa] {ON} ...   104   5e-23
YKR059W Chr11 (554987..556174) [1188 bp, 395 aa] {ON}  TIF1Trans...   104   5e-23
Kpol_1016.14 s1016 complement(36309..38507) [2199 bp, 732 aa] {O...   107   5e-23
KLLA0F13926g Chr6 complement(1290006..1292228) [2223 bp, 740 aa]...   107   6e-23
NDAI0A06900 Chr1 (1578643..1580622) [1980 bp, 659 aa] {ON} Anc_3...   106   7e-23
TBLA0D05750 Chr4 (1420975..1422180) [1206 bp, 401 aa] {ON} Anc_1...   103   8e-23
AGR278C Chr7 complement(1261914..1263701) [1788 bp, 595 aa] {ON}...   105   1e-22
SAKL0C10296g Chr3 complement(927939..930377) [2439 bp, 812 aa] {...   106   1e-22
Skud_11.257 Chr11 complement(465439..467658) [2220 bp, 739 aa] {...   105   1e-22
Ecym_6354 Chr6 (686603..688819) [2217 bp, 738 aa] {ON} similar t...   105   2e-22
TBLA0A09740 Chr1 complement(2393212..2395065) [1854 bp, 617 aa] ...   105   2e-22
NCAS0G00610 Chr7 (105992..107407) [1416 bp, 471 aa] {ON} Anc_5.643    103   2e-22
Kwal_56.22971 s56 (351639..352331) [693 bp, 230 aa] {ON} YDR021W...    99   2e-22
Kpol_1060.58 s1060 complement(135570..136760) [1191 bp, 396 aa] ...   102   2e-22
TBLA0J00890 Chr10 complement(199404..200900) [1497 bp, 498 aa] {...   103   2e-22
KAFR0G00650 Chr7 complement(164087..165274) [1188 bp, 395 aa] {O...   102   2e-22
TPHA0L00960 Chr12 complement(194538..196568) [2031 bp, 676 aa] {...   104   3e-22
NCAS0B08130 Chr2 (1551641..1552831) [1191 bp, 396 aa] {ON} Anc_1...   102   3e-22
Kwal_56.23164 s56 (430116..432539) [2424 bp, 807 aa] {ON} YBR142...   105   3e-22
KAFR0C06090 Chr3 complement(1208993..1210417) [1425 bp, 474 aa] ...   103   3e-22
Kpol_473.7 s473 complement(21177..22613) [1437 bp, 478 aa] {ON} ...   103   3e-22
ZYRO0B15576g Chr2 complement(1265375..1266850) [1476 bp, 491 aa]...   102   5e-22
TDEL0B02800 Chr2 (504332..505726) [1395 bp, 464 aa] {ON} Anc_5.6...   102   5e-22
TPHA0B01270 Chr2 complement(283532..285754) [2223 bp, 740 aa] {O...   103   6e-22
TBLA0D05490 Chr4 (1352976..1355243) [2268 bp, 755 aa] {ON}            103   9e-22
NDAI0C04680 Chr3 complement(1077391..1079541) [2151 bp, 716 aa] ...   103   1e-21
Smik_11.281 Chr11 complement(472555..474783) [2229 bp, 742 aa] {...   103   1e-21
AFR082C Chr6 complement(576175..578307) [2133 bp, 710 aa] {ON} S...   102   1e-21
AER027W Chr5 (685709..687967) [2259 bp, 752 aa] {ON} Syntenic ho...   102   2e-21
CAGL0I04356g Chr9 (389225..390415) [1191 bp, 396 aa] {ON} highly...    99   2e-21
CAGL0L03047g Chr12 (352032..354179) [2148 bp, 715 aa] {ON} simil...   101   3e-21
NDAI0B05440 Chr2 (1333810..1335000) [1191 bp, 396 aa] {ON} Anc_1...    99   3e-21
KLTH0G15840g Chr7 complement(1381355..1383748) [2394 bp, 797 aa]...   101   4e-21
Suva_11.256 Chr11 complement(469196..471424) [2229 bp, 742 aa] {...   100   5e-21
YKR024C Chr11 complement(485144..487372) [2229 bp, 742 aa] {ON} ...   100   6e-21
KNAG0C01220 Chr3 complement(237478..238671) [1194 bp, 397 aa] {O...    98   6e-21
Kwal_26.7302 s26 complement(304411..306555) [2145 bp, 714 aa] {O...   100   7e-21
YDR194C Chr4 complement(845952..847946) [1995 bp, 664 aa] {ON}  ...   100   7e-21
Smik_4.442 Chr4 complement(801552..803549) [1998 bp, 665 aa] {ON...   100   8e-21
KLLA0D18667g Chr4 complement(1574160..1576217) [2058 bp, 685 aa]...   100   8e-21
KNAG0C01480 Chr3 complement(294677..296947) [2271 bp, 756 aa] {O...   100   8e-21
NCAS0B07760 Chr2 (1469599..1471845) [2247 bp, 748 aa] {ON} Anc_1...   100   9e-21
KLTH0F17050g Chr6 complement(1380459..1381888,1381971..1381977) ...    99   1e-20
TPHA0M00750 Chr13 complement(141794..144082) [2289 bp, 762 aa] {...   100   1e-20
KAFR0A03450 Chr1 complement(708114..710348) [2235 bp, 744 aa] {O...    99   3e-20
KLLA0F15950g Chr6 (1477113..1478522) [1410 bp, 469 aa] {ON} simi...    97   3e-20
TBLA0B09205 Chr2 (2175882..2177243) [1362 bp, 453 aa] {ON}             97   3e-20
Suva_2.362 Chr2 complement(636909..638903) [1995 bp, 664 aa] {ON...    98   4e-20
KLLA0F06941g Chr6 complement(665970..667862) [1893 bp, 630 aa] {...    97   5e-20
Ecym_5488 Chr5 (998651..1000099) [1449 bp, 482 aa] {ON} similar ...    96   5e-20
ZYRO0F01826g Chr6 complement(149490..151799) [2310 bp, 769 aa] {...    98   5e-20
KLTH0D03190g Chr4 complement(306459..308609) [2151 bp, 716 aa] {...    97   6e-20
Ecym_5326 Chr5 (663464..665737) [2274 bp, 757 aa] {ON} similar t...    97   7e-20
Skud_4.458 Chr4 complement(812448..814442) [1995 bp, 664 aa] {ON...    97   9e-20
SAKL0G01496g Chr7 (125044..125050,125133..126568) [1443 bp, 480 ...    96   1e-19
TPHA0J01230 Chr10 complement(289735..291210) [1476 bp, 491 aa] {...    95   2e-19
SAKL0D05258g Chr4 complement(416100..418247) [2148 bp, 715 aa] {...    96   2e-19
Kpol_1028.29 s1028 complement(76405..78318) [1914 bp, 637 aa] {O...    95   2e-19
NDAI0F00700 Chr6 (170569..171699) [1131 bp, 376 aa] {ON} Anc_5.643     93   3e-19
TPHA0M01940 Chr13 (401463..403469) [2007 bp, 668 aa] {ON} Anc_6....    94   5e-19
TDEL0H01300 Chr8 (221815..223962) [2148 bp, 715 aa] {ON} Anc_1.2...    94   5e-19
ACR078W Chr3 (501241..502644) [1404 bp, 467 aa] {ON} Syntenic ho...    93   6e-19
KNAG0D00300 Chr4 complement(40830..42743) [1914 bp, 637 aa] {ON}...    94   6e-19
NDAI0B05110 Chr2 (1249929..1252217) [2289 bp, 762 aa] {ON} Anc_1...    94   7e-19
Kwal_55.21609 s55 complement(912148..913269) [1122 bp, 373 aa] {...    91   1e-18
NCAS0B03030 Chr2 (522163..524217) [2055 bp, 684 aa] {ON} Anc_8.402     92   2e-18
SAKL0A00924g Chr1 complement(98231..100150) [1920 bp, 639 aa] {O...    92   3e-18
KAFR0C04690 Chr3 (934039..935928) [1890 bp, 629 aa] {ON} Anc_6.3...    91   4e-18
CAGL0G07975g Chr7 (752176..754131) [1956 bp, 651 aa] {ON} simila...    91   5e-18
TBLA0F04210 Chr6 (1034478..1036397) [1920 bp, 639 aa] {ON} Anc_6...    88   4e-17
NDAI0K02300 Chr11 (514779..516908) [2130 bp, 709 aa] {ON} Anc_6....    87   1e-16
Ecym_2514 Chr2 (1000911..1002773) [1863 bp, 620 aa] {ON} similar...    86   1e-16
TDEL0A07700 Chr1 (1338381..1340264) [1884 bp, 627 aa] {ON} Anc_6...    86   1e-16
Kwal_23.6387 s23 (1558522..1560468) [1947 bp, 648 aa] {ON} YNR03...    86   2e-16
AGL225C Chr7 complement(275826..277649) [1824 bp, 607 aa] {ON} S...    84   6e-16
NDAI0I00790 Chr9 complement(175765..177567) [1803 bp, 600 aa] {O...    84   9e-16
NCAS0D04130 Chr4 (779645..781408) [1764 bp, 587 aa] {ON} Anc_6.223     84   1e-15
ZYRO0C12012g Chr3 (936848..938722) [1875 bp, 624 aa] {ON} simila...    83   2e-15
KLTH0A07084g Chr1 (587692..589578) [1887 bp, 628 aa] {ON} simila...    82   4e-15
Smik_14.369 Chr14 (653538..655427) [1890 bp, 629 aa] {ON} YNR038...    81   7e-15
YNR038W Chr14 (695595..697484) [1890 bp, 629 aa] {ON}  DBP6Essen...    80   8e-15
CAGL0M05753g Chr13 complement(610837..612543) [1707 bp, 568 aa] ...    77   9e-14
AFR452C Chr6 complement(1250342..1251203) [862 bp, 287.333333333...    75   1e-13
Agos_YGOB_AFR452C Chr6 complement(1250310..1251203) [894 bp, 298...    75   1e-13
Kpol_1002.46 s1002 (135310..136929) [1620 bp, 539 aa] {ON} (1353...    76   2e-13
SAKL0A04224g Chr1 (394175..395896) [1722 bp, 573 aa] {ON} simila...    74   1e-12
Suva_114.1 Chr114 complement(3..506) [504 bp, 168 aa] {ON} YKR05...    69   1e-12
Skud_14.371 Chr14 (663742..665631) [1890 bp, 629 aa] {ON} YNR038...    73   3e-12
Ecym_2193 Chr2 (379905..381545) [1641 bp, 546 aa] {ON} similar t...    70   1e-11
TDEL0E05320 Chr5 complement(973951..975570) [1620 bp, 539 aa] {O...    69   3e-11
Smik_7.216 Chr7 complement(376052..377737) [1686 bp, 561 aa] {ON...    69   4e-11
ZYRO0E07040g Chr5 complement(532475..534094) [1620 bp, 539 aa] {...    67   9e-11
AFL102W Chr6 (247419..249083) [1665 bp, 554 aa] {ON} Syntenic ho...    67   1e-10
KLLA0B02310g Chr2 (205046..206800) [1755 bp, 584 aa] {ON} simila...    67   1e-10
Kwal_56.24094 s56 complement(846901..848571) [1671 bp, 556 aa] {...    67   2e-10
TPHA0J02440 Chr10 complement(537553..539259) [1707 bp, 568 aa] {...    66   3e-10
YGL064C Chr7 complement(381523..383208) [1686 bp, 561 aa] {ON}  ...    65   4e-10
KLTH0H03960g Chr8 (361653..363323) [1671 bp, 556 aa] {ON} simila...    65   4e-10
KAFR0K02330 Chr11 complement(477370..478992) [1623 bp, 540 aa] {...    65   5e-10
Skud_7.216 Chr7 complement(384838..386586) [1749 bp, 582 aa] {ON...    65   7e-10
Suva_7.205 Chr7 complement(374687..376435) [1749 bp, 582 aa] {ON...    64   1e-09
Kwal_56.22974 s56 (352370..352837) [468 bp, 155 aa] {OFF} YPL119...    59   2e-09
TBLA0A06180 Chr1 (1518694..1520301) [1608 bp, 535 aa] {ON} Anc_6...    62   4e-09
Kpol_1009.3 s1009 complement(4730..6169) [1440 bp, 479 aa] {ON} ...    57   2e-07
KNAG0F01930 Chr6 (371697..373379) [1683 bp, 560 aa] {ON} Anc_6.2...    57   2e-07
Kpol_1029.1 s1029 (145..148,407..774) [372 bp, 123 aa] {OFF} (14...    44   2e-04
Suva_2.502 Chr2 (888423..890483) [2061 bp, 686 aa] {ON} YDR332W ...    46   5e-04
Kwal_14.2171 s14 (643215..643973) [759 bp, 252 aa] {ON} YOR204W ...    44   0.001
Skud_4.599 Chr4 (1067036..1069102) [2067 bp, 688 aa] {ON} YDR332...    45   0.001
YDR332W Chr4 (1131001..1133070) [2070 bp, 689 aa] {ON}  IRC3Puta...    44   0.002
CAGL0C02563g Chr3 (259114..262965) [3852 bp, 1283 aa] {ON} simil...    44   0.003
TBLA0H01810 Chr8 complement(426223..428346) [2124 bp, 707 aa] {O...    44   0.003
Ecym_3257 Chr3 (491150..494974) [3825 bp, 1274 aa] {ON} similar ...    43   0.004
KLTH0E03630g Chr5 complement(327367..329385) [2019 bp, 672 aa] {...    43   0.005
NDAI0J02330 Chr10 complement(564963..568895) [3933 bp, 1310 aa] ...    43   0.005
KNAG0C05350 Chr3 complement(1044926..1047028) [2103 bp, 700 aa] ...    42   0.007
TPHA0H01510 Chr8 (340988..343018) [2031 bp, 676 aa] {ON} Anc_5.3...    42   0.008
KLLA0D12694g Chr4 (1079740..1083843) [4104 bp, 1367 aa] {ON} sim...    42   0.011
Kpol_1055.74 s1055 (201332..205156) [3825 bp, 1274 aa] {ON} (201...    42   0.012
Kwal_23.4187 s23 (607525..611301) [3777 bp, 1258 aa] {ON} YLR398...    42   0.012
NCAS0E00200 Chr5 complement(26080..29448) [3369 bp, 1122 aa] {ON...    42   0.013
NCAS0J01560 Chr10 complement(276723..280619) [3897 bp, 1298 aa] ...    42   0.013
TPHA0B02170 Chr2 (503118..506930) [3813 bp, 1270 aa] {ON} Anc_4....    41   0.015
Kwal_55.20938 s55 complement(617612..618622) [1011 bp, 336 aa] {...    40   0.016
TBLA0A06360 Chr1 (1561496..1565389) [3894 bp, 1297 aa] {ON} Anc_...    41   0.018
Suva_9.211 Chr9 complement(344361..347336) [2976 bp, 991 aa] {ON...    41   0.022
Kpol_365.4 s365 (7095..9170) [2076 bp, 691 aa] {ON} (7095..9170)...    40   0.022
Smik_9.201 Chr9 complement(333404..336379) [2976 bp, 991 aa] {ON...    40   0.025
YIR002C Chr9 complement(357415..360396) [2982 bp, 993 aa] {ON}  ...    40   0.026
KAFR0A05880 Chr1 (1191511..1195341) [3831 bp, 1276 aa] {ON} Anc_...    40   0.030
TPHA0G03720 Chr7 (787108..790563) [3456 bp, 1151 aa] {ON} Anc_3....    40   0.031
CAGL0J01980g Chr10 (196812..199970) [3159 bp, 1052 aa] {ON} simi...    40   0.037
KLLA0E17095g Chr5 (1519323..1521395) [2073 bp, 690 aa] {ON} simi...    40   0.038
KNAG0B06170 Chr2 complement(1212229..1216080) [3852 bp, 1283 aa]...    40   0.038
Skud_9.179 Chr9 complement(328238..331216) [2979 bp, 992 aa] {ON...    40   0.039
AFL159W Chr6 (134254..137706) [3453 bp, 1150 aa] {ON} Syntenic h...    40   0.041
Smik_4.592 Chr4 (1057406..1059475) [2070 bp, 689 aa] {ON} YDR332...    40   0.041
NDAI0A00780 Chr1 (156271..158034) [1764 bp, 587 aa] {ON} Anc_1.150     39   0.050
TDEL0E01090 Chr5 (222389..226162) [3774 bp, 1257 aa] {ON} Anc_4....    40   0.050
NCAS0F03010 Chr6 (598773..600782) [2010 bp, 669 aa] {ON} Anc_5.3...    39   0.053
NDAI0C04460 Chr3 (1012182..1014188) [2007 bp, 668 aa] {ON} Anc_5...    39   0.054
KLLA0B03179g Chr2 (289199..292204) [3006 bp, 1001 aa] {ON} simil...    39   0.056
NDAI0I00750 Chr9 (164874..169178) [4305 bp, 1434 aa] {ON} Anc_6....    39   0.058
KAFR0A07190 Chr1 complement(1453748..1457704) [3957 bp, 1318 aa]...    39   0.063
Kwal_47.19313 s47 complement(1186091..1189306) [3216 bp, 1071 aa...    39   0.064
Kwal_56.24359 s56 complement(966614..970789) [4176 bp, 1391 aa] ...    39   0.069
TDEL0E02500 Chr5 complement(483905..485878) [1974 bp, 657 aa] {O...    39   0.072
Smik_13.395 Chr13 complement(625338..629669) [4332 bp, 1443 aa] ...    39   0.075
KLTH0D14630g Chr4 complement(1193537..1197340) [3804 bp, 1267 aa...    39   0.077
Suva_10.515 Chr10 complement(880776..884624) [3849 bp, 1282 aa] ...    39   0.077
Suva_13.371 Chr13 complement(621139..625512) [4374 bp, 1457 aa] ...    39   0.091
KNAG0F01640 Chr6 (294524..298645) [4122 bp, 1373 aa] {ON} Anc_6....    39   0.093
SAKL0H02706g Chr8 (268843..272661) [3819 bp, 1272 aa] {ON} simil...    39   0.095
NDAI0I03300 Chr9 (771772..771820,771929..775467) [3588 bp, 1195 ...    39   0.096
YMR190C Chr13 complement(640915..645258) [4344 bp, 1447 aa] {ON}...    39   0.097
SAKL0A02904g Chr1 (263239..267465) [4227 bp, 1408 aa] {ON} simil...    39   0.10 
NDAI0B01020 Chr2 (236444..239377) [2934 bp, 977 aa] {ON} Anc_7.1...    39   0.11 
SAKL0F04532g Chr6 (365436..368558) [3123 bp, 1040 aa] {ON} simil...    39   0.11 
Skud_12.483 Chr12 complement(855363..859226) [3864 bp, 1287 aa] ...    39   0.11 
TBLA0A02320 Chr1 complement(559955..564205) [4251 bp, 1416 aa] {...    39   0.11 
Kwal_27.12327 s27 (1178866..1183590) [4725 bp, 1574 aa] {ON} YMR...    39   0.12 
Smik_12.485 Chr12 complement(853862..857722) [3861 bp, 1286 aa] ...    38   0.12 
Skud_13.356 Chr13 complement(614958..619313) [4356 bp, 1451 aa] ...    38   0.13 
AER067C Chr5 complement(757163..761011) [3849 bp, 1282 aa] {ON} ...    38   0.14 
YLR398C Chr12 complement(915156..919019) [3864 bp, 1287 aa] {ON}...    38   0.17 
KLTH0F13310g Chr6 complement(1090990..1094076) [3087 bp, 1028 aa...    38   0.17 
Kwal_55.20185 s55 complement(286058..288073) [2016 bp, 671 aa] {...    38   0.18 
NCAS0A13190 Chr1 complement(2593419..2596559) [3141 bp, 1046 aa]...    37   0.20 
TPHA0O01420 Chr15 complement(281318..284545) [3228 bp, 1075 aa] ...    37   0.20 
ZYRO0B12650g Chr2 complement(1017101..1020862) [3762 bp, 1253 aa...    37   0.21 
Kpol_328.1 s328 complement(673..3711) [3039 bp, 1012 aa] {ON} co...    37   0.24 
TDEL0A06910 Chr1 complement(1207623..1211717) [4095 bp, 1364 aa]...    37   0.24 
TBLA0E00120 Chr5 complement(11340..15049,15149..15332) [3894 bp,...    37   0.25 
Kpol_1018.31 s1018 (87697..91695) [3999 bp, 1332 aa] {ON} (87697...    37   0.29 
KLTH0H02706g Chr8 (238367..242578) [4212 bp, 1403 aa] {ON} simil...    37   0.32 
SAKL0G08228g Chr7 complement(700095..702248) [2154 bp, 717 aa] {...    37   0.33 
TPHA0D03600 Chr4 complement(754714..758556) [3843 bp, 1280 aa] {...    37   0.33 
KNAG0E03530 Chr5 (705077..708016) [2940 bp, 979 aa] {ON} Anc_7.1...    37   0.41 
YGL251C Chr7 complement(27921..31426,31579..31636) [3564 bp, 118...    37   0.41 
Ecym_8005 Chr8 (9383..11551) [2169 bp, 722 aa] {ON} similar to A...    36   0.43 
TPHA0I02220 Chr9 (496020..499136) [3117 bp, 1038 aa] {ON} Anc_7....    37   0.43 
KNAG0D00680 Chr4 complement(102336..104981) [2646 bp, 881 aa] {O...    37   0.43 
KLLA0D13552g Chr4 (1167629..1170655) [3027 bp, 1008 aa] {ON} sim...    36   0.50 
Kpol_1035.20 s1035 complement(45238..48471) [3234 bp, 1077 aa] {...    36   0.59 
KAFR0F01050 Chr6 (198407..201028) [2622 bp, 873 aa] {ON} Anc_6.2...    36   0.73 
Ecym_4473 Chr4 (962193..965228) [3036 bp, 1011 aa] {ON} similar ...    35   0.82 
TDEL0H03170 Chr8 complement(522372..525392) [3021 bp, 1006 aa] {...    35   0.90 
KAFR0K01070 Chr11 (221301..224285) [2985 bp, 994 aa] {ON} Anc_7....    35   0.93 
Skud_14.220 Chr14 (406111..406449) [339 bp, 112 aa] {ON} YNL112W...    33   1.0  
TBLA0J01920 Chr10 (455227..458469) [3243 bp, 1080 aa] {ON} Anc_7...    35   1.0  
Kwal_26.8466 s26 complement(797363..797710) [348 bp, 115 aa] {OF...    33   1.1  
KAFR0D04360 Chr4 complement(858295..860295) [2001 bp, 666 aa] {O...    35   1.2  
NCAS0G01110 Chr7 (196418..199387) [2970 bp, 989 aa] {ON} Anc_6.278     35   1.2  
NCAS0B08450 Chr2 complement(1614300..1616060) [1761 bp, 586 aa] ...    35   1.3  
Kpol_1060.23 s1060 (57472..61314) [3843 bp, 1280 aa] {ON} (57472...    35   1.3  
NDAI0F01230 Chr6 (299153..302485) [3333 bp, 1110 aa] {ON} Anc_6....    35   1.3  
ZYRO0G03938g Chr7 (318186..321206) [3021 bp, 1006 aa] {ON} simil...    35   1.5  
ZYRO0E08250g Chr5 complement(647243..651127) [3885 bp, 1294 aa] ...    34   1.9  
ADR011C Chr4 complement(721693..724926) [3234 bp, 1077 aa] {ON} ...    33   3.2  
Ecym_6004 Chr6 complement(9579..12797) [3219 bp, 1072 aa] {ON} s...    33   3.7  
SAKL0F00528g Chr6 complement(46584..50141) [3558 bp, 1185 aa] {O...    33   4.3  
Ecym_2529 Chr2 complement(1029384..1031567) [2184 bp, 727 aa] {O...    33   4.7  
NCAS0D04180 Chr4 complement(788827..792861) [4035 bp, 1344 aa] {...    33   5.0  
CAGL0G00506g Chr7 complement(48535..54405) [5871 bp, 1956 aa] {O...    33   5.1  
KAFR0J02950 Chr10 (559600..559642,559721..563256) [3579 bp, 1192...    33   6.5  
KNAG0A02330 Chr1 (219856..222081) [2226 bp, 741 aa] {ON} Anc_8.4...    32   7.6  

>Smik_4.204 Chr4 (374339..377335) [2997 bp, 998 aa] {ON} YDL031W
           (REAL)
          Length = 998

 Score = 1761 bits (4562), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 879/998 (88%), Positives = 879/998 (88%)

Query: 1   MAGMQKRRRNLEDQDVIGSEEXXXXXXXXXXXXXXXXXXXXXXXXXXIEAGYGPSDVQXX 60
           MAGMQKRRRNLEDQDVIGSEE                          IEAGYGPSDVQ  
Sbjct: 1   MAGMQKRRRNLEDQDVIGSEEDDIAFDIANDIALNDSESDSNDSENEIEAGYGPSDVQDI 60

Query: 61  XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEVAAFPILELSDDENNISGQTQAGEEE 120
                                            EVAAFPILELSDDENNISGQTQAGEEE
Sbjct: 61  IEYSSDDEEEGKKSNKKKKTNDKKPGKNKHNKKEVAAFPILELSDDENNISGQTQAGEEE 120

Query: 121 DDVNEYFSTNNLEKQKHKKGSFPSFGLSKIVLNNIKRKGFRQPTPIQRKTIPLILQSRDI 180
           DDVNEYFSTNNLEKQKHKKGSFPSFGLSKIVLNNIKRKGFRQPTPIQRKTIPLILQSRDI
Sbjct: 121 DDVNEYFSTNNLEKQKHKKGSFPSFGLSKIVLNNIKRKGFRQPTPIQRKTIPLILQSRDI 180

Query: 181 VGMARTGSGKTAAFILPMVEKLKSHSGKIGARAVILSPSRELAMQTFNVFKDFARGTELR 240
           VGMARTGSGKTAAFILPMVEKLKSHSGKIGARAVILSPSRELAMQTFNVFKDFARGTELR
Sbjct: 181 VGMARTGSGKTAAFILPMVEKLKSHSGKIGARAVILSPSRELAMQTFNVFKDFARGTELR 240

Query: 241 SVLLTGGDSLEEQFSMMMSNPDVIIATPGRFLHLKVEMNLDLKSVEYVVFDEADRLFEMG 300
           SVLLTGGDSLEEQFSMMMSNPDVIIATPGRFLHLKVEMNLDLKSVEYVVFDEADRLFEMG
Sbjct: 241 SVLLTGGDSLEEQFSMMMSNPDVIIATPGRFLHLKVEMNLDLKSVEYVVFDEADRLFEMG 300

Query: 301 FQEQLNELLASLPTTRQTLLFSATLPNSLVDFVKAGLVNPVLVRLDAETKVSENLEMLFL 360
           FQEQLNELLASLPTTRQTLLFSATLPNSLVDFVKAGLVNPVLVRLDAETKVSENLEMLFL
Sbjct: 301 FQEQLNELLASLPTTRQTLLFSATLPNSLVDFVKAGLVNPVLVRLDAETKVSENLEMLFL 360

Query: 361 SSKNADREANLLYILQEVIRIPLATSEQLLKLQKSTXXXXXXXXXXXXXXXXXXXXXXXX 420
           SSKNADREANLLYILQEVIRIPLATSEQLLKLQKST                        
Sbjct: 361 SSKNADREANLLYILQEVIRIPLATSEQLLKLQKSTNEADSDSDDENDRQKKKINFKKEK 420

Query: 421 XXXXXMPAANELPSEKATILFVPTRHHVEYISQLLRDCGYLISYIYGTLDQHARKNQLYN 480
                MPAANELPSEKATILFVPTRHHVEYISQLLRDCGYLISYIYGTLDQHARKNQLYN
Sbjct: 421 FRKQKMPAANELPSEKATILFVPTRHHVEYISQLLRDCGYLISYIYGTLDQHARKNQLYN 480

Query: 481 FRAGLTSILVVTDVAARGVDIPMLANVINYTLPGSSKIFVHRVGRTARAGNKGWAYSIVA 540
           FRAGLTSILVVTDVAARGVDIPMLANVINYTLPGSSKIFVHRVGRTARAGNKGWAYSIVA
Sbjct: 481 FRAGLTSILVVTDVAARGVDIPMLANVINYTLPGSSKIFVHRVGRTARAGNKGWAYSIVA 540

Query: 541 XXXXXXXXXXXXXXGKKILLTPMYDSLVDVMKKRWVEEGNSAYNFQLPKLSYTKRLVLGS 600
                         GKKILLTPMYDSLVDVMKKRWVEEGNSAYNFQLPKLSYTKRLVLGS
Sbjct: 541 ENELPYLLDLELFLGKKILLTPMYDSLVDVMKKRWVEEGNSAYNFQLPKLSYTKRLVLGS 600

Query: 601 CPRLDVEGLGDLYKNLMTSNFDLQLAKKTAMKAEKLYYRTRTSASPESLKRSKEIIASGW 660
           CPRLDVEGLGDLYKNLMTSNFDLQLAKKTAMKAEKLYYRTRTSASPESLKRSKEIIASGW
Sbjct: 601 CPRLDVEGLGDLYKNLMTSNFDLQLAKKTAMKAEKLYYRTRTSASPESLKRSKEIIASGW 660

Query: 661 DAQNAYFGKNEEKEKLDFLAKLQNRRNKETVFEFTRNPDDEMAVFMKRRRKQLAPIQRKA 720
           DAQNAYFGKNEEKEKLDFLAKLQNRRNKETVFEFTRNPDDEMAVFMKRRRKQLAPIQRKA
Sbjct: 661 DAQNAYFGKNEEKEKLDFLAKLQNRRNKETVFEFTRNPDDEMAVFMKRRRKQLAPIQRKA 720

Query: 721 TERRELLEKERMAGLSHSIEDEILKGDDGETGYTVSEDALKNFEDADQLLEAQENESXXX 780
           TERRELLEKERMAGLSHSIEDEILKGDDGETGYTVSEDALKNFEDADQLLEAQENES   
Sbjct: 721 TERRELLEKERMAGLSHSIEDEILKGDDGETGYTVSEDALKNFEDADQLLEAQENESKKK 780

Query: 781 XXXXXXXXXXXXLSHYAPAGEIQDKQLQITNGFANDAAQAAYDLNSDDKVQVHKQTATVK 840
                       LSHYAPAGEIQDKQLQITNGFANDAAQAAYDLNSDDKVQVHKQTATVK
Sbjct: 781 KKPKTFKDPTFFLSHYAPAGEIQDKQLQITNGFANDAAQAAYDLNSDDKVQVHKQTATVK 840

Query: 841 WDKKRKKYVNTQGIDNKKYIIGESGQKIAASFRSGRFDDWSKARNLKPLKVGSRESSIPS 900
           WDKKRKKYVNTQGIDNKKYIIGESGQKIAASFRSGRFDDWSKARNLKPLKVGSRESSIPS
Sbjct: 841 WDKKRKKYVNTQGIDNKKYIIGESGQKIAASFRSGRFDDWSKARNLKPLKVGSRESSIPS 900

Query: 901 NLLQDPSQGTGSNGRTVRGKFKHKQMKAPKMPDKHRDNYYSQKKKVDKALQSGISVKGYN 960
           NLLQDPSQGTGSNGRTVRGKFKHKQMKAPKMPDKHRDNYYSQKKKVDKALQSGISVKGYN
Sbjct: 901 NLLQDPSQGTGSNGRTVRGKFKHKQMKAPKMPDKHRDNYYSQKKKVDKALQSGISVKGYN 960

Query: 961 NAPGLRNELKSTEQIRKDRNMAEKKRAKNARPSKKRKF 998
           NAPGLRNELKSTEQIRKDRNMAEKKRAKNARPSKKRKF
Sbjct: 961 NAPGLRNELKSTEQIRKDRNMAEKKRAKNARPSKKRKF 998

>YDL031W Chr4 (394217..397204) [2988 bp, 995 aa] {ON}  DBP10Putative
           ATP-dependent RNA helicase of the DEAD-box protein
           family, constituent of 66S pre-ribosomal particles;
           essential protein involved in ribosome biogenesis
          Length = 995

 Score = 1672 bits (4329), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 832/998 (83%), Positives = 859/998 (86%), Gaps = 3/998 (0%)

Query: 1   MAGMQKRRRNLEDQDVIGSEEXXXXXXXXXXXXXXXXXXXXXXXXXXIEAGYGPSDVQXX 60
           MAG+QKR+R+LEDQD  GSEE                          +EA YGP+DVQ  
Sbjct: 1   MAGVQKRKRDLEDQDDNGSEEDDIAFDIANEIALNDSESDANDSDSEVEADYGPNDVQDV 60

Query: 61  XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEVAAFPILELSDDENNISGQTQAGEEE 120
                                            E+AAFP+LE+SDDENN SG+TQ G++E
Sbjct: 61  IEYSSDEEEGVNNKKKAENKDIKKKKNSKK---EIAAFPMLEMSDDENNASGKTQTGDDE 117

Query: 121 DDVNEYFSTNNLEKQKHKKGSFPSFGLSKIVLNNIKRKGFRQPTPIQRKTIPLILQSRDI 180
           DDVNEYFSTNNLEK KHKKGSFPSFGLSKIVLNNIKRKGFRQPTPIQRKTIPLILQSRDI
Sbjct: 118 DDVNEYFSTNNLEKTKHKKGSFPSFGLSKIVLNNIKRKGFRQPTPIQRKTIPLILQSRDI 177

Query: 181 VGMARTGSGKTAAFILPMVEKLKSHSGKIGARAVILSPSRELAMQTFNVFKDFARGTELR 240
           VGMARTGSGKTAAFILPMVEKLKSHSGKIGARAVILSPSRELAMQTFNVFKDFARGTELR
Sbjct: 178 VGMARTGSGKTAAFILPMVEKLKSHSGKIGARAVILSPSRELAMQTFNVFKDFARGTELR 237

Query: 241 SVLLTGGDSLEEQFSMMMSNPDVIIATPGRFLHLKVEMNLDLKSVEYVVFDEADRLFEMG 300
           SVLLTGGDSLEEQF MMM+NPDVIIATPGRFLHLKVEMNLDLKSVEYVVFDEADRLFEMG
Sbjct: 238 SVLLTGGDSLEEQFGMMMTNPDVIIATPGRFLHLKVEMNLDLKSVEYVVFDEADRLFEMG 297

Query: 301 FQEQLNELLASLPTTRQTLLFSATLPNSLVDFVKAGLVNPVLVRLDAETKVSENLEMLFL 360
           FQEQLNELLASLPTTRQTLLFSATLPNSLVDFVKAGLVNPVLVRLDAETKVSENLEMLFL
Sbjct: 298 FQEQLNELLASLPTTRQTLLFSATLPNSLVDFVKAGLVNPVLVRLDAETKVSENLEMLFL 357

Query: 361 SSKNADREANLLYILQEVIRIPLATSEQLLKLQKSTXXXXXXXXXXXXXXXXXXXXXXXX 420
           SSKNADREANLLYILQE+I+IPLATSEQL KLQ S                         
Sbjct: 358 SSKNADREANLLYILQEIIKIPLATSEQLQKLQNSNNEADSDSDDENDRQKKRRNFKKEK 417

Query: 421 XXXXXMPAANELPSEKATILFVPTRHHVEYISQLLRDCGYLISYIYGTLDQHARKNQLYN 480
                MPAANELPSEKATILFVPTRHHVEYISQLLRDCGYLISYIYGTLDQHARK QLYN
Sbjct: 418 FRKQKMPAANELPSEKATILFVPTRHHVEYISQLLRDCGYLISYIYGTLDQHARKRQLYN 477

Query: 481 FRAGLTSILVVTDVAARGVDIPMLANVINYTLPGSSKIFVHRVGRTARAGNKGWAYSIVA 540
           FRAGLTSILVVTDVAARGVDIPMLANVINYTLPGSSKIFVHRVGRTARAGNKGWAYSIVA
Sbjct: 478 FRAGLTSILVVTDVAARGVDIPMLANVINYTLPGSSKIFVHRVGRTARAGNKGWAYSIVA 537

Query: 541 XXXXXXXXXXXXXXGKKILLTPMYDSLVDVMKKRWVEEGNSAYNFQLPKLSYTKRLVLGS 600
                         GKKILLTPMYDSLVDVMKKRW++EG   Y FQ PKLSYTKRLVLGS
Sbjct: 538 ENELPYLLDLELFLGKKILLTPMYDSLVDVMKKRWIDEGKPEYQFQPPKLSYTKRLVLGS 597

Query: 601 CPRLDVEGLGDLYKNLMTSNFDLQLAKKTAMKAEKLYYRTRTSASPESLKRSKEIIASGW 660
           CPRLDVEGLGDLYKNLM+SNFDLQLAKKTAMKAEKLYYRTRTSASPESLKRSKEII+SGW
Sbjct: 598 CPRLDVEGLGDLYKNLMSSNFDLQLAKKTAMKAEKLYYRTRTSASPESLKRSKEIISSGW 657

Query: 661 DAQNAYFGKNEEKEKLDFLAKLQNRRNKETVFEFTRNPDDEMAVFMKRRRKQLAPIQRKA 720
           DAQNA+FGKNEEKEKLDFLAKLQNRRNKETVFEFTRNPDDEMAVFMKRRRKQLAPIQRKA
Sbjct: 658 DAQNAFFGKNEEKEKLDFLAKLQNRRNKETVFEFTRNPDDEMAVFMKRRRKQLAPIQRKA 717

Query: 721 TERRELLEKERMAGLSHSIEDEILKGDDGETGYTVSEDALKNFEDADQLLEAQENESXXX 780
           TERRELLEKERMAGLSHSIEDEILKGDDGETGYTVSEDALK FEDADQLLEAQENE+   
Sbjct: 718 TERRELLEKERMAGLSHSIEDEILKGDDGETGYTVSEDALKEFEDADQLLEAQENENKKK 777

Query: 781 XXXXXXXXXXXXLSHYAPAGEIQDKQLQITNGFANDAAQAAYDLNSDDKVQVHKQTATVK 840
                       LSHYAPAG+IQDKQLQITNGFANDAAQAAYDLNSDDKVQVHKQTATVK
Sbjct: 778 KKPKSFKDPTFFLSHYAPAGDIQDKQLQITNGFANDAAQAAYDLNSDDKVQVHKQTATVK 837

Query: 841 WDKKRKKYVNTQGIDNKKYIIGESGQKIAASFRSGRFDDWSKARNLKPLKVGSRESSIPS 900
           WDKKRKKYVNTQGIDNKKYIIGESGQKIAASFRSGRFDDWSKARNLKPLKVGSRE+SIPS
Sbjct: 838 WDKKRKKYVNTQGIDNKKYIIGESGQKIAASFRSGRFDDWSKARNLKPLKVGSRETSIPS 897

Query: 901 NLLQDPSQGTGSNGRTVRGKFKHKQMKAPKMPDKHRDNYYSQKKKVDKALQSGISVKGYN 960
           NLL+DPSQG  +NGRTVRGKFKHKQMKAPKMPDKHRDNYYSQKKKV+KALQSGISVKGYN
Sbjct: 898 NLLEDPSQGPAANGRTVRGKFKHKQMKAPKMPDKHRDNYYSQKKKVEKALQSGISVKGYN 957

Query: 961 NAPGLRNELKSTEQIRKDRNMAEKKRAKNARPSKKRKF 998
           NAPGLR+ELKSTEQIRKDR +AEKKRAKNARPSKKRKF
Sbjct: 958 NAPGLRSELKSTEQIRKDRIIAEKKRAKNARPSKKRKF 995

>Skud_4.220 Chr4 (389016..392021) [3006 bp, 1001 aa] {ON} YDL031W
            (REAL)
          Length = 1001

 Score = 1633 bits (4229), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 814/1001 (81%), Positives = 846/1001 (84%), Gaps = 3/1001 (0%)

Query: 1    MAGMQKRRRNLEDQDVIGSEEXXXXXXXXXXXXXXXXXXXXXXXXXXIEAGYGPSDVQXX 60
            M+G+QKR+R+LEDQDV GSEE                           EA YG  DVQ  
Sbjct: 1    MSGVQKRKRDLEDQDVSGSEEEDTAFDIANDIALNGSDSDSDGSSSGTEADYGLGDVQDV 60

Query: 61   XXXXXXXXX---XXXXXXXXXXXXXXXXXXXXXXXXEVAAFPILELSDDENNISGQTQAG 117
                                                EVAAFP LELSDDEN+ SG+TQA 
Sbjct: 61   IKYSSDEEREGDSKKKANGKNGKKNKSDNKKKSGKKEVAAFPTLELSDDENDASGKTQAD 120

Query: 118  EEEDDVNEYFSTNNLEKQKHKKGSFPSFGLSKIVLNNIKRKGFRQPTPIQRKTIPLILQS 177
            ++EDDVNEYFST NLEK KHKKGSFPSFGLSK+VLNNIKRKGFRQPTPIQRKTIPLILQS
Sbjct: 121  DDEDDVNEYFSTTNLEKTKHKKGSFPSFGLSKVVLNNIKRKGFRQPTPIQRKTIPLILQS 180

Query: 178  RDIVGMARTGSGKTAAFILPMVEKLKSHSGKIGARAVILSPSRELAMQTFNVFKDFARGT 237
            RDIVGMARTGSGKTAAFILPMVEKLKSHSGKIGARAVILSPSRELAMQTFNVFKDFA+GT
Sbjct: 181  RDIVGMARTGSGKTAAFILPMVEKLKSHSGKIGARAVILSPSRELAMQTFNVFKDFAKGT 240

Query: 238  ELRSVLLTGGDSLEEQFSMMMSNPDVIIATPGRFLHLKVEMNLDLKSVEYVVFDEADRLF 297
            ELRSVLLTGGDSLEEQFSMMMSNPDVIIATPGRFLHLKVEMNLDLKSVEYVVFDEADRLF
Sbjct: 241  ELRSVLLTGGDSLEEQFSMMMSNPDVIIATPGRFLHLKVEMNLDLKSVEYVVFDEADRLF 300

Query: 298  EMGFQEQLNELLASLPTTRQTLLFSATLPNSLVDFVKAGLVNPVLVRLDAETKVSENLEM 357
            EMGFQEQLNELLASLP  RQTLLFSATLPNSLVDFVKAGLVNPVLVRLD ETKVSENLEM
Sbjct: 301  EMGFQEQLNELLASLPARRQTLLFSATLPNSLVDFVKAGLVNPVLVRLDTETKVSENLEM 360

Query: 358  LFLSSKNADREANLLYILQEVIRIPLATSEQLLKLQKSTXXXXXXXXXXXXXXXXXXXXX 417
            LFLSSKNADREANLLYILQEVI+IPLATSEQL KLQKS                      
Sbjct: 361  LFLSSKNADREANLLYILQEVIKIPLATSEQLQKLQKSNNEADSDSDDENDRHKKKRNFK 420

Query: 418  XXXXXXXXMPAANELPSEKATILFVPTRHHVEYISQLLRDCGYLISYIYGTLDQHARKNQ 477
                    MPAANELPSE+ATILFVPTRHHVEYISQLLRDCGYLISYIYGTLDQHARK Q
Sbjct: 421  KEKFRKQKMPAANELPSERATILFVPTRHHVEYISQLLRDCGYLISYIYGTLDQHARKRQ 480

Query: 478  LYNFRAGLTSILVVTDVAARGVDIPMLANVINYTLPGSSKIFVHRVGRTARAGNKGWAYS 537
            LYNFRAGLTSILVVTDVAARGVDIPMLANVINYTLPGSSKIFVHRVGRTARAGNKGWAYS
Sbjct: 481  LYNFRAGLTSILVVTDVAARGVDIPMLANVINYTLPGSSKIFVHRVGRTARAGNKGWAYS 540

Query: 538  IVAXXXXXXXXXXXXXXGKKILLTPMYDSLVDVMKKRWVEEGNSAYNFQLPKLSYTKRLV 597
            IV+              GKKILL PMYD+LVD +KKRW++EGN  + FQ PKLSYTKRLV
Sbjct: 541  IVSENELPYLLDLELFLGKKILLAPMYDNLVDSIKKRWIDEGNLEFQFQPPKLSYTKRLV 600

Query: 598  LGSCPRLDVEGLGDLYKNLMTSNFDLQLAKKTAMKAEKLYYRTRTSASPESLKRSKEIIA 657
            LGSCPRLDVEGLGDLYKNLMTSNFDLQLA KT+MKAEKLYYRTRTSASPESLKRSKEIIA
Sbjct: 601  LGSCPRLDVEGLGDLYKNLMTSNFDLQLAMKTSMKAEKLYYRTRTSASPESLKRSKEIIA 660

Query: 658  SGWDAQNAYFGKNEEKEKLDFLAKLQNRRNKETVFEFTRNPDDEMAVFMKRRRKQLAPIQ 717
            SGWDAQNA+FGKNEEKEKLDFLAKLQNRRNKETVFEFTRNPDDEMAV MKRRRKQLAPIQ
Sbjct: 661  SGWDAQNAFFGKNEEKEKLDFLAKLQNRRNKETVFEFTRNPDDEMAVLMKRRRKQLAPIQ 720

Query: 718  RKATERRELLEKERMAGLSHSIEDEILKGDDGETGYTVSEDALKNFEDADQLLEAQENES 777
            RKA+ERR+LLEKERMAGLSHSIE+EILKGDDGETGYTVSE+ALK FEDADQLLEAQEN+S
Sbjct: 721  RKASERRKLLEKERMAGLSHSIENEILKGDDGETGYTVSEEALKEFEDADQLLEAQENDS 780

Query: 778  XXXXXXXXXXXXXXXLSHYAPAGEIQDKQLQITNGFANDAAQAAYDLNSDDKVQVHKQTA 837
                           LSHYAPAGEIQDKQLQI +GFANDAA AAYDLN+DDKVQVHKQTA
Sbjct: 781  KKKKKPKTFKDPTFFLSHYAPAGEIQDKQLQIASGFANDAAHAAYDLNTDDKVQVHKQTA 840

Query: 838  TVKWDKKRKKYVNTQGIDNKKYIIGESGQKIAASFRSGRFDDWSKARNLKPLKVGSRESS 897
            TVKWDKKRKKYVNTQGIDNKKYIIGESGQKIAASFRSGRFDDWSKARNLKPLK GSRESS
Sbjct: 841  TVKWDKKRKKYVNTQGIDNKKYIIGESGQKIAASFRSGRFDDWSKARNLKPLKAGSRESS 900

Query: 898  IPSNLLQDPSQGTGSNGRTVRGKFKHKQMKAPKMPDKHRDNYYSQKKKVDKALQSGISVK 957
            IPSNLL DPSQG GSNGRT RGKFKHKQMKAPKMPDKHRDNYYSQKKKV+KALQSG++VK
Sbjct: 901  IPSNLLADPSQGPGSNGRTARGKFKHKQMKAPKMPDKHRDNYYSQKKKVEKALQSGVNVK 960

Query: 958  GYNNAPGLRNELKSTEQIRKDRNMAEKKRAKNARPSKKRKF 998
            G+NNAPGL +ELKSTEQIRKDR MAEKKRAKNARPSKKRKF
Sbjct: 961  GHNNAPGLSSELKSTEQIRKDRVMAEKKRAKNARPSKKRKF 1001

>Suva_4.218 Chr4 (384623..387646) [3024 bp, 1007 aa] {ON} YDL031W
            (REAL)
          Length = 1007

 Score = 1596 bits (4133), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 799/1007 (79%), Positives = 834/1007 (82%), Gaps = 9/1007 (0%)

Query: 1    MAGMQKRRRNLEDQDVIGSEEXXXXXXXXXXXXXXXXXXXXXXXXXXIEAGYGPSDVQXX 60
            MAG+QKR+R+L DQD  GSEE                           EA YG S VQ  
Sbjct: 1    MAGVQKRKRDLGDQDGSGSEEEDAAFDIANDIALNASESDSDDSGSEEEADYGLSGVQDV 60

Query: 61   XXXXXXXXXXXXXXXXXXXXXXXXXXX---------XXXXXXEVAAFPILELSDDENNIS 111
                                                      E AAFP LELSDDEN++ 
Sbjct: 61   IEYSSDEEEKGKNKKKTDAKNTKKNKEDNKTKTKTKTKNGKKEAAAFPTLELSDDENSVP 120

Query: 112  GQTQAGEEEDDVNEYFSTNNLEKQKHKKGSFPSFGLSKIVLNNIKRKGFRQPTPIQRKTI 171
            G+ QA ++EDDVNEYFST NLEK KHKKGSFPSFGLSKIVLNNIKRKGFRQPTPIQRKTI
Sbjct: 121  GKNQADDDEDDVNEYFSTTNLEKTKHKKGSFPSFGLSKIVLNNIKRKGFRQPTPIQRKTI 180

Query: 172  PLILQSRDIVGMARTGSGKTAAFILPMVEKLKSHSGKIGARAVILSPSRELAMQTFNVFK 231
            PLILQSRDIVGMARTGSGKTAAFILPMVEKLKSHSGKIGARAVILSPSRELAMQTFNVFK
Sbjct: 181  PLILQSRDIVGMARTGSGKTAAFILPMVEKLKSHSGKIGARAVILSPSRELAMQTFNVFK 240

Query: 232  DFARGTELRSVLLTGGDSLEEQFSMMMSNPDVIIATPGRFLHLKVEMNLDLKSVEYVVFD 291
            +FARGT LRSVLLTGGDSLEEQFSMMMSNPDVIIATPGRFLHLKVEMNLDLKSVEYVVFD
Sbjct: 241  EFARGTALRSVLLTGGDSLEEQFSMMMSNPDVIIATPGRFLHLKVEMNLDLKSVEYVVFD 300

Query: 292  EADRLFEMGFQEQLNELLASLPTTRQTLLFSATLPNSLVDFVKAGLVNPVLVRLDAETKV 351
            EADRLFEMGFQEQLNELLASLPT RQTLLFSATLPNSLVDFVKAGLVNPVLVRLD ETKV
Sbjct: 301  EADRLFEMGFQEQLNELLASLPTARQTLLFSATLPNSLVDFVKAGLVNPVLVRLDTETKV 360

Query: 352  SENLEMLFLSSKNADREANLLYILQEVIRIPLATSEQLLKLQKSTXXXXXXXXXXXXXXX 411
            SENLEMLF+S+KN DREANLLYILQEVI+IPLATSEQL KLQKS                
Sbjct: 361  SENLEMLFVSTKNDDREANLLYILQEVIKIPLATSEQLQKLQKSNNEADSESDDDNDRQK 420

Query: 412  XXXXXXXXXXXXXXMPAANELPSEKATILFVPTRHHVEYISQLLRDCGYLISYIYGTLDQ 471
                          MP  NELPSEKATILFVPTRHHVEYISQLLRDCG+LISYIYGTLDQ
Sbjct: 421  KRKNFKKEKFRKQRMPGGNELPSEKATILFVPTRHHVEYISQLLRDCGFLISYIYGTLDQ 480

Query: 472  HARKNQLYNFRAGLTSILVVTDVAARGVDIPMLANVINYTLPGSSKIFVHRVGRTARAGN 531
            HARK QLYNFRAGLTSILVVTDVAARGVDIPMLANVINYTLPGSSKIFVHRVGRTARAGN
Sbjct: 481  HARKRQLYNFRAGLTSILVVTDVAARGVDIPMLANVINYTLPGSSKIFVHRVGRTARAGN 540

Query: 532  KGWAYSIVAXXXXXXXXXXXXXXGKKILLTPMYDSLVDVMKKRWVEEGNSAYNFQLPKLS 591
            KGWAYSIVA              GKKILL PMYDSL  +MKKRWV+EG   Y FQ P LS
Sbjct: 541  KGWAYSIVAENELPYLLDLELFLGKKILLAPMYDSLAGLMKKRWVDEGKPEYTFQPPTLS 600

Query: 592  YTKRLVLGSCPRLDVEGLGDLYKNLMTSNFDLQLAKKTAMKAEKLYYRTRTSASPESLKR 651
            YTKRLVLGSCPRLDVEGLGDLYKNLMTSNFDLQLAKKTA+KAE+LYYRTRT+ASPESLKR
Sbjct: 601  YTKRLVLGSCPRLDVEGLGDLYKNLMTSNFDLQLAKKTALKAEQLYYRTRTAASPESLKR 660

Query: 652  SKEIIASGWDAQNAYFGKNEEKEKLDFLAKLQNRRNKETVFEFTRNPDDEMAVFMKRRRK 711
            SKEIIASGWDAQNAYFGKNEEKEKLDFLAKLQNRRNKETVFEFTRNPDDEM+V MKRRRK
Sbjct: 661  SKEIIASGWDAQNAYFGKNEEKEKLDFLAKLQNRRNKETVFEFTRNPDDEMSVLMKRRRK 720

Query: 712  QLAPIQRKATERRELLEKERMAGLSHSIEDEILKGDDGETGYTVSEDALKNFEDADQLLE 771
            QLAPIQRK+ ERRELLEKERMAGLSHSIEDEILKG+DGETGYT+SEDALK FEDADQLLE
Sbjct: 721  QLAPIQRKSRERRELLEKERMAGLSHSIEDEILKGNDGETGYTISEDALKEFEDADQLLE 780

Query: 772  AQENESXXXXXXXXXXXXXXXLSHYAPAGEIQDKQLQITNGFANDAAQAAYDLNSDDKVQ 831
            AQEN+S               LSHYAPAGEIQDKQL+IT GFANDAA AAYDLN DDKVQ
Sbjct: 781  AQENDSKKKKKPKTFKDPSFFLSHYAPAGEIQDKQLEITGGFANDAAHAAYDLNGDDKVQ 840

Query: 832  VHKQTATVKWDKKRKKYVNTQGIDNKKYIIGESGQKIAASFRSGRFDDWSKARNLKPLKV 891
            VHKQTATVKWDKKRKKYVNTQG+DNKKYIIGESGQKIAASFRSGRFDDWSKARNLKPLKV
Sbjct: 841  VHKQTATVKWDKKRKKYVNTQGLDNKKYIIGESGQKIAASFRSGRFDDWSKARNLKPLKV 900

Query: 892  GSRESSIPSNLLQDPSQGTGSNGRTVRGKFKHKQMKAPKMPDKHRDNYYSQKKKVDKALQ 951
            GSRESSIPSNLL DPSQG G+ G  VRGKFKHKQMKAPKMPDKHRDNYY+QKKKV+KALQ
Sbjct: 901  GSRESSIPSNLLADPSQGPGARGGAVRGKFKHKQMKAPKMPDKHRDNYYTQKKKVEKALQ 960

Query: 952  SGISVKGYNNAPGLRNELKSTEQIRKDRNMAEKKRAKNARPSKKRKF 998
            SG++V+GYNNAPGLR+ELKST+QIRKDR  A+KKRAKNARP+KKRKF
Sbjct: 961  SGVNVRGYNNAPGLRSELKSTDQIRKDRAAADKKRAKNARPTKKRKF 1007

>NDAI0G02870 Chr7 (664526..667501) [2976 bp, 991 aa] {ON} 
          Length = 991

 Score = 1381 bits (3575), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 671/910 (73%), Positives = 765/910 (84%), Gaps = 8/910 (0%)

Query: 97  AFPILELSDDEN-----NISGQTQAGEEEDDVNEYFSTNNLEKQKHKKGSFPSFGLSKIV 151
           +FPILELSDDE+     N        +++DD+N YFST NLEK KHKKGSFPSFGLSKI+
Sbjct: 82  SFPILELSDDEDTKKKSNSKNNGSDNDDDDDINAYFSTTNLEKSKHKKGSFPSFGLSKII 141

Query: 152 LNNIKRKGFRQPTPIQRKTIPLILQSRDIVGMARTGSGKTAAFILPMVEKLKSHSGKIGA 211
           + NI ++GFRQPTPIQRKTIPLILQ+RDIVGMARTGSGKTAAFILPM+ K+K+HS KIGA
Sbjct: 142 VTNITKRGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFILPMIRKIKTHSSKIGA 201

Query: 212 RAVILSPSRELAMQTFNVFKDFARGTELRSVLLTGGDSLEEQFSMMMSNPDVIIATPGRF 271
           RAVILSPSRELAMQT NVFK+F++GT+LRSVLLTGGDSLE+QF MMM+NPDVIIATPGRF
Sbjct: 202 RAVILSPSRELAMQTHNVFKEFSKGTQLRSVLLTGGDSLEDQFGMMMNNPDVIIATPGRF 261

Query: 272 LHLKVEMNLDLKSVEYVVFDEADRLFEMGFQEQLNELLASLPTTRQTLLFSATLPNSLVD 331
           LHLKVEM+LDLKS+EY VFDEADRLFEMGFQ+QLNELLASLP+ RQTLLFSATLP+SLVD
Sbjct: 262 LHLKVEMSLDLKSIEYAVFDEADRLFEMGFQDQLNELLASLPSNRQTLLFSATLPSSLVD 321

Query: 332 FVKAGLVNPVLVRLDAETKVSENLEMLFLSSKNADREANLLYILQEVIRIPLATSEQLLK 391
           F KAGL NPVLVRLDAE+K+SENLEMLFLS+KN +REANLLY+LQ+VI+IPLAT EQ  K
Sbjct: 322 FAKAGLTNPVLVRLDAESKISENLEMLFLSTKNDEREANLLYLLQDVIKIPLATKEQQRK 381

Query: 392 LQKSTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMPAANELPSEKATILFVPTRHHVEYI 451
                                             +P AN+LPSEKATILFVPTRHHVEYI
Sbjct: 382 FNDQNKKDNESDSDADDNNNNNKNKKKRKFKKERLPPANQLPSEKATILFVPTRHHVEYI 441

Query: 452 SQLLRDCGYLISYIYGTLDQHARKNQLYNFRAGLTSILVVTDVAARGVDIPMLANVINYT 511
           SQLL+D GYLISYIYGTLDQHARK QLYNFR GLTSILVVTDVAARGVDIPMLANVIN++
Sbjct: 442 SQLLKDSGYLISYIYGTLDQHARKRQLYNFRTGLTSILVVTDVAARGVDIPMLANVINFS 501

Query: 512 LPGSSKIFVHRVGRTARAGNKGWAYSIVAXXXXXXXXXXXXXXGKKILLTPMYDSLVDVM 571
           LP SSKIF+HRVGRTARAGN+GWAYSIV+              GKKI+LTPMYDSL ++M
Sbjct: 502 LPASSKIFIHRVGRTARAGNRGWAYSIVSESELPYLLDLELFLGKKIMLTPMYDSLCEIM 561

Query: 572 KKRWVEEGNSAYNFQLPKLSYTKRLVLGSCPRLDVEGLGDLYKNLMTSNFDLQLAKKTAM 631
           K +W+ EGN   +F  PK++YT RL+LGS PRL+VEGLGDLYKN+M +NF+L+L K  AM
Sbjct: 562 KNKWIAEGNDESSFVNPKIAYTDRLILGSAPRLEVEGLGDLYKNMMQNNFELKLIKDVAM 621

Query: 632 KAEKLYYRTRTSASPESLKRSKEIIASGWDAQNAYFGKNEEKEKLDFLAKLQNRRNKETV 691
           KAEKLY+RTRTSASPESLKRSKEIIASGWD QN  FGKN+EKEKLDFLAKLQNRRNKETV
Sbjct: 622 KAEKLYFRTRTSASPESLKRSKEIIASGWDEQNVLFGKNQEKEKLDFLAKLQNRRNKETV 681

Query: 692 FEFTRNPDDEMAVFMKRRRKQLAPIQRKATERRELLEKERMAGLSHSIEDEILKGDDGET 751
           FEF+RNPDDEM+VFMKRRR+QLAPIQRKA ER+ELL+ E+MAGL+HS+EDEILKGDD E 
Sbjct: 682 FEFSRNPDDEMSVFMKRRRRQLAPIQRKARERKELLQMEKMAGLTHSVEDEILKGDDNEA 741

Query: 752 GYTVSEDALK-NFEDADQLLEAQENESXXXXXXXXXXXX-XXXLSHYAPAGEIQDKQLQI 809
           GY+VSED LK  F+DAD+LL  QEN+S                LSHYAPAG+IQDKQL++
Sbjct: 742 GYSVSEDTLKQQFQDADELLADQENKSKKDKKSKKSFKDPNFFLSHYAPAGDIQDKQLEL 801

Query: 810 TNGFANDAAQAAYDLNSDDKVQVHKQTATVKWDKKRKKYVNTQGIDNKKYIIGESGQKIA 869
           T GF NDAA+ AYDLN+DDKVQVHKQTA VKWDKKRKKYVNTQG+DNKKYIIGE GQKIA
Sbjct: 802 TTGFVNDAAKVAYDLNNDDKVQVHKQTAMVKWDKKRKKYVNTQGLDNKKYIIGEGGQKIA 861

Query: 870 ASFRSGRFDDWSKARNLKPLKVGSRESSIPSNLLQDPSQGT-GSNGRTVRGKFKHKQMKA 928
           ASFRSG+FD+W+K R +KPLKVG+RE++IPSN+L +P+ G+ GS G T+RGKFKHKQMKA
Sbjct: 862 ASFRSGKFDEWAKKRKMKPLKVGARETTIPSNILANPTNGSHGSQGNTIRGKFKHKQMKA 921

Query: 929 PKMPDKHRDNYYSQKKKVDKALQSGISVKGYNNAPGLRNELKSTEQIRKDRNMAEKKRAK 988
           PKMPDKHRD+Y+ QKKKV+KAL +GI V+GY NAPG+ NELKSTEQI KDRN+ E KRAK
Sbjct: 922 PKMPDKHRDDYHIQKKKVEKALANGIQVRGYGNAPGMSNELKSTEQIMKDRNVKENKRAK 981

Query: 989 NARPSKKRKF 998
           NARPSK+RKF
Sbjct: 982 NARPSKRRKF 991

>NCAS0C03530 Chr3 (703955..706888) [2934 bp, 977 aa] {ON} Anc_3.159
          Length = 977

 Score = 1373 bits (3553), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 666/903 (73%), Positives = 762/903 (84%), Gaps = 11/903 (1%)

Query: 97  AFPILELSDDENNISGQTQAGEEEDDVNEYFSTNNLEKQKHKKGSFPSFGLSKIVLNNIK 156
           +FP LELSDDE   + +    +E+DDVN YFST NL+K KHKKGSFPSFGLSK +++NI 
Sbjct: 85  SFPSLELSDDE---ADRRNNEDEDDDVNAYFSTTNLDKSKHKKGSFPSFGLSKFIISNIT 141

Query: 157 RKGFRQPTPIQRKTIPLILQSRDIVGMARTGSGKTAAFILPMVEKLKSHSGKIGARAVIL 216
           RKGFRQPTPIQRKTIPLILQ+RDIVGMARTGSGKTAAFILPM+EKLK+HSGKIGARAVIL
Sbjct: 142 RKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFILPMIEKLKTHSGKIGARAVIL 201

Query: 217 SPSRELAMQTFNVFKDFARGTELRSVLLTGGDSLEEQFSMMMSNPDVIIATPGRFLHLKV 276
           SPSRELAMQT NVFKDF++GT+LRSVLLTGGDSLE+QF MMM+NPDVIIATPGRFLHLKV
Sbjct: 202 SPSRELAMQTHNVFKDFSKGTQLRSVLLTGGDSLEDQFGMMMNNPDVIIATPGRFLHLKV 261

Query: 277 EMNLDLKSVEYVVFDEADRLFEMGFQEQLNELLASLPTTRQTLLFSATLPNSLVDFVKAG 336
           EMNLDLKS+EY VFDEADRLFEMGFQEQLNELLASLP++RQTLLFSATLP+SLVDF KAG
Sbjct: 262 EMNLDLKSIEYAVFDEADRLFEMGFQEQLNELLASLPSSRQTLLFSATLPSSLVDFAKAG 321

Query: 337 LVNPVLVRLDAETKVSENLEMLFLSSKNADREANLLYILQEVIRIPLATSEQLLKLQKST 396
           L NPVLVRLDAETK+SENLEMLFLS+KN +REANLLY+LQEVI+IPLA+ +QL K   + 
Sbjct: 322 LTNPVLVRLDAETKISENLEMLFLSTKNDEREANLLYLLQEVIKIPLASRDQLAKFN-AQ 380

Query: 397 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXMPAANELPSEKATILFVPTRHHVEYISQLLR 456
                                        +P AN+LPSEK+TILFVPTRHHVEYIS LLR
Sbjct: 381 NIKDNASDSDSDGDDKRQKGKRKKFKKERLPPANQLPSEKSTILFVPTRHHVEYISNLLR 440

Query: 457 DCGYLISYIYGTLDQHARKNQLYNFRAGLTSILVVTDVAARGVDIPMLANVINYTLPGSS 516
           + GYLISYIYGTLDQHARK QLYNFR GLTSILVVTDVAARGVDIPMLANVIN++LP SS
Sbjct: 441 ESGYLISYIYGTLDQHARKRQLYNFRTGLTSILVVTDVAARGVDIPMLANVINFSLPASS 500

Query: 517 KIFVHRVGRTARAGNKGWAYSIVAXXXXXXXXXXXXXXGKKILLTPMYDSLVDVMKKRWV 576
           KIFVHRVGRTARAGN+GWAYSIV+              GKKIL+TPMYDS+ D+M K+W+
Sbjct: 501 KIFVHRVGRTARAGNRGWAYSIVSESELPYLLDLEIFLGKKILMTPMYDSMSDIMLKKWI 560

Query: 577 EEGNSAYNFQLPKLSYTKRLVLGSCPRLDVEGLGDLYKNLMTSNFDLQLAKKTAMKAEKL 636
            EG+   NF+ PK+SYT R++LGS PRL++EGLGDLY+N+M SNF++QL K  AMKAEKL
Sbjct: 561 AEGHDEINFKPPKVSYTNRMILGSAPRLELEGLGDLYQNVMKSNFEIQLLKGVAMKAEKL 620

Query: 637 YYRTRTSASPESLKRSKEIIASGWDAQNAYFGKNEEKEKLDFLAKLQNRRNKETVFEFTR 696
           Y+RTR +ASPESLKRSKEIIASGWD QN  FGKN EKEKLDFLAKLQNRRNKETVFEF  
Sbjct: 621 YFRTRPAASPESLKRSKEIIASGWDEQNIMFGKNAEKEKLDFLAKLQNRRNKETVFEFAS 680

Query: 697 NPDDEMAVFMKRRRKQLAPIQRKATERRELLEKERMAGLSHSIEDEILKGDDGE-TGYTV 755
           NPDDEM+VFMKRRR+QLAPIQRKA ER ELL+KE++AGL+H++EDE+LKGD+ E   YT+
Sbjct: 681 NPDDEMSVFMKRRRRQLAPIQRKAKERHELLQKEKLAGLTHTMEDEVLKGDNAEDNSYTI 740

Query: 756 SEDALKNFEDADQLLEAQENESXXXXXXXXXXXXXXXLSHYAPAGEIQDKQLQITNGFAN 815
           SED LK FED D+LL  QEN+                LSHYAPA +IQDKQLQ+ NGFAN
Sbjct: 741 SEDTLKQFEDGDELLAGQENKK----KKKTFKDPTFFLSHYAPASDIQDKQLQVANGFAN 796

Query: 816 DAAQAAYDLNSDDKVQVHKQTATVKWDKKRKKYVNTQGIDNKKYIIGESGQKIAASFRSG 875
           +AAQAAYDLN+DDKVQVHKQTATVKWDKKRKKYVN QG+DNKKYIIGESGQKIAASFRSG
Sbjct: 797 EAAQAAYDLNNDDKVQVHKQTATVKWDKKRKKYVNVQGLDNKKYIIGESGQKIAASFRSG 856

Query: 876 RFDDWSKARNLKPLKVGSRESSIPSNLLQDPSQGTGSNGRTVRGKFKHKQMKAPKMPDKH 935
           +FD+W+KAR LKPLKVG+RESSIPSNLL DP+QG G+   +VRGKFKHKQ+KAPK+PDKH
Sbjct: 857 KFDEWTKARKLKPLKVGARESSIPSNLLSDPTQGPGAQN-SVRGKFKHKQLKAPKLPDKH 915

Query: 936 RDNYYSQKKKVDKALQSGISVKGYNNAPGLRNELKSTEQIRKDRNMAEKKRAKNARPSKK 995
           RD+Y +QKKKV KAL++G+ V+G+   PG+++ELKSTE+IRK R   EKKRAKNARP+K+
Sbjct: 916 RDDYQTQKKKVAKALENGVQVRGF-RGPGMKSELKSTEEIRKQRAFMEKKRAKNARPAKR 974

Query: 996 RKF 998
           RK+
Sbjct: 975 RKY 977

>CAGL0K01551g Chr11 (136421..139330) [2910 bp, 969 aa] {ON} highly
           similar to uniprot|Q12389 Saccharomyces cerevisiae
           YDL031w
          Length = 969

 Score = 1334 bits (3452), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 653/906 (72%), Positives = 740/906 (81%), Gaps = 9/906 (0%)

Query: 94  EVAAFPILELSDDENNISGQTQAGEEEDDVNEYFSTNNLEKQKHKKGSFPSFGLSKIVLN 153
           E  +FP LELSDDE+         ++   VN YFS N   K KHKKGSF SFGLSK++L 
Sbjct: 72  EDKSFPSLELSDDEDEKKKVDNDDDD---VNAYFSVNTDAKSKHKKGSFASFGLSKLILV 128

Query: 154 NIKRKGFRQPTPIQRKTIPLILQSRDIVGMARTGSGKTAAFILPMVEKLKSHSGKIGARA 213
           NI ++GFRQPTPIQRKTIPLILQ+RDIVGMARTGSGKTAAF+LPM+EKLK+HS KIGARA
Sbjct: 129 NISKRGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFVLPMIEKLKTHSSKIGARA 188

Query: 214 VILSPSRELAMQTFNVFKDFARGTELRSVLLTGGDSLEEQFSMMMSNPDVIIATPGRFLH 273
           +ILSPSRELAMQT +VFK+F+RGT LRSVLLTGGDSLE+QF MMM+NPDVIIATPGRFLH
Sbjct: 189 IILSPSRELAMQTHSVFKEFSRGTHLRSVLLTGGDSLEDQFGMMMTNPDVIIATPGRFLH 248

Query: 274 LKVEMNLDLKSVEYVVFDEADRLFEMGFQEQLNELLASLPTTRQTLLFSATLPNSLVDFV 333
           LKVEMNLDLKSVEY VFDEADRLFEMGFQEQLNELLA+LP++RQTLLFSATLP SLVDF 
Sbjct: 249 LKVEMNLDLKSVEYAVFDEADRLFEMGFQEQLNELLAALPSSRQTLLFSATLPTSLVDFA 308

Query: 334 KAGLVNPVLVRLDAETKVSENLEMLFLSSKNADREANLLYILQEVIRIPLATSEQLLKLQ 393
           KAGLVNPVLVRLDAE+K+S+NLEMLFLS+KN +REANLLYILQEVI++PLAT EQ+ +L 
Sbjct: 309 KAGLVNPVLVRLDAESKISDNLEMLFLSTKNDEREANLLYILQEVIKLPLATPEQIKQLN 368

Query: 394 KSTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMPAANELPSEKATILFVPTRHHVEYISQ 453
            +                              MP ANELPSEKAT++FVPTRHHVEY+S 
Sbjct: 369 DN---KADDSDESAEEDEDKKRRKRKSFNRKAMPKANELPSEKATVVFVPTRHHVEYLSN 425

Query: 454 LLRDCGYLISYIYGTLDQHARKNQLYNFRAGLTSILVVTDVAARGVDIPMLANVINYTLP 513
           LL+DCGYL+SYIYG LDQHARK+QLYNFR GLTSILVVTDVAARGVDIPMLANV+NY+LP
Sbjct: 426 LLKDCGYLVSYIYGALDQHARKSQLYNFRIGLTSILVVTDVAARGVDIPMLANVVNYSLP 485

Query: 514 GSSKIFVHRVGRTARAGNKGWAYSIVAXXXXXXXXXXXXXXGKKILLTPMYDSLVDVMKK 573
            SSKIF+HRVGRTARAGN+GWAYSIV+              G+KILLTPMY++L  + K+
Sbjct: 486 ASSKIFIHRVGRTARAGNRGWAYSIVSENELPYLLDLELFLGRKILLTPMYEALERLSKE 545

Query: 574 RWVEEGNSAYNFQLPKLSYTKRLVLGSCPRLDVEGLGDLYKNLMTSNFDLQLAKKTAMKA 633
           +WV EGN    FQ PK+SYT R+VLGSCPRLD+E L +LY NLM SNFDL +AKKTA+KA
Sbjct: 546 KWVAEGNDETLFQSPKISYTSRMVLGSCPRLDIEALSELYNNLMKSNFDLDMAKKTALKA 605

Query: 634 EKLYYRTRTSASPESLKRSKEIIASGWDAQNAYFGKNEEKEKLDFLAKLQNRRNKETVFE 693
           EKLY+RTRTSASPESLKRSKEII+SGWD QN  FGKN EKEK  FL KLQNRRNKETVFE
Sbjct: 606 EKLYFRTRTSASPESLKRSKEIISSGWDEQNVLFGKNLEKEKNAFLEKLQNRRNKETVFE 665

Query: 694 FTRNPDDEMAVFMKRRRKQLAPIQRKATERRELLEKERMAGLSHSIEDEILKGDDGETGY 753
           FTRNP+DEMA  M RRR+ +APIQRKA ER+ELLEKERMAGL+H++EDEILKGDD E GY
Sbjct: 666 FTRNPEDEMANLMHRRRRAIAPIQRKAKERKELLEKERMAGLTHALEDEILKGDDAEVGY 725

Query: 754 TVSEDALKNFEDADQLLEAQENESXXXXXXXXXXXXXXXLSHYAPAGEIQDKQLQITNGF 813
           TV+ED LK FEDAD +L  QEN S               LSHYAPA EIQDKQL+++ GF
Sbjct: 726 TVTEDTLKAFEDADTILAEQENAS--KKKKKTFRDPNFFLSHYAPANEIQDKQLELSGGF 783

Query: 814 ANDAAQAAYDLNSDDKVQVHKQTATVKWDKKRKKYVNTQGIDNKKYIIGESGQKIAASFR 873
            N+AAQ+AYDLNSDDKVQVHKQTATVKWDKKRKKYVN  GIDNKKYIIGESGQKIAASFR
Sbjct: 784 INEAAQSAYDLNSDDKVQVHKQTATVKWDKKRKKYVNMNGIDNKKYIIGESGQKIAASFR 843

Query: 874 SGRFDDWSKARNLKPLKVGSRESSIPSNLLQDPSQGTGSNGRTV-RGKFKHKQMKAPKMP 932
           SG+FD+WSKAR L PLK G+ ESSIPSNLL DP++G G +G  +  GKFKHK  KAP++P
Sbjct: 844 SGKFDEWSKARKLAPLKTGANESSIPSNLLVDPTRGPGKSGSKLPNGKFKHKLEKAPRLP 903

Query: 933 DKHRDNYYSQKKKVDKALQSGISVKGYNNAPGLRNELKSTEQIRKDRNMAEKKRAKNARP 992
           DK RD+Y+ QKKKV+ AL+ GI+VKGYNNAP  ++ELKS  QIRKDR   E + AKNARP
Sbjct: 904 DKKRDDYHKQKKKVESALERGIAVKGYNNAPAFKSELKSVAQIRKDRKTKENRHAKNARP 963

Query: 993 SKKRKF 998
           SKKRKF
Sbjct: 964 SKKRKF 969

>KAFR0C01060 Chr3 complement(215822..218743) [2922 bp, 973 aa] {ON}
           Anc_3.159 YDL031W
          Length = 973

 Score = 1328 bits (3437), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 648/902 (71%), Positives = 738/902 (81%), Gaps = 10/902 (1%)

Query: 98  FPILELSDDENNISGQTQAGEEEDDVNEYFSTNNLE-KQKHKKGSFPSFGLSKIVLNNIK 156
           FP+LELSDDE++   + QA + +DDVN YFSTNNL  K KHKKGSF SFGLSK++L NI 
Sbjct: 81  FPLLELSDDEDS---KKQANDNDDDVNSYFSTNNLNTKTKHKKGSFASFGLSKLILTNIS 137

Query: 157 RKGFRQPTPIQRKTIPLILQSRDIVGMARTGSGKTAAFILPMVEKLKSHSGKIGARAVIL 216
           ++GFRQPTPIQRKTIPLILQSRDIVGMARTGSGKTAAF+LPM+EKLK+HS KIGARA+IL
Sbjct: 138 KRGFRQPTPIQRKTIPLILQSRDIVGMARTGSGKTAAFVLPMIEKLKTHSSKIGARAIIL 197

Query: 217 SPSRELAMQTFNVFKDFARGTELRSVLLTGGDSLEEQFSMMMSNPDVIIATPGRFLHLKV 276
           SPSRELAMQT NVFK+F++G++LRSVLLTGGDSLE+QF M+M+NPDVIIATPGRFLHLKV
Sbjct: 198 SPSRELAMQTHNVFKEFSKGSDLRSVLLTGGDSLEDQFGMIMANPDVIIATPGRFLHLKV 257

Query: 277 EMNLDLKSVEYVVFDEADRLFEMGFQEQLNELLASLPTTRQTLLFSATLPNSLVDFVKAG 336
           EMNLDLKSVEY+ FDEADRLFEMGFQEQLNEL+ SLP+ RQTLLFSATLP+SLVDF KAG
Sbjct: 258 EMNLDLKSVEYICFDEADRLFEMGFQEQLNELIYSLPSNRQTLLFSATLPSSLVDFAKAG 317

Query: 337 LVNPVLVRLDAETKVSENLEMLFLSSKNADREANLLYILQEVIRIPLATSEQLLKLQKST 396
           L NPVLVRLD ETK+SENLEMLFLS KN +REANLLY+LQE I IPLAT EQ+ KL   +
Sbjct: 318 LTNPVLVRLDTETKISENLEMLFLSIKNEEREANLLYLLQEEICIPLATEEQIKKLNNES 377

Query: 397 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXMPAANELPSEKATILFVPTRHHVEYISQLLR 456
                                        +P AN+LPSEKATI+FVPTRHHVEYISQLL+
Sbjct: 378 KIDDDSDSEDDEATRRQKRKSKNFKKQR-LPPANQLPSEKATIIFVPTRHHVEYISQLLK 436

Query: 457 DCGYLISYIYGTLDQHARKNQLYNFRAGLTSILVVTDVAARGVDIPMLANVINYTLPGSS 516
           DCGYL+SYIYGTLDQ AR  QLYNFR GLTSILVVTDVAARGVDIPMLANVIN++LP SS
Sbjct: 437 DCGYLVSYIYGTLDQRARNRQLYNFRLGLTSILVVTDVAARGVDIPMLANVINFSLPVSS 496

Query: 517 KIFVHRVGRTARAGNKGWAYSIVAXXXXXXXXXXXXXXGKKILLTPMYDSLVDVMKKRWV 576
           K+FVHRVGRTARAGN+GWAYSIV+              GKKILLT MYD+  D+MKK+WV
Sbjct: 497 KVFVHRVGRTARAGNRGWAYSIVSENELPYLLDLELFLGKKILLTSMYDATCDIMKKKWV 556

Query: 577 EEGNSAYNFQLPKLSYTKRLVLGSCPRLDVEGLGDLYKNLMTSNFDLQLAKKTAMKAEKL 636
            EG S   FQ PK SYT R+VLGS PRL VE L DLY  +++ +FDL++ K+TA+KAEKL
Sbjct: 557 SEGKSELTFQDPKPSYTNRMVLGSAPRLQVEDLNDLYTGVLSGSFDLKMMKQTALKAEKL 616

Query: 637 YYRTRTSASPESLKRSKEIIASGWDAQNAYFGKNEEKEKLDFLAKLQNRRNKETVFEFTR 696
           Y+RTRTSASPES+KRSKEII SGWD QN  FGKN EKEK  FLAKLQNR NKETVFEF R
Sbjct: 617 YFRTRTSASPESMKRSKEIILSGWDEQNIRFGKNVEKEKFQFLAKLQNRHNKETVFEFAR 676

Query: 697 NPDDEMAVFMKRRRKQLAPIQRKATERRELLEKERMAGLSHSIEDEILKGDDGETGYTVS 756
           NPDDEM+V MKRRR+QLAPIQRKA ERREL+EKER+AGL+H IED+ILKGDD E GYTV 
Sbjct: 677 NPDDEMSVLMKRRRRQLAPIQRKAEERRELMEKERLAGLTHRIEDQILKGDDFEAGYTVP 736

Query: 757 EDALKNFEDADQLLEAQENESXXXXXXXXXXXXXXXLSHYAPAGEIQDKQLQITNGFAND 816
           EDALK FEDAD++LEA   +S               LSHYAP   IQD+Q +++ GF N 
Sbjct: 737 EDALKEFEDADKVLEASNKKS----EQKTFRDENFFLSHYAPTSAIQDQQYKLSTGFTNA 792

Query: 817 AAQAAYDLNSDDKVQVHKQTATVKWDKKRKKYVNTQGIDNKKYIIGESGQKIAASFRSGR 876
           AA+AAYDLNSDDKVQVHKQTATVKWDKKRKKYVN QGIDNKKYI+GESGQKIAASFRSG+
Sbjct: 793 AAEAAYDLNSDDKVQVHKQTATVKWDKKRKKYVNMQGIDNKKYIVGESGQKIAASFRSGK 852

Query: 877 FDDWSKARNLKPLKVGSRESSIPSNLLQDPSQGTGSNGRTVRGKFKHKQMKAPKMPDKHR 936
           F++WSKAR LKPLKVG+RES++ +NLL +P++   +  +TVRGKFKHKQMK+PK+PDK R
Sbjct: 853 FEEWSKARKLKPLKVGARESTMQTNLLSNPTENNSNGQKTVRGKFKHKQMKSPKLPDKFR 912

Query: 937 DNYYSQKKKVDKALQSGISVKGYNNAPGLRNELKSTEQIRKDRNMAEKKRAKNARPSKKR 996
           D+Y  QKKKV  AL  G  VKGY + PG++NELKSTEQIRK+R   E +RAKNARPSKKR
Sbjct: 913 DDYEKQKKKVASALARGAHVKGY-SGPGMKNELKSTEQIRKERMAKENRRAKNARPSKKR 971

Query: 997 KF 998
           KF
Sbjct: 972 KF 973

>KNAG0K01110 Chr11 (215540..218545) [3006 bp, 1001 aa] {ON} Anc_3.159
            YDL031W
          Length = 1001

 Score = 1315 bits (3404), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 646/912 (70%), Positives = 749/912 (82%), Gaps = 17/912 (1%)

Query: 97   AFPILELSDDENNISGQTQAGEEEDDVNEYFSTNN-LEKQKHKKGSFPSFGLSKIVLNNI 155
            AFP LELSDDE   S +      +DDVN YFSTNN  EKQK KKGSF SFGLSK +L+N+
Sbjct: 97   AFPSLELSDDE---SSKAAGDASDDDVNAYFSTNNQAEKQKFKKGSFASFGLSKAILSNV 153

Query: 156  KRKGFRQPTPIQRKTIPLILQSRDIVGMARTGSGKTAAFILPMVEKLKSHSGKIGARAVI 215
             RKGFRQPTPIQRKTIPLILQ+RDIVGMARTGSGKTAAF+LPM+EKLK+HS KIG RA+I
Sbjct: 154  TRKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFVLPMIEKLKTHSSKIGVRAII 213

Query: 216  LSPSRELAMQTFNVFKDFARGTELRSVLLTGGDSLEEQFSMMMSNPDVIIATPGRFLHLK 275
            LSPSRELA+QT NVFKDF++GT LRSVLLTGGDSLEEQF MMMSNPDV+IATPGRFLHLK
Sbjct: 214  LSPSRELALQTHNVFKDFSKGTHLRSVLLTGGDSLEEQFGMMMSNPDVVIATPGRFLHLK 273

Query: 276  VEMNLDLKSVEYVVFDEADRLFEMGFQEQLNELLASLPTTRQTLLFSATLPNSLVDFVKA 335
            VEMNL LK+VEY VFDEADRLFEMGFQEQLNELLA+LP++RQTLLFSATLP+SLV+F KA
Sbjct: 274  VEMNLVLKTVEYAVFDEADRLFEMGFQEQLNELLAALPSSRQTLLFSATLPSSLVEFAKA 333

Query: 336  GLVNPVLVRLDAETKVSENLEMLFLSSKNADREANLLYILQEVIRIPLATSEQLLKLQKS 395
            GL NPVLVRLDAE+K+SENL+MLFLS KN +REANLLY+LQ VI+IPLAT EQL KL+ S
Sbjct: 334  GLTNPVLVRLDAESKISENLQMLFLSIKNDEREANLLYLLQNVIKIPLATPEQLKKLRDS 393

Query: 396  TXXXXXXXXXXXXXXXXX-----XXXXXXXXXXXXMPAANELPSEKATILFVPTRHHVEY 450
                                               +PAANELPSE AT++FVPTRHHVEY
Sbjct: 394  DAKFSESESEDESNEKRGGKRDFKKNGKKKFVKQRLPAANELPSENATVVFVPTRHHVEY 453

Query: 451  ISQLLRDCGYLISYIYGTLDQHARKNQLYNFRAGLTSILVVTDVAARGVDIPMLANVINY 510
            ISQ+L+DCGYL+SYIYG+LDQ+ARK+QLYNFR GLTSILVVTDVAARGVDIPMLANVINY
Sbjct: 454  ISQVLKDCGYLVSYIYGSLDQNARKSQLYNFRLGLTSILVVTDVAARGVDIPMLANVINY 513

Query: 511  TLPGSSKIFVHRVGRTARAGNKGWAYSIVAXXXXXXXXXXXXXXGKKILLTPMYDSLVDV 570
            +LP SSKIF+HRVGRTARAGNKGWAY+IV+               KK+LLTPM ++   +
Sbjct: 514  SLPSSSKIFIHRVGRTARAGNKGWAYTIVSESELPYLLDLELFLSKKVLLTPMLEAKNAI 573

Query: 571  MKKRWVEEGNSAYNFQLPKLSYTKRLVLGSCPRLDVEGLGDLYKNLMTSNFDLQLAKKTA 630
            +K++W+++GN   +F+ P +SYT R+VLGSCPRLD+E +GDL+KN++ +NFDL L K T+
Sbjct: 574  LKQKWIDQGNDEMSFKPPAVSYTDRIVLGSCPRLDLESMGDLFKNILENNFDLSLMKATS 633

Query: 631  MKAEKLYYRTRTSASPESLKRSKEIIASGWDAQNAYFGKNEEKEKLDFLAKLQNRRNKET 690
            +KAEKLY+RTRT AS ESLKRSKE+IASGWD QN  FG N EKEK++FLAKLQNRRNKET
Sbjct: 634  LKAEKLYFRTRTHASLESLKRSKEVIASGWDEQNIIFGSNVEKEKINFLAKLQNRRNKET 693

Query: 691  VFEFTRNPDDEMAVFMKRRRKQLAPIQRKATERRELLEKERMAGLSHSIEDEILKGDDG- 749
            VFEF+RNPDDEM+VFMKRRR+QLAP+Q+KA ERRELLEKER +GLSHSIEDEI   ++  
Sbjct: 694  VFEFSRNPDDEMSVFMKRRRRQLAPVQKKAKERRELLEKERRSGLSHSIEDEIFNQNNNT 753

Query: 750  --ETGYTVSEDALKNFEDADQLLEAQENESXXXXXXXXXXXXXXXLSHYAPAGEIQDKQL 807
              ETGYTVSE+ALK FEDAD+LL+ Q   S               LSHYAPA +IQDKQL
Sbjct: 754  EMETGYTVSEEALKQFEDADELLQKQ---SEKKTKPKNYKDPNFFLSHYAPAADIQDKQL 810

Query: 808  QITNGFANDAAQAAYDLNSDDKVQVHKQTATVKWDKKRKKYVNTQGIDNKKYIIGESGQK 867
            Q+T+GF NDAAQAAYDLN DDKVQVHKQTATVKWDKKRKKYVN QGIDNKKYIIGESGQK
Sbjct: 811  QVTSGFTNDAAQAAYDLNDDDKVQVHKQTATVKWDKKRKKYVNMQGIDNKKYIIGESGQK 870

Query: 868  IAASFRSGRFDDWSKARNLKPLKVGSRESSIPSNLLQDPSQGTGSNG-RTVRGKFKHKQM 926
            IAASFRSG+FD+WSKAR++KPLKVG++E SI ++LL+DP+  +  +G RT  GK+KHKQ 
Sbjct: 871  IAASFRSGKFDEWSKARHIKPLKVGAKEDSIETHLLRDPTGRSNISGNRTASGKYKHKQD 930

Query: 927  KAPKMPDKHRDNYYSQKKKVDKALQSGISVKGYNNAPGLRNELKSTEQIRKDRNMAEKKR 986
            KAPK+PDKHRDNY+SQKKK+  A++ G  VKG+ N PG ++ELKST QIRK R  AEKK+
Sbjct: 931  KAPKLPDKHRDNYHSQKKKIASAMERGTYVKGF-NGPGTQSELKSTAQIRKGRLQAEKKK 989

Query: 987  AKNARPSKKRKF 998
            AKNARP+KKRKF
Sbjct: 990  AKNARPNKKRKF 1001

>TPHA0M00330 Chr13 complement(61976..64921) [2946 bp, 981 aa] {ON} 
          Length = 981

 Score = 1308 bits (3385), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 633/905 (69%), Positives = 739/905 (81%), Gaps = 8/905 (0%)

Query: 98  FPILELSDDENNISGQTQA-GEEEDDVNEYFSTNNLEKQKHKKGSFPSFGLSKIVLNNIK 156
           FP+LE+SDDE++ + +  A  ++ DDVN+YFSTN  +K KHKKGSFPSFGLSK++L+NI 
Sbjct: 81  FPLLEMSDDEDDKNSKNSAFNDDADDVNDYFSTNMQDKSKHKKGSFPSFGLSKLILSNIN 140

Query: 157 RKGFRQPTPIQRKTIPLILQSRDIVGMARTGSGKTAAFILPMVEKLKSHSGKIGARAVIL 216
           +KGFRQPTPIQRKTIPLILQ RDIVGMARTGSGKTAAFILPM+EKLK+HSGKIGARAVIL
Sbjct: 141 KKGFRQPTPIQRKTIPLILQRRDIVGMARTGSGKTAAFILPMIEKLKTHSGKIGARAVIL 200

Query: 217 SPSRELAMQTFNVFKDFARGTELRSVLLTGGDSLEEQFSMMMSNPDVIIATPGRFLHLKV 276
           SPSRELAMQT  VFKDF+RG++LRSVLLTGGDSLEEQFSMMMSNPDVI+ATPGRF+HLKV
Sbjct: 201 SPSRELAMQTHKVFKDFSRGSQLRSVLLTGGDSLEEQFSMMMSNPDVIVATPGRFMHLKV 260

Query: 277 EMNLDLKSVEYVVFDEADRLFEMGFQEQLNELLASLPTTRQTLLFSATLPNSLVDFVKAG 336
           EM LDLK+VEYVVFDEADRLFEMGFQEQLNELLASLP  RQTLLFSATLPNSLVDF KAG
Sbjct: 261 EMGLDLKTVEYVVFDEADRLFEMGFQEQLNELLASLPMNRQTLLFSATLPNSLVDFAKAG 320

Query: 337 LVNPVLVRLDAETKVSENLEMLFLSSKNADREANLLYILQEVIRIPLATSEQLLKL---Q 393
           L NPVLVRLDAE+K+SENL++ F S+KN +REA LLYILQ+VI + + T E++ KL    
Sbjct: 321 LTNPVLVRLDAESKISENLQLAFFSTKNEEREATLLYILQDVIDLQIGTEEEIKKLTASN 380

Query: 394 KSTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMPAANELPSEKATILFVPTRHHVEYISQ 453
           K +                             +P+ANELPSEKATI+FVPTRHHVEYIS 
Sbjct: 381 KRSDEIDSDNEREQADRKLNKKKKFEKFIKPKLPSANELPSEKATIVFVPTRHHVEYISN 440

Query: 454 LLRDCGYLISYIYGTLDQHARKNQLYNFRAGLTSILVVTDVAARGVDIPMLANVINYTLP 513
           LL+DCGYL+SY+YGTLDQHARK+QL+NFRAGLTSILVVTDVAARGVDIPMLANVINY+LP
Sbjct: 441 LLKDCGYLVSYLYGTLDQHARKHQLFNFRAGLTSILVVTDVAARGVDIPMLANVINYSLP 500

Query: 514 GSSKIFVHRVGRTARAGNKGWAYSIVAXXXXXXXXXXXXXXGKKILLTPMYDSLVDVMKK 573
            SSKIFVHRVGRTARAGNKGWAYSI +              GKKILLT MY++   + K 
Sbjct: 501 ASSKIFVHRVGRTARAGNKGWAYSIASETELPYLLDLELFLGKKILLTQMYEATCSLAKN 560

Query: 574 RWVEEGNSAYNFQLPKLSYTKRLVLGSCPRLDVEGLGDLYKNLMTSNFDLQLAKKTAMKA 633
           +W+  GN  Y FQ PK SYT R++LGSCPRL++E +GDLYKN+M+++FDLQ+AKKT++KA
Sbjct: 561 KWIAAGNEEYTFQPPKPSYTDRMILGSCPRLELENIGDLYKNIMSASFDLQMAKKTSLKA 620

Query: 634 EKLYYRTRTSASPESLKRSKEIIASGWDAQNAYFGKNEEKEKLDFLAKLQNRRNKETVFE 693
           EKLY+RTRT+ASPES+KR KE+IASGWD Q+  FGKN EKEKLDFL+K QNR NKETVFE
Sbjct: 621 EKLYFRTRTAASPESIKRGKELIASGWDEQHIMFGKNVEKEKLDFLSKFQNRNNKETVFE 680

Query: 694 FTRNPDDEMAVFMKRRRKQLAPIQRKATERRELLEKERMAGLSHSIEDEILKGDDGETGY 753
           F RNP D  AV M RRR+QLAPIQRKA ERR+LLEKER+AGLSH++EDEILKG+D E+GY
Sbjct: 681 FGRNPTDATAVLMNRRRRQLAPIQRKAVERRKLLEKERLAGLSHALEDEILKGEDHESGY 740

Query: 754 TVSEDALKNFEDADQLLEAQENESXXXXXXXXXXXXXXXLSHYAPAGEIQDKQLQITNGF 813
           T+S++AL  FEDAD+LL+ QE +                LSHYAPA +IQDKQL +T+GF
Sbjct: 741 TISKEALAAFEDADKLLQEQEKKK---RKPKTYKDPQFFLSHYAPAKDIQDKQLNLTSGF 797

Query: 814 ANDAAQAAYDLNSDDKVQVHKQTATVKWDKKRKKYVNTQGIDNKKYIIGESGQKIAASFR 873
            NDAAQAAYDLN+DDKVQVHKQTA +KWDK RKKYVN  G+DNKKYIIGE GQKI ASF+
Sbjct: 798 TNDAAQAAYDLNNDDKVQVHKQTANIKWDKGRKKYVNINGLDNKKYIIGEGGQKIPASFK 857

Query: 874 SGRFDDWSKARNLKPLKVGSRESSIPSNLLQDPSQGTGSNGRTVRGKFKHKQMKAPKMPD 933
           SGRFD+WSKAR++KPLK G RE SIP+NLL D + G     RT  G+FKHKQ KAP++PD
Sbjct: 858 SGRFDEWSKARHIKPLKAGVREDSIPTNLLADVT-GPSDGSRTFGGRFKHKQNKAPRLPD 916

Query: 934 KHRDNYYSQKKKVDKALQSGISVKGYNNAPGLRNELKSTEQIRKDRNMAEKKRAKNARPS 993
           KHRD+Y SQKKKV  AL+ G+ VKGYNN   +++ELK+  QIRK+R + E K+ KNARPS
Sbjct: 917 KHRDDYESQKKKVQNALERGVQVKGYNNRNSVKSELKTVAQIRKERMVNENKQKKNARPS 976

Query: 994 KKRKF 998
           KKRK+
Sbjct: 977 KKRKY 981

>Kpol_1032.11 s1032 complement(27093..30026) [2934 bp, 977 aa] {ON}
           complement(27093..30026) [2934 nt, 978 aa]
          Length = 977

 Score = 1287 bits (3331), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 627/904 (69%), Positives = 745/904 (82%), Gaps = 7/904 (0%)

Query: 97  AFPILELSDDENNISGQTQAGEEEDDVNEYFSTNNLEKQKHKKGSFPSFGLSKIVLNNIK 156
           +FP LE+SDDE++ + +    +++DD+N+YFS NN EK KHKKGSFPSFG SK++L+N+ 
Sbjct: 79  SFPSLEISDDEDS-NNKGDHEDDDDDLNDYFSINNSEKSKHKKGSFPSFGFSKLILSNVH 137

Query: 157 RKGFRQPTPIQRKTIPLILQSRDIVGMARTGSGKTAAFILPMVEKLKSHSGKIGARAVIL 216
           +KGFRQPTPIQRKTIPLILQ RDIVGMARTGSGKTAAF+LPM+EKLKSHS KIGARAVIL
Sbjct: 138 KKGFRQPTPIQRKTIPLILQKRDIVGMARTGSGKTAAFVLPMIEKLKSHSSKIGARAVIL 197

Query: 217 SPSRELAMQTFNVFKDFARGTELRSVLLTGGDSLEEQFSMMMSNPDVIIATPGRFLHLKV 276
           SPSRELA+QT  VFK+F++GT LRSVLLTGGDSLE+QFSMMMSNPDVI+ATPGRFLHLKV
Sbjct: 198 SPSRELALQTHRVFKEFSKGTHLRSVLLTGGDSLEDQFSMMMSNPDVIVATPGRFLHLKV 257

Query: 277 EMNLDLKSVEYVVFDEADRLFEMGFQEQLNELLASLPTTRQTLLFSATLPNSLVDFVKAG 336
           EM+LDLK+VEYVVFDEADRLFEMGFQEQLNELLA+LP  RQTLLFSATLP+SLVDF KAG
Sbjct: 258 EMSLDLKTVEYVVFDEADRLFEMGFQEQLNELLAALPMNRQTLLFSATLPSSLVDFAKAG 317

Query: 337 LVNPVLVRLDAETKVSENLEMLFLSSKNADREANLLYILQEVIRIPLATSEQLLKLQ--K 394
           L NPVLVRLDAETK+SENLE+LFLS+KN +RE NLLY+LQ+VI+IPL T +Q+ KL    
Sbjct: 318 LTNPVLVRLDAETKISENLEILFLSTKNEERENNLLYLLQDVIKIPLGTDDQIKKLSDFN 377

Query: 395 STXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMPAANELPSEKATILFVPTRHHVEYISQL 454
            +                             + A+NELP+EK+TI+F PTRHHVEYI+QL
Sbjct: 378 KSLSDSDSEDEDNKGKQNSRKSKKGKFQKLKVSASNELPTEKSTIVFAPTRHHVEYITQL 437

Query: 455 LRDCGYLISYIYGTLDQHARKNQLYNFRAGLTSILVVTDVAARGVDIPMLANVINYTLPG 514
           L+D G+L+SY+YGTLDQHARK QL NFRAGLTSILVVTDVAARGVDIPMLANVINY+LP 
Sbjct: 438 LKDSGFLVSYLYGTLDQHARKRQLLNFRAGLTSILVVTDVAARGVDIPMLANVINYSLPA 497

Query: 515 SSKIFVHRVGRTARAGNKGWAYSIVAXXXXXXXXXXXXXXGKKILLTPMYDSLVDVMKKR 574
           SSKIF+HRVGRTARAGN+GWAYSIV+              GKKILLT MY++   +MK +
Sbjct: 498 SSKIFIHRVGRTARAGNRGWAYSIVSETELPYMLDLELFLGKKILLTSMYEASCKLMKSK 557

Query: 575 WVEEGNSAYNFQLPKLSYTKRLVLGSCPRLDVEGLGDLYKNLMTSNFDLQLAKKTAMKAE 634
           W+ +GN+  +F+ PK+SYT RLVLGS PR D+E +GDLYKN++ SNFDLQ+AKK ++KAE
Sbjct: 558 WIADGNTESSFEDPKISYTNRLVLGSAPRYDIESVGDLYKNIIESNFDLQMAKKVSLKAE 617

Query: 635 KLYYRTRTSASPESLKRSKEIIASGWDAQNAYFGKNEEKEKLDFLAKLQNRRNKETVFEF 694
           KLY RTRT+ASPES+KRSKE+IASGWD QN  FG+N EKEKL+FLAK QNRRNKETVFEF
Sbjct: 618 KLYCRTRTAASPESIKRSKEVIASGWDEQNIRFGRNLEKEKLNFLAKFQNRRNKETVFEF 677

Query: 695 TRNPDDEMAVFMKRRRKQLAPIQRKATERRELLEKERMAGLSHSIEDEILKGDDGETGYT 754
            +NP+D+ A+ M++RRKQ+APIQRKA +R+ELL+KER+AGL+H IEDEILKG+D E GY+
Sbjct: 678 GKNPNDDTAILMQKRRKQIAPIQRKARKRQELLDKERVAGLTHKIEDEILKGEDHEAGYS 737

Query: 755 VSEDALKNFEDADQLLEAQENESXXXXXXXXXXXXXXXLSHYAPAGEIQDKQLQITNGFA 814
           V E+ALK+FEDAD++LE  E ES               +SHYAPAG+IQDKQLQIT+GF 
Sbjct: 738 VPEEALKSFEDADKILE--EQESSRKKKSKTFRDPNFFISHYAPAGDIQDKQLQITSGFT 795

Query: 815 NDAAQAAYDLNSDDKVQVHKQTATVKWDKKRKKYVNTQGIDNKKYIIGESGQKIAASFRS 874
           NDAAQAAYDLN DDKVQVHKQTATVKWDKKRKKYVN QGIDNKKYIIGESGQKI ASF+S
Sbjct: 796 NDAAQAAYDLNDDDKVQVHKQTATVKWDKKRKKYVNMQGIDNKKYIIGESGQKIPASFKS 855

Query: 875 GRFDDWSKARNLKPLKVGSRESSIPSNLLQDPSQGTGSNGRTVRGKFKHKQMKAPKMPDK 934
           G+F +WSK+RN+K +K G+RE+SIP+NLL DP+  +GS  R   G+FKHKQ KAP++PDK
Sbjct: 856 GKFAEWSKSRNIKGIKTGARETSIPTNLLSDPTTDSGSQ-RGPGGRFKHKQNKAPRLPDK 914

Query: 935 HRDNYYSQKKKVDKALQSGISVKGYNNAPGLRNELKSTEQIRKDRNMAEKKRAKNARPSK 994
            RD+Y SQKKKV  A++ G+SVKG+  + G   ELK+T QIRK+R   EKKR KNARP+K
Sbjct: 915 FRDDYQSQKKKVQSAIERGVSVKGFGGSSG-NTELKTTAQIRKERMAKEKKRQKNARPTK 973

Query: 995 KRKF 998
           KRKF
Sbjct: 974 KRKF 977

>KLLA0F24684g Chr6 complement(2294708..2297629) [2922 bp, 973 aa]
           {ON} similar to uniprot|Q12389 Saccharomyces cerevisiae
           YDL031W DBP10 Essential protein involved in ribosome
           biogenesis
          Length = 973

 Score = 1281 bits (3316), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 624/900 (69%), Positives = 727/900 (80%), Gaps = 16/900 (1%)

Query: 98  FPILELSDDENNISGQTQAGEEEDDVNEYFSTNNLEKQKHKKGSFPSFGLSKIVLNNIKR 157
           FP LELSDDE   +      E +DD+N+YF+T      KHKKGSF SFGLSK+VL NI +
Sbjct: 89  FPSLELSDDEKKATN-----ESDDDLNDYFNTTADAAAKHKKGSFASFGLSKLVLINISK 143

Query: 158 KGFRQPTPIQRKTIPLILQSRDIVGMARTGSGKTAAFILPMVEKLKSHSGKIGARAVILS 217
           KGFRQPTPIQRKTIPLILQ RDIVGMARTGSGKTAAF+LPM+EKLK+HS KIG RAVILS
Sbjct: 144 KGFRQPTPIQRKTIPLILQKRDIVGMARTGSGKTAAFVLPMIEKLKTHSAKIGVRAVILS 203

Query: 218 PSRELAMQTFNVFKDFARGTELRSVLLTGGDSLEEQFSMMMSNPDVIIATPGRFLHLKVE 277
           PSRELA+QT  VFK+F++G++LRS+LLTGGDSLE+QF MMM NPDV+IATPGRFLHLKVE
Sbjct: 204 PSRELAIQTHRVFKEFSKGSDLRSILLTGGDSLEDQFGMMMGNPDVVIATPGRFLHLKVE 263

Query: 278 MNLDLKSVEYVVFDEADRLFEMGFQEQLNELLASLPTTRQTLLFSATLPNSLVDFVKAGL 337
           MNLDLKSVEYVVFDEADRLFEMGFQEQLNELL + PT RQTLLFSATLP+SLVDF KAGL
Sbjct: 264 MNLDLKSVEYVVFDEADRLFEMGFQEQLNELLVAFPTNRQTLLFSATLPSSLVDFAKAGL 323

Query: 338 VNPVLVRLDAETKVSENLEMLFLSSKNADREANLLYILQEVIRIPLATSEQLLKLQKSTX 397
            NPVLVRLDAETK+SENLEMLF+S K  +REANLLY+LQE I++P+AT  Q+ KL++   
Sbjct: 324 SNPVLVRLDAETKISENLEMLFISIKKDEREANLLYLLQEAIKMPVATESQIKKLKQQND 383

Query: 398 XXXXXXXXXXXXXXXXXXXXXXXXXXXXMPAANELPSEKATILFVPTRHHVEYISQLLRD 457
                                       +P ANE+PSEKATI+FVPTRHHVEY++QLL++
Sbjct: 384 ADSDSDDSEDEKKKKAKKAKKSKRR---LPNANEMPSEKATIVFVPTRHHVEYVTQLLKN 440

Query: 458 CGYLISYIYGTLDQHARKNQLYNFRAGLTSILVVTDVAARGVDIPMLANVINYTLPGSSK 517
           CGYL+SYIYG L+QHARK QLYNFRAGLTSILVVTDVAARGVDIP+LANVINY+LPGSSK
Sbjct: 441 CGYLVSYIYGALNQHARKQQLYNFRAGLTSILVVTDVAARGVDIPLLANVINYSLPGSSK 500

Query: 518 IFVHRVGRTARAGNKGWAYSIVAXXXXXXXXXXXXXXGKKILLTPMYDSLVDVMKKRWVE 577
           IF+HRVGRTARAGN+GWA+SIV+              GKKILLTPMY+S   +++K+   
Sbjct: 501 IFIHRVGRTARAGNRGWAFSIVSENELPYLLDLELFLGKKILLTPMYESSCQILRKKAES 560

Query: 578 EGNSAYNFQLPKLSYTKRLVLGSCPRLDVEGLGDLYKNLMTSNFDLQLAKKTAMKAEKLY 637
           EGN+  NF  PK+SYT R+VLG+CPR +++G+GDLY N++ S+F+L   K  A+KAEKLY
Sbjct: 561 EGNN--NFTDPKVSYTTRMVLGACPRSEIDGMGDLYSNMIKSDFELNTVKGVALKAEKLY 618

Query: 638 YRTRTSASPESLKRSKEIIASGWDAQNAYFGKNEEKEKLDFLAKLQNRRNKETVFEFTRN 697
           +RTRT AS ES+KRSKEI+ SGWD QN YFGKN EKEKLDFLAKLQ+R NKETVFEF RN
Sbjct: 619 FRTRTPASAESMKRSKEILRSGWDEQNIYFGKNAEKEKLDFLAKLQHRNNKETVFEFARN 678

Query: 698 PDDEMAVFMKRRRKQLAPIQRKATERRELLEKERMAGLSHSIEDEILKGDDGETGYTVSE 757
           PDDEM+V MKRRR+Q+APIQRKA ER+ELLEKERM GL HSIEDEILKG+D E GY+V +
Sbjct: 679 PDDEMSVLMKRRRRQIAPIQRKAKERQELLEKERMIGLRHSIEDEILKGEDNEVGYSVPD 738

Query: 758 DALKNFEDADQLLEAQENESXXXXXXXXXXXXXXXLSHYAPAGEIQDKQLQITNGFANDA 817
           + LK FEDAD LLE QEN                 LSH+AP  +IQDKQLQI++GF NDA
Sbjct: 739 EVLKEFEDADVLLEEQEN--IKKKQKKTFRDPTFYLSHFAPTSDIQDKQLQISSGFTNDA 796

Query: 818 AQAAYDLNSDDKVQVHKQTATVKWDKKRKKYVNTQGIDNKKYIIGESGQKIAASFRSGRF 877
           + AA+DL +DDKVQVHKQTATVKWDKKRKKYVNTQG+DNKKYIIGESGQKI ASFRSG+F
Sbjct: 797 SNAAFDLANDDKVQVHKQTATVKWDKKRKKYVNTQGLDNKKYIIGESGQKIPASFRSGKF 856

Query: 878 DDWSKARNLKPLKVGSRESSIPSNLLQDPSQGTGSNGRTVRGKFKHKQMKAPKMPDKHRD 937
            DWSKAR + PLKVG+RES+IPSNLL DP   T  + RTV GKFKHK  KAPK+PDKHRD
Sbjct: 857 QDWSKARKIAPLKVGARESTIPSNLLADP---TSPSERTVGGKFKHKTQKAPKLPDKHRD 913

Query: 938 NYYSQKKKVDKALQSGISVKGYNNAPGLRNELKSTEQIRKDRNMAEKKRAKNARPSKKRK 997
           +Y  QKKKV+ AL+ G+ VKGY N PG++ E+KS ++IRK R + EKKR+KNARP+K+RK
Sbjct: 914 DYAFQKKKVEAALERGVRVKGY-NGPGMKQEIKSVDEIRKLREIKEKKRSKNARPTKRRK 972

>SAKL0C08778g Chr3 (804617..807628) [3012 bp, 1003 aa] {ON} similar to
            uniprot|Q12389 Saccharomyces cerevisiae YDL031W DBP10
            Essential protein involved in ribosome biogenesis
            putative ATP-dependent RNA helicase of the DEAD- box
            protein family
          Length = 1003

 Score = 1280 bits (3312), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 636/920 (69%), Positives = 731/920 (79%), Gaps = 29/920 (3%)

Query: 97   AFPILELSDDENNISGQTQAGEEEDDVNEYFSTNNLEKQ-KHKKGSFPSFGLSKIVLNNI 155
            +FP LELSD E+          ++D VN+YFST       KHKKGSFPSFG SK +LNNI
Sbjct: 95   SFPTLELSDAEDEAPDA-----DKDAVNDYFSTTAAAAAGKHKKGSFPSFGFSKFILNNI 149

Query: 156  KRKGFRQPTPIQRKTIPLILQSRDIVGMARTGSGKTAAFILPMVEKLKSHSGKIGARAVI 215
             RKGFRQPTPIQRKTIPLILQ+RDIVGMARTGSGKTAAF LPM+EKLK HS KIG RAVI
Sbjct: 150  SRKGFRQPTPIQRKTIPLILQTRDIVGMARTGSGKTAAFTLPMIEKLKGHSAKIGVRAVI 209

Query: 216  LSPSRELAMQTFNVFKDFARGTELRSVLLTGGDSLEEQFSMMMSNPDVIIATPGRFLHLK 275
            LSPSRELAMQT+ VFK+F+RG++LRSVLLTGGDSLEEQF MMM NPDV+IATPGRFLHLK
Sbjct: 210  LSPSRELAMQTYKVFKEFSRGSDLRSVLLTGGDSLEEQFGMMMGNPDVVIATPGRFLHLK 269

Query: 276  VEMNLDLKSVEYVVFDEADRLFEMGFQEQLNELLASLPTTRQTLLFSATLPNSLVDFVKA 335
            VEMNLDLK+VEYVVFDEADRLFEMGFQEQLNELLA+LP TRQTLLFSATLP+SLVDF KA
Sbjct: 270  VEMNLDLKTVEYVVFDEADRLFEMGFQEQLNELLAALPPTRQTLLFSATLPHSLVDFAKA 329

Query: 336  GLVNPVLVRLDAETKVSENLEMLFLSSKNADREANLLYILQEVIRIPLATSEQLLKLQKS 395
            GL NPVLVRLDAE+KVSENLEMLFL++KN +REANLLY+LQEVIRIP+AT+EQL +L+  
Sbjct: 330  GLTNPVLVRLDAESKVSENLEMLFLTTKNGEREANLLYLLQEVIRIPVATAEQLKQLR-- 387

Query: 396  TXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMPAANELPSEKATILFVPTRHHVEYISQLL 455
                                          MP+ANELPSEKATILFVPTRHHVEY+SQLL
Sbjct: 388  ALNDRSDSDADSDANDKNDRKKRKKQARRKMPSANELPSEKATILFVPTRHHVEYVSQLL 447

Query: 456  RDCGYLISYIYGTLDQHARKNQLYNFRAGLTSILVVTDVAARGVDIPMLANVINYTLPGS 515
            +D GYL+SYIYGTLDQ+ARK QL+NFR+GLTSILVVTDVAARGVDIPMLANVIN++LP S
Sbjct: 448  KDSGYLVSYIYGTLDQNARKQQLFNFRSGLTSILVVTDVAARGVDIPMLANVINFSLPSS 507

Query: 516  SKIFVHRVGRTARAGNKGWAYSIVAXXXXXXXXXXXXXXGKKILLTPMYDSLVDVMKKRW 575
            SKIF+HRVGRTARAGN GWAYSIV+              GKKILL PMYD+  ++M+K+W
Sbjct: 508  SKIFIHRVGRTARAGNSGWAYSIVSENELPYLLDLELFLGKKILLAPMYDATCELMRKQW 567

Query: 576  VEEGNSAYNFQLPKLSYTKRLVLGSCPRLDVEGLGDLYKNLMTSNFDLQLAKKTAMKAEK 635
            V EG     F  P++SYT R+VLGSCPRL++E +GDLYKNL+ S+FDLQL K  A+KAEK
Sbjct: 568  VAEGKQESEFVAPRVSYTNRMVLGSCPRLEMESMGDLYKNLVESSFDLQLLKSVALKAEK 627

Query: 636  LYYRTRTSASPESLKRSKEIIASGWDAQNAYFGKNEEKEKLDFLAKLQNRRNKETVFEFT 695
            LY+RTR  AS E++KRSKEIIASGWD QN  FGKN EKEKLDFLAKLQNR +KETVFEF 
Sbjct: 628  LYFRTRAPASTEAMKRSKEIIASGWDEQNLKFGKNLEKEKLDFLAKLQNRNHKETVFEFA 687

Query: 696  RNPDDEMAVFMKRRRKQLAPIQRKATERRELLEKERMAGLSHSIEDEILKGDDGETGYTV 755
            RN +DEMAV M+RRR+Q+APIQRKA ER+ELLEKERMAGL H++EDE+LKG DGE GY+V
Sbjct: 688  RNQEDEMAVLMRRRRRQIAPIQRKARERQELLEKERMAGLRHTLEDEVLKGGDGEFGYSV 747

Query: 756  SEDAL-KNFEDADQLLEAQENESXXXXXXXXXXXXXXX----------------LSHYAP 798
             E+ L + FEDAD++L+ QEN+                                LSHYAP
Sbjct: 748  PEEVLAQEFEDADKILDEQENKKKTKTMKTRQGETKPKPKPKPKPKTYKDPNFFLSHYAP 807

Query: 799  AGEIQDKQLQITNGFANDAAQAAYDLNSDDKVQVHKQTATVKWDKKRKKYVNTQGIDNKK 858
            AG+IQDKQLQ+T+GF NDAA A +DL+ D+KVQVHKQTATVKWDKKRKKYVN QG+DNKK
Sbjct: 808  AGDIQDKQLQLTSGFTNDAADATFDLHDDNKVQVHKQTATVKWDKKRKKYVNAQGLDNKK 867

Query: 859  YIIGESGQKIAASFRSGRFDDWSKARNLKPLKVGSRESSIPSNLLQDPSQGTGSNGRTVR 918
            YIIGESGQKI ASFRSG+F +WSKAR L PLKVG+RE+S PSNLL DP+ G     R   
Sbjct: 868  YIIGESGQKIPASFRSGKFAEWSKARKLGPLKVGARETSGPSNLLSDPASG---GRRVAG 924

Query: 919  GKFKHKQMKAPKMPDKHRDNYYSQKKKVDKALQSGISVKGYNNAPGLRNELKSTEQIRKD 978
            G+FKHK  KAPK+PD+HRD+Y +Q+KKV  AL+ GISVKG+  APG ++E+KSTEQIR  
Sbjct: 925  GRFKHKLDKAPKLPDRHRDDYKTQQKKVANALERGISVKGF-GAPGAKSEMKSTEQIRSQ 983

Query: 979  RNMAEKKRAKNARPSKKRKF 998
            R   +K+ AKNARPSKKRKF
Sbjct: 984  RVAKDKRLAKNARPSKKRKF 1003

>KLTH0C08866g Chr3 (742559..745477) [2919 bp, 972 aa] {ON} highly
           similar to uniprot|Q12389 Saccharomyces cerevisiae
           YDL031W DBP10 Essential protein involved in ribosome
           biogenesis putative ATP-dependent RNA helicase of the
           DEAD-box protein family
          Length = 972

 Score = 1280 bits (3311), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 621/904 (68%), Positives = 733/904 (81%), Gaps = 14/904 (1%)

Query: 96  AAFPILELSDDENNISGQTQAGEEEDDVNEYFSTNNLEKQKHKKGSFPSFGLSKIVLNNI 155
             FP LELSD+E++  G+  A    DDV EYFSTNN E  KHKKGSF SFGLSK +++NI
Sbjct: 82  GGFPALELSDNEDHDDGKDGA----DDVTEYFSTNNPEAAKHKKGSFASFGLSKFIVSNI 137

Query: 156 KRKGFRQPTPIQRKTIPLILQSRDIVGMARTGSGKTAAFILPMVEKLKSHSGKIGARAVI 215
            +KGFRQPTPIQRKTIPLILQ RDIVGMARTGSGKTAAF+LPM+EKLK HS KIGARAVI
Sbjct: 138 AKKGFRQPTPIQRKTIPLILQKRDIVGMARTGSGKTAAFVLPMIEKLKGHSAKIGARAVI 197

Query: 216 LSPSRELAMQTFNVFKDFARGTELRSVLLTGGDSLEEQFSMMMSNPDVIIATPGRFLHLK 275
           LSPSRELAMQT  VF++F+RG++LRSVLLTGG+SLEEQF +MMSNPDV+IATPGRFLHLK
Sbjct: 198 LSPSRELAMQTHKVFREFSRGSDLRSVLLTGGESLEEQFGLMMSNPDVVIATPGRFLHLK 257

Query: 276 VEMNLDLKSVEYVVFDEADRLFEMGFQEQLNELLASLPTTRQTLLFSATLPNSLVDFVKA 335
           VEMNLDLKSVEY+VFDEADRLFEMGF+EQL+ELLA+LP  RQTLLFSATLP+SLV+F KA
Sbjct: 258 VEMNLDLKSVEYLVFDEADRLFEMGFEEQLSELLAALPVARQTLLFSATLPSSLVNFAKA 317

Query: 336 GLVNPVLVRLDAETKVSENLEMLFLSSKNADREANLLYILQEVIRIPLATSEQLLKLQKS 395
           GL NPVLVRLDAETKVSENLEMLFLSSKN +REANLLY+LQE ++IP+AT EQLL+  K+
Sbjct: 318 GLTNPVLVRLDAETKVSENLEMLFLSSKNEEREANLLYLLQEAMKIPVATEEQLLEY-KA 376

Query: 396 TXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMPAANELPSEKATILFVPTRHHVEYISQLL 455
                                         +P+ANELPSE ATI+FVPTRHHVEYISQLL
Sbjct: 377 KVKNSYDSDDSDEDAKAKAKKQRKSAIRKKLPSANELPSEHATIVFVPTRHHVEYISQLL 436

Query: 456 RDCGYLISYIYGTLDQHARKNQLYNFRAGLTSILVVTDVAARGVDIPMLANVINYTLPGS 515
           +DCGYL+SY+YGTLDQHAR+ QL+NFRAGLT+ILVVTDVAARGVDIP+LANV+NY+LP S
Sbjct: 437 KDCGYLVSYLYGTLDQHARRQQLFNFRAGLTTILVVTDVAARGVDIPLLANVVNYSLPAS 496

Query: 516 SKIFVHRVGRTARAGNKGWAYSIVAXXXXXXXXXXXXXXGKKILLTPMYDSLVDVMKKRW 575
           SKIFVHRVGRTARAGNKG+AYSIV+              GKKILLTPM+++  +++K +W
Sbjct: 497 SKIFVHRVGRTARAGNKGFAYSIVSENELPYLLDLELFLGKKILLTPMFEATTELLKSKW 556

Query: 576 VEEGNSAYNFQLPKLSYTKRLVLGSCPRLDVEGLGDLYKNLMTSNFDLQLAKKTAMKAEK 635
           + EGNS   F  PK+SYT R+VLG+CPRLD+E  GDL+KNL  S+FDLQ  K  A KAEK
Sbjct: 557 IAEGNSELTFNPPKVSYTNRMVLGACPRLDLETCGDLFKNLTQSSFDLQQLKGVAAKAEK 616

Query: 636 LYYRTRTSASPESLKRSKEIIASGWDAQNAYFGKNEEKEKLDFLAKLQNRRNKETVFEFT 695
           LY+RTR  AS +S+KRSKE+IASGWD QN  FGKN EKEKLDFLAKLQNR NKETVFEF 
Sbjct: 617 LYFRTRPPASSQSMKRSKEVIASGWDEQNLRFGKNIEKEKLDFLAKLQNRNNKETVFEFA 676

Query: 696 RNPDDEMAVFMKRRRKQLAPIQRKATERRELLEKERMAGLSHSIEDEILKGDDGETGYTV 755
           RN DDEM++ MK+RR Q+APIQR+A ER+ELLEKERMAGL H++EDEILKGD+ E GY+V
Sbjct: 677 RNQDDEMSLLMKKRRIQIAPIQRRAKERKELLEKERMAGLRHTVEDEILKGDENEVGYSV 736

Query: 756 SEDAL-KNFEDADQLLEAQENESXXXXXXXXXXXXXXXLSHYAPAGEIQDKQLQITNGFA 814
            E+ L + F+DAD+LL AQ                   LSHYAPA EIQDKQL++TNGF 
Sbjct: 737 PEEVLHREFQDADELLGAQSK----SKRPKSFRDPAFFLSHYAPASEIQDKQLEVTNGFT 792

Query: 815 NDAAQAAYDLNSDDKVQVHKQTATVKWDKKRKKYVNTQGIDNKKYIIGESGQKIAASFRS 874
           N+AA A +DL++DDKVQ HKQ AT KWDKKR+KYVNTQG+DNKKYI+GESG KI ASFRS
Sbjct: 793 NEAANATFDLHNDDKVQNHKQVATTKWDKKRQKYVNTQGLDNKKYIMGESGHKIPASFRS 852

Query: 875 GRFDDWSKARNLKPLKVGSRESSIPSNLLQDPSQGTGSNGRTVRGKFKHKQMKAPKMPDK 934
           G+FD+WSKAR L PLKVG++ESS  + +L +P   T    R++ G+FKH +++APK+PDK
Sbjct: 853 GKFDEWSKARKLGPLKVGAKESSTTAKMLSNP---TAEGQRSIGGRFKHNKVRAPKLPDK 909

Query: 935 HRDNYYSQKKKVDKALQSGISVKGYNNAPGLRNELKSTEQIRKDRNMAEKKRAKNARPSK 994
           HRD+Y+ QKKKV+KA+ SGI VKGY NAPG+++E++ST+QI K+R   EKKRAKNARP+K
Sbjct: 910 HRDDYHVQKKKVEKAVSSGIPVKGY-NAPGMKSEMRSTQQIYKERVAKEKKRAKNARPAK 968

Query: 995 KRKF 998
           KRKF
Sbjct: 969 KRKF 972

>AEL086W Chr5 (464521..467403) [2883 bp, 960 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDL031W (DBP10)
          Length = 960

 Score = 1265 bits (3273), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 619/904 (68%), Positives = 731/904 (80%), Gaps = 25/904 (2%)

Query: 96  AAFPILELSDDENNISGQTQAGEEEDDVNEYF-STNNLEKQKHKKGSFPSFGLSKIVLNN 154
           AAFP LELSD E+  +G      ++DDV+ YF +T+ L   K KKGSF SFGLSK +L N
Sbjct: 81  AAFPSLELSDGEDADNG------DKDDVDSYFNTTSQLAASKAKKGSFASFGLSKFILGN 134

Query: 155 IKRKGFRQPTPIQRKTIPLILQSRDIVGMARTGSGKTAAFILPMVEKLKSHSGKIGARAV 214
           I RKGFRQPTPIQRKTIPLILQ RDIVGMARTGSGKTAAF+LP++EKLK HS KIGARA+
Sbjct: 135 ISRKGFRQPTPIQRKTIPLILQQRDIVGMARTGSGKTAAFVLPLIEKLKMHSAKIGARAM 194

Query: 215 ILSPSRELAMQTFNVFKDFARGTELRSVLLTGGDSLEEQFSMMMSNPDVIIATPGRFLHL 274
           ILSPSRELAMQT  VFK+FA+G+ LRSVLLTGGD LE+QFSMMMSNPDVIIATPGRFLHL
Sbjct: 195 ILSPSRELAMQTHKVFKEFAKGSNLRSVLLTGGDGLEDQFSMMMSNPDVIIATPGRFLHL 254

Query: 275 KVEMNLDLKSVEYVVFDEADRLFEMGFQEQLNELLASLPTTRQTLLFSATLPNSLVDFVK 334
           KVEMNLDL S+EYVVFDEADRLFEMGFQEQLNELL SLPT RQTLLFSATLP+SLVDF K
Sbjct: 255 KVEMNLDLHSIEYVVFDEADRLFEMGFQEQLNELLGSLPTARQTLLFSATLPSSLVDFAK 314

Query: 335 AGLVNPVLVRLDAETKVSENLEMLFLSSKNADREANLLYILQEVIRIPLATSEQLLKLQK 394
           AGL NPVLVRLD ETKVSENLEMLFLS KN +REANLLY+LQEVI+IP+AT EQL + +K
Sbjct: 315 AGLTNPVLVRLDTETKVSENLEMLFLSVKNDEREANLLYLLQEVIKIPVATEEQLQRFRK 374

Query: 395 STXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMPAANELPSEKATILFVPTRHHVEYISQL 454
            +                             +P+A ++PS  +TI+FV TRHHVEY+S L
Sbjct: 375 QS-----NDDADDSDDETDKKKKHSKKSKQPLPSAKDMPSPNSTIIFVSTRHHVEYVSNL 429

Query: 455 LRDCGYLISYIYGTLDQHARKNQLYNFRAGLTSILVVTDVAARGVDIPMLANVINYTLPG 514
           L+DCGYL+SY+YGTLDQHAR+ QL+NFR GLT+ILVVTDVAARGVDIP+LANV+N +LP 
Sbjct: 430 LKDCGYLVSYLYGTLDQHARRQQLHNFRCGLTNILVVTDVAARGVDIPLLANVVNMSLPA 489

Query: 515 SSKIFVHRVGRTARAGNKGWAYSIVAXXXXXXXXXXXXXXGKKILLTPMYDSLVDVMKKR 574
           SSKIFVHRVGRTARAGNKGWAY+I++              GKK+LLTPMY++  D++KK+
Sbjct: 490 SSKIFVHRVGRTARAGNKGWAYTILSESELPYLLDLELFLGKKVLLTPMYEATCDLLKKK 549

Query: 575 WVEEGNSAYNFQLPKLSYTKRLVLGSCPRLDVEGLGDLYKNLMTSNFDLQLAKKTAMKAE 634
           W+ EGN    FQ PK+SY  RL+LGS PRLD+E +GDL+KNL+ SNF+LQ  K  ++KAE
Sbjct: 550 WISEGNEGALFQPPKISYVNRLILGSAPRLDLEAMGDLFKNLVESNFELQNLKAVSIKAE 609

Query: 635 KLYYRTRTSASPESLKRSKEIIASGWDAQNAYFGKNEEKEKLDFLAKLQNRRNKETVFEF 694
           KLY RTR  AS ES+KR+KE+IA+GWD QN  FGKN EKEKL+FLAKLQNR NKETVFEF
Sbjct: 610 KLYLRTRQPASAESIKRAKEVIAAGWDEQNVRFGKNIEKEKLEFLAKLQNRHNKETVFEF 669

Query: 695 TRNPDDEMAVFMKRRRKQLAPIQRKATERRELLEKERMAGLSHSIEDEILKGDDGETGYT 754
            RN DDEMA+ MKRRR+Q+APIQ++A ER++LLEKER AGL H++EDEILKG++ E GY+
Sbjct: 670 ARNHDDEMAILMKRRRRQIAPIQQRAKERQQLLEKERQAGLRHTLEDEILKGEENEVGYS 729

Query: 755 VSEDALKNFEDADQLLEAQENESXXXXXXXXXXXXXXXLSHYAPAGEIQDKQLQITNGFA 814
           V ++ L++FEDAD+ L A+ N                 LSH+APA +IQDKQLQ+ + F 
Sbjct: 730 VPQELLRDFEDADE-LAAKRN------TKKGFRDENFYLSHFAPASDIQDKQLQVASSFT 782

Query: 815 NDAAQAAYDLNSDDKVQVHKQTATVKWDKKRKKYVNTQGIDNKKYIIGESGQKIAASFRS 874
           N+ ++A +DL++DDKVQVHKQTATVKWDKKRKKYVN QGIDNKKYIIGESGQKI ASFRS
Sbjct: 783 NEVSKATFDLHNDDKVQVHKQTATVKWDKKRKKYVNVQGIDNKKYIIGESGQKIPASFRS 842

Query: 875 GRFDDWSKARNLKPLKVGSRESSIPSNLLQDPSQGTGSNGRTVRGKFKHKQMKAPKMPDK 934
           G+FD+WSKAR L PLKVG+RESSIP+NLL DP   TGS  R   GKFKHKQ+KAPKMPDK
Sbjct: 843 GKFDEWSKARKLAPLKVGARESSIPANLLADP---TGS--RLANGKFKHKQIKAPKMPDK 897

Query: 935 HRDNYYSQKKKVDKALQSGISVKGYNNAPGLRNELKSTEQIRKDRNMAEKKRAKNARPSK 994
           +RD+Y SQ KKV+KA++SG+ VKGY NAPG++ EL++TEQIRK R+MAEK++AKNARP+K
Sbjct: 898 NRDDYQSQLKKVNKAMESGLHVKGY-NAPGMKQELRTTEQIRKQRSMAEKRKAKNARPAK 956

Query: 995 KRKF 998
           KRKF
Sbjct: 957 KRKF 960

>Kwal_56.22804 s56 complement(286570..289491) [2922 bp, 973 aa] {ON}
           YDL031W (DBP10) - similar to RNA helicases [contig 184]
           FULL
          Length = 973

 Score = 1255 bits (3247), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 611/904 (67%), Positives = 730/904 (80%), Gaps = 14/904 (1%)

Query: 96  AAFPILELSDDENNISGQTQAGEEEDDVNEYFSTNNLEKQKHKKGSFPSFGLSKIVLNNI 155
           A+FP+LELSDDE     +  A + EDDV EYF+T N E  KHKKGSF SFGLSK +++NI
Sbjct: 83  ASFPLLELSDDEE----EQAANDGEDDVTEYFTTTNAEASKHKKGSFASFGLSKFIISNI 138

Query: 156 KRKGFRQPTPIQRKTIPLILQSRDIVGMARTGSGKTAAFILPMVEKLKSHSGKIGARAVI 215
            +KGFRQPTPIQRKTIPLILQ RDIVGMARTGSGKTAAF+LPM+E+LK HS KIGARAVI
Sbjct: 139 AKKGFRQPTPIQRKTIPLILQKRDIVGMARTGSGKTAAFVLPMIERLKGHSAKIGARAVI 198

Query: 216 LSPSRELAMQTFNVFKDFARGTELRSVLLTGGDSLEEQFSMMMSNPDVIIATPGRFLHLK 275
           +SPSRELA+QT  VF++F+RG++LRSVLLTGG+SLEEQF +MMSNPDV+IATPGRFLHLK
Sbjct: 199 MSPSRELALQTHKVFREFSRGSDLRSVLLTGGESLEEQFGLMMSNPDVVIATPGRFLHLK 258

Query: 276 VEMNLDLKSVEYVVFDEADRLFEMGFQEQLNELLASLPTTRQTLLFSATLPNSLVDFVKA 335
           VEMNLDLKS+EYVVFDEADRLFEMGF+EQLNELLA+ P  RQTLLFSATLP+SLVDF KA
Sbjct: 259 VEMNLDLKSIEYVVFDEADRLFEMGFEEQLNELLAAFPVARQTLLFSATLPSSLVDFAKA 318

Query: 336 GLVNPVLVRLDAETKVSENLEMLFLSSKNADREANLLYILQEVIRIPLATSEQLLKLQKS 395
           GL +PVLVRLD ETKVSENLEML+LSSKN +REANLLY+LQE ++IP+AT EQL +  ++
Sbjct: 319 GLTSPVLVRLDTETKVSENLEMLYLSSKNEEREANLLYLLQEAMQIPVATEEQLAEY-RT 377

Query: 396 TXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMPAANELPSEKATILFVPTRHHVEYISQLL 455
                                         MPAANELPSE ATI+FVPTRHHVEYI+QLL
Sbjct: 378 KIKDDYDSDDSDSKDKLKAKKKKKAMIRRKMPAANELPSEHATIVFVPTRHHVEYITQLL 437

Query: 456 RDCGYLISYIYGTLDQHARKNQLYNFRAGLTSILVVTDVAARGVDIPMLANVINYTLPGS 515
           +DCGYL+SY+YGTLDQHAR+ QL+NFRAGLT+ILVVTDVAARGVDIPMLANV+NY+LP S
Sbjct: 438 KDCGYLVSYLYGTLDQHARRQQLFNFRAGLTTILVVTDVAARGVDIPMLANVVNYSLPAS 497

Query: 516 SKIFVHRVGRTARAGNKGWAYSIVAXXXXXXXXXXXXXXGKKILLTPMYDSLVDVMKKRW 575
           SKIFVHRVGRTARAGNKG AYSIV+              GKKILLTPMY++  +++K RW
Sbjct: 498 SKIFVHRVGRTARAGNKGSAYSIVSDNELPYLLDLELFLGKKILLTPMYEATTEMLKSRW 557

Query: 576 VEEGNSAYNFQLPKLSYTKRLVLGSCPRLDVEGLGDLYKNLMTSNFDLQLAKKTAMKAEK 635
           + EG S   F  PK+SYT R+VLG+CPRL++E  GDL+K+L+ S+FDL+  K  A KAEK
Sbjct: 558 IAEGKSELTFNAPKVSYTNRMVLGACPRLELETCGDLFKSLIDSSFDLKQLKAVANKAEK 617

Query: 636 LYYRTRTSASPESLKRSKEIIASGWDAQNAYFGKNEEKEKLDFLAKLQNRRNKETVFEFT 695
           LY+RTR  AS +S+KRSKE+++SGWD QN  FGKN EKEKLDFLAKLQNR +KETVFEF 
Sbjct: 618 LYFRTRPPASSQSMKRSKEVLSSGWDEQNLRFGKNMEKEKLDFLAKLQNRHHKETVFEFA 677

Query: 696 RNPDDEMAVFMKRRRKQLAPIQRKATERRELLEKERMAGLSHSIEDEILKGDDGETGYTV 755
           RN DDEMA+ MK+RR Q+APIQR+A ER+ELLEKER AGL HS+EDEILKGD+ E GY+V
Sbjct: 678 RNHDDEMALLMKKRRIQIAPIQRRAKERKELLEKERKAGLVHSVEDEILKGDETEVGYSV 737

Query: 756 SEDAL-KNFEDADQLLEAQENESXXXXXXXXXXXXXXXLSHYAPAGEIQDKQLQITNGFA 814
            E+ L + FEDAD+LLE Q+ E                LSHYAPA EIQDKQL+++NGF 
Sbjct: 738 PEEVLHQEFEDADELLEGQKKEK----KQKSFRDPTYFLSHYAPASEIQDKQLEVSNGFT 793

Query: 815 NDAAQAAYDLNSDDKVQVHKQTATVKWDKKRKKYVNTQGIDNKKYIIGESGQKIAASFRS 874
           N+AA A +DL++DDKVQ HKQ AT+KWDKKR+KYVN+QG+DNKKYI GESG KI ASFRS
Sbjct: 794 NEAANATFDLHNDDKVQNHKQIATIKWDKKRQKYVNSQGLDNKKYITGESGHKIPASFRS 853

Query: 875 GRFDDWSKARNLKPLKVGSRESSIPSNLLQDPSQGTGSNGRTVRGKFKHKQMKAPKMPDK 934
           G+FD+WSKAR L P+KVG+RESS  S +L +P   T +N R   GKFKH ++KAPK+PDK
Sbjct: 854 GKFDEWSKARKLGPIKVGARESSSTSKMLSNP---TSNNQRMGGGKFKHNKVKAPKLPDK 910

Query: 935 HRDNYYSQKKKVDKALQSGISVKGYNNAPGLRNELKSTEQIRKDRNMAEKKRAKNARPSK 994
           +RD+Y+ QKKKV+KA+ SGI VKG+ NAPG+++E+++ +QI K+R   EKKRAKNARP+K
Sbjct: 911 NRDDYHVQKKKVEKAISSGIRVKGF-NAPGMKSEMRTPQQIYKERVAKEKKRAKNARPAK 969

Query: 995 KRKF 998
           KRK+
Sbjct: 970 KRKY 973

>ZYRO0B04972g Chr2 complement(401735..404674) [2940 bp, 979 aa] {ON}
           similar to uniprot|Q12389 Saccharomyces cerevisiae
           YDL031W DBP10 Essential protein involved in ribosome
           biogenesis putative ATP-dependent RNA helicase of the
           DEAD- box protein family
          Length = 979

 Score = 1243 bits (3216), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 605/904 (66%), Positives = 723/904 (79%), Gaps = 9/904 (0%)

Query: 98  FPILELSDDENNISGQTQAGE-EEDDVNEYFSTNNLEKQKHKKGSFPSFGLSKIVLNNIK 156
           FPILELSD+E +   + +  + + DD++EYF+TNN E +KHKKGSFPSFG SK +LNNI 
Sbjct: 80  FPILELSDNEEDADAKKKKEDGDADDISEYFTTNNSESKKHKKGSFPSFGFSKFILNNIN 139

Query: 157 RKGFRQPTPIQRKTIPLILQSRDIVGMARTGSGKTAAFILPMVEKLKSHSGKIGARAVIL 216
           +KGFRQPTPIQRKTIPLILQ+RDIVGMARTGSGKTAAF+LPM+EKLK+HS KIGARAVIL
Sbjct: 140 KKGFRQPTPIQRKTIPLILQNRDIVGMARTGSGKTAAFVLPMIEKLKAHSSKIGARAVIL 199

Query: 217 SPSRELAMQTFNVFKDFARGTELRSVLLTGGDSLEEQFSMMMSNPDVIIATPGRFLHLKV 276
           SPSRE+AMQT+ VFK+F++G++LRSVLLTGGDSLE+QF MMMSNPDV++ATPGRFLHLKV
Sbjct: 200 SPSREIAMQTYKVFKEFSKGSDLRSVLLTGGDSLEDQFGMMMSNPDVVVATPGRFLHLKV 259

Query: 277 EMNLDLKSVEYVVFDEADRLFEMGFQEQLNELLASLPTTRQTLLFSATLPNSLVDFVKAG 336
           EMNL+LKSVEY VFDEADRLFEMGF EQLNELLASLP  RQTLLFSATLPN+LVDF KAG
Sbjct: 260 EMNLNLKSVEYAVFDEADRLFEMGFAEQLNELLASLPEKRQTLLFSATLPNTLVDFAKAG 319

Query: 337 LVNPVLVRLDAETKVSENLEMLFLSSKNADREANLLYILQEVIRIPLATSEQLLKLQKST 396
           L NPVLVRLDAE+K+SENLEMLF+S+K+ +REANL Y+LQEVI+IPLAT EQ + L +  
Sbjct: 320 LTNPVLVRLDAESKISENLEMLFVSTKHDEREANLFYLLQEVIKIPLATEEQKMILGEGN 379

Query: 397 XXXXXXXXXXXXXXXXXXXXXXXXXXXX--XMPAANELPSEKATILFVPTRHHVEYISQL 454
                                          +P+ANELPSEKATI+FVPTRHHVEYISQL
Sbjct: 380 KALSDSEDSDAENGKKDRRKKGKKNKAKRPKLPSANELPSEKATIVFVPTRHHVEYISQL 439

Query: 455 LRDCGYLISYIYGTLDQHARKNQLYNFRAGLTSILVVTDVAARGVDIPMLANVINYTLPG 514
           L+ CGYL+SYIYGTLDQHAR+ QLYNFRAGLTSILVVTDVAARGVDIPMLANVIN+T+P 
Sbjct: 440 LKACGYLVSYIYGTLDQHARRRQLYNFRAGLTSILVVTDVAARGVDIPMLANVINFTMPS 499

Query: 515 SSKIFVHRVGRTARAGNKGWAYSIVAXXXXXXXXXXXXXXGKKILLTPMYDSLVDVMKKR 574
           SSKIFVHRVGRTARAGN+GWAYSIV+              GKKILL PMY++  +++K++
Sbjct: 500 SSKIFVHRVGRTARAGNRGWAYSIVSESELPYLLDLELFLGKKILLAPMYEATCNLLKEK 559

Query: 575 WVEEGNSAYNFQLPKLSYTKRLVLGSCPRLDVEGLGDLYKNLMTSNFDLQLAKKTAMKAE 634
           WV EGN  + FQ PK+SYT R+VLGSCPR+++E +GDLYKNLM SN+DL   +  ++KAE
Sbjct: 560 WVNEGNDEFRFQPPKVSYTDRMVLGSCPRIELESMGDLYKNLMDSNYDLGSTRGVSIKAE 619

Query: 635 KLYYRTRTSASPESLKRSKEIIASGWDAQNAYFGKNEEKEKLDFLAKLQNRRNKETVFEF 694
            +Y RTR  AS ES+KR+K++I SGWD QN  FGKN E EK  FLAKLQ+RRNKETVFEF
Sbjct: 620 IMYMRTRQPASAESMKRAKQMIISGWDEQNILFGKNMEAEKNKFLAKLQDRRNKETVFEF 679

Query: 695 TRNPDDEMAVFMKRRRKQLAPIQRKATERRELLEKERMAGLSHSIEDEILKGDDGETGYT 754
            RNPDD+M+V MK+RR+QL P+Q +A +R+EL+EKE++AGL+HS+EDE+L    GE GY+
Sbjct: 680 ARNPDDKMSVLMKKRRQQLEPVQLRAKQRQELMEKEKLAGLTHSLEDEVLDKYKGEVGYS 739

Query: 755 VSEDALKNFEDADQLLEAQENESXXXXXXXXXXXXXX-XLSHYAPAGEIQDKQLQITNGF 813
           V +  L+ FEDADQ+LE QE E                 +SHYAPA  +QD QL I++GF
Sbjct: 740 VPDAVLEEFEDADQVLEDQETEGKKQKQKSKSFKDSNFFMSHYAPAQSVQDSQLNISSGF 799

Query: 814 ANDAAQAAYDLNSDDKVQVHKQTATVKWDKKRKKYVNTQGIDNKKYIIGESGQKIAASFR 873
             DAAQA+YDLN DDK+QVHKQTATVKWDKK+KKYVN QG DN +YI  ESGQKI AS+R
Sbjct: 800 TTDAAQASYDLNDDDKIQVHKQTATVKWDKKKKKYVNPQGADNVRYITSESGQKIPASYR 859

Query: 874 SGRFDDWSKARNLKPLKVGSRESSIPSNLLQDPSQGT-GSNGRTVRGKFKHKQMKAPKMP 932
           SG+FD+WSK R LK  KVGSRESS+ +NLLQDP++G   SN R    +F HKQ+KAPK+P
Sbjct: 860 SGKFDEWSKKRKLKMPKVGSRESSMATNLLQDPTRGNPSSNNR----RFMHKQVKAPKVP 915

Query: 933 DKHRDNYYSQKKKVDKALQSGISVKGYNNAPGLRNELKSTEQIRKDRNMAEKKRAKNARP 992
           DK+RD+Y  QK KV KAL+ GI VKG+NNAPG+ NEL+S +QIRK R + +K+RAKNAR 
Sbjct: 916 DKYRDDYGKQKTKVAKALEKGIHVKGHNNAPGMTNELRSADQIRKQRVVKDKRRAKNARV 975

Query: 993 SKKR 996
            KKR
Sbjct: 976 GKKR 979

>TDEL0D04630 Chr4 complement(849268..852174) [2907 bp, 968 aa] {ON}
           Anc_3.159 YDL031W
          Length = 968

 Score = 1223 bits (3164), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 599/877 (68%), Positives = 701/877 (79%), Gaps = 6/877 (0%)

Query: 123 VNEYFSTNNLEKQKHKKGSFPSFGLSKIVLNNIKRKGFRQPTPIQRKTIPLILQSRDIVG 182
           VNEYFST     +KHKKGSFPSFGLSK++LNNI RKGF QPTPIQRKTIPLILQSRDIVG
Sbjct: 97  VNEYFSTTAQTNKKHKKGSFPSFGLSKLILNNISRKGFHQPTPIQRKTIPLILQSRDIVG 156

Query: 183 MARTGSGKTAAFILPMVEKLKSHSGKIGARAVILSPSRELAMQTFNVFKDFARGTELRSV 242
           +ARTGSGKTAAFILPM+EKLKSHS K+GARAVILSPSRELAMQT  VFKDF+RGT LRSV
Sbjct: 157 LARTGSGKTAAFILPMIEKLKSHSSKVGARAVILSPSRELAMQTHKVFKDFSRGTHLRSV 216

Query: 243 LLTGGDSLEEQFSMMMSNPDVIIATPGRFLHLKVEMNLDLKSVEYVVFDEADRLFEMGFQ 302
           LLTGGDSLEEQF MMMSNPDVI+ATPGRFLHLKVEMNLDLKS+EY VFDE+DRLFEMGF+
Sbjct: 217 LLTGGDSLEEQFGMMMSNPDVIVATPGRFLHLKVEMNLDLKSIEYAVFDESDRLFEMGFE 276

Query: 303 EQLNELLASLPTTRQTLLFSATLPNSLVDFVKAGLVNPVLVRLDAETKVSENLEMLFLSS 362
           EQLNELLA+LP+ RQTLLFSATLPNSLVDF KAGL NPVLVRLD E+K+SENLEMLFLS+
Sbjct: 277 EQLNELLAALPSNRQTLLFSATLPNSLVDFAKAGLTNPVLVRLDQESKISENLEMLFLST 336

Query: 363 KNADREANLLYILQEVIRIPLATSEQLLKLQKSTXXXXXXXXXXXXXXXXXXXXXXXXXX 422
           K+ +REA LLY++QEVI+IPLAT EQ +KL K                            
Sbjct: 337 KHDEREAALLYLIQEVIQIPLATEEQ-IKLIKDKSPDSDEESDDDNGKRSHNKHKKEKFK 395

Query: 423 XXXMPAANELPSEKATILFVPTRHHVEYISQLLRDCGYLISYIYGTLDQHARKNQLYNFR 482
              MPAAN+LPSEK+TILFVPTRHHVEYI+ LL++CGYL+SYIYG+LDQ AR  QLYNFR
Sbjct: 396 KVRMPAANQLPSEKSTILFVPTRHHVEYIANLLKNCGYLVSYIYGSLDQRARNRQLYNFR 455

Query: 483 AGLTSILVVTDVAARGVDIPMLANVINYTLPGSSKIFVHRVGRTARAGNKGWAYSIVAXX 542
           AGLTSILVVTDVAARGVDIPMLANVIN++ P SSKIFVHRVGRTARAGN+GWAYSI++  
Sbjct: 456 AGLTSILVVTDVAARGVDIPMLANVINFSFPSSSKIFVHRVGRTARAGNRGWAYSIISES 515

Query: 543 XXXXXXXXXXXXGKKILLTPMYDSLVDVMKKRWVEEGNSAYNFQLPKLSYTKRLVLGSCP 602
                       GKKIL TPMY++  D+++KRWVEEG     F+ PK SYT RLVLGSCP
Sbjct: 516 ELPYLLDLELFLGKKILTTPMYEAATDLLEKRWVEEGKEKILFKAPKPSYTNRLVLGSCP 575

Query: 603 RLDVEGLGDLYKNLMTSNFDLQLAKKTAMKAEKLYYRTRTSASPESLKRSKEIIASGWDA 662
           RLD++ +GDLYKNLM+S F+L+  +  A KAEKLY RTRT+AS ES+KRS+E++ SGWD 
Sbjct: 576 RLDIDSMGDLYKNLMSS-FELETLRGVAKKAEKLYLRTRTAASVESVKRSRELMTSGWDE 634

Query: 663 QNAYFGKNEEKEKLDFLAKLQNRRNKETVFEFTRNPDDEMAVFMKRRRKQLAPIQRKATE 722
           QN  FGKN EKEKLDFLAKLQ+R NKETVFEF RN DDE ++ MK+RR Q+API  KA +
Sbjct: 635 QNVMFGKNLEKEKLDFLAKLQDRTNKETVFEFARNADDETSMLMKKRRFQVAPITEKAKK 694

Query: 723 RRELLEKERMAGLSHSIEDEILKGDDGETGYTVSEDALKNFEDADQLLEAQENESXXXXX 782
           R+ELLE ++ AG SH++EDE+L  D+     +V E+ L+ FEDAD+LLE QE        
Sbjct: 695 RKELLELQKAAGFSHAMEDELL-NDNELIKESVPEEVLQEFEDADKLLEDQEK--LGRKK 751

Query: 783 XXXXXXXXXXLSHYAPAGEIQDKQLQITNGFANDAAQAAYDLNSDDKVQVHKQTATVKWD 842
                     LSHYAP G + + +L +T+GF  DAAQAA D+N DDKVQVHKQ ATVKWD
Sbjct: 752 SKSFRDPNFFLSHYAPQGGLHENELNLTSGFTTDAAQAACDINGDDKVQVHKQNATVKWD 811

Query: 843 KKRKKYVNTQGIDNKKYIIGESGQKIAASFRSGRFDDWSKARNLKPLKVGSRESSIPSNL 902
            K+KKY+N+QG DNKKYI+GESGQKI ASFRSG++ +WSKARNL+P+KVG+RES   +N+
Sbjct: 812 SKKKKYINSQGADNKKYIVGESGQKIPASFRSGKYAEWSKARNLQPIKVGARESPTAANM 871

Query: 903 LQDPSQGTGSNG-RTVRGKFKHKQMKAPKMPDKHRDNYYSQKKKVDKALQSGISVKGYNN 961
           L++P+Q   ++G RTV GKFKHKQ+KAPK+PDKHRD+Y+ QKKKV +AL  GI+VKGYN 
Sbjct: 872 LRNPAQNHPTDGQRTVGGKFKHKQVKAPKLPDKHRDDYHKQKKKVKEALDKGINVKGYNT 931

Query: 962 APGLRNELKSTEQIRKDRNMAEKKRAKNARPSKKRKF 998
               +NEL+S  QIRK R  +EKK AKNARPSKKRK+
Sbjct: 932 RGAPKNELQSIAQIRKQRQTSEKKHAKNARPSKKRKY 968

>TBLA0B01590 Chr2 (349441..352230) [2790 bp, 929 aa] {ON} Anc_3.159
           YDL031W
          Length = 929

 Score =  945 bits (2443), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 499/914 (54%), Positives = 635/914 (69%), Gaps = 64/914 (7%)

Query: 104 SDDENN---------ISGQTQAGEEEDDVNEYFSTNNLEKQKHKKGSFPSFGLSKIVLNN 154
           +D ENN         + G  +   ++DD+N+YF+T +L+ +K KKGSF SFG ++ ++NN
Sbjct: 60  TDKENNTKSKNDFPQLDGNVEVESDDDDINDYFATTHLDTKKFKKGSFASFGFNRFIMNN 119

Query: 155 IKRKGFRQPTPIQRKTIPLILQSRDIVGMARTGSGKTAAFILPMVEKLKSHSGKIGARAV 214
           I +KG++QPTPIQRKTIPLILQ RDIVGMARTGSGKTAAF+LPM+EKLK+HS KIG R V
Sbjct: 120 INKKGYKQPTPIQRKTIPLILQKRDIVGMARTGSGKTAAFLLPMIEKLKTHSSKIGVRGV 179

Query: 215 ILSPSRELAMQTFNVFKDFARGTELRSVLLTGGDSLEEQFSMMMSNPDVIIATPGRFLHL 274
           ILSPSRE+A+QT  VFK+F++ TELRSVLLTGGDSLE+QF MMMSNPDV+IATPGRFLHL
Sbjct: 180 ILSPSREIAIQTHRVFKEFSKNTELRSVLLTGGDSLEDQFGMMMSNPDVVIATPGRFLHL 239

Query: 275 KVEMNLDLKSVEYVVFDEADRLFEMGFQEQLNELLASLPTTRQTLLFSATLPNSLVDFVK 334
           KVEM LDLKSVEY+VFDEADRLFEMGF+EQLNELLA+LP  RQ+LLFSATLPNSLV+F K
Sbjct: 240 KVEMKLDLKSVEYIVFDEADRLFEMGFEEQLNELLAALPDNRQSLLFSATLPNSLVEFAK 299

Query: 335 AGLVNPVLVRLDAETKVSENLEMLFLSSKNADREANLLYILQEVIRIPLATSEQLLKLQK 394
           AGL NPVLV+LD E+K+S+NLEMLFLS K  +RE+NLL++LQ+VI +P+A++E++ + Q 
Sbjct: 300 AGLKNPVLVKLDQESKISDNLEMLFLSCKKEERESNLLFLLQDVIGVPVASTEEMKRFQT 359

Query: 395 STXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMPAANELPSEKATILFVPTRHHVEYISQL 454
            +                                ++E+P E+ATI+FVPTRHHVEYISQL
Sbjct: 360 DSREVEEKEEKEKEKGKEKEKRAKYYK-------SDEIPHEQATIIFVPTRHHVEYISQL 412

Query: 455 LRDCGYLISYIYGTLDQHARKNQLYNFRAGLTSILVVTDVAARGVDIPMLANVINYTLPG 514
           L  CGYL+SY+YGTLDQHAR+NQL  F  G+T ILVVTDVAARGVDIP+L NVINY+LPG
Sbjct: 413 LMKCGYLVSYLYGTLDQHARRNQLRQFCFGITRILVVTDVAARGVDIPLLPNVINYSLPG 472

Query: 515 SSKIFVHRVGRTARAGNKGWAYSIVAXXXXXXXXXXXXXXGKKILLTPMYDSLVDVMKKR 574
           SSKIFVHRVGRTARAGN+GWAYSIV+              GKK++ T M + L       
Sbjct: 473 SSKIFVHRVGRTARAGNRGWAYSIVSESELPYLVELGTFLGKKVITTGMVEKL------- 525

Query: 575 WVEEGNSAYNFQLPKLSYTKRLVLGSCPRLDVEGLGDLYKNLMTSNFDLQLAKKTAMKAE 634
                         K+SY K +VLGS PR+DVE  GDLYKN+    FDLQ++KKT  KAE
Sbjct: 526 ---------GVSFDKISYNKWMVLGSGPRVDVESFGDLYKNVYDQEFDLQMSKKTCEKAE 576

Query: 635 KLYYRTRTSASPESLKRSKEIIASGWDAQNAYFGKNEEKEKLDFLAKLQNRRNKETVFEF 694
           KLY RTR  AS +S+KRSKE+I   WD QN  FG++ E+ KL+ L K   R+NKETVFEF
Sbjct: 577 KLYLRTRGGASNDSVKRSKELILQKWDGQNVKFGQDLERAKLELLNKFALRKNKETVFEF 636

Query: 695 TRNPDDEMAVFMKRRRKQLAPIQRKATERRELLEKERMAGLSHSIEDEILKGDDGETGYT 754
            +N +DEM+  M RR K +  I+RKA  RRE+ E+E          +E L    G     
Sbjct: 637 GKNGEDEMSTLMNRRWKVVKGIERKAKRRREMKEEEEGGVEEELQFEEELGSGSGPGPGQ 696

Query: 755 VSEDALKN-------FEDADQLLEAQENESXXXXXXXXXXXXXXXLSHYAPAGEIQDKQL 807
                L +       FED D +L  Q                   LSHYA   +++++  
Sbjct: 697 GPGQDLVDAGNYNGVFEDGDAILNGQ------TKKRKTFKDERFFLSHYADPKKVENE-- 748

Query: 808 QITNGFANDAAQAAYDLNSDDKVQVHKQ-TATVKWDKKRKKYVNTQGIDNKKYIIGESGQ 866
           ++ +GF N A++A+YDLN+D+K+QVHKQ +ATVKWD+KRKKYVN QGIDNKKYIIGESG+
Sbjct: 749 EVVDGFINAASEASYDLNNDEKIQVHKQSSATVKWDRKRKKYVNLQGIDNKKYIIGESGR 808

Query: 867 KIAASFRSGRFDDWSKARNLKP---LKVGSRESSIPSNLLQDPSQGTGSNGRTVRGKFKH 923
           KI A+FRSG++++W+KARN+     ++VG+RES              G       G+FKH
Sbjct: 809 KIPATFRSGKYEEWAKARNINTRNVMRVGARESE---------GSVVGGGRGGGGGRFKH 859

Query: 924 KQMKAPKMPDKHRDNYYSQKKKVDKALQSGISVKGYNNAPGLRNELKSTEQIRKDRNMAE 983
           K  K PKMPDK+RD+Y  QK+K ++A++ G+ +KG     G ++ELK+  +IRK+R   E
Sbjct: 860 KLDKKPKMPDKYRDDYKKQKEKNERAVERGV-MKG---KRGYKDELKNVAEIRKNRVEKE 915

Query: 984 KKRAKNARPSKKRK 997
           K+RAKN RP ++R+
Sbjct: 916 KRRAKNGRPGRERR 929

>KAFR0C06420 Chr3 complement(1286002..1288221) [2220 bp, 739 aa]
           {ON} Anc_5.208 YLL008W
          Length = 739

 Score =  236 bits (601), Expect = 4e-65,   Method: Compositional matrix adjust.
 Identities = 147/428 (34%), Positives = 228/428 (53%), Gaps = 65/428 (15%)

Query: 123 VNEYFS----TNNLEKQKHKKGSFPSFGLSKIVLNNIKRKGFRQPTPIQRKTIPLILQSR 178
           V EYF+      + +KQ H   +F +  LS+ VL  +   GF +P+PIQ  TIP+ L  +
Sbjct: 195 VAEYFAPEEEAEDAKKQTHT--TFNTLNLSRPVLKGLSSLGFTKPSPIQSATIPIALLGK 252

Query: 179 DIVGMARTGSGKTAAFILPMVEKLKSHSGKIGA-RAVILSPSRELAMQTFNVFK---DFA 234
           DIV  A TGSGKTAAF++P++E+L     K+ + R VIL+P+RELA+Q  +V K    F 
Sbjct: 253 DIVAGAVTGSGKTAAFMIPIIERLLYKPAKVASTRVVILTPTRELAIQISDVAKKIGHFV 312

Query: 235 RGTELRSVLLTGGDSLEEQFSMMMSNPDVIIATPGRFL-HLKVEMNLDLKSVEYVVFDEA 293
            G  L   L  GG +L +Q  ++ S PD++IATPGRF+ H++   +  +  VE +V DEA
Sbjct: 313 NG--LTFGLAVGGLNLRQQEQILKSRPDIVIATPGRFIDHVRNSASFSVDRVEILVLDEA 370

Query: 294 DRLFEMGFQEQLNELLASLPTTRQTLLFSATLPNSLVDFVKAGLVNPVLVRLDAETKVSE 353
           DR+ E GFQ++L+E++  LPT RQ LLFSAT+ + +   V   L  PV + +D   + ++
Sbjct: 371 DRMLEEGFQDELSEIMTLLPTRRQNLLFSATMNSKIKQLVSLSLKKPVRIMIDPPKQAAD 430

Query: 354 NLEMLFLSSKNADR-EANLLYILQEVIRIPLATSEQLLKLQKSTXXXXXXXXXXXXXXXX 412
            L   F+  +  D  +  LLY               L++   ST                
Sbjct: 431 RLVQEFVRIRKRDHLKPALLY--------------NLIRKLDST---------------- 460

Query: 413 XXXXXXXXXXXXXMPAANELPSEKATILFVPTRHHVEYISQLLRDCGYLISYIYGTLDQH 472
                                 +K  ++FV  +     +  +L   G  ++ ++G+L Q 
Sbjct: 461 ---------------------GQKRIVVFVSRKEVAHRLRIILGLLGMGVAELHGSLSQE 499

Query: 473 ARKNQLYNFRAGLTSILVVTDVAARGVDIPMLANVINYTLPGSSKIFVHRVGRTARAGNK 532
            R + +  F++    +L+ TD+A+RG+DIP +  VINY +P S +I++HRVGRTARAG +
Sbjct: 500 QRLDSVNKFKSLDVPVLICTDLASRGLDIPKIEIVINYDMPKSYEIYLHRVGRTARAGRE 559

Query: 533 GWAYSIVA 540
           G + + V 
Sbjct: 560 GRSVTFVG 567

>KLLA0F15752g Chr6 (1454735..1456981) [2247 bp, 748 aa] {ON} similar
           to uniprot|P32892 Saccharomyces cerevisiae YLL008W DRS1
           Nucleolar DEAD-box protein required for ribosome
           assembly and function
          Length = 748

 Score =  231 bits (590), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 137/408 (33%), Positives = 219/408 (53%), Gaps = 57/408 (13%)

Query: 137 HKKGSFPSFGLSKIVLNNIKRKGFRQPTPIQRKTIPLILQSRDIVGMARTGSGKTAAFIL 196
           HK  +F S  LS+ VL  +   G+  P+PIQ   IP+ L  +DI+  A TGSGKTAAF++
Sbjct: 232 HK--TFNSLSLSRPVLKGLGSLGYTSPSPIQSAAIPIALLGKDIIAGAVTGSGKTAAFMI 289

Query: 197 PMVEKLKSHSGKIGA-RAVILSPSRELAMQTFNVFKDFARGTE-LRSVLLTGGDSLEEQF 254
           P++E+L      I + R V+L+P+RELA+Q  +V K+  +    L   L  GG +L +Q 
Sbjct: 290 PIIERLLYKPAHIASTRVVVLTPTRELAIQVADVGKNIGKFVNGLTFGLAVGGLNLRQQE 349

Query: 255 SMMMSNPDVIIATPGRFL-HLKVEMNLDLKSVEYVVFDEADRLFEMGFQEQLNELLASLP 313
             + + PD++IATPGRF+ HL+   +  + SVE +V DEADR+ E GFQE+L E+++ +P
Sbjct: 350 QALKTRPDIVIATPGRFIDHLRNSASFSVDSVEILVIDEADRMLEEGFQEELQEIMSLIP 409

Query: 314 TTRQTLLFSATLPNSLVDFVKAGLVNPVLVRLDAETKVSENLEMLFLSSKNADR-EANLL 372
           + RQTLLFSAT+ + +   +   L  PV + +D   + ++ L   F+  +  D  +  LL
Sbjct: 410 SKRQTLLFSATMNSKIKQLISLSLKKPVRIMIDPPKQAADKLTQEFIRIRKRDHLKPALL 469

Query: 373 YILQEVIRIPLATSEQLLKLQKSTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMPAANEL 432
           Y              QL++   +T                                    
Sbjct: 470 Y--------------QLIRKLDNT------------------------------------ 479

Query: 433 PSEKATILFVPTRHHVEYISQLLRDCGYLISYIYGTLDQHARKNQLYNFRAGLTSILVVT 492
            S+K  ++FV  +     +  +L   G  +  ++G+L Q  R   + NF++    +L+ T
Sbjct: 480 -SQKRIVVFVARKETAHKLRIVLGLLGMQVGELHGSLTQEQRLQSVNNFKSLQVPVLICT 538

Query: 493 DVAARGVDIPMLANVINYTLPGSSKIFVHRVGRTARAGNKGWAYSIVA 540
           D+A+RG+DIP +  VIN+ +P + +I++HRVGRTARAG +G + + V 
Sbjct: 539 DLASRGLDIPKIEVVINFDMPKTYEIYLHRVGRTARAGREGRSVTFVG 586

>TPHA0N00700 Chr14 (157186..159453) [2268 bp, 755 aa] {ON} Anc_5.208
           YLL008W
          Length = 755

 Score =  232 bits (591), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 138/413 (33%), Positives = 222/413 (53%), Gaps = 57/413 (13%)

Query: 133 EKQKHKKGSFPSFGLSKIVLNNIKRKGFRQPTPIQRKTIPLILQSRDIVGMARTGSGKTA 192
           E +K    +F +  LS+ VL  +   G+ +P+PIQ  TIP+ L  +DI+  A TGSGKTA
Sbjct: 213 EAKKQVHTNFNTLSLSRPVLKGLSDLGYTKPSPIQSATIPIGLLGKDIIAGAVTGSGKTA 272

Query: 193 AFILPMVEKLKSHSGKIGA-RAVILSPSRELAMQTFNVFKDFARGTE-LRSVLLTGGDSL 250
           AF++P++E+L      I + R ++L+P+RELA+Q  +V K   +    L   L  GG +L
Sbjct: 273 AFMIPIIERLLYKPANIASTRVIVLTPTRELAIQVSDVGKRIGKYVNGLTFGLAVGGLNL 332

Query: 251 EEQFSMMMSNPDVIIATPGRFL-HLKVEMNLDLKSVEYVVFDEADRLFEMGFQEQLNELL 309
            +Q   + + PDV+IATPGRF+ H++   + ++ SVE +V DEADR+ E GFQE+LNE++
Sbjct: 333 RQQEQELKTRPDVVIATPGRFIDHIRNSASFNVDSVEVLVIDEADRMLEDGFQEELNEIM 392

Query: 310 ASLPTTRQTLLFSATLPNSLVDFVKAGLVNPVLVRLDAETKVSENLEMLFLSSKNAD--R 367
           + LPT RQTLLFSAT+ + +   +   L  PV + ++   + +  L   F+  +  D  +
Sbjct: 393 SLLPTKRQTLLFSATMNSKIKQLISLSLRRPVRIMINPPKQAAARLTQEFVRIRKRDLLK 452

Query: 368 EANLLYILQEVIRIPLATSEQLLKLQKSTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMP 427
            A L Y+++              KL  S                                
Sbjct: 453 PALLYYLIR--------------KLDSS-------------------------------- 466

Query: 428 AANELPSEKATILFVPTRHHVEYISQLLRDCGYLISYIYGTLDQHARKNQLYNFRAGLTS 487
                 S+K  ++FV  +     +  ++   G  ++ ++G+L Q  R   +  F++    
Sbjct: 467 ------SQKRIVVFVSRKEMAHRLRIIMGLLGMKVAELHGSLTQEQRLQSVNQFKSLEVP 520

Query: 488 ILVVTDVAARGVDIPMLANVINYTLPGSSKIFVHRVGRTARAGNKGWAYSIVA 540
           +L+ TD+A+RG+DIP +  VINY +P S +I++HRVGRTARAG +G + + V 
Sbjct: 521 VLICTDLASRGLDIPKIEVVINYDMPKSYEIYLHRVGRTARAGREGRSVTFVG 573

>AAL164C Chr1 complement(55223..57427) [2205 bp, 734 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLL008W
           (DRS1)
          Length = 734

 Score =  226 bits (577), Expect = 6e-62,   Method: Compositional matrix adjust.
 Identities = 142/431 (32%), Positives = 226/431 (52%), Gaps = 60/431 (13%)

Query: 119 EEDDVNE----YFSTNNLEKQKHK-KGSFPSFGLSKIVLNNIKRKGFRQPTPIQRKTIPL 173
           EED   E    Y  +N  E+ K+    +F S  LS+ VL  +   G+ +P+PIQ  TIP+
Sbjct: 193 EEDTAEEMAQFYAPSNEGEEAKNVVHSTFNSLSLSRPVLKGLAALGYTKPSPIQGATIPI 252

Query: 174 ILQSRDIVGMARTGSGKTAAFILPMVEKLKSHSGKIGA-RAVILSPSRELAMQTFNVFKD 232
            L  +D++  A TGSGKTAAF++P++E+L     KI + R ++L+P+RELA+Q  +V K 
Sbjct: 253 ALLGKDVIAGAVTGSGKTAAFMIPIIERLLYKPAKIASTRVLVLTPTRELAIQVADVGKK 312

Query: 233 FARGTE-LRSVLLTGGDSLEEQFSMMMSNPDVIIATPGRFL-HLKVEMNLDLKSVEYVVF 290
             +    L   L  GG +L +Q   +   PD++IATPGR + H++   +  + SVE +V 
Sbjct: 313 LGKFVSGLTFGLAVGGLNLRQQEQALKLRPDIVIATPGRIIDHIRNSASFSVDSVEVLVI 372

Query: 291 DEADRLFEMGFQEQLNELLASLPTTRQTLLFSATLPNSLVDFVKAGLVNPVLVRLDAETK 350
           DEADR+ E GFQ++LNE+++ +P+ RQTLLFSAT+ + +   +   L  PV + +D   +
Sbjct: 373 DEADRMLEDGFQDELNEIMSLIPSKRQTLLFSATMNSRIKQLISLSLKKPVRIMIDPPKQ 432

Query: 351 VSENLEMLFLSSKNADR-EANLLYILQEVIRIPLATSEQLLKLQKSTXXXXXXXXXXXXX 409
            +  L   F+  +  +  +  LLY               LL+   ST             
Sbjct: 433 AANKLTQEFVRLRKREHLKPALLY--------------HLLRKLDST------------- 465

Query: 410 XXXXXXXXXXXXXXXXMPAANELPSEKATILFVPTRHHVEYISQLLRDCGYLISYIYGTL 469
                                    +K  ++FV  +     +  +L   G     ++G+L
Sbjct: 466 ------------------------GQKRIVVFVARKEVAHRLRVILGLLGMKAGELHGSL 501

Query: 470 DQHARKNQLYNFRAGLTSILVVTDVAARGVDIPMLANVINYTLPGSSKIFVHRVGRTARA 529
            Q  R   + NF++    +LV TD+A+RG+DIP +  VINY +P + +I++HRVGRTARA
Sbjct: 502 TQEQRLQSVNNFKSLDVPVLVCTDLASRGLDIPKIEVVINYDMPKTYEIYLHRVGRTARA 561

Query: 530 GNKGWAYSIVA 540
           G +G + ++V 
Sbjct: 562 GREGKSVTLVG 572

>KLTH0B03278g Chr2 complement(257395..259614) [2220 bp, 739 aa] {ON}
           similar to uniprot|P32892 Saccharomyces cerevisiae
           YLL008W DRS1 Nucleolar DEAD-box protein required for
           ribosome assembly and function including synthesis of
           60S ribosomal subunits
          Length = 739

 Score =  221 bits (562), Expect = 5e-60,   Method: Compositional matrix adjust.
 Identities = 136/446 (30%), Positives = 231/446 (51%), Gaps = 67/446 (15%)

Query: 100 ILELSDDENNISGQTQAGEEEDDVNEYFSTNNLEKQKHKKGSFPSFGLSKIVLNNIKRKG 159
           + ++ DD      +  A EEE          + E +K    +F S  LS+ VL  +    
Sbjct: 193 VSDIEDDSEEAKAEFYALEEE----------STEAKKTVHTNFNSLSLSRPVLKGLGALN 242

Query: 160 FRQPTPIQRKTIPLILQSRDIVGMARTGSGKTAAFILPMVEKLKSHSGKIGA-RAVILSP 218
           + +P+PIQ  TIP+ L  +DI+  A TGSGKTAA+++P++E+L     +I + R ++L+P
Sbjct: 243 YVKPSPIQSATIPIALLGKDIIAGAVTGSGKTAAYMIPIIERLLYKPAQIASTRVIVLTP 302

Query: 219 SRELAMQTFNVFKDFARGTELRSV-LLTGGDSLEEQFSMMMSNPDVIIATPGRFL-HLKV 276
           +RELA+Q  +V    A+     S  L  GG +L +Q   + S PD++IATPGR + H++ 
Sbjct: 303 TRELAIQVSDVGAKLAKFVNGISFGLAVGGLNLRQQEQTLRSRPDIVIATPGRLIDHIRN 362

Query: 277 EMNLDLKSVEYVVFDEADRLFEMGFQEQLNELLASLPTTRQTLLFSATLPNSLVDFVKAG 336
             + ++ SVE +V DEADR+ E GFQ++LNE+++ +P+ RQTLLFSAT+ + +   +   
Sbjct: 363 SASFNVDSVEILVIDEADRMLEEGFQDELNEIMSLIPSKRQTLLFSATMNSKINQLISLS 422

Query: 337 LVNPVLVRLDAETKVSENLEMLFLSSKNAD--REANLLYILQEVIRIPLATSEQLLKLQK 394
           L  PV + +D   + +  L   F+  +  D  + A L ++++++                
Sbjct: 423 LKKPVKIMIDPPRQAAAKLTQEFVRVRKRDELKPALLFHLIRKL---------------- 466

Query: 395 STXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMPAANELPSEKATILFVPTRHHVEYISQL 454
                                              ++L  ++  + FV  +     +  +
Sbjct: 467 -----------------------------------DDLSQKRVVV-FVARKEVAHKLRII 490

Query: 455 LRDCGYLISYIYGTLDQHARKNQLYNFRAGLTSILVVTDVAARGVDIPMLANVINYTLPG 514
           L   G  ++ ++G+L Q  R   +  F++    +L+ TD+A+RG+DIP +  VINY +P 
Sbjct: 491 LGLLGMKVAELHGSLSQEQRLQAVNGFKSLQVPVLICTDLASRGLDIPKIEFVINYDMPK 550

Query: 515 SSKIFVHRVGRTARAGNKGWAYSIVA 540
           +  I++HRVGRTARAG +G + S V 
Sbjct: 551 TYDIYLHRVGRTARAGREGRSISFVG 576

>NDAI0F02740 Chr6 complement(670654..671051,672039..673326) [1686
           bp, 561 aa] {ON} 
          Length = 561

 Score =  203 bits (516), Expect = 3e-55,   Method: Compositional matrix adjust.
 Identities = 129/402 (32%), Positives = 202/402 (50%), Gaps = 56/402 (13%)

Query: 141 SFPSFGLSKIVLNNIKRKGFRQPTPIQRKTIPLILQSRDIVGMARTGSGKTAAFILPMVE 200
           SF   G    VL  +K +GF  PT IQ +  P+ L  RD++G+A TGSGKT ++ LP + 
Sbjct: 119 SFDEAGFPDYVLKEVKAEGFDAPTGIQCQGWPMALSGRDMIGVAATGSGKTLSYCLPGIV 178

Query: 201 KLKSH---SGKIGARAVILSPSRELAMQTFNVFKDFARGTELRSVLLTGGDSLEEQFSMM 257
            + +    S   G   ++L+P+RELA+Q       F   + +R+  + GG    +Q   +
Sbjct: 179 HINAQPLLSPGDGPIVLVLAPTRELAVQIQKECSKFGHSSRIRNTCVYGGVPRGQQIRDL 238

Query: 258 MSNPDVIIATPGRFLHLKVEMNLDLKSVEYVVFDEADRLFEMGFQEQLNELLASLPTTRQ 317
               +++IATPGR + +      +LK V Y+V DEADR+ +MGF+ Q+ +++  +   RQ
Sbjct: 239 SRGSEIVIATPGRLIDMLEIGKTNLKRVTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQ 298

Query: 318 TLLFSATLPNSLVDFVKAGLVNPVLVRLDA-ETKVSENLEMLFLSSKNADREANLLYILQ 376
           TL++SAT P  +       L +P+ V++ + E   S N+             A L+ +L 
Sbjct: 299 TLMWSATWPKEVQQLASDYLNDPIQVQVGSLELSASHNI-------------AQLVEVLS 345

Query: 377 EVIRIPLATSEQLLKLQKSTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMPAANELPSEK 436
           E         ++LLK                                  +  A+E   E 
Sbjct: 346 E-----FEKRDRLLK---------------------------------HLETASE-DKES 366

Query: 437 ATILFVPTRHHVEYISQLLRDCGYLISYIYGTLDQHARKNQLYNFRAGLTSILVVTDVAA 496
             ++F  T+   + I+++LR+ G+    I+G  DQ  R   L  FRAG + I+V TDVAA
Sbjct: 367 KILIFASTKRMCDEITKMLREDGWPALAIHGDKDQRERDWVLGEFRAGNSPIMVATDVAA 426

Query: 497 RGVDIPMLANVINYTLPGSSKIFVHRVGRTARAGNKGWAYSI 538
           RG+D+  +  VINY +PG+ + +VHR+GRT RAG KG A S 
Sbjct: 427 RGIDVKGINFVINYDMPGNIEDYVHRIGRTGRAGAKGTAISF 468

>ZYRO0B09856g Chr2 complement(769104..769462,770138..771401) [1623
           bp, 540 aa] {ON} similar to uniprot|P24783 Saccharomyces
           cerevisiae YNL112W DBP2 Essential ATP-dependent RNA
           helicase of the DEAD-box protein family involved in
           nonsense-mediated mRNA decay and rRNA processing
          Length = 540

 Score =  201 bits (511), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 128/402 (31%), Positives = 208/402 (51%), Gaps = 56/402 (13%)

Query: 141 SFPSFGLSKIVLNNIKRKGFRQPTPIQRKTIPLILQSRDIVGMARTGSGKTAAFILPMVE 200
           SF   G    VL  +K +GF  PT IQ +  P+ L  RD+VG+A TGSGKT ++ LP + 
Sbjct: 111 SFDEAGFPDYVLKEVKAEGFAAPTGIQCQGWPMALSGRDMVGVAATGSGKTLSYCLPAIV 170

Query: 201 KLKSH---SGKIGARAVILSPSRELAMQTFNVFKDFARGTELRSVLLTGGDSLEEQFSMM 257
            + +    +   G   ++L+P+RELA+Q       F R + +R+  + GG    +Q   +
Sbjct: 171 HINAQPLLAPGDGPVVLVLAPTRELAVQIQKECSKFGRSSRIRNTCVYGGVPRGQQIRDL 230

Query: 258 MSNPDVIIATPGRFLHLKVEMN-LDLKSVEYVVFDEADRLFEMGFQEQLNELLASLPTTR 316
               +++IATPGR + + +E+N  +LK V Y+V DEADR+ +MGF+ Q+ +++  +   R
Sbjct: 231 ARGAEIVIATPGRLIDM-LEINKTNLKRVTYLVLDEADRMLDMGFEPQIRKIVDQIRPDR 289

Query: 317 QTLLFSATLPNSLVDFVKAGLVNPVLVRLDAETKVSENLEMLFLSSKNADREANLLYILQ 376
           QTL++SAT P  +    +  L +P+ V++ +          L LS+          + ++
Sbjct: 290 QTLMWSATWPKEVKQLARDYLTDPIQVQIGS----------LELSAS---------HTIK 330

Query: 377 EVIRIPLATSEQLLKLQKSTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMPAANELPSEK 436
           +V+ + ++  E+  +L K                               +  A+E    K
Sbjct: 331 QVVEV-ISEFEKRDRLSKH------------------------------LEIASEDQDSK 359

Query: 437 ATILFVPTRHHVEYISQLLRDCGYLISYIYGTLDQHARKNQLYNFRAGLTSILVVTDVAA 496
             ++F  T+   + I+Q LR  G+    I+G  DQ  R   L  F+ G + I+V TDVAA
Sbjct: 360 -VLVFASTKRTCDDITQYLRQDGWSALAIHGDKDQRERDWVLEEFKNGRSPIMVATDVAA 418

Query: 497 RGVDIPMLANVINYTLPGSSKIFVHRVGRTARAGNKGWAYSI 538
           RG+D+  +  VINY +PG+ + +VHR+GRT RAG KG A S 
Sbjct: 419 RGIDVKGINYVINYDMPGNIEDYVHRIGRTGRAGAKGTAISF 460

>Suva_8.257 Chr8 (461776..463632) [1857 bp, 618 aa] {ON} YOR204W
           (REAL)
          Length = 618

 Score =  202 bits (513), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 128/411 (31%), Positives = 203/411 (49%), Gaps = 71/411 (17%)

Query: 142 FPSFGLSKIVLNNIKRKGFRQPTPIQRKTIPLILQSRDIVGMARTGSGKTAAFILPMV-E 200
           F S  L +++L NIK   F +PTP+Q+ ++P++   RD++  A+TGSGKT  F+ P++ E
Sbjct: 151 FTSPPLDELLLENIKLARFTKPTPVQKYSVPIVANGRDLMACAQTGSGKTGGFLFPVLSE 210

Query: 201 KLKS------------HSGKIGARAVILSPSRELAMQTFNVFKDFARGTELRSVLLTGGD 248
             K+            +  K    AVI++P+RELA Q F+  K F   + +++ ++ GG 
Sbjct: 211 SFKTGPSPQPEAQGSFYQRKAYPTAVIMAPTRELATQIFDEAKKFTYRSWVKACVVYGGS 270

Query: 249 SLEEQFSMMMSNPDVIIATPGRFLHLKVEMNLDLKSVEYVVFDEADRLFEMGFQEQLNEL 308
            +  Q   +    D+++ATPGR   L     + L +V+Y+V DEADR+ +MGF+ Q+  +
Sbjct: 271 PIGNQLREIERGCDLLVATPGRLNDLLERGKISLANVKYLVLDEADRMLDMGFEPQIRHI 330

Query: 309 LASLPTT----RQTLLFSATLPNSLVDFVKAGLVNPVLVRLDAETKVSENLEMLFLSSKN 364
           +     T    RQTL+FSAT P  +    +  L + + + +      SEN+    L  +N
Sbjct: 331 VEDCDMTPVGERQTLMFSATFPADIQHLARDFLSDYIFLSVGRVGSTSENITQKVLYVEN 390

Query: 365 ADREANLLYILQEVIRIPLATSEQLLKLQKSTXXXXXXXXXXXXXXXXXXXXXXXXXXXX 424
            D+++ LL +L        AT++  L                                  
Sbjct: 391 QDKKSALLDLLS-------ATTDDGL---------------------------------- 409

Query: 425 XMPAANELPSEKATILFVPTRHHVEYISQLLRDCGYLISYIYGTLDQHARKNQLYNFRAG 484
                        T++FV T+   + ++  L    +  + I+G   Q  R+  L  FR+G
Sbjct: 410 -------------TLIFVETKRMADQLTDFLIMQNFRATAIHGDRTQSERERALAAFRSG 456

Query: 485 LTSILVVTDVAARGVDIPMLANVINYTLPGSSKIFVHRVGRTARAGNKGWA 535
             S+LV T VAARG+DIP + +VINY LP     +VHR+GRT RAGN G A
Sbjct: 457 AASLLVATAVAARGLDIPNVTHVINYDLPSDVDDYVHRIGRTGRAGNTGLA 507

>TDEL0B04060 Chr2 complement(724075..726618) [2544 bp, 847 aa] {ON}
           Anc_6.148 YBR237W
          Length = 847

 Score =  204 bits (520), Expect = 5e-54,   Method: Compositional matrix adjust.
 Identities = 123/400 (30%), Positives = 216/400 (54%), Gaps = 52/400 (13%)

Query: 150 IVLNNIKRKGFRQPTPIQRKTIPLILQSRDIVGMARTGSGKTAAFILPMVEKLKSH---- 205
            +++N+K   +  PTPIQ + IP I+  RD++G++RTGSGKT +++LP++ ++K+     
Sbjct: 271 FIMHNLK---YDSPTPIQSQAIPAIMSGRDVIGISRTGSGKTISYLLPLLRQIKAQRPLA 327

Query: 206 SGKIGARAVILSPSRELAMQTFNVFKDFARGT-ELRSVLLTGGDSLEEQFSMMMSNPDVI 264
           + + G   +IL+P+RELA+Q     + F +    + S+  TGG  L++Q +M+    +++
Sbjct: 328 TNETGPLGLILAPTRELALQIHEEVELFTKNDLAVNSLCCTGGSELKQQINMLKRGTEIV 387

Query: 265 IATPGRFLHLKVEMN----LDLKSVEYVVFDEADRLFEMGFQEQLNELLASLPTTRQTLL 320
           +ATPGRF+ L + +N    L  K + +VV DEADRLF++GF+ Q+ +++ ++   +Q +L
Sbjct: 388 VATPGRFIDL-LTLNTGKLLTTKRITFVVLDEADRLFDLGFEPQITQIMKTIRPDKQCVL 446

Query: 321 FSATLPNSLVDFVKAGLVNPVLVRLDAETKVSENLEMLF-LSSKNADREANLLYILQEVI 379
           FSAT PN L  F    L  P+ + ++++  V+EN++  F +   + ++   LL IL + +
Sbjct: 447 FSATFPNKLRSFAMRVLRLPLSITINSKNLVNENVKQRFEIFPTDENKYRALLSILDKRM 506

Query: 380 RIPLATSEQLLKLQKSTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMPAANELPSEKATI 439
           +      E  L                                     A +E+  +KA I
Sbjct: 507 KEEDENEESEL-------------------------------------ADDEVNDDKA-I 528

Query: 440 LFVPTRHHVEYISQLLRDCGYLISYIYGTLDQHARKNQLYNFRAGLTSILVVTDVAARGV 499
           +FV ++   +++   L + GY I  I+       R N L NFR    SIL+ T+V +RG+
Sbjct: 529 IFVSSQQICDFLGTRLENEGYSIHTIHAGKPYQERVNNLQNFRHTRNSILLCTEVLSRGL 588

Query: 500 DIPMLANVINYTLPGSSKIFVHRVGRTARAGNKGWAYSIV 539
           ++P ++ VI Y    +   +VH  GRTAR  N G A +++
Sbjct: 589 NVPEVSLVIIYNAVKTFAQYVHTAGRTARGTNSGEAITLL 628

>NCAS0C01720 Chr3 complement(317951..319873) [1923 bp, 640 aa] {ON}
           Anc_2.164 YNL112W
          Length = 640

 Score =  201 bits (511), Expect = 7e-54,   Method: Compositional matrix adjust.
 Identities = 128/409 (31%), Positives = 205/409 (50%), Gaps = 72/409 (17%)

Query: 147 LSKIVLNNIKRKGFRQPTPIQRKTIPLILQSRDIVGMARTGSGKTAAFILPMV-EKLKS- 204
           L +++L NIK   F +PTP+Q+ ++P++   RD++  A+TGSGKT  F+ P++ E  K+ 
Sbjct: 176 LDELLLENIKLARFTKPTPVQKYSVPIVENGRDLMACAQTGSGKTGGFLFPVLSESFKTG 235

Query: 205 -----------HSGKIGARAVILSPSRELAMQTFNVFKDFARGTELRSVLLTGGDSLEEQ 253
                      +S K    A+IL+P+RELA Q F+  K F   + +R  ++ GG  +  Q
Sbjct: 236 PSKTPEQGRNFYSKKGYPTALILAPTRELATQIFDEAKKFTYRSWVRPCVVYGGAPIGNQ 295

Query: 254 FSMMMSNPDVIIATPGRFLHLKVEMNLDLKSVEYVVFDEADRLFEMGFQEQLNELL--AS 311
              +    D+++ATPGR   L     + L ++ Y+V DEADR+ +MGF+ Q+ +++  + 
Sbjct: 296 MREVDHGCDLLVATPGRLTDLIDRGKISLANIRYLVLDEADRMLDMGFEPQIRQIVEGSD 355

Query: 312 LPTT--RQTLLFSATLPNSLVDFVKAGLVNPVLVRLDAETKVSENLEMLFLSSKNADREA 369
           +P    RQTL+FSAT P  +    +  L + + + +      SEN+  + L  ++ D+ +
Sbjct: 356 MPQVGDRQTLMFSATFPVDIQQLARDFLNDYIFLSVGRVGSTSENITQVILYVEDQDKYS 415

Query: 370 NLLYILQEVIRIPLATSEQLLKLQKSTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMPAA 429
            LL +L        AT++ L                                        
Sbjct: 416 ALLDLLA-------ATTDGL---------------------------------------- 428

Query: 430 NELPSEKATILFVPTRHHVEYISQLLRDCGYLISYIYGTLDQHARKNQLYNFRAGLTSIL 489
                   T++FV T+   + ++  L    +  + I+G   Q  R+  L  FRAG  +IL
Sbjct: 429 --------TLIFVETKRMADQLTDFLIMQNFKATAIHGDRTQQERERALSAFRAGTATIL 480

Query: 490 VVTDVAARGVDIPMLANVINYTLPGSSKIFVHRVGRTARAGNKGWAYSI 538
           V T VAARG+DIP + +VIN+ LPG    +VHR+GRT RAGN G A S 
Sbjct: 481 VATAVAARGLDIPNVTHVINFDLPGDIDDYVHRIGRTGRAGNTGVATSF 529

>NCAS0G02560 Chr7 (457574..458852,459621..460012) [1671 bp, 556 aa]
           {ON} Anc_2.164
          Length = 556

 Score =  199 bits (506), Expect = 7e-54,   Method: Compositional matrix adjust.
 Identities = 122/402 (30%), Positives = 198/402 (49%), Gaps = 56/402 (13%)

Query: 141 SFPSFGLSKIVLNNIKRKGFRQPTPIQRKTIPLILQSRDIVGMARTGSGKTAAFILPMVE 200
           +F   G    VLN +K +GF +PT IQ +  P+ L  RD++G+A TGSGKT ++ LP + 
Sbjct: 116 TFDEAGFPDYVLNEVKAEGFDKPTGIQCQGWPMALSGRDMIGVAATGSGKTLSYCLPGIV 175

Query: 201 KLKSH---SGKIGARAVILSPSRELAMQTFNVFKDFARGTELRSVLLTGGDSLEEQFSMM 257
            + +    +   G   ++L+P+RELA+Q       F   + +R+  + GG    +Q   +
Sbjct: 176 HINAQPLLAPGDGPIVLVLAPTRELAVQIQKECSKFGHSSRIRNTCVYGGVPRGQQIRDL 235

Query: 258 MSNPDVIIATPGRFLHLKVEMNLDLKSVEYVVFDEADRLFEMGFQEQLNELLASLPTTRQ 317
               +++IATPGR + +      +LK V Y+V DEADR+ +MGF+ Q+ +++  +   RQ
Sbjct: 236 SRGSEIVIATPGRLIDMLEIGKTNLKRVTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQ 295

Query: 318 TLLFSATLPNSLVDFVKAGLVNPVLVRLDA-ETKVSENLEMLFLSSKNADREANLLYILQ 376
           TL++SAT P  +       L +P+ V++ + E   S N+  L       ++   LL  L+
Sbjct: 296 TLMWSATWPKEVKQLASDYLNDPIQVQIGSLELSASHNITQLVEVVSEFEKRDRLLKHLE 355

Query: 377 EVIRIPLATSEQLLKLQKSTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMPAANELPSEK 436
                  A+ +Q                                              E 
Sbjct: 356 ------TASQDQ----------------------------------------------ES 363

Query: 437 ATILFVPTRHHVEYISQLLRDCGYLISYIYGTLDQHARKNQLYNFRAGLTSILVVTDVAA 496
             ++F  T+   + +++ LR+ G+    I+G  DQ  R   L  FR+G + I+V TDVAA
Sbjct: 364 KILIFASTKRTCDEVTKYLREDGWPALAIHGDKDQRERDWVLEEFRSGRSPIMVATDVAA 423

Query: 497 RGVDIPMLANVINYTLPGSSKIFVHRVGRTARAGNKGWAYSI 538
           RG+D+  +  VINY +PG+ + +VHR+GRT RAG  G A S 
Sbjct: 424 RGIDVKGINYVINYDMPGNIEDYVHRIGRTGRAGATGTAISF 465

>Kpol_1033.40 s1033 complement(104203..105795) [1593 bp, 530 aa]
           {ON} complement(104203..105795) [1593 nt, 531 aa]
          Length = 530

 Score =  198 bits (504), Expect = 8e-54,   Method: Compositional matrix adjust.
 Identities = 130/428 (30%), Positives = 211/428 (49%), Gaps = 58/428 (13%)

Query: 120 EDDVNEYFSTNNLEKQKHKKGSF-PSFGLSKIVLNN---IKRKGFRQPTPIQRKTIPLIL 175
           + +++E+F+TN +  +   K +  P    S I L++    +   F +PTPIQ  + P +L
Sbjct: 91  QSEIDEFFTTNEVAVEDESKLNLRPLLSFSHISLDSRIQAEISKFPKPTPIQAVSWPYLL 150

Query: 176 QSRDIVGMARTGSGKTAAFILPMVEKLKSHSG----KIGARAVILSPSRELAMQTFNVFK 231
             +D++G+A TGSGKT AF +P +  + + SG    K G + +I+SP+RELA Q ++   
Sbjct: 151 AGKDVIGVAETGSGKTFAFGVPAINNILTKSGSKPGKNGIQVLIISPTRELASQIYDNLV 210

Query: 232 DFARGTELRSVLLTGGDSLEEQFSMMMSNPDVIIATPGRFLHLKVEMNLDLKSVEYVVFD 291
                  L    + GG   +EQ + +  +  V++ATPGR L L  E   +L +V Y+V D
Sbjct: 211 ILTDKVGLECCCVYGGVPKDEQRTQLKRS-QVVVATPGRLLDLIQEGAANLSNVNYLVLD 269

Query: 292 EADRLFEMGFQEQLNELLASLPTT-RQTLLFSATLPNSLVDFVKAGLVNPVLVRLDAETK 350
           EADR+ E GF+E +  ++    +T RQTL+F+AT P  + +     + +P+ V +    +
Sbjct: 270 EADRMLEKGFEEDIKNIIRETKSTGRQTLMFTATWPKEVRELASTFMNSPIKVSIGNTDE 329

Query: 351 VSENLEMLFLSSKNADREANLLYILQEVIRIPLATSEQLLKLQKSTXXXXXXXXXXXXXX 410
           +S N            R   ++ ++      P     +LL+L K                
Sbjct: 330 LSAN-----------KRITQIVEVID-----PFKKERKLLELLKKYQSGSK--------- 364

Query: 411 XXXXXXXXXXXXXXXMPAANELPSEKATILFVPTRHHVEYISQLLRDCGYLISYIYGTLD 470
                                   +   ++F   +     + + L   GY +S I+G L 
Sbjct: 365 -----------------------KDDKVLIFALYKKEAARVERNLNYNGYKVSAIHGDLS 401

Query: 471 QHARKNQLYNFRAGLTSILVVTDVAARGVDIPMLANVINYTLPGSSKIFVHRVGRTARAG 530
           Q  R N L  F+ G +SIL+ TDVAARG+DIP +  VIN T P + + +VHR+GRT RAG
Sbjct: 402 QQQRTNALDEFKTGRSSILLATDVAARGLDIPNVKTVINLTFPLTVEDYVHRIGRTGRAG 461

Query: 531 NKGWAYSI 538
             G A+++
Sbjct: 462 KTGTAHTL 469

>KLLA0F01034g Chr6 (93422..95305) [1884 bp, 627 aa] {ON} similar to
           uniprot|P06634 Saccharomyces cerevisiae YOR204W DED1
           ATP-dependent DEAD (Asp-Glu-Ala-Asp)-box RNA helicase
           required for translation initiation of all yeast mRNAs
          Length = 627

 Score =  200 bits (508), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 127/411 (30%), Positives = 206/411 (50%), Gaps = 72/411 (17%)

Query: 142 FPSFGLSKIVLNNIKRKGFRQPTPIQRKTIPLILQSRDIVGMARTGSGKTAAFILPMVEK 201
           F S  L  ++L+NIK   F +PTP+Q+ ++P++   RD++  A+TGSGKT  F+ P++ +
Sbjct: 161 FHSPPLDPLLLDNIKLARFTKPTPVQKYSVPIVAAGRDLMACAQTGSGKTGGFLFPVLSE 220

Query: 202 L-------------KSHSGKIGARAVILSPSRELAMQTFNVFKDFARGTELRSVLLTGGD 248
                          S+  K+   AVIL+P+RELA Q ++  K F   + ++ +++ GG 
Sbjct: 221 SFSSGPASTPEAAGNSYIKKVYPTAVILAPTRELATQIYDEAKKFTYRSWVKPMVVYGGA 280

Query: 249 SLEEQFSMMMSNPDVIIATPGRFLHLKVEMNLDLKSVEYVVFDEADRLFEMGFQEQLNEL 308
           S++ Q   M    ++++ATPGR   L     + L +V+Y+V DEADR+ +MGF+ Q+  +
Sbjct: 281 SIDNQIKQMRYGCNLLVATPGRLTDLLERRYISLANVKYLVLDEADRMLDMGFEPQIRRI 340

Query: 309 L--ASLPTT--RQTLLFSATLPNSLVDFVKAGLVNPVLVRLDAETKVSENLEMLFLSSKN 364
           +  + +P+   RQTL+FSAT P+ +       L + V + +      SEN+    L  ++
Sbjct: 341 VEGSDMPSVDNRQTLMFSATFPSEIQHLASDFLKDYVFLSVGRVGSTSENITQKILYVED 400

Query: 365 ADREANLLYILQEVIRIPLATSEQLLKLQKSTXXXXXXXXXXXXXXXXXXXXXXXXXXXX 424
            D+   LL +L        A++E L                                   
Sbjct: 401 FDKNDTLLDLLA-------ASNEGL----------------------------------- 418

Query: 425 XMPAANELPSEKATILFVPTRHHVEYISQLLRDCGYLISYIYGTLDQHARKNQLYNFRAG 484
                        T++FV T+   + ++  L   G+  + I+G   Q  R+  L  F+ G
Sbjct: 419 -------------TLIFVETKRAADSLTDFLIMEGFKATAIHGDRTQGERERALSAFKTG 465

Query: 485 LTSILVVTDVAARGVDIPMLANVINYTLPGSSKIFVHRVGRTARAGNKGWA 535
             +ILV T VAARG+DIP + +VIN+ LP     +VHR+GRT RAGN G A
Sbjct: 466 RATILVATAVAARGLDIPNVTHVINFDLPNDIDDYVHRIGRTGRAGNTGVA 516

>CAGL0L02915g Chr12 complement(342831..344684) [1854 bp, 617 aa]
           {ON} highly similar to uniprot|P06634 Saccharomyces
           cerevisiae YOR204w DED1 ATP-dependent RNA helicase
          Length = 617

 Score =  198 bits (504), Expect = 4e-53,   Method: Compositional matrix adjust.
 Identities = 129/411 (31%), Positives = 203/411 (49%), Gaps = 72/411 (17%)

Query: 142 FPSFGLSKIVLNNIKRKGFRQPTPIQRKTIPLILQSRDIVGMARTGSGKTAAFILPMV-- 199
           F S  L  ++L NIK   F +PTP+Q+ ++P++ + RD++  A+TGSGKT  F+ P++  
Sbjct: 147 FTSPPLDSLLLENIKLARFTKPTPVQKYSVPIVSKGRDLMACAQTGSGKTGGFLFPVLSE 206

Query: 200 -------EKLK----SHSGKIGARAVILSPSRELAMQTFNVFKDFARGTELRSVLLTGGD 248
                  EK      S+  K    AV+++P+RELA Q F+  K F   + ++  ++ GG 
Sbjct: 207 SFLTGPAEKAANDGYSYQRKAFPTAVVMAPTRELATQIFDEAKKFCYRSWVKPCVVYGGA 266

Query: 249 SLEEQFSMMMSNPDVIIATPGRFLHLKVEMNLDLKSVEYVVFDEADRLFEMGFQEQLNEL 308
            +  Q   M    D+++ATPGR   L     + L +V+Y+V DEADR+ +MGF+ Q+  +
Sbjct: 267 PIGNQMREMDHGCDLLVATPGRLNDLLERGKVSLSNVKYLVLDEADRMLDMGFEPQIRHI 326

Query: 309 L--ASLPTT--RQTLLFSATLPNSLVDFVKAGLVNPVLVRLDAETKVSENLEMLFLSSKN 364
           +    +P T  RQTL+FSAT P+ +    +  L + + + +      SEN+    L  +N
Sbjct: 327 VEDCDMPPTGERQTLMFSATFPHDIQHLARDFLHDYIFLSVGRVGSTSENITQRILYVEN 386

Query: 365 ADREANLLYILQEVIRIPLATSEQLLKLQKSTXXXXXXXXXXXXXXXXXXXXXXXXXXXX 424
            D+ +                   LL L                                
Sbjct: 387 RDKNS------------------ALLDL-------------------------------- 396

Query: 425 XMPAANELPSEKATILFVPTRHHVEYISQLLRDCGYLISYIYGTLDQHARKNQLYNFRAG 484
            + A+N+      T++FV T+   + ++  L    +  + I+G   Q  R+  L  FR+G
Sbjct: 397 -LAASND----NLTLIFVETKRMADQLTDFLIMQNFSATAIHGDRSQAERERALAAFRSG 451

Query: 485 LTSILVVTDVAARGVDIPMLANVINYTLPGSSKIFVHRVGRTARAGNKGWA 535
             +ILV T VAARG+DIP + +VINY LP     +VHR+GRT RAGN G A
Sbjct: 452 RANILVATAVAARGLDIPNVTHVINYDLPSDVDDYVHRIGRTGRAGNTGVA 502

>NDAI0E01590 Chr5 complement(315658..317484) [1827 bp, 608 aa] {ON} 
          Length = 608

 Score =  197 bits (502), Expect = 5e-53,   Method: Compositional matrix adjust.
 Identities = 127/410 (30%), Positives = 200/410 (48%), Gaps = 71/410 (17%)

Query: 142 FPSFGLSKIVLNNIKRKGFRQPTPIQRKTIPLILQSRDIVGMARTGSGKTAAFILPMV-E 200
           F S  L +++L NI+   F +PTP+Q+ +IP++   RD++  A+TGSGKT  F+ P++ E
Sbjct: 137 FTSPPLDELLLENIQLARFTKPTPVQKYSIPIVAAGRDLMACAQTGSGKTGGFLFPVLSE 196

Query: 201 KLKS-----------HSGKIGARAVILSPSRELAMQTFNVFKDFARGTELRSVLLTGGDS 249
             K+           +  K    AV+++P+RELA Q F+  K F   + ++  +  GG  
Sbjct: 197 SFKTGPTATHDQGSYYQKKAFPTAVVMAPTRELATQIFDEAKKFCYRSWVQPCVAYGGAP 256

Query: 250 LEEQFSMMMSNPDVIIATPGRFLHLKVEMNLDLKSVEYVVFDEADRLFEMGFQEQLNELL 309
           +  Q   M    D+++ATPGR   L     + L +V+Y+V DEADR+ +MGF+ Q+  ++
Sbjct: 257 IGNQMREMDRGCDLLVATPGRLSDLIDRGKISLSNVKYLVLDEADRMLDMGFEPQIRAIV 316

Query: 310 ASLPTT----RQTLLFSATLPNSLVDFVKAGLVNPVLVRLDAETKVSENLEMLFLSSKNA 365
                T    RQTL+FSAT P  +    +  L + + + +      SEN+    L  +N 
Sbjct: 317 EGADMTPVGERQTLMFSATFPADIQHLARDFLADYIFLSVGRVGSTSENITQRVLYVENQ 376

Query: 366 DREANLLYILQEVIRIPLATSEQLLKLQKSTXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 425
           D+++ LL +        L+ SE  L L                                 
Sbjct: 377 DKKSALLDL--------LSASEDGLTL--------------------------------- 395

Query: 426 MPAANELPSEKATILFVPTRHHVEYISQLLRDCGYLISYIYGTLDQHARKNQLYNFRAGL 485
                         +FV T+   + ++  L    +  + I+G   Q  R+  L  F++G 
Sbjct: 396 --------------IFVETKRMADQLTDFLIMQNFRATAIHGDRTQAERERALAAFKSGA 441

Query: 486 TSILVVTDVAARGVDIPMLANVINYTLPGSSKIFVHRVGRTARAGNKGWA 535
            ++LV T VAARG+DIP + +VINY LPG    +VHR+GRT RAGN G A
Sbjct: 442 ATLLVATAVAARGLDIPNVTHVINYDLPGDIDDYVHRIGRTGRAGNTGIA 491

>ADL273C Chr4 complement(225068..226939) [1872 bp, 623 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOR204W
           (DED1) and YPL119C (DBP1)
          Length = 623

 Score =  197 bits (502), Expect = 8e-53,   Method: Compositional matrix adjust.
 Identities = 130/410 (31%), Positives = 201/410 (49%), Gaps = 71/410 (17%)

Query: 142 FPSFGLSKIVLNNIKRKGFRQPTPIQRKTIPLILQSRDIVGMARTGSGKTAAFILPMVEK 201
           F S  L +++L NIK   F +PTP+Q+ ++P++ + RD++  A+TGSGKT  F+ P++ +
Sbjct: 148 FTSPPLDELLLENIKLARFTKPTPVQKYSVPIVAKGRDLMACAQTGSGKTGGFLFPVLSQ 207

Query: 202 LKSH--------SG----KIGARAVILSPSRELAMQTFNVFKDFARGTELRSVLLTGGDS 249
             S+        SG    K    AV+L+P+RELA Q F+  K F   + ++  ++ GG  
Sbjct: 208 SFSNGPASTPDESGYYMRKAYPTAVVLAPTRELATQIFDEAKKFTYRSWVKPCVVYGGAD 267

Query: 250 LEEQFSMMMSNPDVIIATPGRFLHLKVEMNLDLKSVEYVVFDEADRLFEMGFQEQLNELL 309
           + +Q   +    D+I+ATPGR   L     + L SV+Y+V DEADR+ +MGF+ Q+  ++
Sbjct: 268 IRQQIRELERGCDLIVATPGRLNDLLERGKISLCSVKYLVLDEADRMLDMGFEPQIRHIV 327

Query: 310 --ASLPTT--RQTLLFSATLPNSLVDFVKAGLVNPVLVRLDAETKVSENLEMLFLSSKNA 365
               +PT   RQTL+FSAT P  +       L + + + +      SEN+    L  ++ 
Sbjct: 328 EGCDMPTVENRQTLMFSATFPTDIQHLAADFLKDYIFLSVGRVGSTSENITQKVLHVEDI 387

Query: 366 DREANLLYILQEVIRIPLATSEQLLKLQKSTXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 425
           D+ + LL +        LA S+  L L                                 
Sbjct: 388 DKRSVLLDL--------LAASDGGLTL--------------------------------- 406

Query: 426 MPAANELPSEKATILFVPTRHHVEYISQLLRDCGYLISYIYGTLDQHARKNQLYNFRAGL 485
                         +FV T+   + ++  L       + I+G   Q  R+  L  FR G 
Sbjct: 407 --------------VFVETKRMADALTDFLIMQNLSATAIHGDRTQAERERALAFFRTGR 452

Query: 486 TSILVVTDVAARGVDIPMLANVINYTLPGSSKIFVHRVGRTARAGNKGWA 535
            ++LV T VAARG+DIP + +VINY LP     +VHR+GRT RAGN G A
Sbjct: 453 ANVLVATAVAARGLDIPNVTHVINYDLPSDIDDYVHRIGRTGRAGNTGLA 502

>Kwal_14.1653 s14 complement(406891..408957) [2067 bp, 688 aa] {ON}
           YBR237W (PRP5) - 1:1 [contig 238] PARTIAL
          Length = 688

 Score =  199 bits (505), Expect = 8e-53,   Method: Compositional matrix adjust.
 Identities = 125/411 (30%), Positives = 214/411 (52%), Gaps = 61/411 (14%)

Query: 142 FPSFGLSKIVLNNIKRK-GFRQPTPIQRKTIPLILQSRDIVGMARTGSGKTAAFILPMVE 200
           +   GL+  ++N I     F  PTPIQ + IP I+  RD++G+++TGSGKT +F+LPM+ 
Sbjct: 109 WSQLGLTTDIMNLITNDFKFESPTPIQAQAIPAIMTGRDVIGISKTGSGKTVSFLLPMLR 168

Query: 201 KLKS-------HSGKIGARAVILSPSRELAMQTFNVFKDFARG-TELRSVLLTGGDSLEE 252
           ++K+        SG +G   +IL+P+RELA+Q       F +G T LRS+  TGG  L++
Sbjct: 169 QIKALRPLAREESGPLG---LILAPTRELAVQIHEESMKFLKGNTRLRSICCTGGSELKQ 225

Query: 253 QFSMMMSNPDVIIATPGRFLHLKVEMN----LDLKSVEYVVFDEADRLFEMGFQEQLNEL 308
           Q + +    ++++ATPGRF+ L + +N    ++ + + +VV DEADRLF++GF+ Q+ E+
Sbjct: 226 QINDLKKGVEIVVATPGRFIDL-LTLNSGKLINTERITFVVMDEADRLFDLGFEPQITEI 284

Query: 309 LASLPTTRQTLLFSATLPNSLVDFVKAGLVNPVLVRLDAETKVSENLEMLFLSSKNADRE 368
           + ++   +Q +LFSAT P+ L  F    L  PV + +++++ ++EN+E      +N + +
Sbjct: 285 MKTVRPDKQCVLFSATFPSKLKSFASRILHTPVSITINSKSLINENIEQKLQIHENDEEK 344

Query: 369 ANLLYILQEVIRIPLATSEQLLKLQKSTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMPA 428
            N L               ++LK Q +                                A
Sbjct: 345 FNSLL--------------EVLKAQINRE------------------------------A 360

Query: 429 ANELPSEKATILFVPTRHHVEYISQLLRDCGYLISYIYGTLDQHARKNQLYNFRAGLTSI 488
            +    ++ TI+FV ++   + I   L D  Y    I+     H R + L  F+     I
Sbjct: 361 ESHDDKDEKTIIFVSSQQICDLIYLKLLDHNYTTYAIHAGKPYHERASNLEKFKNTRNGI 420

Query: 489 LVVTDVAARGVDIPMLANVINYTLPGSSKIFVHRVGRTARAGNKGWAYSIV 539
           L+ T+V +RG+++P ++ V+ Y    +   +VH  GRTAR   KG A S++
Sbjct: 421 LLCTEVLSRGLNVPEVSLVVIYNAVKTFAQYVHTTGRTARGDKKGTAISLL 471

>NDAI0F02010 Chr6 (492540..495206) [2667 bp, 888 aa] {ON} Anc_6.148
          Length = 888

 Score =  201 bits (512), Expect = 9e-53,   Method: Compositional matrix adjust.
 Identities = 119/405 (29%), Positives = 218/405 (53%), Gaps = 45/405 (11%)

Query: 145 FGLSKIVLNNIKRK-GFRQPTPIQRKTIPLILQSRDIVGMARTGSGKTAAFILPMVEKLK 203
            GL+  V++ I +  GFR  TPIQ + IP I+   D++G+++TGSGKT +++LP++  +K
Sbjct: 291 LGLNTDVMDLITKDFGFRSLTPIQSQAIPAIMDGHDVIGISKTGSGKTISYLLPLIRHIK 350

Query: 204 SHS----GKIGARAVILSPSRELAMQTFN-VFKDFARGTELRSVLLTGGDSLEEQFSMMM 258
           + +     + G   +IL+P+RELA+Q    + K  +  T + S+  TGG  L++Q + + 
Sbjct: 351 AQNPLMKNETGPLGLILAPTRELALQIHQEIIKFISTDTAITSICCTGGSELKQQINSLK 410

Query: 259 SNPDVIIATPGRFLHLKVEMN---LDLKSVEYVVFDEADRLFEMGFQEQLNELLASLPTT 315
               +++ATPGR + L    N   + +K V +V+ DEADRLF++GF+ Q+ +++ ++   
Sbjct: 411 KGVHIVVATPGRLIDLLTLNNGRLMSIKRVTFVIMDEADRLFDLGFEPQITQIMKTIRPD 470

Query: 316 RQTLLFSATLPNSLVDFVKAGLVNPVLVRLDAETKVSENLEMLF-LSSKNADREANLLYI 374
           +Q +LFSAT PN L +F    L +P+ + +++++ V+E ++  F + + + ++   LL +
Sbjct: 471 KQCVLFSATFPNKLRNFAMRILRDPLSITINSQSLVNERVQQRFHICANDEEKFDELLAM 530

Query: 375 LQEVIRIPLATSEQLLKLQKSTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMPAANELPS 434
           ++E    P+ T++ L K ++                                      P 
Sbjct: 531 IEENSSEPIETTD-LGKEEEE----------------------------------EHTPQ 555

Query: 435 EKATILFVPTRHHVEYISQLLRDCGYLISYIYGTLDQHARKNQLYNFRAGLTSILVVTDV 494
           ++ TI+FV ++   ++I   L + GY    I+       R   L NF++   SILV T+V
Sbjct: 556 DRKTIIFVASQQICDFIGTKLENEGYQPFSIHAGKSYQERVQNLENFKSTKNSILVATEV 615

Query: 495 AARGVDIPMLANVINYTLPGSSKIFVHRVGRTARAGNKGWAYSIV 539
            +RG++I  ++ VI +    +   +VH  GRTAR  + G A S++
Sbjct: 616 LSRGLNITEVSLVIIFNAVKTFAQYVHTTGRTARGNHSGVAISLI 660

>Skud_7.204 Chr7 complement(363553..365103) [1551 bp, 516 aa] {ON}
           YGL078C (REAL)
          Length = 516

 Score =  194 bits (494), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 129/423 (30%), Positives = 207/423 (48%), Gaps = 58/423 (13%)

Query: 123 VNEYFSTNNLEKQ------KHKKGSFPSFGLSKIVLNNIKRKGFRQPTPIQRKTIPLILQ 176
           V+EYF  N +  +           SF    L+  +   I +  F  PTPIQ    P +L 
Sbjct: 84  VDEYFKENEVAVEDPLNLNLRPLLSFDYLSLNPSIQAEISK--FPTPTPIQAVAWPYLLS 141

Query: 177 SRDIVGMARTGSGKTAAFILPMVEKLKSHSGKIGARAVILSPSRELAMQTFNVFKDFARG 236
            +D+VG+A TGSGKT AF +P +  L +  GK G + +++SP+RELA Q ++        
Sbjct: 142 GKDVVGVAETGSGKTFAFGVPAISHLMNDQGKRGIQVLVISPTRELASQIYDNLIILTDK 201

Query: 237 TELRSVLLTGGDSLEEQFSMMMSNPDVIIATPGRFLHLKVEMNLDLKSVEYVVFDEADRL 296
             ++   + GG   +EQ + +  +  V++ATPGR L L  E ++DL  V Y+V DEADR+
Sbjct: 202 VGMQCCCVYGGVPKDEQRNQLKRS-QVVVATPGRLLDLLQEGSVDLSQVNYLVLDEADRM 260

Query: 297 FEMGFQEQLNELLASLPTT-RQTLLFSATLPNSLVDFVKAGLVNPVLVRLDAETKVSENL 355
            E GF+E +  ++     + RQTL+F+AT P  + +     + NP+ V +    +++ N 
Sbjct: 261 LEKGFEEDIRNIIRETDASKRQTLMFTATWPKEVRELASTFMKNPIKVSIGNTDQLTANK 320

Query: 356 EMLFLSSKNADREANLLYILQEVIRIPLATSEQLLKLQKSTXXXXXXXXXXXXXXXXXXX 415
           ++  +                EV+  P     +LL+L K                     
Sbjct: 321 KITQIV---------------EVVD-PRGKERKLLELLKKYHSG---------------- 348

Query: 416 XXXXXXXXXXMPAANELPSEKATILFVPTRHHVEYISQLLRDCGYLISYIYGTLDQHARK 475
                      P  NE       ++F   +     + + L+  GY ++ I+G L Q  R 
Sbjct: 349 -----------PKKNE-----KVLIFALYKKEATRVERNLKYNGYDVAAIHGDLSQQQRT 392

Query: 476 NQLYNFRAGLTSILVVTDVAARGVDIPMLANVINYTLPGSSKIFVHRVGRTARAGNKGWA 535
             L  F++G +++L+ TDVAARG+DIP +  VIN T P + + +VHR+GRT RAG  G A
Sbjct: 393 QALNEFKSGKSNLLLATDVAARGLDIPNVKTVINLTFPLTVEDYVHRIGRTGRAGQTGTA 452

Query: 536 YSI 538
           +++
Sbjct: 453 HTL 455

>KAFR0H02820 Chr8 (537121..538956) [1836 bp, 611 aa] {ON} Anc_8.614
           YOR204W
          Length = 611

 Score =  196 bits (499), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 128/414 (30%), Positives = 202/414 (48%), Gaps = 72/414 (17%)

Query: 142 FPSFGLSKIVLNNIKRKGFRQPTPIQRKTIPLILQSRDIVGMARTGSGKTAAFILPMV-- 199
           F S  L +++L NIK   F +PTP+Q+ +IP++ ++RD++G A+TGSGKT  F+ P++  
Sbjct: 139 FTSPPLEELLLENIKLARFTKPTPVQKYSIPIVSKNRDLMGCAQTGSGKTGGFLFPILSE 198

Query: 200 ----------EKLKSHSGKIG-ARAVILSPSRELAMQTFNVFKDFARGTELRSVLLTGGD 248
                     +K ++H  + G   A++L+P+RELA Q F   + F   + +R  ++ GG 
Sbjct: 199 MFINGPLNVPDKSRNHYMRKGYPTALVLAPTRELATQIFEESRKFTYRSWVRPCVVYGGA 258

Query: 249 SLEEQFSMMMSNPDVIIATPGRFLHLKVEMNLDLKSVEYVVFDEADRLFEMGFQEQLNEL 308
            +  Q   +    D+++ATPGR   L     + L +V Y++ DEADR+ +MGF+ Q+  +
Sbjct: 259 PIGNQMRELDRGCDLLVATPGRLNDLLERGKISLMNVRYLILDEADRMLDMGFEPQIRHI 318

Query: 309 L--ASLPTT--RQTLLFSATLPNSLVDFVKAGLVNPVLVRLDAETKVSENLEMLFLSSKN 364
           +    +P    RQTL+FSAT P  +    +  L N V + +      SEN+    +  ++
Sbjct: 319 VEDCDMPEVQDRQTLMFSATFPRDIQHLARDFLKNYVFLSVGRVGSTSENITQKIIMVED 378

Query: 365 ADREANLLYILQEVIRIPLATSEQLLKLQKSTXXXXXXXXXXXXXXXXXXXXXXXXXXXX 424
            D+++ LL                LL  Q                               
Sbjct: 379 MDKKSALL---------------DLLAYQH------------------------------ 393

Query: 425 XMPAANELPSEKATILFVPTRHHVEYISQLLRDCGYLISYIYGTLDQHARKNQLYNFRAG 484
                     E  T++FV T+   + ++  L    +  + I+G   Q  R+  L  F+AG
Sbjct: 394 ----------EGLTLIFVETKRMADQLTDFLIMQNFNATAIHGDRTQEERERALGAFKAG 443

Query: 485 LTSILVVTDVAARGVDIPMLANVINYTLPGSSKIFVHRVGRTARAGNKGWAYSI 538
              ILV T VAARG+DIP +  VIN+ LP     +VHR+GRT RAGN G A S 
Sbjct: 444 RADILVATAVAARGLDIPNVTLVINFDLPSDIDDYVHRIGRTGRAGNTGVAISF 497

>YGL078C Chr7 complement(360288..361859) [1572 bp, 523 aa] {ON}
           DBP3RNA-Dependent ATPase, member of DExD/H-box family;
           involved in cleavage of site A3 within the ITS1 spacer
           during rRNA processing; not essential for growth, but
           deletion causes severe slow-growth phenotype
          Length = 523

 Score =  194 bits (493), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 128/426 (30%), Positives = 207/426 (48%), Gaps = 58/426 (13%)

Query: 120 EDDVNEYFSTN------NLEKQKHKKGSFPSFGLSKIVLNNIKRKGFRQPTPIQRKTIPL 173
           + D++EYF  N      +L+       SF    L   +   I +  F +PTPIQ    P 
Sbjct: 88  QSDIDEYFKENEIAVEDSLDLALRPLLSFDYLSLDSSIQAEISK--FPKPTPIQAVAWPY 145

Query: 174 ILQSRDIVGMARTGSGKTAAFILPMVEKLKSHSGKIGARAVILSPSRELAMQTFNVFKDF 233
           +L  +D+VG+A TGSGKT AF +P +  L +   K G + +++SP+RELA Q ++     
Sbjct: 146 LLSGKDVVGVAETGSGKTFAFGVPAISHLMNDQKKRGIQVLVISPTRELASQIYDNLIVL 205

Query: 234 ARGTELRSVLLTGGDSLEEQFSMMMSNPDVIIATPGRFLHLKVEMNLDLKSVEYVVFDEA 293
                ++   + GG   +EQ  + +    V++ATPGR L L  E ++DL  V Y+V DEA
Sbjct: 206 TDKVGMQCCCVYGGVPKDEQ-RIQLKKSQVVVATPGRLLDLLQEGSVDLSQVNYLVLDEA 264

Query: 294 DRLFEMGFQEQLNELLASLPTT-RQTLLFSATLPNSLVDFVKAGLVNPVLVRLDAETKVS 352
           DR+ E GF+E +  ++     + RQTL+F+AT P  + +     + NP+ V +    +++
Sbjct: 265 DRMLEKGFEEDIKNIIRETDASKRQTLMFTATWPKEVRELASTFMNNPIKVSIGNTDQLT 324

Query: 353 ENLEMLFLSSKNADREANLLYILQEVIRIPLATSEQLLKLQKSTXXXXXXXXXXXXXXXX 412
            N            R   ++ ++      P     +LL+L K                  
Sbjct: 325 AN-----------KRITQIVEVVD-----PRGKERKLLELLKKYHSG------------- 355

Query: 413 XXXXXXXXXXXXXMPAANELPSEKATILFVPTRHHVEYISQLLRDCGYLISYIYGTLDQH 472
                         P  NE       ++F   +     + + L+  GY ++ I+G L Q 
Sbjct: 356 --------------PKKNE-----KVLIFALYKKEAARVERNLKYNGYNVAAIHGDLSQQ 396

Query: 473 ARKNQLYNFRAGLTSILVVTDVAARGVDIPMLANVINYTLPGSSKIFVHRVGRTARAGNK 532
            R   L  F++G +++L+ TDVAARG+DIP +  VIN T P + + +VHR+GRT RAG  
Sbjct: 397 QRTQALNEFKSGKSNLLLATDVAARGLDIPNVKTVINLTFPLTVEDYVHRIGRTGRAGQT 456

Query: 533 GWAYSI 538
           G A+++
Sbjct: 457 GTAHTL 462

>KNAG0H01520 Chr8 complement(267709..269574) [1866 bp, 621 aa] {ON}
           Anc_8.614 YOR204W
          Length = 621

 Score =  196 bits (497), Expect = 3e-52,   Method: Compositional matrix adjust.
 Identities = 123/416 (29%), Positives = 199/416 (47%), Gaps = 74/416 (17%)

Query: 142 FPSFGLSKIVLNNIKRKGFRQPTPIQRKTIPLILQSRDIVGMARTGSGKTAAFILPMVEK 201
           F S  L +++ +N++R GF +PTP+Q+ +IP++   RD++G A+TGSGKT  F+ P++ +
Sbjct: 138 FTSPPLEQLLFDNVQRAGFSKPTPVQKYSIPIVTAGRDLMGCAQTGSGKTGGFLFPILSE 197

Query: 202 L---------------KSHSGKIGARAVILSPSRELAMQTFNVFKDFARGTELRSVLLTG 246
           +                S+  K+   A++L+P+RELA Q F   + F   + +R  ++ G
Sbjct: 198 MFTAGPAPKPQAASGGYSYQRKVYPTALVLAPTRELATQIFEEARKFTYRSWVRPCVVYG 257

Query: 247 GDSLEEQFSMMMSNPDVIIATPGRFLHLKVEMNLDLKSVEYVVFDEADRLFEMGFQEQLN 306
           G  +  Q   +    D+++ATPGR   L     + L +++Y+  DEADR+ +MGF+ Q+ 
Sbjct: 258 GAPVGAQMGELERGCDLLVATPGRLNDLLERGKISLANIKYLTLDEADRMLDMGFEPQIR 317

Query: 307 ELL--ASLPTT--RQTLLFSATLPNSLVDFVKAGLVNPVLVRLDAETKVSENLEMLFLSS 362
            ++    +P    RQTL+FSAT P  +    +  L + + + +      SEN+    L  
Sbjct: 318 HIVEDCDMPPVNERQTLMFSATFPRDIQHLARDFLNDYIFLSVGRVGSTSENITQKVLYV 377

Query: 363 KNADREANLLYILQEVIRIPLATSEQLLKLQKSTXXXXXXXXXXXXXXXXXXXXXXXXXX 422
            + D+++                   LL L  ST                          
Sbjct: 378 DDMDKKS------------------ALLDLLSSTKG------------------------ 395

Query: 423 XXXMPAANELPSEKATILFVPTRHHVEYISQLLRDCGYLISYIYGTLDQHARKNQLYNFR 482
                          T++FV T+   + ++  L       + I+G   Q  R+  L  F+
Sbjct: 396 -------------GLTLIFVETKRMADQLTDFLIMQNIRATAIHGDRTQMERERALGAFK 442

Query: 483 AGLTSILVVTDVAARGVDIPMLANVINYTLPGSSKIFVHRVGRTARAGNKGWAYSI 538
           +G   +LV T VAARG+DIP +  VINY LPG    +VHR+GRT RAGN G A S 
Sbjct: 443 SGTADVLVATAVAARGLDIPNVTLVINYDLPGDIDDYVHRIGRTGRAGNTGTAISF 498

>Smik_7.205 Chr7 complement(354693..356261) [1569 bp, 522 aa] {ON}
           YGL078C (REAL)
          Length = 522

 Score =  193 bits (491), Expect = 3e-52,   Method: Compositional matrix adjust.
 Identities = 129/424 (30%), Positives = 208/424 (49%), Gaps = 58/424 (13%)

Query: 122 DVNEYFSTNNLEKQKHKKG------SFPSFGLSKIVLNNIKRKGFRQPTPIQRKTIPLIL 175
           +V+EYF  N +  +           SF    L   +   I +  F +PTPIQ    P +L
Sbjct: 89  EVDEYFKENEVAVEDPSNLNLRPLLSFDYLSLDPSIQAEISK--FPKPTPIQAVAWPYLL 146

Query: 176 QSRDIVGMARTGSGKTAAFILPMVEKLKSHSGKIGARAVILSPSRELAMQTFNVFKDFAR 235
             +D+VG+A TGSGKT AF +P +  L +   K G + +++SP+RELA Q ++       
Sbjct: 147 SGKDVVGVAETGSGKTFAFGVPAISHLMNDQKKRGIQVLVISPTRELASQIYDNLIILTD 206

Query: 236 GTELRSVLLTGGDSLEEQFSMMMSNPDVIIATPGRFLHLKVEMNLDLKSVEYVVFDEADR 295
              ++   + GG   +EQ + +  +  V++ATPGR L L  E ++DL  V Y+V DEADR
Sbjct: 207 KVGMQCCCVYGGVPKDEQRNQLKKS-QVVVATPGRLLDLLQEGSVDLSQVNYLVLDEADR 265

Query: 296 LFEMGFQEQLNELLASLPTT-RQTLLFSATLPNSLVDFVKAGLVNPVLVRLDAETKVSEN 354
           + E GF+E +  ++     + RQTL+F+AT P  + +     + NP+ V +    +++ N
Sbjct: 266 MLEKGFEEDIKNIIRETNVSKRQTLMFTATWPKEVRELASTFMKNPIKVSIGNTDQLTAN 325

Query: 355 LEMLFLSSKNADREANLLYILQEVIRIPLATSEQLLKLQKSTXXXXXXXXXXXXXXXXXX 414
            ++  +                EV+  P A   +LL+L K                    
Sbjct: 326 KKITQIV---------------EVVD-PRAKERKLLELLKKYHSG--------------- 354

Query: 415 XXXXXXXXXXXMPAANELPSEKATILFVPTRHHVEYISQLLRDCGYLISYIYGTLDQHAR 474
                       P  NE       ++F   +     + + L+  GY ++ I+G L Q  R
Sbjct: 355 ------------PKKNE-----KVLIFALYKKEAARVERNLKYNGYSVAAIHGDLSQQQR 397

Query: 475 KNQLYNFRAGLTSILVVTDVAARGVDIPMLANVINYTLPGSSKIFVHRVGRTARAGNKGW 534
              L  F++G +++L+ TDVAARG+DIP +  VIN T P + + +VHR+GRT RAG  G 
Sbjct: 398 TQALNEFKSGKSNLLLATDVAARGLDIPNVKTVINLTFPLTVEDYVHRIGRTGRAGQTGT 457

Query: 535 AYSI 538
           A+++
Sbjct: 458 AHTL 461

>Ecym_5422 Chr5 complement(868686..869065,869897..871199) [1683 bp,
           560 aa] {ON} similar to Ashbya gossypii AFL221C
          Length = 560

 Score =  194 bits (493), Expect = 4e-52,   Method: Compositional matrix adjust.
 Identities = 122/400 (30%), Positives = 201/400 (50%), Gaps = 54/400 (13%)

Query: 141 SFPSFGLSKIVLNNIKRKGFRQPTPIQRKTIPLILQSRDIVGMARTGSGKTAAFILPMVE 200
           +F   G  + VL  +K +GF +PT IQ +  P+ L  RD++G+A TGSGKT ++ LP + 
Sbjct: 124 TFDEAGFPEYVLKEVKEEGFDKPTAIQCQGWPMALSGRDMIGVAATGSGKTLSYCLPGIV 183

Query: 201 KLKSH---SGKIGARAVILSPSRELAMQTFNVFKDFARGTELRSVLLTGGDSLEEQFSMM 257
            + +    S   G   ++L+P+RELA+Q       F   + +R+  + GG    +Q   +
Sbjct: 184 HINAQPLLSPGDGPIVLVLAPTRELAVQIQKECSKFGHSSRIRNTCVYGGVPKSQQIRDL 243

Query: 258 MSNPDVIIATPGRFLHLKVEMNLDLKSVEYVVFDEADRLFEMGFQEQLNELLASLPTTRQ 317
               +++IATPGR + +      +LK V Y+V DEADR+ +MGF+ Q+ +++  +   RQ
Sbjct: 244 QRGVEILIATPGRLIDMLEIGKTNLKRVTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQ 303

Query: 318 TLLFSATLPNSLVDFVKAGLVNPVLVRLDAETKVSENLEMLFLSSKNADREANLLYILQE 377
           TL++SAT P  +    +  L +P+ V          N+  L L++          + + +
Sbjct: 304 TLMWSATWPKEVQQLARDYLHDPIQV----------NIGSLELAAS---------HTITQ 344

Query: 378 VIRIPLATSEQLLKLQKSTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMPAANELPSEKA 437
           ++ + ++  E+  +L K                               +  A++ P  K 
Sbjct: 345 IVEV-ISDFEKRDRLVKH------------------------------LDIASKDPESK- 372

Query: 438 TILFVPTRHHVEYISQLLRDCGYLISYIYGTLDQHARKNQLYNFRAGLTSILVVTDVAAR 497
            I+F  T+   + I+  LR  G+    I+G   Q  R   L  FR G + I+V TDVAAR
Sbjct: 373 IIIFASTKRTCDDITSYLRQDGWPALAIHGDKQQQERDWVLNEFRCGRSPIMVATDVAAR 432

Query: 498 GVDIPMLANVINYTLPGSSKIFVHRVGRTARAGNKGWAYS 537
           G+D+  +  VINY +PG+ + +VHR+GRT RAG  G A S
Sbjct: 433 GIDVKGINFVINYDMPGNIEDYVHRIGRTGRAGATGTAIS 472

>KLTH0D09328g Chr4 complement(773449..773837,774557..775823) [1656
           bp, 551 aa] {ON} similar to uniprot|P24783 Saccharomyces
           cerevisiae YNL112W DBP2 Essential ATP-dependent RNA
           helicase of the DEAD-box protein family involved in
           nonsense-mediated mRNA decay and rRNA processing
          Length = 551

 Score =  193 bits (490), Expect = 7e-52,   Method: Compositional matrix adjust.
 Identities = 122/402 (30%), Positives = 196/402 (48%), Gaps = 56/402 (13%)

Query: 141 SFPSFGLSKIVLNNIKRKGFRQPTPIQRKTIPLILQSRDIVGMARTGSGKTAAFILPMVE 200
           +F   G  + VL+ +K +GF +PT IQ +  P+ L  RD++G+A TGSGKT ++ LP + 
Sbjct: 112 TFDEAGFPEYVLSEVKAEGFEKPTGIQCQGWPMALSGRDMIGVAATGSGKTLSYCLPGIV 171

Query: 201 KLKSH---SGKIGARAVILSPSRELAMQTFNVFKDFARGTELRSVLLTGGDSLEEQFSMM 257
            + +    S   G   ++L+P+RELA+Q       F + + +R+  + GG     Q   +
Sbjct: 172 HINAQPLLSPGDGPIVLVLAPTRELAVQIQTECSKFGKSSRIRNTCVYGGVPRGHQIREL 231

Query: 258 MSNPDVIIATPGRFLHLKVEMNLDLKSVEYVVFDEADRLFEMGFQEQLNELLASLPTTRQ 317
               +++IATPGR + +      +LK V Y+V DEADR+ +MGF+ Q+ +++  +   RQ
Sbjct: 232 TRGAEIVIATPGRLIDMLEIGKTNLKRVTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQ 291

Query: 318 TLLFSATLPNSLVDFVKAGLVNPVLVRLDA-ETKVSENLEMLFLSSKNADREANLLYILQ 376
           TL++SAT P  +    +  L +P+ V + + E   S N+  +     + ++   LL  L+
Sbjct: 292 TLMWSATWPKEVQQLARDYLHDPIQVNVGSLELAASHNIAQIVEVVSDMEKRDRLLKHLE 351

Query: 377 EVIRIPLATSEQLLKLQKSTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMPAANELPSEK 436
                                                               A+E    K
Sbjct: 352 ---------------------------------------------------TASEDKDSK 360

Query: 437 ATILFVPTRHHVEYISQLLRDCGYLISYIYGTLDQHARKNQLYNFRAGLTSILVVTDVAA 496
             I F  T+   + I++ LR  G+    I+G   Q+ R   L  FR G + I+V TDVAA
Sbjct: 361 ILI-FASTKRTCDEITRYLRQDGWPALAIHGDKAQNERDWVLQEFRTGNSPIMVATDVAA 419

Query: 497 RGVDIPMLANVINYTLPGSSKIFVHRVGRTARAGNKGWAYSI 538
           RG+D+  +  VINY +PG+ + +VHR+GRT RAG  G A S 
Sbjct: 420 RGIDVKGINFVINYDMPGNIEDYVHRIGRTGRAGATGTAISF 461

>CAGL0H03377g Chr8 complement(313755..315377) [1623 bp, 540 aa] {ON}
           highly similar to uniprot|P20447 Saccharomyces
           cerevisiae YGL078c DBP3
          Length = 540

 Score =  192 bits (488), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 127/424 (29%), Positives = 210/424 (49%), Gaps = 59/424 (13%)

Query: 123 VNEYFSTNNLEKQKHKKG------SFPSFGLSKIVLNNIKRKGFRQPTPIQRKTIPLILQ 176
           ++E+F  N +  +   K       +F    L K V N I +  F +PTPIQ  + P +L 
Sbjct: 107 IDEFFKENEVSVEDPSKLNLRPLLAFNQISLDKEVQNEIAK--FPKPTPIQAVSWPYLLS 164

Query: 177 SRDIVGMARTGSGKTAAFILPMVEKLKSHSGKI-GARAVILSPSRELAMQTFNVFKDFAR 235
            +D++G+A TGSGKT AF +P +  L + S K  G + +++SP+RELA Q ++      +
Sbjct: 165 GKDVIGVAETGSGKTFAFGVPAINNLLTSSSKPKGIKVLVISPTRELASQIYDNLVLLTQ 224

Query: 236 GTELRSVLLTGGDSLEEQFSMMMSNPDVIIATPGRFLHLKVEMNLDLKSVEYVVFDEADR 295
              +   ++ GG   ++Q    ++  +V++ATPGR L L  E ++DL  V+Y+V DEADR
Sbjct: 225 KVGIDCCVVYGGVPKDDQ-RRQIAKSNVVVATPGRLLDLIEEGSVDLSPVDYMVLDEADR 283

Query: 296 LFEMGFQEQLNELLASLPTT-RQTLLFSATLPNSLVDFVKAGLVNPVLVRLDAETKVSEN 354
           + E GF+E +  ++    +  RQTL+F+AT P  + +     +  PV V +    ++S N
Sbjct: 284 MLEKGFEEDIKRIIGQTKSKDRQTLMFTATWPKEVRELASTFMKEPVKVSIGNRDELSAN 343

Query: 355 LEMLFLSSKNADREANLLYILQEVIRIPLATSEQLLKLQKSTXXXXXXXXXXXXXXXXXX 414
                       R   ++ ++      P +   +LL L K                    
Sbjct: 344 -----------KRITQIVEVVD-----PRSKERKLLDLLKKYQSG--------------- 372

Query: 415 XXXXXXXXXXXMPAANELPSEKATILFVPTRHHVEYISQLLRDCGYLISYIYGTLDQHAR 474
                       P  N+       ++F   +     + + L   GY ++ I+G L Q  R
Sbjct: 373 ------------PKKND-----KVLIFALYKKEASRVERNLNYNGYKVAAIHGDLSQQQR 415

Query: 475 KNQLYNFRAGLTSILVVTDVAARGVDIPMLANVINYTLPGSSKIFVHRVGRTARAGNKGW 534
              L  F++G +++L+ TDVAARG+DIP +  VIN T P + + +VHR+GRT RAG  G 
Sbjct: 416 TQALNEFKSGKSNLLLATDVAARGLDIPNVKTVINLTFPLTVEDYVHRIGRTGRAGQTGT 475

Query: 535 AYSI 538
           A+++
Sbjct: 476 AHTL 479

>KLTH0D09746g Chr4 (805863..807728) [1866 bp, 621 aa] {ON} similar
           to uniprot|P06634 Saccharomyces cerevisiae YOR204W DED1
           ATP-dependent DEAD (Asp-Glu-Ala- Asp)-box RNA helicase
           required for translation initiation of all yeast mRNAs
           mutations in human DEAD-box DBY are a frequent cause of
           male infertility
          Length = 621

 Score =  194 bits (492), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 126/415 (30%), Positives = 203/415 (48%), Gaps = 72/415 (17%)

Query: 142 FPSFGLSKIVLNNIKRKGFRQPTPIQRKTIPLILQSRDIVGMARTGSGKTAAFILPMVEK 201
           F S  L +++L+NI +  F +PTP+Q+ ++P+I   RD++  A+TGSGKT  F+ P++ +
Sbjct: 151 FTSPPLDQLLLDNIIKARFTKPTPVQKYSVPIIAARRDLMACAQTGSGKTGGFLFPVLSE 210

Query: 202 LKSHSG-------------KIGARAVILSPSRELAMQTFNVFKDFARGTELRSVLLTGGD 248
             ++               K    AV+L+P+RELA Q F+  K F   + +R  ++ GG 
Sbjct: 211 SFANGPAPVPEQASNFYIKKAFPTAVVLAPTRELATQIFDEAKKFTYRSWVRPCVVYGGA 270

Query: 249 SLEEQFSMMMSNPDVIIATPGRFLHLKVEMNLDLKSVEYVVFDEADRLFEMGFQEQLNEL 308
            +  Q   +    D+++ATPGR   L     + L +++Y+V DEADR+ +MGF+ Q+  +
Sbjct: 271 DIGSQIKELNRGCDLLVATPGRLSDLLERGRISLCNIKYLVLDEADRMLDMGFEPQIRHI 330

Query: 309 L--ASLPTT--RQTLLFSATLPNSLVDFVKAGLVNPVLVRLDAETKVSENLEMLFLSSKN 364
           +    +P+   RQTL+FSAT P  +    +  L + V + +      SEN+    L  ++
Sbjct: 331 VEGCDMPSVDERQTLMFSATFPMDIQHLARDFLKDYVFLSVGRVGSTSENITQHVLYVED 390

Query: 365 ADREANLLYILQEVIRIPLATSEQLLKLQKSTXXXXXXXXXXXXXXXXXXXXXXXXXXXX 424
            D+++ LL +        LA S+  L L                                
Sbjct: 391 MDKKSALLDL--------LAASDDGLTL-------------------------------- 410

Query: 425 XMPAANELPSEKATILFVPTRHHVEYISQLLRDCGYLISYIYGTLDQHARKNQLYNFRAG 484
                          +FV T+   + ++  L       + I+G   Q  R+  L  FR+G
Sbjct: 411 ---------------IFVETKRMADALTDFLIMQNLRATAIHGDRSQSERERALAAFRSG 455

Query: 485 LTSILVVTDVAARGVDIPMLANVINYTLPGSSKIFVHRVGRTARAGNKGWAYSIV 539
             S+LV T VAARG+DIP + +VINY LP     +VHR+GRT RAGN G A + +
Sbjct: 456 KASLLVATAVAARGLDIPNVTHVINYDLPNDIDDYVHRIGRTGRAGNTGVATAFL 510

>Suva_7.192 Chr7 complement(353138..354694) [1557 bp, 518 aa] {ON}
           YGL078C (REAL)
          Length = 518

 Score =  191 bits (486), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 123/399 (30%), Positives = 198/399 (49%), Gaps = 52/399 (13%)

Query: 141 SFPSFGLSKIVLNNIKRKGFRQPTPIQRKTIPLILQSRDIVGMARTGSGKTAAFILPMVE 200
           SF    L   +   I +  F +PTPIQ    P +L  +D+VG+A TGSGKT AF +P + 
Sbjct: 110 SFDHLSLDSSIQAEISK--FPKPTPIQAVAWPYLLSGKDVVGVAETGSGKTFAFGVPAIS 167

Query: 201 KLKSHSGKIGARAVILSPSRELAMQTFNVFKDFARGTELRSVLLTGGDSLEEQFSMMMSN 260
            L +   K G + +++SP+RELA Q ++          L+   + GG   +EQ + +  +
Sbjct: 168 HLMNDQKKRGIQVLVISPTRELASQIYDNLIILTDKVGLQCCCVYGGVPKDEQRNQLKKS 227

Query: 261 PDVIIATPGRFLHLKVEMNLDLKSVEYVVFDEADRLFEMGFQEQLNELLASLPTT-RQTL 319
             V++ATPGR L L  E ++DL  V Y+V DE DR+ E GF+E +  ++     + RQTL
Sbjct: 228 -QVVVATPGRLLDLLQEGSVDLSQVNYLVLDEGDRMLEKGFEEDIKNIIRETDASKRQTL 286

Query: 320 LFSATLPNSLVDFVKAGLVNPVLVRLDAETKVSENLEMLFLSSKNADREANLLYILQEVI 379
           +F+AT P  + +   + + NP+ V +    +++ N ++  +                EV+
Sbjct: 287 MFTATWPKEVRELASSFMKNPIRVSIGNTDQLTANKKITQIV---------------EVV 331

Query: 380 RIPLATSEQLLKLQKSTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMPAANELPSEKATI 439
             P     +LL+L K                                P  NE       +
Sbjct: 332 D-PRGKERKLLELLKKYHSG---------------------------PKKNE-----KVL 358

Query: 440 LFVPTRHHVEYISQLLRDCGYLISYIYGTLDQHARKNQLYNFRAGLTSILVVTDVAARGV 499
           +F   +     + + L+  GY ++ I+G L Q  R   L  F++G +++L+ TDVAARG+
Sbjct: 359 IFALYKKEATRVERNLKYNGYNVAAIHGDLSQQQRTQALSEFKSGKSNLLLATDVAARGL 418

Query: 500 DIPMLANVINYTLPGSSKIFVHRVGRTARAGNKGWAYSI 538
           DIP +  VIN T P + + +VHR+GRT RAG  G A+++
Sbjct: 419 DIPNVKTVINLTFPLTVEDYVHRIGRTGRAGQTGTAHTL 457

>AFL027C Chr6 complement(386001..388451) [2451 bp, 816 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBR237W
           (PRP5)
          Length = 816

 Score =  197 bits (500), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 124/406 (30%), Positives = 211/406 (51%), Gaps = 63/406 (15%)

Query: 145 FGLSKIVLNNIKRK-GFRQPTPIQRKTIPLILQSRDIVGMARTGSGKTAAFILPMVEKLK 203
            GL+  ++N + R+  F  PTPIQ + IP I+  RD++G+++TGSGKT +FILP++ ++K
Sbjct: 241 LGLNSGIMNLLTRELEFTVPTPIQAQAIPAIMSGRDVIGISKTGSGKTVSFILPLLRQIK 300

Query: 204 SH----SGKIGARAVILSPSRELAMQTFNVFKDFARG-TELRSVLLTGGDSLEEQFSMMM 258
           +       + G   +ILSP+RELA+Q       F  G   +RS+  TGG  L+ Q + + 
Sbjct: 301 AQRPLGGDETGPLGLILSPTRELALQIHEEVTKFTSGDPSIRSLCCTGGSELKRQINDIK 360

Query: 259 SNPDVIIATPGRFLHLKVEMN----LDLKSVEYVVFDEADRLFEMGFQEQLNELLASLPT 314
              +++IATPGRF+ L + +N    ++ K + +VV DEADRLF++GF+ Q+N+++  +  
Sbjct: 361 RGVEIVIATPGRFIDL-LSLNSGNLINPKRIVFVVMDEADRLFDLGFEPQVNQIMKCIRP 419

Query: 315 TRQTLLFSATLPNSLVDFVKAGLVNPVLVRLDAETKVSENLEM-LFLSSKNADREANLLY 373
            +Q +LFSAT PN L  F    L +PV + +++++ ++EN+E  + + S   D+  +L++
Sbjct: 420 DKQCVLFSATFPNKLKSFASKILHDPVYITVNSKSLINENIEQKVEIFSNEEDKFKSLIH 479

Query: 374 ILQEVIRIPLATSEQLLKLQKSTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMPAANELP 433
                    LA ++Q L  +K                                       
Sbjct: 480 W--------LALTQQNLNDEK--------------------------------------- 492

Query: 434 SEKATILFVPTRHHVEYISQLLRDCGYLISYIYGTLDQHARKNQLYNFRAGLTSILVVTD 493
               TI+FV ++   + +   L   G+    I+       R   L  F+     IL+ T+
Sbjct: 493 ----TIVFVSSQQICDILYNRLEANGFTTFAIHAGKIYTERAWNLKCFKETANGILICTE 548

Query: 494 VAARGVDIPMLANVINYTLPGSSKIFVHRVGRTARAGNKGWAYSIV 539
           V +RG+++P ++ VI Y    +   +VH  GRTAR  NKG A +++
Sbjct: 549 VLSRGLNVPEVSLVIIYNAAKTFAQYVHTTGRTARGSNKGTALTLL 594

>KAFR0G02030 Chr7 complement(428516..430336) [1821 bp, 606 aa] {ON}
           Anc_8.614 YOR204W
          Length = 606

 Score =  192 bits (489), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 124/406 (30%), Positives = 199/406 (49%), Gaps = 72/406 (17%)

Query: 147 LSKIVLNNIKRKGFRQPTPIQRKTIPLILQSRDIVGMARTGSGKTAAFILPMVEK----- 201
           L  ++L NIK   F +PTP+Q+ ++P++   RD++  A+TGSGKT  F+ P++ +     
Sbjct: 145 LEGLLLENIKLARFTKPTPVQKYSVPIVANGRDLMACAQTGSGKTGGFLFPVLSESFKNG 204

Query: 202 ---LKSHSG-----KIGARAVILSPSRELAMQTFNVFKDFARGTELRSVLLTGGDSLEEQ 253
              L  +SG     K    AVI++P+REL  Q F+  K F   + ++  ++ GG  +  Q
Sbjct: 205 PTPLPENSGSHYQRKAYPTAVIMAPTRELVSQIFDEAKKFTYRSWVKPCVVYGGAPIANQ 264

Query: 254 FSMMMSNPDVIIATPGRFLHLKVEMNLDLKSVEYVVFDEADRLFEMGFQEQLNELLASLP 313
              M    D+++ATPGR   L     + L +V+Y+V DEADR+ +MGF+ Q+  ++    
Sbjct: 265 MREMDRGCDLLVATPGRLSDLLERGKISLANVKYLVLDEADRMLDMGFEPQIRHIVEGCD 324

Query: 314 TT----RQTLLFSATLPNSLVDFVKAGLVNPVLVRLDAETKVSENLEMLFLSSKNADREA 369
            T    RQTL+FSAT P  +    +  L + + + +      SEN+    L  ++ D+++
Sbjct: 325 MTPVGERQTLMFSATFPADIQHLARDFLSDYIFLSVGRVGSTSENITQRVLYVEDEDKKS 384

Query: 370 NLLYILQEVIRIPLATSEQLLKLQKSTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMPAA 429
            LL +        LA S++ L                                       
Sbjct: 385 ALLDL--------LAASDEGL--------------------------------------- 397

Query: 430 NELPSEKATILFVPTRHHVEYISQLLRDCGYLISYIYGTLDQHARKNQLYNFRAGLTSIL 489
                   T++FV T+   + ++  L    +  + I+G   Q  R+  L  FR+G  ++L
Sbjct: 398 --------TLIFVETKRLADQLTDFLIMQNFRATAIHGDRTQSERERALAAFRSGAANLL 449

Query: 490 VVTDVAARGVDIPMLANVINYTLPGSSKIFVHRVGRTARAGNKGWA 535
           V T VAARG+DIP + +VIN+ LP     +VHR+GRT RAGN G A
Sbjct: 450 VATAVAARGLDIPNVTHVINFDLPSDIDDYVHRIGRTGRAGNTGVA 495

>TPHA0E02410 Chr5 (512919..514490) [1572 bp, 523 aa] {ON} Anc_6.204
           YGL078C
          Length = 523

 Score =  190 bits (483), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 124/403 (30%), Positives = 200/403 (49%), Gaps = 56/403 (13%)

Query: 141 SFPSFGLSKIVLNNIKRKGFRQPTPIQRKTIPLILQSRDIVGMARTGSGKTAAFILPMVE 200
           SF    L+K + + I +  F +PTPIQ  + P +L  RD++G+A TGSGKT AF +P + 
Sbjct: 111 SFNHVKLNKKIQDEISK--FPKPTPIQSVSWPYLLTGRDVIGVAETGSGKTFAFGVPAIN 168

Query: 201 KLKSHSGKI----GARAVILSPSRELAMQTFNVFKDFARGTELRSVLLTGGDSLEEQFSM 256
            L   +G++    G + +++SP+RELA QTF+          L    + GG   + Q + 
Sbjct: 169 NLVDANGQLKYKKGIQVLVISPTRELASQTFDNLVILTDKLGLHCCCVYGGVPKDPQRTQ 228

Query: 257 MMSNPDVIIATPGRFLHLKVEMNLDLKSVEYVVFDEADRLFEMGFQEQLNELLASLPTT- 315
           +  +  V++ATPGR L L  E ++DL +V Y+V DEADR+ E GF+E +  ++    +  
Sbjct: 229 LKVS-QVVVATPGRLLDLLQEGSVDLSNVNYLVLDEADRMLEKGFEEDIKNIIRETASVG 287

Query: 316 RQTLLFSATLPNSLVDFVKAGLVNPVLVRLDAETKVSENLEMLFLSSKNADREANLLYIL 375
           RQTL+F+AT P  + +     +  PV V +    +++ N            R   ++ ++
Sbjct: 288 RQTLMFTATWPKEVRELASTFMERPVKVSIGNRDELTAN-----------KRITQIVEVI 336

Query: 376 QEVIRIPLATSEQLLKLQKSTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMPAANELPSE 435
                 P     +LL L K                                P  +E    
Sbjct: 337 D-----PFKKDRKLLDLLKKYHSG---------------------------PKKDE---- 360

Query: 436 KATILFVPTRHHVEYISQLLRDCGYLISYIYGTLDQHARKNQLYNFRAGLTSILVVTDVA 495
              ++F   +     + + L+  GY ++ I+G L Q  R   L  F++G  ++L+ TDVA
Sbjct: 361 -KVLIFALYKKEASRVERNLQYNGYQVAAIHGDLSQQQRTQALNEFKSGKCNLLLATDVA 419

Query: 496 ARGVDIPMLANVINYTLPGSSKIFVHRVGRTARAGNKGWAYSI 538
           ARG+DIP +  VIN T P + + +VHR+GRT RAG  G A+++
Sbjct: 420 ARGLDIPNVKTVINLTFPLTVEDYVHRIGRTGRAGQTGTAHTL 462

>ZYRO0G14960g Chr7 (1201495..1203990) [2496 bp, 831 aa] {ON} similar
           to uniprot|P21372 Saccharomyces cerevisiae YBR237W PRP5
           RNA helicase in the DEAD-box family
          Length = 831

 Score =  196 bits (497), Expect = 4e-51,   Method: Compositional matrix adjust.
 Identities = 120/403 (29%), Positives = 218/403 (54%), Gaps = 51/403 (12%)

Query: 147 LSKIVLNNIKRKGFRQPTPIQRKTIPLILQSRDIVGMARTGSGKTAAFILPMVEKLKSH- 205
           ++ +++N++K   F  PT IQ + IP I+  RD++G+++TGSGKT +++LP++  +K+  
Sbjct: 251 ITSVLINDLK---FENPTSIQAQAIPAIMCGRDVIGISKTGSGKTISYLLPLIRHIKAQR 307

Query: 206 ---SGKIGARAVILSPSRELAMQTFNVFKDF-ARGTELRSVLLTGGDSLEEQFSMMMSNP 261
              S + G   ++L+P+RELA+Q       F A+   + SV  TGG  L+EQ   +    
Sbjct: 308 HLASDESGPLGLVLAPTRELAIQINEEVTKFTAKDKSVNSVCCTGGSELKEQIRKLKKGI 367

Query: 262 DVIIATPGRFLHLKVEMN----LDLKSVEYVVFDEADRLFEMGFQEQLNELLASLPTTRQ 317
           ++++ATPGRF+ L + +N    L  + + +V+ DEADRLF+MGF+ Q+ +++ ++   +Q
Sbjct: 368 EIVVATPGRFIDL-LTLNTGKLLSTRRITFVIMDEADRLFDMGFEPQITQIMKTIRPDKQ 426

Query: 318 TLLFSATLPNSLVDFVKAGLVNPVLVRLDAETKVSENLEMLF-LSSKNADREANLLYILQ 376
            +LFSAT PN L +F    L  P+ + +++++ V+EN+   F +++ + ++   LL IL+
Sbjct: 427 CVLFSATFPNKLRNFAMRVLHRPLSITINSKSLVNENVTQRFDIANSDEEKFNTLLRILE 486

Query: 377 EVIRIPLATSEQLLKLQKSTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMPAANELPSEK 436
           +        S   + +Q+                                   +E   EK
Sbjct: 487 K-----HEESSNGVPMQQDWND-------------------------------SENKDEK 510

Query: 437 ATILFVPTRHHVEYISQLLRDCGYLISYIYGTLDQHARKNQLYNFRAGLTSILVVTDVAA 496
           A I+FV ++   + +   L + GY I  I+       R N L NF++   SIL+ T+V +
Sbjct: 511 A-IIFVSSQQICDLLHIKLENEGYTIYSIHAGKPYQERLNNLENFKSTPNSILLCTEVLS 569

Query: 497 RGVDIPMLANVINYTLPGSSKIFVHRVGRTARAGNKGWAYSIV 539
           RG+++P ++ V+ Y    +   +VH  GRTAR  + G A +++
Sbjct: 570 RGLNVPEVSLVLIYNAVKTFAQYVHTTGRTARGTHTGVAMTLL 612

>TDEL0A05590 Chr1 (980392..982185) [1794 bp, 597 aa] {ON} Anc_8.614
           YOR204W
          Length = 597

 Score =  192 bits (487), Expect = 5e-51,   Method: Compositional matrix adjust.
 Identities = 125/409 (30%), Positives = 200/409 (48%), Gaps = 72/409 (17%)

Query: 142 FPSFGLSKIVLNNIKRKGFRQPTPIQRKTIPLILQSRDIVGMARTGSGKTAAFILPMV-E 200
           F S  L +++L NIK   F +PTP+Q+ ++P++   RD++  A+TGSGKT  F+ P++ E
Sbjct: 142 FTSPPLDELLLENIKLARFTKPTPVQKYSVPIVANGRDLMACAQTGSGKTGGFLFPVLSE 201

Query: 201 KLKSHSGKI--GAR----------AVILSPSRELAMQTFNVFKDFARGTELRSVLLTGGD 248
              +   +I   AR          AV+L+P+RELA Q F+  K F   + +R+ ++ GG 
Sbjct: 202 SFSTGPSEIPENARGGYMRKAFPTAVVLAPTRELATQIFDEAKKFTYRSWVRATVVYGGA 261

Query: 249 SLEEQFSMMMSNPDVIIATPGRFLHLKVEMNLDLKSVEYVVFDEADRLFEMGFQEQLNEL 308
            +  Q   +    D+++ATPGR   L     + L  V+Y+V DEADR+ +MGF+ Q+  +
Sbjct: 262 DVGSQMRELDRGCDLLVATPGRLNDLLERGKISLAKVKYLVLDEADRMLDMGFEPQIRHI 321

Query: 309 L--ASLPTT--RQTLLFSATLPNSLVDFVKAGLVNPVLVRLDAETKVSENLEMLFLSSKN 364
           +    +P    RQTL+FSAT P  +    +  L + + + +      SEN+    L  ++
Sbjct: 322 VEGCDMPGVEDRQTLMFSATFPVDIQHLARDFLSDYIFLSVGRVGSTSENITQHVLYVED 381

Query: 365 ADREANLLYILQEVIRIPLATSEQLLKLQKSTXXXXXXXXXXXXXXXXXXXXXXXXXXXX 424
            D+++                   LL L  S                             
Sbjct: 382 EDKKS------------------ALLDLISSA---------------------------- 395

Query: 425 XMPAANELPSEKATILFVPTRHHVEYISQLLRDCGYLISYIYGTLDQHARKNQLYNFRAG 484
                    ++  T++FV T+   + ++  L    +  + I+G   Q  R+  L  FR+G
Sbjct: 396 ---------TDGLTLIFVETKRMADQLTDFLIMQNFAATAIHGDRTQGERERALAAFRSG 446

Query: 485 LTSILVVTDVAARGVDIPMLANVINYTLPGSSKIFVHRVGRTARAGNKG 533
             ++LV T VAARG+DIP + +VINY LP     +VHR+GRT RAGN G
Sbjct: 447 KANLLVATAVAARGLDIPNVTHVINYDLPSDVDDYVHRIGRTGRAGNTG 495

>NDAI0E02430 Chr5 complement(503901..505886) [1986 bp, 661 aa] {ON}
           Anc_8.614
          Length = 661

 Score =  192 bits (487), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 126/409 (30%), Positives = 200/409 (48%), Gaps = 72/409 (17%)

Query: 147 LSKIVLNNIKRKGFRQPTPIQRKTIPLILQSRDIVGMARTGSGKTAAFILPMV-EKLKS- 204
           L  ++L NI    F +PTP+Q+ +IP+I   RD++  A+TGSGKT  F+ P++ E  KS 
Sbjct: 192 LDDLLLENINLARFSKPTPVQKYSIPIIANGRDLMACAQTGSGKTGGFLFPVLSEAFKSG 251

Query: 205 -----------HSGKIGARAVILSPSRELAMQTFNVFKDFARGTELRSVLLTGGDSLEEQ 253
                      +S K    ++IL+P+RELA Q F   K F   + ++  ++ GG  +  Q
Sbjct: 252 PSPTPEQGRNFYSKKGYPTSLILAPTRELATQIFEEAKKFTYRSWVKPCVVYGGAPIGNQ 311

Query: 254 FSMMMSNPDVIIATPGRFLHLKVEMNLDLKSVEYVVFDEADRLFEMGFQEQLNELL--AS 311
              +    D+++ATPGR   L     + L++++Y+V DEADR+ +MGF+ Q+  ++    
Sbjct: 312 MREIDHGCDLLVATPGRLSDLLERGKISLQNIKYLVLDEADRMLDMGFEPQIRHIVEGVD 371

Query: 312 LPTT--RQTLLFSATLPNSLVDFVKAGLVNPVLVRLDAETKVSENLEMLFLSSKNADREA 369
           +P    RQTL+FSAT P  +    +  L + V + +      S+N+    L  ++ D+ +
Sbjct: 372 MPQVGERQTLMFSATFPIDIQQLARDFLNDYVFLSVGRVGSTSDNITQKILYVEDQDKYS 431

Query: 370 NLLYILQEVIRIPLATSEQLLKLQKSTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMPAA 429
            LL +L        ATS+ L                                        
Sbjct: 432 ALLDLLS-------ATSDGL---------------------------------------- 444

Query: 430 NELPSEKATILFVPTRHHVEYISQLLRDCGYLISYIYGTLDQHARKNQLYNFRAGLTSIL 489
                   T++FV T+   + ++  L    +  + I+G   Q  R+  L  F+AG  ++L
Sbjct: 445 --------TLIFVETKRMADQLTDFLIMQNFRATAIHGDRTQAERERALSAFKAGTANLL 496

Query: 490 VVTDVAARGVDIPMLANVINYTLPGSSKIFVHRVGRTARAGNKGWAYSI 538
           V T VAARG+DIP + +VIN+ LP     +VHR+GRT RAGN G A S 
Sbjct: 497 VATAVAARGLDIPNVTHVINFDLPSDIDDYVHRIGRTGRAGNTGVATSF 545

>NDAI0I01150 Chr9 (278832..280403) [1572 bp, 523 aa] {ON} Anc_6.204
          Length = 523

 Score =  189 bits (479), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 121/388 (31%), Positives = 195/388 (50%), Gaps = 60/388 (15%)

Query: 160 FRQPTPIQRKTIPLILQSRDIVGMARTGSGKTAAFILPMVEKL--------KSHSGKIGA 211
           F +PTPIQ  + P +L  +D++G+A TGSGKT AF +P ++ L        K +SG  G 
Sbjct: 126 FPKPTPIQAVSWPYLLSGKDVIGVAETGSGKTFAFGVPAIDYLVKTNQSNNKKNSG--GI 183

Query: 212 RAVILSPSRELAMQTFNVFKDFARGTELRSVLLTGGDSLEEQFSMMMSNPDVIIATPGRF 271
           + +++SP+RELA Q ++          L+   + GG   E Q  + +    V++ATPGR 
Sbjct: 184 QVLVISPTRELASQIYDNLIILTEKVGLQCCCVYGGVPKEAQ-RIQLKKSQVVVATPGRL 242

Query: 272 LHLKVEMNLDLKSVEYVVFDEADRLFEMGFQEQLNELL-ASLPTTRQTLLFSATLPNSLV 330
           L L  E +++L +V+Y+V DEADR+ E GF+E +  ++  + P  RQTL+F+AT P  + 
Sbjct: 243 LDLIQEGSVNLSAVKYLVLDEADRMLEKGFEEDIKNIIRETSPKGRQTLMFTATWPKEVR 302

Query: 331 DFVKAGLVNPVLVRLDAETKVSENLEMLFLSSKNADREANLLYILQEVIRIPLATSEQLL 390
           +   + +  PV V +    +++ N            R   ++ ++      P     +LL
Sbjct: 303 ELASSFMNEPVKVSIGNRDELTAN-----------KRITQIVEVID-----PQRKDRKLL 346

Query: 391 KLQKSTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMPAANELPSEKATILFVPTRHHVEY 450
            L K                                P  N+       ++F   +     
Sbjct: 347 DLLKKYHSG---------------------------PTKND-----KVLIFALYKKEAAR 374

Query: 451 ISQLLRDCGYLISYIYGTLDQHARKNQLYNFRAGLTSILVVTDVAARGVDIPMLANVINY 510
           + + L+  GY ++ I+G L Q  R   L  F+AG T++L+ TDVAARG+DIP +  VIN 
Sbjct: 375 VERNLKYNGYEVAAIHGDLSQEQRTRALGEFKAGKTNLLLATDVAARGLDIPNVKTVINL 434

Query: 511 TLPGSSKIFVHRVGRTARAGNKGWAYSI 538
           T P + + +VHR+GRT RAG  G A+++
Sbjct: 435 TFPLTVEDYVHRIGRTGRAGQTGTAHTL 462

>NCAS0D03740 Chr4 complement(694809..696368) [1560 bp, 519 aa] {ON}
           Anc_6.204
          Length = 519

 Score =  188 bits (478), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 118/381 (30%), Positives = 194/381 (50%), Gaps = 54/381 (14%)

Query: 160 FRQPTPIQRKTIPLILQSRDIVGMARTGSGKTAAFILPMVEKLKSHSGKI-GARAVILSP 218
           F +PTPIQ  + P +L  +D++G+A TGSGKT AF +P +  L  ++GK  G + +++SP
Sbjct: 130 FPKPTPIQAVSWPYLLSGKDVIGVAETGSGKTFAFGVPAINYLVLNNGKSKGVQVLVISP 189

Query: 219 SRELAMQTFNVFKDFARGTELRSVLLTGGDSLEEQFSMMMSNPDVIIATPGRFLHLKVEM 278
           +RELA Q ++          L    + GG   + Q + +  +  V++ATPGR L L  E 
Sbjct: 190 TRELASQIYDNLIVLTDKVGLECCCVYGGVPKDAQRAQLRRS-QVVVATPGRLLDLIQEG 248

Query: 279 NLDLKSVEYVVFDEADRLFEMGFQEQLNELLASLPTT-RQTLLFSATLPNSLVDFVKAGL 337
           ++DL +V+Y+V DEADR+ E GF+E +  ++    T  RQTL+F+AT P  + +   + +
Sbjct: 249 SVDLSAVKYLVLDEADRMLEKGFEEDIKNIIRETATKDRQTLMFTATWPKEVRELASSFM 308

Query: 338 VNPVLVRLDAETKVSENLEMLFLSSKNADREANLLYILQEVIRIPLATSEQLLKLQKSTX 397
             PV V +    ++S N            R   ++ +++     P     +LL+L K   
Sbjct: 309 NKPVKVSIGNRDELSAN-----------KRITQIVEVIE-----PQRKDRKLLELLKKYH 352

Query: 398 XXXXXXXXXXXXXXXXXXXXXXXXXXXXMPAANELPSEKATILFVPTRHHVEYISQLLRD 457
                                                ++  ++F   +     + + LR 
Sbjct: 353 S-----------------------------------KKEKVLIFALYKKEAARVERTLRY 377

Query: 458 CGYLISYIYGTLDQHARKNQLYNFRAGLTSILVVTDVAARGVDIPMLANVINYTLPGSSK 517
            GY ++ I+G L Q  R   L  F++G +++L+ TDVAARG+DIP +  VIN T P + +
Sbjct: 378 NGYDVAAIHGDLSQEQRTKALGEFKSGKSNLLLATDVAARGLDIPNVKTVINLTFPLTVE 437

Query: 518 IFVHRVGRTARAGNKGWAYSI 538
            +VHR+GRT RAG  G A+++
Sbjct: 438 DYVHRIGRTGRAGQTGTAHTL 458

>CAGL0I02354g Chr9 (209279..210592) [1314 bp, 437 aa] {ON} highly
           similar to uniprot|P38719 Saccharomyces cerevisiae
           YHR169w DBP8
          Length = 437

 Score =  186 bits (472), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 131/419 (31%), Positives = 191/419 (45%), Gaps = 65/419 (15%)

Query: 132 LEKQKHKKGSFPSFGLSKIVLNNIKRKGFRQPTPIQRKTIPLILQSRDIVGMARTGSGKT 191
           + ++  +K +F   GLSK ++ ++     R PT IQ   IP IL+ RD +G A+TGSGKT
Sbjct: 1   MTEEVSRKQNFRQLGLSKWLVESLDAMRIRTPTAIQSGCIPEILKGRDCIGGAKTGSGKT 60

Query: 192 AAFILPMVEKLKSHSGKIGARAVILSPSRELAMQTFNVFKDFARGTELRSVLLTGGDSLE 251
            AF  PM+ +        G   ++L+P+RELAMQ    F        +R  L+ GG+S+ 
Sbjct: 61  IAFAGPMLTQWSEDP--TGMFGIVLTPTRELAMQIAEQFTALGSYMNIRVALVVGGESIV 118

Query: 252 EQFSMMMSNPDVIIATPGRFLHLKVEMNLD----LKSVEYVVFDEADRLFEMGFQEQLNE 307
           +Q   +   P  IIATPGR  H  +    D    LK V+Y+V DEAD L    F   L  
Sbjct: 119 DQALQLQRKPHFIIATPGRLAHHILNSGDDTVGGLKRVKYLVLDEADILLTETFSNDLKT 178

Query: 308 LLASLPTT--RQTLLFSATLPNSLVDFVKAGLVNPVLVRLDAETKVSENLEMLFL-SSKN 364
            + +LP    RQTLLF+AT+ +               VR   +  V +  + LF    +N
Sbjct: 179 CVGALPPKEKRQTLLFTATITDQ--------------VRALQDAPVQKGKQPLFCYEVEN 224

Query: 365 ADREANLLYILQEVIRIPLATSE----QLLKLQKSTXXXXXXXXXXXXXXXXXXXXXXXX 420
            D  A    +  E + +P    E    QLL  +                           
Sbjct: 225 VDNVAIPSTLNTEYVLVPEHVKEAYLYQLLTCESY------------------------- 259

Query: 421 XXXXXMPAANELPSEKATILFVPTRHHVEYISQLLRDCGYLISYIYGTLDQHARKNQLYN 480
                        +    I+FV      E + + L+     ++ ++  + Q  R N ++ 
Sbjct: 260 -------------ANSTAIIFVNRTTAAEVLRRTLKALDVRVASLHSQMPQQERTNSMHR 306

Query: 481 FRAGLTSILVVTDVAARGVDIPMLANVINYTLPGSSKIFVHRVGRTARAGNKGWAYSIV 539
           FRA    +L+ TDVA+RG+DIP +  VINY +P     F+HR GRTARAG KG A S +
Sbjct: 307 FRANAARVLIATDVASRGLDIPTVELVINYDIPSDPDTFIHRSGRTARAGRKGDAISFI 365

>KLLA0A05203g Chr1 complement(462167..463474) [1308 bp, 435 aa] {ON}
           highly similar to uniprot|P38719 Saccharomyces
           cerevisiae YHR169W DBP8 Putative ATP-dependent RNA
           helicase of the DEAD-box family involved in biogenesis
           of the 40S ribosomal subunit
          Length = 435

 Score =  186 bits (471), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 127/410 (30%), Positives = 188/410 (45%), Gaps = 67/410 (16%)

Query: 142 FPSFGLSKIVLNNIKRKGFRQPTPIQRKTIPLILQSRDIVGMARTGSGKTAAFILPMVEK 201
           F S G SK ++  +      QPT IQ+  IP IL+ RD +G A TGSGKT AF  PM+ K
Sbjct: 6   FKSLGCSKWLVEALNAMKIVQPTAIQKACIPEILKGRDCIGGANTGSGKTIAFAAPMLTK 65

Query: 202 LKSHSGKIGARAVILSPSRELAMQTFNVFKDFARGTELRSVLLTGGDSLEEQFSMMMSNP 261
                   G   ++L+P+RELAMQ    F  F     +R  ++ GG+S+ +Q   +   P
Sbjct: 66  WSEDPQ--GMFGIVLTPTRELAMQIAEQFTAFGSAMNIRVAIVVGGESIVQQAIELQKRP 123

Query: 262 DVIIATPGRFLHLKVEMNLD----LKSVEYVVFDEADRLFEMGFQEQLNELLASLP--TT 315
             IIATPGR  H  +    D    LK V+++V DEAD L    F + L   ++ LP    
Sbjct: 124 HFIIATPGRLAHHVLNSGEDTIGGLKRVKFLVLDEADILLTETFSKDLATCVSILPPKNK 183

Query: 316 RQTLLFSATLPNSLVDFVKAGLVN--PVLVRLDAET----KVSENLEMLFLSSKNADREA 369
           RQ LLF+AT+ + +     A      P +   + E+     + + LE  +L      +E+
Sbjct: 184 RQNLLFTATMTDQVKALSDAPQTEGKPPVFTFEVESVDNVAIPKTLETTYLLVPEHVKES 243

Query: 370 NLLYILQEVIRIPLATSEQLLKLQKSTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMPAA 429
            L  IL         TSE+ +K                                      
Sbjct: 244 YLYQIL---------TSEKYVK-------------------------------------- 256

Query: 430 NELPSEKATILFVPTRHHVEYISQLLRDCGYLISYIYGTLDQHARKNQLYNFRAGLTSIL 489
                  + I+FV      E + + L+     ++ ++  + Q  R N +  FRA    +L
Sbjct: 257 ------SSCIIFVNRTVTAEILRRTLKSLDVRVTSLHSQMPQQERTNSVQRFRAQAARVL 310

Query: 490 VVTDVAARGVDIPMLANVINYTLPGSSKIFVHRVGRTARAGNKGWAYSIV 539
           + TDVA+RG+DIP++  V+NY +PG+   F+HR GRTARAG  G +   V
Sbjct: 311 IATDVASRGLDIPIVELVVNYDIPGNPDTFIHRAGRTARAGRHGESLCFV 360

>Ecym_2269 Chr2 complement(527849..530482) [2634 bp, 877 aa] {ON}
           similar to Ashbya gossypii AFL027C
          Length = 877

 Score =  194 bits (492), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 122/411 (29%), Positives = 213/411 (51%), Gaps = 67/411 (16%)

Query: 142 FPSFGLSKIVLNN-IKRKGFRQPTPIQRKTIPLILQSRDIVGMARTGSGKTAAFILPMVE 200
           +   GL+  V++  +K   F  PTPIQ + IP I+  RDI+G+++TGSGKT +F+LP++ 
Sbjct: 299 WTHLGLTSDVMDLLVKEFQFNFPTPIQSQAIPAIMSGRDIIGISKTGSGKTVSFLLPLLR 358

Query: 201 KLKSHS----GKIGARAVILSPSRELAMQTFN-VFKDFARGTELRSVLLTGGDSLEEQFS 255
           ++KS      G+ G   ++L+P+RELA+Q    V K  A    ++S+  TGG  +++Q +
Sbjct: 359 QIKSQRPLRVGETGPIGLLLAPTRELAVQIHEEVVKFTAANPRIKSICCTGGSEIKKQIN 418

Query: 256 MMMSNPDVIIATPGRFLHLKVEMN----LDLKSVEYVVFDEADRLFEMGFQEQLNELLAS 311
            +    ++I+ATPGRF+ L + +N    ++ K + +VV DEADRLF++GF+ Q+N+++  
Sbjct: 419 DIKRGIEIIVATPGRFIDL-LSLNSGNLVNPKRIVFVVLDEADRLFDLGFEPQVNQIMKC 477

Query: 312 LPTTRQTLLFSATLPNSLVDFVKAGLVNPVLVRLDAETKVSENLEM---LFLSSKNADRE 368
           +   +Q +LFSAT P  L  F    L NP+ + +++++ ++EN+E    +F      D E
Sbjct: 478 IRPDKQCVLFSATFPTKLKSFASKILHNPIHITINSKSLINENIEQRVEIF-----GDEE 532

Query: 369 ANLLYILQEVIRIPLATSEQLLKLQKSTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMPA 428
           +    +L  +  +P  T E                                         
Sbjct: 533 SKFKSLLHWL--VPTQTRE----------------------------------------- 549

Query: 429 ANELPSEKATILFVPTRHHVEYISQLLRDCGYLISYIYGTLDQHARKNQLYNFRAGLTSI 488
                 ++ TI+FV ++   +++S  L   G     I+     + R   L +F+     I
Sbjct: 550 -----VDEKTIIFVSSQQICDFLSNRLEVNGLGTFSIHAGKPFNERTWNLRSFKETKNGI 604

Query: 489 LVVTDVAARGVDIPMLANVINYTLPGSSKIFVHRVGRTARAGNKGWAYSIV 539
           L+ T+V +RG+++P ++ V+ Y    S   +VH  GRTAR  NKG A +++
Sbjct: 605 LICTEVLSRGLNVPEVSLVLIYNAAKSFAQYVHTTGRTARGTNKGMAVTLL 655

>Ecym_8298 Chr8 (605258..607174) [1917 bp, 638 aa] {ON} similar to
           Ashbya gossypii ADL273C
          Length = 638

 Score =  190 bits (483), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 127/414 (30%), Positives = 197/414 (47%), Gaps = 75/414 (18%)

Query: 142 FPSFGLSKIVLNNIKRKGFRQPTPIQRKTIPLILQSRDIVGMARTGSGKTAAFILPMVEK 201
           F S  L  ++L NIK   F +PTP+Q+ ++P++   RD++  A+TGSGKT  F+ P++ +
Sbjct: 154 FTSPPLDNLLLENIKMARFTRPTPVQKYSVPIVALGRDLMACAQTGSGKTGGFLFPVLSQ 213

Query: 202 --------LKSHSG--------KIGARAVILSPSRELAMQTFNVFKDFARGTELRSVLLT 245
                   +   SG        K    AV+L+P+RELA Q F+  K F   + ++  ++ 
Sbjct: 214 SFGAGPAVVTEESGNNNYYNSRKAYPTAVVLAPTRELATQIFDEAKKFTYRSWVKPCVVY 273

Query: 246 GGDSLEEQFSMMMSNPDVIIATPGRFLHLKVEMNLDLKSVEYVVFDEADRLFEMGFQEQL 305
           GG  + +Q   +    D+I+ATPGR   L     + L +V+Y+V DEADR+ +MGF+ Q+
Sbjct: 274 GGADIRQQLRELEHGCDLIVATPGRLNDLLERGKISLCNVKYLVLDEADRMLDMGFEPQI 333

Query: 306 NELL--ASLPTT--RQTLLFSATLPNSLVDFVKAGLVNPVLVRLDAETKVSENLEMLFLS 361
             ++    +P+   RQTL+FSAT P  +       L + + + +      SEN+    L 
Sbjct: 334 RHIVEGCDMPSVENRQTLMFSATFPTDIQHLAADFLKDYIFLSVGRVGSTSENITQKVLY 393

Query: 362 SKNADREANLLYILQEVIRIPLATSEQLLKLQKSTXXXXXXXXXXXXXXXXXXXXXXXXX 421
            ++ D+ + LL +        LA S+  L L                             
Sbjct: 394 VEDLDKRSVLLDL--------LAASDGGLTL----------------------------- 416

Query: 422 XXXXMPAANELPSEKATILFVPTRHHVEYISQLLRDCGYLISYIYGTLDQHARKNQLYNF 481
                             +FV T+   + ++  L       + I+G   Q  R+  L  F
Sbjct: 417 ------------------VFVETKRMADALTDFLIMQNLSATAIHGDRSQAERERALQFF 458

Query: 482 RAGLTSILVVTDVAARGVDIPMLANVINYTLPGSSKIFVHRVGRTARAGNKGWA 535
           R    +ILV T VAARG+DIP + +VINY LP     +VHR+GRT RAGN G A
Sbjct: 459 RTARANILVATAVAARGLDIPNVTHVINYDLPSDIDDYVHRIGRTGRAGNTGLA 512

>KNAG0A03280 Chr1 complement(416099..417922) [1824 bp, 607 aa] {ON}
           Anc_8.614 YOR204W
          Length = 607

 Score =  189 bits (481), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 127/410 (30%), Positives = 202/410 (49%), Gaps = 79/410 (19%)

Query: 147 LSKIVLNNIKRKGFRQPTPIQRKTIPLILQSRDIVGMARTGSGKTAAFILPMV-EKLK-- 203
           L  +++ N+K   F +PTP+Q+ +IP+I   RD++  A+TGSGKT  F+ P++ E  K  
Sbjct: 156 LDDLLMENVKLARFTKPTPVQKYSIPIISIGRDLMACAQTGSGKTGGFLFPVLSESFKVG 215

Query: 204 ----------SHSGKIGARAVILSPSRELAMQTFNVFKDFARGTELRSVLLTGGDSLEEQ 253
                     S+  K    AVI++P+RELA Q F+  K F   + +   ++ GG  +  Q
Sbjct: 216 PSVVQGNEGYSYQRKAYPTAVIMAPTRELATQIFDEAKKFCYRSWVNPCVVYGGAPIGNQ 275

Query: 254 FSMMMSNPDVIIATPGRFLHLKVEMNLDLKSVEYVVFDEADRLFEMGFQEQLNELL--AS 311
              M    D+++ATPGR   +     + L +V+Y+V DEADR+ +MGF+ Q+ +++    
Sbjct: 276 LREMDRGCDLLVATPGRLSDMIERGKISLSNVKYLVLDEADRMLDMGFEIQIRQIVEGCD 335

Query: 312 LPTT--RQTLLFSATLPNSLV----DFVKAGLVNPVLVRLDAETKVSENLEMLFLSSKNA 365
           +P +  RQTL+FSAT P  +     DF++      + + +      SEN+    +  ++ 
Sbjct: 336 MPPSSERQTLMFSATFPADIQHLARDFLRPDY---IFLSVGKVGSTSENITQRVMYVESM 392

Query: 366 DREANLLYILQEVIRIPLATSEQLLKLQKSTXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 425
           D+++ LL +        LA+SE  L                                   
Sbjct: 393 DKKSALLDL--------LASSEPGL----------------------------------- 409

Query: 426 MPAANELPSEKATILFVPTRHHVEYISQLLRDCGYLISYIYGTLDQHARKNQLYNFRAGL 485
                       T++FV T+   + ++  L       + I+G   Q  R+  L  F++G 
Sbjct: 410 ------------TLIFVETKRMADQLTDFLIMQNLRATAIHGDRTQSERERALAAFKSGR 457

Query: 486 TSILVVTDVAARGVDIPMLANVINYTLPGSSKIFVHRVGRTARAGNKGWA 535
            +ILV T VAARG+DIP + +VINY LPG    +VHR+GRT RAGN G A
Sbjct: 458 ANILVATAVAARGLDIPNVTHVINYDLPGDIDDYVHRIGRTGRAGNTGLA 507

>Kpol_534.31 s534 complement(73551..76169) [2619 bp, 872 aa] {ON}
           complement(73551..76169) [2619 nt, 873 aa]
          Length = 872

 Score =  193 bits (491), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 118/409 (28%), Positives = 211/409 (51%), Gaps = 47/409 (11%)

Query: 142 FPSFGLSKIVLNNIKRK-GFRQPTPIQRKTIPLILQSRDIVGMARTGSGKTAAFILPMVE 200
           +   GL   ++N I ++  + +PT IQ + IP I+  RD++G+++TGSGKT ++ILPM+ 
Sbjct: 278 WSQLGLPTDIMNLITKELKYDEPTAIQSQAIPAIMSGRDLIGISKTGSGKTISYILPMLR 337

Query: 201 KLKSH----SGKIGARAVILSPSRELAMQTFNVFKDFAR-GTELRSVLLTGGDSLEEQFS 255
           ++K+       + G   +IL+P+RELA+Q     + F +    +R++  TGG  +++Q +
Sbjct: 338 QIKAQRTLSKNETGPLGLILAPTRELALQINEEVEKFTKQDRSIRTICCTGGSEMKKQIN 397

Query: 256 MMMSNPDVIIATPGRFLHLKVEMN----LDLKSVEYVVFDEADRLFEMGFQEQLNELLAS 311
            +    ++++ATPGR + + + +N    +  K + +VV DEADRLF+MGF+ Q+ +++ +
Sbjct: 398 DLKRGVEIVVATPGRLIDI-LTLNSGKLISTKRITFVVMDEADRLFDMGFEPQITQIMKT 456

Query: 312 LPTTRQTLLFSATLPNSLVDFVKAGLVNPVLVRLDAETKVSENLEMLFLSSKNADREAN- 370
           +   +Q +LFSAT PN L  F    L +P+ V +++   V+EN+   F    N + + N 
Sbjct: 457 VRPDKQCVLFSATFPNKLRSFAARILTDPLTVTINSNNLVNENVNQSFYIEDNENDKFNR 516

Query: 371 LLYILQEVIRIPLATSEQLLKLQKSTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMPAAN 430
           L+ IL           +   K+ K+                                  +
Sbjct: 517 LVNIL-----------DGFYKVNKNITSNSEER------------------------EID 541

Query: 431 ELPSEKATILFVPTRHHVEYISQLLRDCGYLISYIYGTLDQHARKNQLYNFRAGLTSILV 490
           E  S+K  I+FV ++   + +   L + GY    I+       R   L  F+    SIL+
Sbjct: 542 EEVSDKKIIIFVSSQQFCDLLYSKLENFGYFPYTIHAGKPYQERVMNLEKFKTTTNSILL 601

Query: 491 VTDVAARGVDIPMLANVINYTLPGSSKIFVHRVGRTARAGNKGWAYSIV 539
            T+V +RG+++P ++ VI Y    +   +VH  GRTAR  +KG A +++
Sbjct: 602 CTEVLSRGLNVPEVSLVIIYNAAKTFAQYVHTTGRTARGTHKGDAITLL 650

>TBLA0E04100 Chr5 (1032727..1035327) [2601 bp, 866 aa] {ON}
           Anc_8.614 YOR204W
          Length = 866

 Score =  190 bits (483), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 124/425 (29%), Positives = 205/425 (48%), Gaps = 81/425 (19%)

Query: 142 FPSFGLSKIVLNNIKRKGFRQPTPIQRKTIPLILQSRDIVGMARTGSGKTAAFILPMVEK 201
           F S  L  +++ NIK   F +PTPIQ+ +IP++ Q RD++  A+TGSGKT AF+ P++ K
Sbjct: 359 FTSPPLDNLLVENIKLARFNKPTPIQKYSIPIVNQGRDLMACAQTGSGKTDAFLFPILSK 418

Query: 202 L------------------------KSHSGKIGARAVILSPSRELAMQTFNVFKDFARGT 237
                                    K  +  I    +IL+P+RELA Q F   + F+  +
Sbjct: 419 AFSLGPSINNNNDNDNDANQYNKISKYRAKNIKPIILILAPTRELANQIFEEARKFSYRS 478

Query: 238 ELRSVLLTGGDSLEEQFSMMMSNPDVIIATPGRFLHLKVEMNLDLKSVEYVVFDEADRLF 297
            +R  ++ GG ++  Q   + +   +++ATPGR   L     + L +++Y++ DEADR+ 
Sbjct: 479 WIRPCVVYGGTNIFTQMKNLENGSQLLVATPGRLNDLMERGKISLSNIKYLILDEADRML 538

Query: 298 EMGFQEQLNELLAS----LPTTRQTLLFSATLPNSLVDFVKAGLVNPVLVRLDAETKVSE 353
           +MGF+ Q+ +++      + T+RQTL+FSAT P+++ +     L + + + +      ++
Sbjct: 539 DMGFELQIRQIVEHYDMPIATSRQTLMFSATFPSNIQNLAGDFLNDYIFLSVGKIGSTTD 598

Query: 354 NLEMLFLSSKNADREANLLYILQEVIRIPLATSEQLLKLQKSTXXXXXXXXXXXXXXXXX 413
           N+              ++ Y+ QE           LL L  S                  
Sbjct: 599 NIIQ------------HIYYVRQE------EKDNTLLDLLDSKNYK-------------- 626

Query: 414 XXXXXXXXXXXXMPAANELPSEKATILFVPTRHHVEYISQLLRDCGYLISYIYGTLDQHA 473
                                +K T++FV T+   + ++ LL   GY  + I+G   Q  
Sbjct: 627 ---------------------KKQTLIFVETKRSADALTDLLIIEGYKATAIHGDRTQLE 665

Query: 474 RKNQLYNFRAGLTSILVVTDVAARGVDIPMLANVINYTLPGSSKIFVHRVGRTARAGNKG 533
           R+  L  F+    ++LV T VAARG+DIP +A+V+NY LP +   +VHR+GRT R GN G
Sbjct: 666 RERALTAFKTKRANVLVATSVAARGLDIPNVAHVLNYDLPNNIDDYVHRIGRTGRVGNIG 725

Query: 534 WAYSI 538
            A S 
Sbjct: 726 MATSF 730

>TBLA0D03520 Chr4 (873710..876379) [2670 bp, 889 aa] {ON} Anc_6.148
           YBR237W
          Length = 889

 Score =  191 bits (484), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 122/410 (29%), Positives = 209/410 (50%), Gaps = 49/410 (11%)

Query: 141 SFPSFGLSKIVLNNIKRK-GFRQPTPIQRKTIPLILQSRDIVGMARTGSGKTAAFILPMV 199
           ++   GLS + +N I +   F  PTPIQ + IP I+  +DI+G+++TGSGKT A+ILP++
Sbjct: 290 NWAQLGLSSLTMNYITQILKFETPTPIQAQAIPAIMSGKDIIGISKTGSGKTIAYILPLL 349

Query: 200 EKLKSHS----GKIGARAVILSPSRELAMQTFNVFKDFARGT--ELRSVLLTGGDSLEEQ 253
             +++       + G  A++L+P+RELA+Q  +   +F      +L S+   GG  L  Q
Sbjct: 350 RHVRAQKPLSRNETGPIALVLAPTRELAIQINDEINNFLSNDNYQLNSICCAGGSDLRGQ 409

Query: 254 FSMMMSNPDVIIATPGRFLHLKVEMNLDL---KSVEYVVFDEADRLFEMGFQEQLNELLA 310
            +++     +I+ATPGR++ L      +L   K + ++V DEADRLF++GF+ Q+++++ 
Sbjct: 410 INIIKKGVSIIVATPGRYIDLLTLNGGNLLNTKRISFIVMDEADRLFDLGFEPQISQIMK 469

Query: 311 SLPTTRQTLLFSATLPNSLVDFVKAGLVNPVLVRLDAETKVSENLEMLF-LSSKNADREA 369
           ++   +  +LFSAT P  L  F    L +P+ + +D+E  ++EN+E  F +   + ++  
Sbjct: 470 TIRPDKHGVLFSATFPKKLRSFALKALNSPITITIDSENMINENIEQKFKICKSDNEKFN 529

Query: 370 NLLYILQEVIRIPLATSEQLLKLQKSTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMPAA 429
           NLL IL +              +Q S                                 +
Sbjct: 530 NLLDILNK---------HDYENIQSSASRDG---------------------------IS 553

Query: 430 NELPSEKATILFVPTRHHVEYISQLLRDCGYLISYIYGTLDQHARKNQLYNFRAGLTSIL 489
           NE  ++K  I+FV ++   E I   L + G+    I+     + R   L NFR    SIL
Sbjct: 554 NE--NDKKIIIFVSSQQISELIYNKLENNGFSPFLIHAGKPYNERVQNLENFRRAKNSIL 611

Query: 490 VVTDVAARGVDIPMLANVINYTLPGSSKIFVHRVGRTARAGNKGWAYSIV 539
           + T+V +RG+++P  + VI Y    +   +VH  GRT R   +G A S++
Sbjct: 612 LCTEVLSRGLNVPETSLVIIYNAVKAFAQYVHTTGRTGRGIYRGVAISLL 661

>Kpol_1072.50 s1072 complement(115009..116961) [1953 bp, 650 aa]
           {ON} complement(115009..116961) [1953 nt, 651 aa]
          Length = 650

 Score =  187 bits (474), Expect = 5e-49,   Method: Compositional matrix adjust.
 Identities = 121/411 (29%), Positives = 201/411 (48%), Gaps = 72/411 (17%)

Query: 142 FPSFGLSKIVLNNIKRKGFRQPTPIQRKTIPLILQSRDIVGMARTGSGKTAAFILPMVEK 201
           F S  L  ++L NI    F +PTP+Q+ ++P++ + RD++  A+TGSGKT  F+ P++ +
Sbjct: 162 FTSPPLDALLLENIILARFTKPTPVQKYSVPIVSRGRDLMACAQTGSGKTGGFLFPVLSE 221

Query: 202 -------------LKSHSGKIGARAVILSPSRELAMQTFNVFKDFARGTELRSVLLTGGD 248
                         KS   K    A++L+P+RELA Q ++  K F   + +R  ++ GG 
Sbjct: 222 SFKNGPSPMPESARKSFVKKAYPTALVLAPTRELATQIYDEAKKFTYRSWVRPTVVYGGS 281

Query: 249 SLEEQFSMMMSNPDVIIATPGRFLHLKVEMNLDLKSVEYVVFDEADRLFEMGFQEQLNEL 308
            +  Q   +    D+++ATPGR   L     + L +V+Y+V DEADR+ +MGF+ Q+ ++
Sbjct: 282 DIGSQIRDLSRGCDLLVATPGRLSDLLERGRVSLANVKYLVLDEADRMLDMGFEPQIRQI 341

Query: 309 L--ASLPTT--RQTLLFSATLPNSLVDFVKAGLVNPVLVRLDAETKVSENLEMLFLSSKN 364
           +    +P    RQTL+FSAT P+ +    +  L + + + +      SEN+    L  ++
Sbjct: 342 VDGCDMPPVGERQTLMFSATFPDDIQHLARDFLSDYIFLSVGKVGSTSENITQRILYVED 401

Query: 365 ADREANLLYILQEVIRIPLATSEQLLKLQKSTXXXXXXXXXXXXXXXXXXXXXXXXXXXX 424
            D+++                   LL L                                
Sbjct: 402 MDKKS------------------TLLDL-------------------------------- 411

Query: 425 XMPAANELPSEKATILFVPTRHHVEYISQLLRDCGYLISYIYGTLDQHARKNQLYNFRAG 484
            + A+N+      T++FV T+   + ++  L    +  + I+G   Q  R+  L  F+ G
Sbjct: 412 -LSASND----GLTLIFVETKRMADELTDFLIMQDFRATAIHGDRTQSERERALAAFKNG 466

Query: 485 LTSILVVTDVAARGVDIPMLANVINYTLPGSSKIFVHRVGRTARAGNKGWA 535
             ++LV T VAARG+DIP + +V+NY LP     +VHR+GRT RAGN G A
Sbjct: 467 NANLLVATAVAARGLDIPNVTHVVNYDLPSDIDDYVHRIGRTGRAGNTGVA 517

>TDEL0G00930 Chr7 complement(186836..188146) [1311 bp, 436 aa] {ON}
           Anc_5.69 YHR169W
          Length = 436

 Score =  181 bits (460), Expect = 6e-49,   Method: Compositional matrix adjust.
 Identities = 128/407 (31%), Positives = 191/407 (46%), Gaps = 59/407 (14%)

Query: 141 SFPSFGLSKIVLNNIKRKGFRQPTPIQRKTIPLILQSRDIVGMARTGSGKTAAFILPMVE 200
           +F S GL + +++ +      QPT IQ+  IP I++  D +G A+TGSGKT AF  PM+ 
Sbjct: 8   TFKSLGLPRWLVDALSAMRITQPTSIQKGCIPAIMKGGDCIGGAKTGSGKTIAFAAPMLT 67

Query: 201 KL-KSHSGKIGARAVILSPSRELAMQTFNVFKDFARGTELRSVLLTGGDSLEEQFSMMMS 259
           K  +  SG  G   V+L+P+RELAMQ    F        +R  ++ GG+S+ +Q   +  
Sbjct: 68  KWSEDPSGMFG---VVLTPTRELAMQIAEQFTALGSSMNIRVSIVVGGESIVKQALELQR 124

Query: 260 NPDVIIATPGRFLHLKVEMNLD----LKSVEYVVFDEADRLFEMGFQEQLNELLASLPT- 314
            P  IIATPGR  H  +    D    L   +++V DEAD L    F + LN  +++LP  
Sbjct: 125 KPHFIIATPGRLAHHILNSGEDTVGGLMRAKFLVLDEADSLLTSTFAKDLNVCVSALPPK 184

Query: 315 -TRQTLLFSATLPNSLVDFVKAGLVNPVLVRLDAETKVSENLEMLFL-SSKNADREANLL 372
             RQTLLF+AT+ +               VR   +    EN   L+    +N D  A   
Sbjct: 185 DKRQTLLFTATITDQ--------------VRALQDAPSQENKPPLYCYEVENVDNVAVPS 230

Query: 373 YILQEVIRIPLATSEQLLKLQKSTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMPAANEL 432
            +  E I IP    E  L                                   +  + E 
Sbjct: 231 TLKTEYILIPEYVKEAYL---------------------------------YHLLTSEEY 257

Query: 433 PSEKATILFVPTRHHVEYISQLLRDCGYLISYIYGTLDQHARKNQLYNFRAGLTSILVVT 492
               A I+FV      E + + L++    ++ ++  + Q  R N L  FRA    +L+ T
Sbjct: 258 KDSSA-IIFVNRTMTAEIMRRTLKNLDIRVASLHSQMPQQERTNSLQRFRANAARVLIAT 316

Query: 493 DVAARGVDIPMLANVINYTLPGSSKIFVHRVGRTARAGNKGWAYSIV 539
           DVA+RG+DIP++  V+NY +P    +++HR GRTARAG +G A S +
Sbjct: 317 DVASRGLDIPVVELVVNYDIPSDPDVYIHRSGRTARAGRRGDAISFI 363

>KLTH0H05852g Chr8 complement(514352..516787) [2436 bp, 811 aa] {ON}
           similar to uniprot|P21372 Saccharomyces cerevisiae
           YBR237W PRP5 RNA helicase in the DEAD-box family
          Length = 811

 Score =  187 bits (475), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 117/409 (28%), Positives = 213/409 (52%), Gaps = 59/409 (14%)

Query: 142 FPSFGLSKIVLNNIKRK-GFRQPTPIQRKTIPLILQSRDIVGMARTGSGKTAAFILPMVE 200
           +   GL+  +++ I ++  F  PTPIQ + IP I+  RD++G+++TGSGKT +F+LP++ 
Sbjct: 234 WSQLGLTTDIMDLITKEFAFVSPTPIQAQAIPAIMAGRDVIGISKTGSGKTVSFLLPLLR 293

Query: 201 KLKS----HSGKIGARAVILSPSRELAMQTFNVFKDFARG-TELRSVLLTGGDSLEEQFS 255
           ++K+     SG+ G   +IL+P+RELA+Q     + F    ++LRS+  TGG  L++Q  
Sbjct: 294 QIKALRPLTSGETGPMGLILAPTRELAVQIHEETEKFLNPVSKLRSICCTGGSELKQQIK 353

Query: 256 MMMSNPDVIIATPGRFLHLKVEMN----LDLKSVEYVVFDEADRLFEMGFQEQLNELLAS 311
            +    ++++ATPGRF+ L + +N    L+ + V +VV DEADRLF++GF+ Q+ E++ +
Sbjct: 354 ELKKGVEIVVATPGRFIDL-LTLNSGKLLNTERVTFVVMDEADRLFDLGFEPQITEIMKT 412

Query: 312 LPTTRQTLLFSATLPNSLVDFVKAGLVNPVLVRLDAETKVSENLE-MLFLSSKNADREAN 370
           +   +Q +LFSAT P  L  F    L  P+ + +++++ ++EN+E  L +   +  +   
Sbjct: 413 IRPDKQCVLFSATFPTKLKSFASRILDRPISITINSKSLINENIEQQLRIYDNDESKFEG 472

Query: 371 LLYILQEVIRIPLATSEQLLKLQKSTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMPAAN 430
           LL IL++                                                M + +
Sbjct: 473 LLDILRK---------------------------------------------QTQMSSDD 487

Query: 431 ELPSEKATILFVPTRHHVEYISQLLRDCGYLISYIYGTLDQHARKNQLYNFRAGLTSILV 490
           E   ++  I+F+ ++   + I   L++  Y    I+     + R + L  F+     IL+
Sbjct: 488 E--RDEKIIVFLSSQQICDLIYYRLQEQNYTTYAIHAGKPYNERASSLEKFKNTKNGILL 545

Query: 491 VTDVAARGVDIPMLANVINYTLPGSSKIFVHRVGRTARAGNKGWAYSIV 539
            T+V +RG+++P ++ VI Y    +   +VH  GRTAR    G A +++
Sbjct: 546 CTEVLSRGLNVPEVSLVIIYNAVKTFAQYVHTTGRTARGDKHGTAVTLL 594

>YBR237W Chr2 (691969..694518) [2550 bp, 849 aa] {ON}  PRP5RNA
           helicase in the DEAD-box family, necessary for
           prespliceosome formation, bridges U1 and U2 snRNPs and
           enables stable U2 snRNP association with intron RNA
          Length = 849

 Score =  187 bits (474), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 117/409 (28%), Positives = 212/409 (51%), Gaps = 47/409 (11%)

Query: 142 FPSFGLSKIVLNNIKRK-GFRQPTPIQRKTIPLILQSRDIVGMARTGSGKTAAFILPMVE 200
           +   GLS   +  I  K  F   TPIQ + +P I+  RD++G+++TGSGKT +++LP++ 
Sbjct: 257 WSQLGLSTDTMVLITEKLHFGSLTPIQSQALPAIMSGRDVIGISKTGSGKTISYLLPLLR 316

Query: 201 KLKSH----SGKIGARAVILSPSRELAMQTFNVFKDFARG-TELRSVLLTGGDSLEEQFS 255
           ++K+       + G   +IL+P+RELA+Q       F    T +RSV  TGG  +++Q +
Sbjct: 317 QVKAQRPLSKHETGPMGLILAPTRELALQIHEEVTKFTEADTSIRSVCCTGGSEMKKQIT 376

Query: 256 MMMSNPDVIIATPGRFLHLKVEMN----LDLKSVEYVVFDEADRLFEMGFQEQLNELLAS 311
            +    ++++ATPGRF+ + + +N    L  K + +VV DEADRLF++GF+ Q+ +++ +
Sbjct: 377 DLKRGTEIVVATPGRFIDI-LTLNDGKLLSTKRITFVVMDEADRLFDLGFEPQITQIMKT 435

Query: 312 LPTTRQTLLFSATLPNSLVDFVKAGLVNPVLVRLDAETKVSENLEMLFLSSKNADRE-AN 370
           +   +Q +LFSAT PN L  F    L +P+ + ++++  V+EN++  F    + D +  N
Sbjct: 436 VRPDKQCVLFSATFPNKLRSFAVRVLHSPISITINSKGMVNENVKQKFRICHSEDEKFDN 495

Query: 371 LLYILQEVIRIPLATSEQLLKLQKSTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMPAAN 430
           L+ ++ E        SE   ++Q                                  +++
Sbjct: 496 LVQLIHE-------RSEFFDEVQSENDGQ----------------------------SSD 520

Query: 431 ELPSEKATILFVPTRHHVEYISQLLRDCGYLISYIYGTLDQHARKNQLYNFRAGLTSILV 490
               +   I+FV +++  ++IS+ L + G +   I+       R   L  F+    SIL+
Sbjct: 521 VEEVDAKAIIFVSSQNICDFISKKLLNAGIVTCAIHAGKPYQERLMNLEKFKREKNSILL 580

Query: 491 VTDVAARGVDIPMLANVINYTLPGSSKIFVHRVGRTARAGNKGWAYSIV 539
            T+V +RG+++P ++ VI Y    +   +VH  GRTAR    G A +++
Sbjct: 581 CTEVLSRGLNVPEVSLVIIYNAVKTFAQYVHTTGRTARGSRSGTAITLL 629

>Kwal_27.11734 s27 complement(923899..925614) [1716 bp, 571 aa] {ON}
           YDR243C (PRP28) - RNA helicase [contig 27] FULL
          Length = 571

 Score =  182 bits (461), Expect = 6e-48,   Method: Compositional matrix adjust.
 Identities = 127/409 (31%), Positives = 210/409 (51%), Gaps = 75/409 (18%)

Query: 146 GLSKIVLNNIKRKGFRQPTPIQRKTIPLILQSRDIVGMARTGSGKTAAFILPMVEKLK-- 203
           GL +I+ + +K   +R+PTPIQR TIP +L+ RD VG+A TGSGKT AF+LP + +L   
Sbjct: 178 GLVEIISSKLK---YREPTPIQRITIPNVLRGRDFVGIAATGSGKTLAFLLPSLCQLSKL 234

Query: 204 ---SHSGKI-GARAVILSPSRELAMQ----TFNVFKDFARGTELRSVLLTGGDSLEEQFS 255
              +   K+ G   +IL+P+RELA Q       V   ++R T++ S++  GG S+EE   
Sbjct: 235 PPLNDITKLDGPFTLILAPTRELAQQIEAEAKKVVNLWSRPTKVTSIV--GGHSIEEISY 292

Query: 256 MMMSNPDVIIATPGRFLHLKVEMNLDLKSVEYVVFDEADRLFEMGFQEQLNELLASLPTT 315
            +    D+++ATPGR +       L LK V  +V DEADR+ + GF++QL  +LA   + 
Sbjct: 293 SLSDGCDILVATPGRLIDCLENRMLVLKQVRILVLDEADRMIDFGFEDQLTTILARTESV 352

Query: 316 --RQTLLFSATLPNSLVDFVKAGLVNPVLVRLDAETKVSENLEMLFLSSKNADREANLLY 373
             RQT++F+AT+ N++       L  P  VR+ ++                 D +A +  
Sbjct: 353 SGRQTMMFTATMSNTVEKIANGYLTKPAYVRVGSD-----------------DTKAQIKQ 395

Query: 374 ILQEVIRIPLATSEQLLKLQKSTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMPAANELP 433
           I++      L + EQ  + QK                                 A + LP
Sbjct: 396 IVEY-----LPSEEQ--RFQKM--------------------------------ARDILP 416

Query: 434 SEKATIL-FVPTRHHVEY-ISQLLRDCGYLISYIYGTLDQHARKNQLYNFRAGLTSILVV 491
             +A I+ F+  +   ++ +S+   +  + ++ ++G+  Q  R++ L   R G   I++ 
Sbjct: 417 KFRAPIMIFINYKKTADWLVSKFSSETRFKVTTLHGSKSQEQREHSLNMLRTGKVDIMIA 476

Query: 492 TDVAARGVDIPMLANVINYTLPGSSKIFVHRVGRTARAGNKGWAYSIVA 540
           TDVA RG+DIP ++ V+N+ +  + + +VHR+GRT RAG  G A + + 
Sbjct: 477 TDVAGRGIDIPDVSLVVNFQMCTAFESYVHRIGRTGRAGRSGCALTFLG 525

>Skud_12.59 Chr12 (122973..125249) [2277 bp, 758 aa] {ON} YLL008W
           (REAL)
          Length = 758

 Score =  185 bits (469), Expect = 7e-48,   Method: Compositional matrix adjust.
 Identities = 105/265 (39%), Positives = 158/265 (59%), Gaps = 9/265 (3%)

Query: 111 SGQTQAGEEEDDVNE----YFS--TNNLEKQKHKKGSFPSFGLSKIVLNNIKRKGFRQPT 164
           +G+     EEDD  E    +++  T   E +K    +F S  LS+ VL  +   G+  P+
Sbjct: 202 TGKDDEVAEEDDSEEAKADFYAPETEGNEAKKQMYDNFNSLSLSRPVLKGLANLGYVTPS 261

Query: 165 PIQRKTIPLILQSRDIVGMARTGSGKTAAFILPMVEKLKSHSGKIGA-RAVILSPSRELA 223
           PIQ  TIP+ L  +DI+  A TGSGKTAAF++P++E+L     KI + R ++L P+RELA
Sbjct: 262 PIQSATIPIALLGKDIIAGAVTGSGKTAAFMIPIIERLLYKPAKIASTRVIVLLPTRELA 321

Query: 224 MQTFNVFKDFARGT-ELRSVLLTGGDSLEEQFSMMMSNPDVIIATPGRFL-HLKVEMNLD 281
           +Q  +V K  AR    +   L  GG +L +Q  M+ S PD++IATPGRF+ H++   + +
Sbjct: 322 LQVADVGKQIARFVPSITFGLAVGGLNLRQQEQMLKSRPDIVIATPGRFIDHIRNSASFN 381

Query: 282 LKSVEYVVFDEADRLFEMGFQEQLNELLASLPTTRQTLLFSATLPNSLVDFVKAGLVNPV 341
           + SVE +V DEADR+ E GFQ++LNE++  LP++RQ LLFSAT+ + +   V   L  PV
Sbjct: 382 VDSVEILVMDEADRMLEEGFQDELNEIMGLLPSSRQNLLFSATMNSKIKSLVSLSLKRPV 441

Query: 342 LVRLDAETKVSENLEMLFLSSKNAD 366
            + +D   K +  L   F+  +  D
Sbjct: 442 RIMIDPPKKAATKLTQEFVRIRKRD 466

 Score = 82.0 bits (201), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 36/107 (33%), Positives = 65/107 (60%)

Query: 434 SEKATILFVPTRHHVEYISQLLRDCGYLISYIYGTLDQHARKNQLYNFRAGLTSILVVTD 493
           ++K  ++FV  +     +  ++   G  +  ++G+L Q  R + +  F+     +L+ TD
Sbjct: 484 AQKRIVVFVARKESAHRLRIIMGLLGMSVGELHGSLTQEQRLDSVSKFKNLEVPVLICTD 543

Query: 494 VAARGVDIPMLANVINYTLPGSSKIFVHRVGRTARAGNKGWAYSIVA 540
           +A+RG+DIP +  VINY +P S ++++HRVGRTARAG +G + + V 
Sbjct: 544 LASRGLDIPKIEVVINYDMPKSHEVYLHRVGRTARAGREGRSVTFVG 590

>SAKL0G11748g Chr7 complement(998525..1000816) [2292 bp, 763 aa]
           {ON} highly similar to uniprot|P20448 Saccharomyces
           cerevisiae YJL033W HCA4 Putative nucleolar DEAD box RNA
           helicase high-copy number suppression of a U14 snoRNA
           processing mutant suggests an involvement in 18S rRNA
           synthesis
          Length = 763

 Score =  184 bits (468), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 124/399 (31%), Positives = 194/399 (48%), Gaps = 57/399 (14%)

Query: 141 SFPSFGLSKIVLNNIKRKGFRQPTPIQRKTIPLILQSRDIVGMARTGSGKTAAFILPMVE 200
           +F    +S   L  +K   F + T IQ+ +IP+ L+  D++G A+TGSGKT AF++P++E
Sbjct: 42  TFDDLPISGNTLKGLKESAFIKMTEIQKNSIPVSLKGHDLLGAAKTGSGKTLAFLIPVIE 101

Query: 201 KL--KSHSGKIGARAVILSPSRELAMQTFNVFKDFARGTELRSVLLTGGDSLEEQFSMMM 258
           KL  +  +   G  A+I+SP+RELAMQT+ V     R T   + L+ GG  ++ +   + 
Sbjct: 102 KLYREKWTEHDGLGALIISPTRELAMQTYEVLVKIGRHTSFSAGLVIGGKDVKFELERI- 160

Query: 259 SNPDVIIATPGRFL-HLKVEMNLDLKSVEYVVFDEADRLFEMGFQEQLNELLASLPTTRQ 317
           S  +V+I TPGR L H+   + L+   ++ +V DEADR  +MGF+  L+ ++++LP TRQ
Sbjct: 161 SKINVLIGTPGRILQHMDQAIGLNTSGLQMLVLDEADRCLDMGFKRTLDAIVSNLPPTRQ 220

Query: 318 TLLFSATLPNSLVDFVKAGLVNPVLVRLDAETKVSENLEMLFLSSKNADREANLLYILQE 377
           TLLFSAT   SL D  +  L +          K    +++L      AD  A    + Q 
Sbjct: 221 TLLFSATQSQSLADLARLSLTD---------YKSVGTMDVL----NPADTPATPETLQQS 267

Query: 378 VIRIPLATS-EQLLKLQKSTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMPAANELPSEK 436
            I++PLA   + L    K+                                    L S+ 
Sbjct: 268 YIQVPLADKLDVLFSFIKT-----------------------------------HLKSK- 291

Query: 437 ATILFVPTRHHVEYISQLLRDC--GYLISYIYGTLDQHARKNQLYNFRAGLTSILVVTDV 494
             I+F+ +   V ++ +  R    G  + +++G   Q AR   L  F       L  TDV
Sbjct: 292 -MIVFLSSSKQVHFVYETFRKLQPGISLMHLHGRQKQTARTETLDKFSRAQQVCLFATDV 350

Query: 495 AARGVDIPMLANVINYTLPGSSKIFVHRVGRTARAGNKG 533
            ARG+D P +  V+    P     ++HR GR+AR G +G
Sbjct: 351 VARGIDFPAVDWVVQVDCPEDVDTYIHRAGRSARYGKQG 389

>Suva_4.494 Chr4 (862220..864772) [2553 bp, 850 aa] {ON} YBR237W
           (REAL)
          Length = 850

 Score =  183 bits (465), Expect = 5e-47,   Method: Compositional matrix adjust.
 Identities = 118/408 (28%), Positives = 212/408 (51%), Gaps = 51/408 (12%)

Query: 145 FGLSKIVLNNIKRK-GFRQPTPIQRKTIPLILQSRDIVGMARTGSGKTAAFILPMVEKLK 203
            GLS   +N I  +  F   TPIQ + +P I+  RD++G+++TGSGKT +++LP++ ++K
Sbjct: 260 LGLSTDTMNLITSELQFDSLTPIQSQALPAIMSGRDVIGISKTGSGKTISYLLPLLRQVK 319

Query: 204 SH----SGKIGARAVILSPSRELAMQT---FNVFKDFARGTELRSVLLTGGDSLEEQFSM 256
           +       + G   +IL+P+RELA+Q     N F +   G  +RSV  TGG  +++Q + 
Sbjct: 320 AQRPLSKHETGPLGLILAPTRELALQIHEEVNKFTETDAG--IRSVCCTGGSEMKKQITD 377

Query: 257 MMSNPDVIIATPGRFLHLKVEMN----LDLKSVEYVVFDEADRLFEMGFQEQLNELLASL 312
           +    ++++ATPGRF+ + + +N    L  K + +V+ DEADRLF++GF+ Q+ +++ ++
Sbjct: 378 LKRGAEIVVATPGRFIDI-LTLNDGKLLSTKRITFVIMDEADRLFDLGFEPQITQIMKTV 436

Query: 313 PTTRQTLLFSATLPNSLVDFVKAGLVNPVLVRLDAETKVSENLEMLFLSSKNADRE-ANL 371
              +Q +LFSAT PN L  F    L +P+ + ++++  V+EN++  F    + D +  NL
Sbjct: 437 RPDKQFVLFSATFPNKLRSFAVRVLRSPISITINSKGMVNENVKQKFKICHSEDEKFDNL 496

Query: 372 LYILQEVIRIPLATSEQLLKLQKSTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMPAANE 431
           + IL++        +E L ++Q                                      
Sbjct: 497 MQILRK-------RNELLDEVQSDVDGETSDLEEV------------------------- 524

Query: 432 LPSEKATILFVPTRHHVEYISQLLRDCGYLISYIYGTLDQHARKNQLYNFRAGLTSILVV 491
              +   I+FV ++   ++IS+ L + G +   I+       R   L  F+    SIL+ 
Sbjct: 525 ---DAKAIIFVSSQQICDFISKKLANVGVVTYAIHAGKPYQERVMNLEKFKREKNSILLC 581

Query: 492 TDVAARGVDIPMLANVINYTLPGSSKIFVHRVGRTARAGNKGWAYSIV 539
           T+V +RG+++P ++ VI Y    +   +VH  GRTAR    G A +++
Sbjct: 582 TEVLSRGLNVPEVSLVIIYNSVKTFAQYVHTTGRTARGSRSGTAITLL 629

>Smik_12.55 Chr12 (118743..120950) [2208 bp, 735 aa] {ON} YLL008W
           (REAL)
          Length = 735

 Score =  182 bits (461), Expect = 5e-47,   Method: Compositional matrix adjust.
 Identities = 98/237 (41%), Positives = 146/237 (61%), Gaps = 3/237 (1%)

Query: 133 EKQKHKKGSFPSFGLSKIVLNNIKRKGFRQPTPIQRKTIPLILQSRDIVGMARTGSGKTA 192
           E +K    +F S  LS+ VL  +   G+ +P+PIQ  TIP+ L  +DI+  A TGSGKTA
Sbjct: 207 EAKKQLYDNFNSLSLSRPVLKGLASLGYAKPSPIQSATIPIALLGKDIIAGAVTGSGKTA 266

Query: 193 AFILPMVEKLKSHSGKIGA-RAVILSPSRELAMQTFNVFKDFARGTE-LRSVLLTGGDSL 250
           AF++P++E+L     KI + R ++L P+RELA+Q  +V K  AR    +   L  GG +L
Sbjct: 267 AFMIPIIERLLYKPAKIASTRVIVLLPTRELAIQVADVGKQIARFVSGITFGLAVGGLNL 326

Query: 251 EEQFSMMMSNPDVIIATPGRFL-HLKVEMNLDLKSVEYVVFDEADRLFEMGFQEQLNELL 309
            +Q  M+ S PD++IATPGRF+ H++   + ++ SVE +V DEADR+ E GFQ++LNE++
Sbjct: 327 RQQEQMLKSRPDIVIATPGRFIDHIRNSASFNVDSVEILVMDEADRMLEEGFQDELNEIM 386

Query: 310 ASLPTTRQTLLFSATLPNSLVDFVKAGLVNPVLVRLDAETKVSENLEMLFLSSKNAD 366
             LP+ RQ LLFSAT+ + +   V   L  PV + +D   K +  L   F+  +  D
Sbjct: 387 GLLPSNRQNLLFSATMNSKIKSLVSLSLKKPVRIMIDPPKKAATKLTQEFVRIRKRD 443

 Score = 82.8 bits (203), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 42/109 (38%), Positives = 66/109 (60%), Gaps = 6/109 (5%)

Query: 435 EKATILFVP---TRHHVEYISQLLRDCGYLISYIYGTLDQHARKNQLYNFRAGLTSILVV 491
           +K  ++FV    T H +  I  LL   G  +  ++G+L Q  R + +  F+     +L+ 
Sbjct: 462 QKRIVVFVARKETAHRLRIIMGLL---GMSVGELHGSLTQEQRLDSVNKFKNLEVPVLIC 518

Query: 492 TDVAARGVDIPMLANVINYTLPGSSKIFVHRVGRTARAGNKGWAYSIVA 540
           TD+A+RG+DIP +  VINY +P S +I++HRVGRTARAG +G + + V 
Sbjct: 519 TDLASRGLDIPKIEVVINYDMPKSHEIYLHRVGRTARAGREGRSVTFVG 567

>YLL008W Chr12 (131729..133987) [2259 bp, 752 aa] {ON}
           DRS1Nucleolar DEAD-box protein required for ribosome
           assembly and function, including synthesis of 60S
           ribosomal subunits; constituent of 66S pre-ribosomal
           particles
          Length = 752

 Score =  182 bits (462), Expect = 6e-47,   Method: Compositional matrix adjust.
 Identities = 99/241 (41%), Positives = 147/241 (60%), Gaps = 3/241 (1%)

Query: 129 TNNLEKQKHKKGSFPSFGLSKIVLNNIKRKGFRQPTPIQRKTIPLILQSRDIVGMARTGS 188
           T   E +K    +F S  LS+ VL  +   G+ +P+PIQ  TIP+ L  +DI+  A TGS
Sbjct: 220 TEGDEAKKQMYENFNSLSLSRPVLKGLASLGYVKPSPIQSATIPIALLGKDIIAGAVTGS 279

Query: 189 GKTAAFILPMVEKLKSHSGKIGA-RAVILSPSRELAMQTFNVFKDFARGTE-LRSVLLTG 246
           GKTAAF++P++E+L     KI + R ++L P+RELA+Q  +V K  AR    +   L  G
Sbjct: 280 GKTAAFMIPIIERLLYKPAKIASTRVIVLLPTRELAIQVADVGKQIARFVSGITFGLAVG 339

Query: 247 GDSLEEQFSMMMSNPDVIIATPGRFL-HLKVEMNLDLKSVEYVVFDEADRLFEMGFQEQL 305
           G +L +Q  M+ S PD++IATPGRF+ H++   + ++ SVE +V DEADR+ E GFQ++L
Sbjct: 340 GLNLRQQEQMLKSRPDIVIATPGRFIDHIRNSASFNVDSVEILVMDEADRMLEEGFQDEL 399

Query: 306 NELLASLPTTRQTLLFSATLPNSLVDFVKAGLVNPVLVRLDAETKVSENLEMLFLSSKNA 365
           NE++  LP+ RQ LLFSAT+ + +   V   L  PV + +D   K +  L   F+  +  
Sbjct: 400 NEIMGLLPSNRQNLLFSATMNSKIKSLVSLSLKKPVRIMIDPPKKAATKLTQEFVRIRKR 459

Query: 366 D 366
           D
Sbjct: 460 D 460

 Score = 83.2 bits (204), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 42/109 (38%), Positives = 66/109 (60%), Gaps = 6/109 (5%)

Query: 435 EKATILFVP---TRHHVEYISQLLRDCGYLISYIYGTLDQHARKNQLYNFRAGLTSILVV 491
           +K  ++FV    T H +  I  LL   G  +  ++G+L Q  R + +  F+     +L+ 
Sbjct: 479 QKRIVVFVARKETAHRLRIIMGLL---GMSVGELHGSLTQEQRLDSVNKFKNLEVPVLIC 535

Query: 492 TDVAARGVDIPMLANVINYTLPGSSKIFVHRVGRTARAGNKGWAYSIVA 540
           TD+A+RG+DIP +  VINY +P S +I++HRVGRTARAG +G + + V 
Sbjct: 536 TDLASRGLDIPKIEVVINYDMPKSYEIYLHRVGRTARAGREGRSVTFVG 584

>KNAG0M00660 Chr13 complement(107772..110426) [2655 bp, 884 aa] {ON}
           Anc_6.148 YBR237W
          Length = 884

 Score =  183 bits (464), Expect = 8e-47,   Method: Compositional matrix adjust.
 Identities = 121/436 (27%), Positives = 215/436 (49%), Gaps = 63/436 (14%)

Query: 119 EEDDVNEYFSTNNLEKQKHKKGSFPSFGLSKIVLNNIKRK------GFRQPTPIQRKTIP 172
           +ED V   FS  N+ K K +    P+   S++ L+  K         F   TPIQ + +P
Sbjct: 279 QEDMVELRFSLGNI-KVKGENCPKPATRWSQLGLDTSKMNLIENVFKFDSLTPIQAQALP 337

Query: 173 LILQSRDIVGMARTGSGKTAAFILPMVEKLKSH----SGKIGARAVILSPSRELAMQTFN 228
            I+  RD++G+++TGSGKT +++LP++  +K+       + G  A+I++P+RELA+Q + 
Sbjct: 338 AIMSGRDVIGISKTGSGKTISYLLPLLRHIKAQRPLSKNETGPLALIIAPTRELALQIYQ 397

Query: 229 -VFKDFARGTELRSVLLTGGDSLEEQFSMMMSNPDVIIATPGRFLHLKVEMN----LDLK 283
              +       LR++  TGG  L+ Q + +    ++++ATPGRF+ L + MN    +  K
Sbjct: 398 ETLRFLDSDKSLRAICCTGGSQLKTQINDLKRGTEIVVATPGRFIDL-LTMNSGKLISSK 456

Query: 284 SVEYVVFDEADRLFEMGFQEQLNELLASLPTTRQTLLFSATLPNSLVDFVKAGLVNPVLV 343
            + +VV DEADRLF+MGF+ Q+ +++ ++   +Q +LFSAT PN L +F    L +P+ +
Sbjct: 457 KISFVVLDEADRLFDMGFEPQVTQIMKTIRPDKQCVLFSATFPNKLRNFAMRVLKSPLSI 516

Query: 344 RLDAETKVSENLEMLFLSSKNADREANLLYILQEVIRIPLATSEQLLKLQKSTXXXXXXX 403
            +++ T V+EN+        N   + ++L  L E  +  L + EQ               
Sbjct: 517 TINSNTMVNENVTQKVELCNNELDKFDILLSLLEKHQAKLVSPEQ--------------- 561

Query: 404 XXXXXXXXXXXXXXXXXXXXXXMPAANELPSEKATILFVPTRHHVEYISQLLRDCGYLIS 463
                                          ++  I+FV ++   + +   L +  Y + 
Sbjct: 562 -------------------------------DEKVIIFVASQQICDTLYAKLENYDYDLF 590

Query: 464 YIYGTLDQHARKNQLYNFRAGLTSILVVTDVAARGVDIPMLANVINYTLPGSSKIFVHRV 523
            I+       R   L  F+    SIL+ T+V +RG+++P ++ V+ +    +   +VH  
Sbjct: 591 AIHAGKSYQERITNLNKFKETANSILICTEVLSRGLNVPEVSLVVIFNAIKTFAQYVHTT 650

Query: 524 GRTARAGNKGWAYSIV 539
           GRTAR  N G A +++
Sbjct: 651 GRTARGNNHGDAITLL 666

>CAGL0D03124g Chr4 complement(321029..323206) [2178 bp, 725 aa] {ON}
           highly similar to uniprot|P32892 Saccharomyces
           cerevisiae YLL008w DRS1 RNA helicase of the DEAD box
           family
          Length = 725

 Score =  181 bits (459), Expect = 9e-47,   Method: Compositional matrix adjust.
 Identities = 102/276 (36%), Positives = 168/276 (60%), Gaps = 13/276 (4%)

Query: 111 SGQTQAGEEEDDVNE---YFS----TNNLEKQKHKKGSFPSFGLSKIVLNNIKRKGFRQP 163
           +G  +   EED   E   +++    + N +K+ HK  +F    LS+ V+  +   G+ +P
Sbjct: 172 AGDAEEKVEEDTAEEMQAFYAPESESENAKKEVHK--TFNDLALSRPVMKGLSNLGYVKP 229

Query: 164 TPIQRKTIPLILQSRDIVGMARTGSGKTAAFILPMVEKLKSHSGKIGA-RAVILSPSREL 222
           +PIQ  TIP+ L  +DI+  A TGSGKTAAF++P++E+L     K+ + R ++L+P+REL
Sbjct: 230 SPIQSATIPIALLGKDIIAGAVTGSGKTAAFMIPIIERLLYKPAKVASTRVIVLTPTREL 289

Query: 223 AMQTFNVFKDFAR-GTELRSVLLTGGDSLEEQFSMMMSNPDVIIATPGRFL-HLKVEMNL 280
           A+Q  +V K   +  + L   L  GG +L +Q  M+ + PD++IATPGRF+ H++   + 
Sbjct: 290 AIQVADVGKKIGQFVSNLTFGLAVGGLNLRQQEQMLKTRPDIVIATPGRFIDHIRNSASF 349

Query: 281 DLKSVEYVVFDEADRLFEMGFQEQLNELLASLPTTRQTLLFSATLPNSLVDFVKAGLVNP 340
           ++ SVE +V DEADR+ E GFQ++LNE+++ LP+ RQTLLFSAT+ + +   +   L  P
Sbjct: 350 NVDSVEVLVIDEADRMLEDGFQDELNEIMSLLPSKRQTLLFSATMNSRIKQLISLSLKRP 409

Query: 341 VLVRLDAETKVSENLEMLFLSSKNADR-EANLLYIL 375
           V + +D   + +  L   F+  +  D  + +LL+ L
Sbjct: 410 VRIMIDPPKQAATKLTQEFVRIRKRDHLKPSLLFNL 445

 Score = 85.9 bits (211), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 38/106 (35%), Positives = 66/106 (62%)

Query: 435 EKATILFVPTRHHVEYISQLLRDCGYLISYIYGTLDQHARKNQLYNFRAGLTSILVVTDV 494
           +K  ++FV  +     +  +L   G  ++ ++G+L Q  R + +  F++    +L+ TD+
Sbjct: 454 QKRIVVFVARKDMAHKLRIILGLLGMAVAELHGSLTQEQRLDSVNKFKSLQVPVLICTDL 513

Query: 495 AARGVDIPMLANVINYTLPGSSKIFVHRVGRTARAGNKGWAYSIVA 540
           A+RG+DIP +  VINY +P S +I++HRVGRTARAG +G + + V 
Sbjct: 514 ASRGLDIPKIEVVINYDMPKSYEIYLHRVGRTARAGREGRSITFVG 559

>Suva_10.67 Chr10 (136688..138922) [2235 bp, 744 aa] {ON} YLL008W
           (REAL)
          Length = 744

 Score =  181 bits (459), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 98/240 (40%), Positives = 150/240 (62%), Gaps = 5/240 (2%)

Query: 130 NNLEKQKHKKGSFPSFGLSKIVLNNIKRKGFRQPTPIQRKTIPLILQSRDIVGMARTGSG 189
           N+ +KQ +   +F S  LS+ VL  +   G+ +P+PIQ  TIP+ L  +DI+  A TGSG
Sbjct: 215 NDAKKQMYD--NFNSLSLSRPVLKGLASLGYVKPSPIQSATIPIALLGKDIIAGAVTGSG 272

Query: 190 KTAAFILPMVEKLKSHSGKIGA-RAVILSPSRELAMQTFNVFKDFARGTE-LRSVLLTGG 247
           KTAAF++P++E+L    GKI + R ++L P+RELA+Q  +V K  AR    +   L  GG
Sbjct: 273 KTAAFMIPIIERLLYKPGKIASTRVIVLLPTRELALQVADVGKQIARFVSGITFGLAVGG 332

Query: 248 DSLEEQFSMMMSNPDVIIATPGRFL-HLKVEMNLDLKSVEYVVFDEADRLFEMGFQEQLN 306
            +L +Q  ++ S PD++IATPGRF+ H++   + ++ SVE +V DEADR+ E GFQ++LN
Sbjct: 333 LNLRQQEQLLKSRPDIVIATPGRFIDHIRNSASFNVDSVEILVMDEADRMLEEGFQDELN 392

Query: 307 ELLASLPTTRQTLLFSATLPNSLVDFVKAGLVNPVLVRLDAETKVSENLEMLFLSSKNAD 366
           E++  LP+ RQ LLFSAT+ + +   V   L  PV + +D   + +  L   F+  +  D
Sbjct: 393 EIMGLLPSNRQNLLFSATMNSKIKSLVSLSLRRPVRIMIDPPKQAATKLTQEFVRIRKRD 452

 Score = 80.5 bits (197), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 41/109 (37%), Positives = 66/109 (60%), Gaps = 6/109 (5%)

Query: 435 EKATILFVP---TRHHVEYISQLLRDCGYLISYIYGTLDQHARKNQLYNFRAGLTSILVV 491
           +K  ++FV    T H +  I  LL   G  +  ++G+L Q  R + +  F+     +LV 
Sbjct: 471 QKRIVVFVARKETAHRLRIIMGLL---GMSVGELHGSLTQEQRLDSVNKFKNLEVPVLVC 527

Query: 492 TDVAARGVDIPMLANVINYTLPGSSKIFVHRVGRTARAGNKGWAYSIVA 540
           TD+A+RG+DIP +  V+NY +P S +I++HRVGRTARA  +G + ++V 
Sbjct: 528 TDLASRGLDIPKIEVVVNYDMPKSYEIYLHRVGRTARADREGRSVTLVG 576

>AER301C Chr5 complement(1188485..1189792) [1308 bp, 435 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YHR169W
           (DBP8)
          Length = 435

 Score =  175 bits (443), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 128/430 (29%), Positives = 186/430 (43%), Gaps = 67/430 (15%)

Query: 141 SFPSFGLSKIVLNNIKRKGFRQPTPIQRKTIPLILQSRDIVGMARTGSGKTAAFILPMVE 200
           +F   G++K +   +      QPT IQ+  IP IL  RD +G A+TGSGKT AF  PM+ 
Sbjct: 7   TFKDLGVAKWLAEALNSMKITQPTTIQKACIPEILAGRDCIGGAKTGSGKTIAFAAPMLT 66

Query: 201 KLKSHSGKIGARAVILSPSRELAMQTFNVFKDFARGTELRSVLLTGGDSLEEQFSMMMSN 260
           K  +     G   ++L+P+RELAMQ    F        +R  L+ GG+ +  Q   +   
Sbjct: 67  KWSADP--CGMFGIVLTPTRELAMQIAEQFTALGSVMNIRVALVVGGEDIVSQALELQRK 124

Query: 261 PDVIIATPGRFLHLKVEMNLD----LKSVEYVVFDEADRLFEMGFQEQLNELLASLPT-- 314
           P  IIATPGR  H  +    D    LK V Y+V DEAD L    F + L   +  LP   
Sbjct: 125 PHFIIATPGRLAHHIMHSGEDTIGGLKRVRYLVLDEADILLTDTFSDALATCVQILPPKE 184

Query: 315 TRQTLLFSATLPNSLVDFVKAGLVN--PVLVRLDAET----KVSENLEMLFLSSKNADRE 368
            RQ LLF+AT+ + ++    A   +  P L     E      V  +L+  +L      +E
Sbjct: 185 KRQNLLFTATMTDQVLALKDAPPTSGKPPLFSFHVENLDDLAVPASLQTTYLLVPEHVKE 244

Query: 369 ANLLYILQEVIRIPLATSEQLLKLQKSTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMPA 428
           A L  +L                                                    +
Sbjct: 245 AYLYQVL----------------------------------------------------S 252

Query: 429 ANELPSEKATILFVPTRHHVEYISQLLRDCGYLISYIYGTLDQHARKNQLYNFRAGLTSI 488
           + E  S+ A + FV      E + ++L      ++ ++  + Q  R N L  FRA    +
Sbjct: 253 SEEYKSKSAIV-FVNRTISAEILRRMLMQLEIRVTSLHSQMPQRERTNSLQRFRANAARV 311

Query: 489 LVVTDVAARGVDIPMLANVINYTLPGSSKIFVHRVGRTARAGNKGWAYSIVAXXXXXXXX 548
           L+ TDVA+RG+DIP +  V+NY +P +   ++HR GRTARAG  G A S +A        
Sbjct: 312 LIATDVASRGLDIPAVQLVVNYDIPANPDTYIHRAGRTARAGRGGEALSFIAPKDVSRIQ 371

Query: 549 XXXXXXGKKI 558
                 GKK+
Sbjct: 372 AIEERIGKKM 381

>CAGL0K07029g Chr11 complement(690501..692951) [2451 bp, 816 aa]
           {ON} similar to uniprot|P21372 Saccharomyces cerevisiae
           YBR237w Pre-mRNA processing RNA helicase PRP5
          Length = 816

 Score =  182 bits (461), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 118/389 (30%), Positives = 196/389 (50%), Gaps = 59/389 (15%)

Query: 159 GFRQPTPIQRKTIPLILQSRDIVGMARTGSGKTAAFILPMVEKLKSH----SGKIGARAV 214
            ++  TPIQ +TIP I+  RD++G+++TGSGKT +++LPM+  +K+     +G+ G  AV
Sbjct: 271 SYKSLTPIQTQTIPAIMSGRDVIGISKTGSGKTISYLLPMIRHVKAQKKLRNGETGPIAV 330

Query: 215 ILSPSRELAMQTFNVFKDFARGTELRSVLLTGGDSLEEQFSMMMSNPDVIIATPGRFLHL 274
           I +P+RELA+Q     +      ++ S+  TGG  L++Q   + +  ++ IATPGRF+ L
Sbjct: 331 IFAPTRELAVQINEEVQKLISDLDISSICCTGGSDLKKQIDKLKTGVEIAIATPGRFIDL 390

Query: 275 KVEMNLDLKS---VEYVVFDEADRLFEMGFQEQLNELLASLPTTRQTLLFSATLPNSLVD 331
                 +L S   + +VV DEADRLF+ GF+ Q+  +L ++   RQ +LFSAT P+ + +
Sbjct: 391 LSLNGGNLVSTLRISFVVMDEADRLFDFGFEPQIASVLRTVRPDRQCVLFSATFPSKVSN 450

Query: 332 FVKAGLVNPVLVRLDAETKVSENLEMLF-LSSKNADREANLLYILQEVIRIPLATSEQLL 390
           F    L +P+ + ++AE  V+E +   F + S  +D+   LL                LL
Sbjct: 451 FASRFLDSPLQITVNAEGMVNERINQKFTICSDESDKFKELL---------------SLL 495

Query: 391 KLQKSTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMPAANELPSEKATILFVPTRHHVEY 450
           K+  S                                   E   EK  I FV ++   + 
Sbjct: 496 KVFNS-----------------------------------ETVDEKTII-FVSSQQICDI 519

Query: 451 ISQLLRDCGYLISYIYGTLDQHARKNQLYNFRAGLTSILVVTDVAARGVDIPMLANVINY 510
           I + L D    +  I+     + R+  L  F+    SIL+ T+V +RG+++P ++ VI Y
Sbjct: 520 IEKRLTDYSEKLYSIHAGRPYNERRQNLELFKKTSNSILLCTEVMSRGLNVPEVSRVILY 579

Query: 511 TLPGSSKIFVHRVGRTARAGNKGWAYSIV 539
               +   +VH  GRTAR   +G + S++
Sbjct: 580 NSAKTFAQYVHSTGRTARGTREGTSISLL 608

>NCAS0A01550 Chr1 complement(302857..305103) [2247 bp, 748 aa] {ON}
           Anc_5.208
          Length = 748

 Score =  180 bits (456), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 98/237 (41%), Positives = 145/237 (61%), Gaps = 7/237 (2%)

Query: 135 QKHKKGSFPSFGLSKIVLNNIKRKGFRQPTPIQRKTIPLILQSRDIVGMARTGSGKTAAF 194
           +K    +F S  LS+ VL  +   G+ +P+PIQ  TIP+ L  +DI+  A TGSGKTAAF
Sbjct: 221 KKQTYANFNSLSLSRPVLKGLATLGYTKPSPIQSATIPVALSGKDIIAGAVTGSGKTAAF 280

Query: 195 ILPMVEKLKSHSGKIGA-RAVILSPSRELAMQTFNVFKD---FARGTELRSVLLTGGDSL 250
           ++P++E+L   S KI A R ++L+P+RELA+Q  +V K    F  G      L  GG +L
Sbjct: 281 MIPVIERLLFKSAKIAATRVIVLTPTRELAIQISDVGKKIGKFINGITFG--LAVGGLNL 338

Query: 251 EEQFSMMMSNPDVIIATPGRFL-HLKVEMNLDLKSVEYVVFDEADRLFEMGFQEQLNELL 309
            +Q   + + PD++IATPGRF+ H++   + ++ SVE +V DEADR+ E GFQE+LNE++
Sbjct: 339 RQQEQELKARPDIVIATPGRFIDHIRNSASFNVDSVEILVIDEADRMLEEGFQEELNEIM 398

Query: 310 ASLPTTRQTLLFSATLPNSLVDFVKAGLVNPVLVRLDAETKVSENLEMLFLSSKNAD 366
             LP  RQTLLFSAT+ + +   V   L  PV + +D   + +  L   F+  +  D
Sbjct: 399 QLLPNKRQTLLFSATMNSKIKQLVSLSLRKPVRIMIDPPKQAASRLTQEFVRIRARD 455

 Score = 85.5 bits (210), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 39/106 (36%), Positives = 65/106 (61%)

Query: 435 EKATILFVPTRHHVEYISQLLRDCGYLISYIYGTLDQHARKNQLYNFRAGLTSILVVTDV 494
           +K  ++FV  +     +  +L   G  ++ ++G+L Q  R   +  F++    +L+ TD+
Sbjct: 474 QKRMVVFVSRKEMAHRLRIILGLLGMNVAELHGSLSQEQRLESVTKFKSLEIPVLICTDL 533

Query: 495 AARGVDIPMLANVINYTLPGSSKIFVHRVGRTARAGNKGWAYSIVA 540
           A+RG+DIP +  VINY +P S +I++HRVGRTARAG +G + S V 
Sbjct: 534 ASRGLDIPKIEVVINYDMPKSYEIYLHRVGRTARAGREGRSVSFVG 579

>TDEL0E04210 Chr5 complement(786151..788373) [2223 bp, 740 aa] {ON}
           Anc_5.208 YLL008W
          Length = 740

 Score =  179 bits (455), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 98/236 (41%), Positives = 146/236 (61%), Gaps = 5/236 (2%)

Query: 134 KQKHKKGSFPSFGLSKIVLNNIKRKGFRQPTPIQRKTIPLILQSRDIVGMARTGSGKTAA 193
           KQ H    F S  LS+ VL  +   G+ +P+PIQ  TIP+ L  +DI+  A TGSGKTAA
Sbjct: 215 KQVH--NDFNSLSLSRPVLKGLGDLGYTRPSPIQSATIPIALLGKDIIAGAVTGSGKTAA 272

Query: 194 FILPMVEKLKSHSGKIGA-RAVILSPSRELAMQTFNVFKDFARGTE-LRSVLLTGGDSLE 251
           F++P++E+L     KI + R ++L+P+RELA+Q  +V K   +    L   L  GG +L 
Sbjct: 273 FMIPIIERLLYKPAKIASTRVIVLTPTRELAIQVSDVAKKLGKYVSGLTFGLAVGGLNLR 332

Query: 252 EQFSMMMSNPDVIIATPGRFL-HLKVEMNLDLKSVEYVVFDEADRLFEMGFQEQLNELLA 310
           +Q   + + PD+++ATPGRF+ H++   + ++ SVE +V DEADR+ E GFQE+LNE+L+
Sbjct: 333 QQEQSLKARPDIVVATPGRFIDHIRNSASFNVDSVEVLVIDEADRMLEEGFQEELNEILS 392

Query: 311 SLPTTRQTLLFSATLPNSLVDFVKAGLVNPVLVRLDAETKVSENLEMLFLSSKNAD 366
            LP+ RQTLLFSAT+ + +   V   L  PV V +D   + +  L   F+  +  D
Sbjct: 393 LLPSKRQTLLFSATMNSKIKQLVSLTLKRPVRVMIDPPKQAASKLTQEFVRIRKRD 448

 Score = 84.7 bits (208), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 39/106 (36%), Positives = 65/106 (61%)

Query: 435 EKATILFVPTRHHVEYISQLLRDCGYLISYIYGTLDQHARKNQLYNFRAGLTSILVVTDV 494
           +K  ++FV  +     +  +L   G  +  ++G+L Q  R   +  F++    ILV TD+
Sbjct: 467 QKRMVVFVARKEMAHRLRIILGLLGISVGELHGSLSQEQRLQSVNQFKSLEVPILVCTDL 526

Query: 495 AARGVDIPMLANVINYTLPGSSKIFVHRVGRTARAGNKGWAYSIVA 540
           A+RG+DIP +  VINY +P + ++++HRVGRTARAG +G + S+V 
Sbjct: 527 ASRGLDIPKIEVVINYDMPKNYEVYLHRVGRTARAGREGRSVSLVG 572

>KNAG0H02520 Chr8 complement(463527..465791) [2265 bp, 754 aa] {ON}
           Anc_5.208 YLL008W
          Length = 754

 Score =  179 bits (454), Expect = 5e-46,   Method: Compositional matrix adjust.
 Identities = 97/251 (38%), Positives = 154/251 (61%), Gaps = 13/251 (5%)

Query: 125 EYFSTNN----LEKQKHKKGSFPSFGLSKIVLNNIKRKGFRQPTPIQRKTIPLILQSRDI 180
           E+++++N     +KQ H+  +F S  LS+ VL  +   G+ +P+PIQ  TIP+ LQ +D+
Sbjct: 222 EFYASDNEADDAKKQTHE--TFNSLSLSRPVLKGLAHLGYTKPSPIQSATIPVALQGKDV 279

Query: 181 VGMARTGSGKTAAFILPMVEKLKSHSGKIG-ARAVILSPSRELAMQTFNVFK---DFARG 236
           +  A TGSGKTAAF++P++E+L     K+   R ++L+P+RELA+Q  +V K    F  G
Sbjct: 280 IAGAVTGSGKTAAFMIPIIERLLFKPSKVAMTRVIVLTPTRELAIQISDVAKKIGQFVSG 339

Query: 237 TELRSVLLTGGDSLEEQFSMMMSNPDVIIATPGRFL-HLKVEMNLDLKSVEYVVFDEADR 295
             L   L  GG +L +Q   + + PD++IATPGRF+ H++   + ++ SVE +V DEADR
Sbjct: 340 --LTFGLAVGGLNLRQQEQALKARPDIVIATPGRFIDHIRNSASFNVDSVEILVLDEADR 397

Query: 296 LFEMGFQEQLNELLASLPTTRQTLLFSATLPNSLVDFVKAGLVNPVLVRLDAETKVSENL 355
           + E GFQ++L E++  LP+ RQ LLFSAT+ + +   V   L  PV + +D   + +  L
Sbjct: 398 MLEEGFQDELKEIMTMLPSKRQNLLFSATMNSKIKSLVSLSLRRPVRIMIDPPKQAASKL 457

Query: 356 EMLFLSSKNAD 366
              F+  +  D
Sbjct: 458 TQEFVRIRKRD 468

 Score = 87.0 bits (214), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 38/107 (35%), Positives = 67/107 (62%)

Query: 434 SEKATILFVPTRHHVEYISQLLRDCGYLISYIYGTLDQHARKNQLYNFRAGLTSILVVTD 493
           ++K  ++FV  +     +  +L   G  ++ ++G+L Q  R   +  F++    +L+ TD
Sbjct: 486 AQKRIVVFVARKETAHRLRIILGLLGMAVAELHGSLTQEQRLESVTRFKSLDVPVLICTD 545

Query: 494 VAARGVDIPMLANVINYTLPGSSKIFVHRVGRTARAGNKGWAYSIVA 540
           +A+RG+DIP +  VINY +P S +I++HRVGRTARAG +G + ++V 
Sbjct: 546 LASRGLDIPKIEVVINYDMPKSHEIYLHRVGRTARAGREGRSVTLVG 592

>KLLA0D09504g Chr4 complement(801783..804095) [2313 bp, 770 aa] {ON}
           highly similar to uniprot|P20448 Saccharomyces
           cerevisiae YJL033W HCA4 Putative nucleolar DEAD box RNA
           helicase high-copy number suppression of a U14 snoRNA
           processing mutant suggests an involvement in 18S rRNA
           synthesis
          Length = 770

 Score =  178 bits (452), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 124/398 (31%), Positives = 193/398 (48%), Gaps = 57/398 (14%)

Query: 142 FPSFGLSKIVLNNIKRKGFRQPTPIQRKTIPLILQSRDIVGMARTGSGKTAAFILPMVEK 201
           F    +S+  L  +K   F + T IQR++IPL L+  D++G A+TGSGKT AF++P++EK
Sbjct: 43  FQDLPISEQTLKGLKEAAFIKLTEIQRESIPLSLKGHDVLGAAKTGSGKTLAFLIPVIEK 102

Query: 202 L--KSHSGKIGARAVILSPSRELAMQTFNVFKDFARGTELRSVLLTGGDSLEEQFSMMMS 259
           L  +  +   G  A+I+SP+RELAMQ + V     + T   + L+ GG  +  +    +S
Sbjct: 103 LYREKWTDMDGLGALIISPTRELAMQIYEVLSKIGKHTTFSAGLVIGGKDVTFE-KERIS 161

Query: 260 NPDVIIATPGRFL-HLKVEMNLDLKSVEYVVFDEADRLFEMGFQEQLNELLASLPTTRQT 318
             +++I TPGR L H+   +  +  +++ +V DEADR  +MGF+  L+ ++ +LP +RQT
Sbjct: 162 RINILIGTPGRILQHMDQAVGFNTSNLQLLVLDEADRCLDMGFKRTLDAIINNLPASRQT 221

Query: 319 LLFSATLPNSLVDFVKAGLVNPVLVRLDAETKVSENLEMLFLSSKNADREANLLYILQEV 378
           LLFSAT   SL D  +  L +          K    +E+L  +S +A  E+    + Q  
Sbjct: 222 LLFSATQSQSLDDLARLSLTD---------YKQVGTMEVLNANSSSATPES----LQQSY 268

Query: 379 IRIPLATS-EQLLKLQKSTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMPAANELPSEKA 437
           I +PL    + L    KS                                    L S+  
Sbjct: 269 IEVPLPDKLDILFSFIKS-----------------------------------HLKSK-- 291

Query: 438 TILFVPTRHHVEYISQLLRDC--GYLISYIYGTLDQHARKNQLYNFRAGLTSILVVTDVA 495
            I+F+ +   V ++ +  R    G  + +++G   Q AR   L  F       L  TDV 
Sbjct: 292 LIVFLSSSKQVHFVYETFRKLQPGISLMHLHGRQKQTARTETLDKFSRAQHVCLFSTDVV 351

Query: 496 ARGVDIPMLANVINYTLPGSSKIFVHRVGRTARAGNKG 533
           ARG+D P +  VI    P     ++HRVGR AR G +G
Sbjct: 352 ARGIDFPSVDWVIQVDCPEDVDTYIHRVGRAARFGKEG 389

>NDAI0C02490 Chr3 complement(570276..572591) [2316 bp, 771 aa] {ON}
           Anc_5.208
          Length = 771

 Score =  178 bits (451), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 94/240 (39%), Positives = 149/240 (62%), Gaps = 5/240 (2%)

Query: 130 NNLEKQKHKKGSFPSFGLSKIVLNNIKRKGFRQPTPIQRKTIPLILQSRDIVGMARTGSG 189
           ++ +KQ H   SF +  LS+ VL  +   G+ +P+PIQ  TIP+ L  +DI+  A TGSG
Sbjct: 241 DDAKKQTHT--SFNTLSLSRPVLKGLANLGYNKPSPIQSATIPIALLGKDIIAGAVTGSG 298

Query: 190 KTAAFILPMVEKLKSHSGKIGA-RAVILSPSRELAMQTFNVFKDFARGTE-LRSVLLTGG 247
           KTAAF++P++E+L     K+ + R ++L+P+RELA+Q  +V K   +    L   L  GG
Sbjct: 299 KTAAFMIPIIERLLFKPAKVSSTRVIVLTPTRELAIQIADVAKKIGKFVNGLTFGLAVGG 358

Query: 248 DSLEEQFSMMMSNPDVIIATPGRFL-HLKVEMNLDLKSVEYVVFDEADRLFEMGFQEQLN 306
            +L +Q  ++   PD++IATPGRF+ H++   + ++ SVE +V DEADR+ E GFQE+LN
Sbjct: 359 LNLRQQEQILKQRPDIVIATPGRFIDHVRNSASFNVDSVEILVMDEADRMLEEGFQEELN 418

Query: 307 ELLASLPTTRQTLLFSATLPNSLVDFVKAGLVNPVLVRLDAETKVSENLEMLFLSSKNAD 366
           E++  LPT RQT+LFSAT+ + +   +   L  PV + ++   + +  L   F+  +  D
Sbjct: 419 EIMQLLPTKRQTMLFSATMNSKIKQLINLSLKKPVRIMINPPKQAASKLTQEFVRIRTRD 478

 Score = 86.7 bits (213), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 40/107 (37%), Positives = 66/107 (61%)

Query: 434 SEKATILFVPTRHHVEYISQLLRDCGYLISYIYGTLDQHARKNQLYNFRAGLTSILVVTD 493
           S+K  ++FV  +     +  +L   G  ++ ++G+L Q  R   +  F++    +L+ TD
Sbjct: 496 SQKRMVVFVARKETAHKLRIILGLLGMNVAELHGSLTQEQRLESVTKFKSLEIPVLICTD 555

Query: 494 VAARGVDIPMLANVINYTLPGSSKIFVHRVGRTARAGNKGWAYSIVA 540
           +A+RG+DIP +  VINY +P S  I++HRVGRTARAG +G + S+V 
Sbjct: 556 LASRGLDIPKIEVVINYDMPKSYDIYLHRVGRTARAGREGRSVSLVG 602

>Kpol_534.53 s534 (137204..139462) [2259 bp, 752 aa] {ON}
           (137204..139462) [2259 nt, 753 aa]
          Length = 752

 Score =  177 bits (448), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 95/243 (39%), Positives = 152/243 (62%), Gaps = 5/243 (2%)

Query: 141 SFPSFGLSKIVLNNIKRKGFRQPTPIQRKTIPLILQSRDIVGMARTGSGKTAAFILPMVE 200
           +F S  LS+ VL  +   G+ +P+PIQ  TIP+ L  +DI+  A TGSGKTAAF++P++E
Sbjct: 232 TFNSLTLSRPVLKGLSDLGYTKPSPIQSATIPIGLSGKDIIAGAVTGSGKTAAFMIPIIE 291

Query: 201 KLKSHSGKIGA-RAVILSPSRELAMQTFNVFKDFARGTE-LRSVLLTGGDSLEEQFSMMM 258
           +L     K+ + R ++L+P+RELA+Q  +V K   +    L   L  GG +L +Q   + 
Sbjct: 292 RLLYKPAKVASTRVIVLTPTRELAIQIADVGKKIGKYVSGLTFGLAVGGLNLRQQEQELK 351

Query: 259 SNPDVIIATPGRFL-HLKVEMNLDLKSVEYVVFDEADRLFEMGFQEQLNELLASLPTTRQ 317
           + PD++IATPGRF+ H++   + ++ SVE +V DEADR+ E GFQE+LNE+L  LP+ RQ
Sbjct: 352 TRPDIVIATPGRFIDHVRNSSSFNVDSVEVLVMDEADRMLEEGFQEELNEILTLLPSKRQ 411

Query: 318 TLLFSATLPNSLVDFVKAGLVNPVLVRLDAETKVSENLEMLFLSSKNAD--REANLLYIL 375
           TLLFSAT+ + +   +   L  PV + ++   + +  L   F+  +  D  + A L Y++
Sbjct: 412 TLLFSATMNSRIKSLISLSLRKPVRIMINPPKQAAARLTQEFVRIRKRDHLKPALLFYLI 471

Query: 376 QEV 378
           +++
Sbjct: 472 RKL 474

 Score = 84.7 bits (208), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 38/106 (35%), Positives = 65/106 (61%)

Query: 435 EKATILFVPTRHHVEYISQLLRDCGYLISYIYGTLDQHARKNQLYNFRAGLTSILVVTDV 494
           +K  ++FV  +     +  +L   G  +  ++G+L Q  R   + NF++    +L+ TD+
Sbjct: 479 QKRIVVFVARKEMAHKLRIILGLLGMKVGELHGSLTQEQRLQSVNNFKSLEVPVLICTDL 538

Query: 495 AARGVDIPMLANVINYTLPGSSKIFVHRVGRTARAGNKGWAYSIVA 540
           A+RG+DIP +  VIN+ +P S +I++HRVGRTARAG +G + + V 
Sbjct: 539 ASRGLDIPKIEVVINFDMPKSYEIYLHRVGRTARAGREGRSVTFVG 584

>TBLA0C06160 Chr3 (1494579..1496852) [2274 bp, 757 aa] {ON}
           Anc_5.208 YLL008W
          Length = 757

 Score =  177 bits (448), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 96/249 (38%), Positives = 150/249 (60%), Gaps = 8/249 (3%)

Query: 133 EKQKHKKGSFPSFGLSKIVLNNIKRKGFRQPTPIQRKTIPLILQSRDIVGMARTGSGKTA 192
           E +K    +F +  LS+ VL  +   G+ +P+PIQ   IP+ L  +DI+  A TGSGKTA
Sbjct: 229 EAKKQVHNTFNTLSLSRPVLKGLAALGYSKPSPIQSAAIPIALLGKDIIAGAVTGSGKTA 288

Query: 193 AFILPMVEKLKSHSGKI-GARAVILSPSRELAMQTFNVFKD---FARGTELRSVLLTGGD 248
           AF++P++E+L     K+   R ++L+P+RELA+Q  +V K    F  G      L  GG 
Sbjct: 289 AFMIPIIERLLYKPAKVTSTRVIVLTPTRELAIQVSDVGKKVGKFVNGVTFG--LAVGGL 346

Query: 249 SLEEQFSMMMSNPDVIIATPGRFL-HLKVEMNLDLKSVEYVVFDEADRLFEMGFQEQLNE 307
           +L +Q   + S PD+++ATPGRF+ H++   + ++ SVE +V DEADR+ E GFQ++LNE
Sbjct: 347 NLRQQEQQLKSRPDIVVATPGRFIDHIRNSASFNVDSVEILVIDEADRMLEDGFQDELNE 406

Query: 308 LLASLPTTRQTLLFSATLPNSLVDFVKAGLVNPVLVRLDAETKVSENLEMLFLSSKNADR 367
           +++ LP+ RQTLLFSAT+ + +   +   L  PV + +D   + +  L   F+  +  D 
Sbjct: 407 IMSLLPSKRQTLLFSATMNSKIKQLISLSLKKPVRIMIDPPKQAAAKLVQEFVRIRKRDN 466

Query: 368 -EANLLYIL 375
            +  LLY L
Sbjct: 467 LKPALLYTL 475

 Score = 83.6 bits (205), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 38/106 (35%), Positives = 65/106 (61%)

Query: 435 EKATILFVPTRHHVEYISQLLRDCGYLISYIYGTLDQHARKNQLYNFRAGLTSILVVTDV 494
           +K  ++FV  +     +  +L   G  +  ++G+L Q  R + +  F++    +L+ TD+
Sbjct: 484 QKRIVVFVARKETAHKLRIILGLLGQSVGELHGSLTQEQRLDSVNKFKSLEVPVLLCTDL 543

Query: 495 AARGVDIPMLANVINYTLPGSSKIFVHRVGRTARAGNKGWAYSIVA 540
           A+RG+DIP +  VINY +P S +I++HRVGRTARAG +G + + V 
Sbjct: 544 ASRGLDIPKIEVVINYDMPKSYEIYLHRVGRTARAGREGRSVTFVG 589

>Ecym_1395 Chr1 complement(818424..820121) [1698 bp, 565 aa] {ON}
           similar to Ashbya gossypii AFR452C
          Length = 565

 Score =  173 bits (438), Expect = 7e-45,   Method: Compositional matrix adjust.
 Identities = 120/400 (30%), Positives = 197/400 (49%), Gaps = 73/400 (18%)

Query: 147 LSKIVLNNIKRKGFRQPTPIQRKTIPLILQSRDIVGMARTGSGKTAAFILPMVEK----- 201
           + K++ +++   G+ +PTPIQR TIP +  +RD +G+A TGSGKT AF++P+  K     
Sbjct: 173 IVKVITDDL---GYEEPTPIQRATIPNVQNNRDFMGVASTGSGKTLAFLIPIFMKFTKLP 229

Query: 202 -LKSHSGKIGARAVILSPSRELAMQTFNVFKDFARGTELRSVLLT---GGDSLEEQFSMM 257
            L   + + G +A+IL+P+RELA Q     K F    + R  L+T   GG +LEE    +
Sbjct: 230 PLNVITRQDGPQALILAPTRELAQQIEAEAKKFCAHWK-RPCLVTSIVGGHTLEEIIFNL 288

Query: 258 MSNPDVIIATPGRFLHLKVEMNLDLKSVEYVVFDEADRLFEMGFQEQLNELLASLPTT-- 315
               ++++ATPGR +       L LK V  +V DEADR+ + GF++QL  +LA       
Sbjct: 289 QDGCNILVATPGRLIDCLENHVLVLKQVYTLVLDEADRMVDFGFEDQLTTILARTDDILE 348

Query: 316 RQTLLFSATLPNSLVDFVKAGLVNPVLVRLDAETKVSENLEMLFLSSKNADREANLLYIL 375
           +QTL+F+AT+ +S+       L NP  V +       +                     +
Sbjct: 349 KQTLMFTATMSSSIERIANGYLRNPGFVTIGGSGSAPQ---------------------I 387

Query: 376 QEVIRIPLATSEQLLKLQKSTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMPAANELPSE 435
           Q++I   +AT EQ  K                                  M   + LP+ 
Sbjct: 388 QQIIEY-VATDEQRFK----------------------------------MLTQDILPNY 412

Query: 436 K-ATILFVPTRHHVEY-ISQLLRDCGYLISYIYGTLDQHARKNQLYNFRAGLTSILVVTD 493
           +   I+F+  +   ++ + +   +  + ++ ++G+  Q  R++ L  FR G   I+V TD
Sbjct: 413 RPPVIIFINYKVTADWLLRKFQEESKFRVTILHGSKSQTQREHSLKAFREGKVDIMVATD 472

Query: 494 VAARGVDIPMLANVINYTLPGSSKIFVHRVGRTARAGNKG 533
           VA RG+DIP ++ V+N+ +P     ++HR+GRT RA  KG
Sbjct: 473 VAGRGIDIPNVSLVVNFQMPSKLDDYIHRIGRTGRANQKG 512

>KAFR0G03480 Chr7 (718012..720570) [2559 bp, 852 aa] {ON} Anc_6.148
           YBR237W
          Length = 852

 Score =  176 bits (447), Expect = 9e-45,   Method: Compositional matrix adjust.
 Identities = 113/409 (27%), Positives = 202/409 (49%), Gaps = 51/409 (12%)

Query: 142 FPSFGLSKIVLNNIKR-KGFRQPTPIQRKTIPLILQSRDIVGMARTGSGKTAAFILPMVE 200
           +   GL+  ++N+IK    F++ TPIQ + +P I+  RD++G+++TGSGKT +++LP++ 
Sbjct: 260 WSQLGLNTSIMNSIKNVMKFQELTPIQAQALPAIMSGRDVIGISKTGSGKTISYLLPLLR 319

Query: 201 KLKSH----SGKIGARAVILSPSRELAMQTFN-VFKDFARGTELRSVLLTGGDSLEEQFS 255
           ++KS     + + G   ++L+P+RELA+Q    + K       L  +  TGG  L++Q S
Sbjct: 320 QVKSQRDLSNSETGPIGLVLAPTRELALQIHEEINKLINDDASLNCICCTGGSELKDQIS 379

Query: 256 MMMSNPDVIIATPGRFLHLKVEMN----LDLKSVEYVVFDEADRLFEMGFQEQLNELLAS 311
            +     +++ATPGRF+ L + +N    L    + +VV DEADRLF+MGF+ Q+ +++ +
Sbjct: 380 SVKRGVKIVVATPGRFIDL-LTINSGKLLSTGRITFVVMDEADRLFDMGFEPQVTQIMKA 438

Query: 312 LPTTRQTLLFSATLPNSLVDFVKAGLVNPVLVRLDAETKVSENLEMLF-LSSKNADREAN 370
           +   +Q +LFSAT  N +  F    L NP+ + +++   V+EN+   F +   +  +   
Sbjct: 439 IRPDKQCVLFSATFSNKIRSFAMRVLKNPITITINSNNIVNENVSQNFRVCESDTQKFDE 498

Query: 371 LLYILQEVIRIPLATSEQLLKLQKSTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMPAAN 430
           L+ +L+E                                                   ++
Sbjct: 499 LISLLKE--------------------------------------RNDKHEAQEGFEESD 520

Query: 431 ELPSEKATILFVPTRHHVEYISQLLRDCGYLISYIYGTLDQHARKNQLYNFRAGLTSILV 490
            L   K  I FV ++   + +   L   G+ I  I+       R   L  +R    S+L+
Sbjct: 521 NLQDNKTII-FVASQQICDILETNLVSSGFEIFSIHAGKPYQERVLNLEKYRRTRNSLLL 579

Query: 491 VTDVAARGVDIPMLANVINYTLPGSSKIFVHRVGRTARAGNKGWAYSIV 539
            T+V +RG+++P ++ VI Y    +   ++H  GRTAR  +KG A S +
Sbjct: 580 CTEVLSRGLNVPEVSLVIIYNAVKTFAQYIHTTGRTARGNSKGKAVSFL 628

>ZYRO0B10318g Chr2 complement(808717..810969) [2253 bp, 750 aa] {ON}
           similar to uniprot|P32892 Saccharomyces cerevisiae
           YLL008W DRS1 Nucleolar DEAD-box protein required for
           ribosome assembly and function including synthesis of
           60S ribosomal subunits
          Length = 750

 Score =  174 bits (441), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 94/251 (37%), Positives = 154/251 (61%), Gaps = 5/251 (1%)

Query: 133 EKQKHKKGSFPSFGLSKIVLNNIKRKGFRQPTPIQRKTIPLILQSRDIVGMARTGSGKTA 192
           E +K    +F S  LS+ VL  +   G+  P+PIQ  TIP+ L  +DI+  A TGSGKTA
Sbjct: 230 EAKKKVFNNFNSLSLSRPVLKALGDLGYATPSPIQGATIPIALLGKDIIAGAVTGSGKTA 289

Query: 193 AFILPMVEKLKSHSGKIGA-RAVILSPSRELAMQTFNVFKDFARGTE-LRSVLLTGGDSL 250
           AF++P++E+L     K+ + R ++L+P+RELA+Q  +V K   +    L   +  GG +L
Sbjct: 290 AFMIPIIERLIYKPAKVASTRVIVLAPTRELAIQVADVGKKLGKYVNGLTFGIAVGGLNL 349

Query: 251 EEQFSMMMSNPDVIIATPGRFL-HLKVEMNLDLKSVEYVVFDEADRLFEMGFQEQLNELL 309
            +Q  ++ + PD++IATPGRF+ H++   + ++ SVE +V DEADR+ E GFQ+++NE++
Sbjct: 350 RQQEQILKTRPDIVIATPGRFIDHIRNSSSFNVDSVEVLVIDEADRMLEEGFQDEINEIM 409

Query: 310 ASLPTTRQTLLFSATLPNSLVDFVKAGLVNPVLVRLDAETKVSENLEMLFLSSKNAD--R 367
             LP+ RQT+LFSAT+ + +   V   L  PV V  D   +    L+  F+  +  D  +
Sbjct: 410 HLLPSKRQTMLFSATMNSKIKQLVSLSLKRPVRVMTDPPQQAVSKLQQEFVRIRKRDHLK 469

Query: 368 EANLLYILQEV 378
            + L Y+++++
Sbjct: 470 PSTLFYLIKKL 480

 Score = 89.7 bits (221), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 40/107 (37%), Positives = 68/107 (63%)

Query: 434 SEKATILFVPTRHHVEYISQLLRDCGYLISYIYGTLDQHARKNQLYNFRAGLTSILVVTD 493
           ++K  ++FV  +  V  +  +L   G  ++ ++G+L+Q  R   +  F++    +L+ TD
Sbjct: 484 AQKRMVVFVSKKEMVHRLRIILGLLGMAVAELHGSLNQEQRLQSINKFKSLEVPVLICTD 543

Query: 494 VAARGVDIPMLANVINYTLPGSSKIFVHRVGRTARAGNKGWAYSIVA 540
           +A+RG+DIP +  VINY +P S +I++HRVGRTARAG +G + S V 
Sbjct: 544 LASRGLDIPKIEVVINYDMPKSFEIYLHRVGRTARAGREGRSVSFVG 590

>NCAS0B02570 Chr2 (429423..431195) [1773 bp, 590 aa] {ON} Anc_8.469
          Length = 590

 Score =  170 bits (431), Expect = 7e-44,   Method: Compositional matrix adjust.
 Identities = 122/406 (30%), Positives = 201/406 (49%), Gaps = 81/406 (19%)

Query: 160 FRQPTPIQRKTIPLILQ-SRDIVGMARTGSGKTAAFILPMVEKL----------KSHSGK 208
           F  PTP+QR TIP I++ +RD VG+A TGSGKT AF+LPM+ +L          K  +G 
Sbjct: 195 FDFPTPVQRITIPNIVKGNRDFVGVASTGSGKTLAFVLPMLTQLLTNGVPPIALKKMNGP 254

Query: 209 IGARAVILSPSRELAMQ-------TFNVFKDFARGTELRSVLLTGGDSLEEQFSMMMSNP 261
           IG   ++L P+RELA Q         N+ ++     ++ S++  GG SLEE  S +    
Sbjct: 255 IG---LVLVPTRELAQQIQLEAEKVVNLIRE-EYPIKIESIV--GGHSLEEISSNLNEGC 308

Query: 262 DVIIATPGRFLHLKVEMNLDLKSVEYVVFDEADRLFEMGFQEQLNELLASLPTTR----- 316
           D++IATPG+ +       L + ++ Y+V DEAD++ ++GF++QL  +L +L         
Sbjct: 309 DILIATPGKLIECLENHLLVISNLSYLVLDEADKMIDLGFEDQLKTILNNLEVNNSNVSS 368

Query: 317 --QTLLFSATLPNSLVDFVKAGLVNPVLVRLDAETKVSENLEMLFLSSKNADREANLLYI 374
             +TL+F+ATL + L       L NP+   + AE                    A+ +  
Sbjct: 369 LYRTLMFTATLSSPLEKIASGYLRNPIYASIKAEG-------------------ADAMPQ 409

Query: 375 LQEVIRIPLATSEQLLKLQKSTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMPAANELPS 434
           +Q+V++    T +Q  K  +S                              +   N + +
Sbjct: 410 IQQVVQY-CPTDDQKFKAIESI-----------------------------LREKNTMDN 439

Query: 435 EKATILFVPTRHHVEYISQLLRDCGYLISYIYGTLDQHARKNQLYNFRAGLTSILVVTDV 494
            +  I F+  +   ++++       Y ++ ++G+  Q  R++ +   R+G   IL+ T+V
Sbjct: 440 PRVII-FINYKATADWLANKFASTKYKVTILHGSKSQEQREHSIQLLRSGKIQILIATNV 498

Query: 495 AARGVDIPMLANVINYTLPGSSKIFVHRVGRTARAGNKGWAYSIVA 540
           AARG+DIP +A VIN+  P     +VHR+GRT RAGN G A +++ 
Sbjct: 499 AARGLDIPNVALVINFHFPKDFADYVHRIGRTGRAGNLGTAVTLIG 544

>YJL033W Chr10 (383837..386149) [2313 bp, 770 aa] {ON}  HCA4Putative
           nucleolar DEAD box RNA helicase; high-copy number
           suppression of a U14 snoRNA processing mutant suggests
           an involvement in 18S rRNA synthesis
          Length = 770

 Score =  172 bits (435), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 119/399 (29%), Positives = 190/399 (47%), Gaps = 57/399 (14%)

Query: 142 FPSFGLSKIVLNNIKRKGFRQPTPIQRKTIPLILQSRDIVGMARTGSGKTAAFILPMVEK 201
           F    +S   L  ++   F + T IQ  +IP+ LQ  D++  A+TGSGKT AF++P++EK
Sbjct: 43  FKDLPISDPTLKGLRESSFIKLTEIQADSIPVSLQGHDVLAAAKTGSGKTLAFLVPVIEK 102

Query: 202 L--KSHSGKIGARAVILSPSRELAMQTFNVFKDFARGTELRSVLLTGGDSLEEQFSMMMS 259
           L  +  +   G  A+I+SP+RELAMQ + V       T   + L+ GG  ++ +   + S
Sbjct: 103 LYREKWTEFDGLGALIISPTRELAMQIYEVLTKIGSHTSFSAGLVIGGKDVKFELERI-S 161

Query: 260 NPDVIIATPGRFL-HLKVEMNLDLKSVEYVVFDEADRLFEMGFQEQLNELLASLPTTRQT 318
             +++I TPGR L HL   + L+  +++ +V DEADR  +MGF++ L+ ++++L  +RQT
Sbjct: 162 RINILIGTPGRILQHLDQAVGLNTSNLQMLVLDEADRCLDMGFKKTLDAIVSTLSPSRQT 221

Query: 319 LLFSATLPNSLVDFVKAGLVNPVLVRLDAETKVSENLEMLFLSSKNADREANLLYILQEV 378
           LLFSAT   S+ D  +  L        D +T  + ++        + ++EA+    LQ+ 
Sbjct: 222 LLFSATQSQSVADLARLSLT-------DYKTVGTHDV-----MDGSVNKEASTPETLQQF 269

Query: 379 -IRIPLATS-EQLLKLQKSTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMPAANELPSEK 436
            I +PLA   + L    KS                                         
Sbjct: 270 YIEVPLADKLDILFSFIKSHLKCKM----------------------------------- 294

Query: 437 ATILFVPTRHHVEYISQLLRDC--GYLISYIYGTLDQHARKNQLYNFRAGLTSILVVTDV 494
             I+F+ +   V ++ +  R    G  + +++G   Q AR   L  F       L  TDV
Sbjct: 295 --IVFLSSSKQVHFVYETFRKMQPGISLMHLHGRQKQRARTETLDKFNRAQQVCLFATDV 352

Query: 495 AARGVDIPMLANVINYTLPGSSKIFVHRVGRTARAGNKG 533
            ARG+D P +  V+    P     ++HRVGR AR G KG
Sbjct: 353 VARGIDFPAVDWVVQVDCPEDVDTYIHRVGRCARYGKKG 391

>SAKL0G12760g Chr7 complement(1088344..1090557) [2214 bp, 737 aa]
           {ON} similar to uniprot|P32892 Saccharomyces cerevisiae
           YLL008W DRS1 Nucleolar DEAD-box protein required for
           ribosome assembly and function including synthesis of
           60S ribosomal subunits
          Length = 737

 Score =  171 bits (433), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 93/251 (37%), Positives = 153/251 (60%), Gaps = 5/251 (1%)

Query: 133 EKQKHKKGSFPSFGLSKIVLNNIKRKGFRQPTPIQRKTIPLILQSRDIVGMARTGSGKTA 192
           E + +   SF S  LS+ VL  +   G+ +P+PIQ  TIP+ L  +DI+  A TGSGKTA
Sbjct: 216 EAKNNTHTSFNSLSLSRPVLKGLGALGYVKPSPIQGATIPIALLGKDIIAGAVTGSGKTA 275

Query: 193 AFILPMVEKLKSHSGKIGA-RAVILSPSRELAMQTFNVFKDFARGTE-LRSVLLTGGDSL 250
           A+++P++E+L     ++ + R V+L+P+RELA+Q  +V K   +    L   L  GG +L
Sbjct: 276 AYMIPIIERLLYKPAQVASTRVVVLAPTRELAIQVADVGKKIGKFVNGLTFGLAVGGLNL 335

Query: 251 EEQFSMMMSNPDVIIATPGRFL-HLKVEMNLDLKSVEYVVFDEADRLFEMGFQEQLNELL 309
            +Q   +   PD++IATPGRF+ H++   +  + SVE +V DEADR+ E GF ++LNE++
Sbjct: 336 RQQEQTLKLRPDIVIATPGRFIDHIRNSASFSVDSVEVLVIDEADRMLEEGFHDELNEIM 395

Query: 310 ASLPTTRQTLLFSATLPNSLVDFVKAGLVNPVLVRLDAETKVSENLEMLFLSSKNAD--R 367
           + +P+ RQTLLFSAT+ + +   V   L  PV + +D   + +  L   F+  +  D  +
Sbjct: 396 SLIPSKRQTLLFSATMNSKIKQLVSLSLKKPVRIMIDPPKQAAAKLTQEFVRIRKRDHLK 455

Query: 368 EANLLYILQEV 378
            A L ++++++
Sbjct: 456 PALLFHLIRKI 466

 Score = 84.3 bits (207), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 38/107 (35%), Positives = 67/107 (62%)

Query: 434 SEKATILFVPTRHHVEYISQLLRDCGYLISYIYGTLDQHARKNQLYNFRAGLTSILVVTD 493
           S+K  ++FV  +     +  +L   G  ++ ++G+L Q  R   + +F++    +L+ TD
Sbjct: 470 SQKRIVVFVSRKEMAHRLRIILGLLGMKVAELHGSLTQEQRLQSVNSFKSLDVPVLICTD 529

Query: 494 VAARGVDIPMLANVINYTLPGSSKIFVHRVGRTARAGNKGWAYSIVA 540
           +A+RG+DIP +  VIN+ +P + +I++HRVGRTARAG +G + S V 
Sbjct: 530 LASRGLDIPKIEVVINFDMPKTYEIYLHRVGRTARAGREGRSVSFVG 576

>Kwal_33.15165 s33 (987878..990073) [2196 bp, 731 aa] {ON} YLL008W
           (DRS1) - putative ATP dependent RNA helicase [contig 94]
           FULL
          Length = 731

 Score =  167 bits (422), Expect = 5e-42,   Method: Compositional matrix adjust.
 Identities = 90/251 (35%), Positives = 154/251 (61%), Gaps = 5/251 (1%)

Query: 133 EKQKHKKGSFPSFGLSKIVLNNIKRKGFRQPTPIQRKTIPLILQSRDIVGMARTGSGKTA 192
           E +K    +F S  LS+ VL  +    + +P+PIQ  TIP+ L  +DI+  A TGSGKTA
Sbjct: 208 EARKAIHTNFNSLSLSRPVLKGLGALNYVKPSPIQSATIPIALTGKDIIAGAVTGSGKTA 267

Query: 193 AFILPMVEKLKSHSGKIGA-RAVILSPSRELAMQTFNVFKDFARGTE-LRSVLLTGGDSL 250
           A+++P++E+L     ++ + R ++L+P+RELA+Q  +V    A+    +   L  GG +L
Sbjct: 268 AYMIPIIERLLYKPAQVSSTRVIVLAPTRELAIQVSDVGTKLAKYVNGINFGLAVGGLNL 327

Query: 251 EEQFSMMMSNPDVIIATPGRFL-HLKVEMNLDLKSVEYVVFDEADRLFEMGFQEQLNELL 309
            +Q   + + PDV+IATPGR + H++   + ++ SVE +V DEADR+ E GFQ++LNE++
Sbjct: 328 RQQEQALRARPDVVIATPGRLIDHIRNSASFNVDSVEILVIDEADRMLEDGFQDELNEIM 387

Query: 310 ASLPTTRQTLLFSATLPNSLVDFVKAGLVNPVLVRLDAETKVSENLEMLFLSSKNAD--R 367
           + +P+ RQTLLFSAT+ + +   +   L  PV + +D   + +  L   F+  +  D  +
Sbjct: 388 SLIPSKRQTLLFSATMNSKINQLISLSLKKPVRIMIDPPKQAAAKLVQEFVRVRKRDDLK 447

Query: 368 EANLLYILQEV 378
            A L ++++++
Sbjct: 448 PALLFHLIRKL 458

 Score = 83.2 bits (204), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 38/107 (35%), Positives = 65/107 (60%)

Query: 434 SEKATILFVPTRHHVEYISQLLRDCGYLISYIYGTLDQHARKNQLYNFRAGLTSILVVTD 493
           S+K  ++FV  +     +  +L   G  ++ ++G+L Q  R   +  F++    +L+ TD
Sbjct: 462 SQKRVVVFVARKEMAHKLRIILGLLGMKVAELHGSLSQEQRLQAVNGFKSLQIPVLICTD 521

Query: 494 VAARGVDIPMLANVINYTLPGSSKIFVHRVGRTARAGNKGWAYSIVA 540
           +A+RG+DIP +  VIN+ +P +  I++HRVGRTARAG +G + S V 
Sbjct: 522 LASRGLDIPKIEFVINFDMPKTYDIYLHRVGRTARAGREGRSISFVG 568

>SAKL0A06204g Chr1 complement(560276..562807) [2532 bp, 843 aa] {ON}
           similar to uniprot|P21372 Saccharomyces cerevisiae
           YBR237W PRP5 RNA helicase in the DEAD-box family
          Length = 843

 Score =  166 bits (419), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 85/246 (34%), Positives = 156/246 (63%), Gaps = 12/246 (4%)

Query: 142 FPSFGLSKIVLNNIKRK-GFRQPTPIQRKTIPLILQSRDIVGMARTGSGKTAAFILPMVE 200
           +   GL+  +++ I ++  F  PTPIQ + IP I+  RD+VG+++TGSGKT +F+LP++ 
Sbjct: 252 WSQLGLTTDIMDLITKEFKFVTPTPIQAQAIPAIMSGRDVVGISKTGSGKTVSFLLPLLR 311

Query: 201 KLKSH----SGKIGARAVILSPSRELAMQTFNVFKDFARGT-ELRSVLLTGGDSLEEQFS 255
           ++K+       + G   +IL+P+RELA+Q +     F  G+  +RS+  TGG  L++Q +
Sbjct: 312 QIKAQRPLSKTETGPMGLILAPTRELAVQIYEEVVKFTTGSGSIRSICCTGGSELKQQIN 371

Query: 256 MMMSNPDVIIATPGRFLHLKVEMN----LDLKSVEYVVFDEADRLFEMGFQEQLNELLAS 311
            +    +V++ATPGRF+ L + +N    L  + + +VV DEADRLF++GF+ Q+ +++ +
Sbjct: 372 DLKKGVEVVVATPGRFIDL-LTLNSGRLLSTERITFVVMDEADRLFDLGFEPQITQIMKA 430

Query: 312 LPTTRQTLLFSATLPNSLVDFVKAGLVNPVLVRLDAETKVSENLEM-LFLSSKNADREAN 370
           +   +Q +LFSAT PN L +F    L  P+ + +++++ ++EN+E  L +   + ++ A 
Sbjct: 431 VRPDKQCVLFSATFPNKLKNFALKILQKPISITINSKSLINENIEQRLKIFQTDNEKFAA 490

Query: 371 LLYILQ 376
           +L +L+
Sbjct: 491 MLEVLE 496

 Score = 62.8 bits (151), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 33/105 (31%), Positives = 58/105 (55%)

Query: 435 EKATILFVPTRHHVEYISQLLRDCGYLISYIYGTLDQHARKNQLYNFRAGLTSILVVTDV 494
           ++ TI+FV ++   + I   L + GY+   I+     + R + L  F+     IL+ T+V
Sbjct: 519 DEKTIVFVSSQQICDLIYNRLLEHGYVTYAIHAGKPYNERASNLEKFKNTPNGILLCTEV 578

Query: 495 AARGVDIPMLANVINYTLPGSSKIFVHRVGRTARAGNKGWAYSIV 539
            +RG+++P ++ VI Y    +   +VH  GRTAR  NKG A +++
Sbjct: 579 LSRGLNVPEVSLVIIYNAVKTFAQYVHTTGRTARGTNKGVALTML 623

>KNAG0A04130 Chr1 (559075..560904) [1830 bp, 609 aa] {ON} Anc_8.469
           YDR243C
          Length = 609

 Score =  163 bits (412), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 112/403 (27%), Positives = 205/403 (50%), Gaps = 77/403 (19%)

Query: 160 FRQPTPIQRKTIPLILQS--RDIVGMARTGSGKTAAFILPMVEKL----KSHSGKI--GA 211
           F +P+PIQR  IP I+    +D++G++ TGSGKT AF +P++ K+    +  S K+  G 
Sbjct: 216 FVEPSPIQRIAIPNIVHQPYKDLIGVSSTGSGKTVAFAVPILIKMNGLIRPRSLKLMEGP 275

Query: 212 RAVILSPSRELAMQTFNVFKDFAR------GTELRSVLLTGGDSLEEQFSMMMSNPDVII 265
           +A+IL+P+REL  Q  +  K+           E   V + GG SLEE  + + +  D+++
Sbjct: 276 KALILAPTRELVQQIESQIKNVTTRDWTDDPNECTVVSIVGGHSLEELTNSLRNGCDILV 335

Query: 266 ATPGRFLHLKVEMNLDLKSVEYVVFDEADRLFEMGFQEQLNELLASLPTTR------QTL 319
           ATPGR +       L + +++ +V DEAD++ ++GF++QL   L+ +          QTL
Sbjct: 336 ATPGRLIDCLENHILTISNIDTLVLDEADKMIDLGFEDQLKLTLSKVNVETKHRAGFQTL 395

Query: 320 LFSATLPNSLVDFVKAGLVNPVLVRLDAETKVSENLEMLFLSSKNADREANLLYILQEVI 379
           +F+ATL  ++     + L +P+ + +D              S + +  +      +++++
Sbjct: 396 MFTATLSPAIELISHSYLQSPIHILVD--------------SGEGSQPQ------VKQIV 435

Query: 380 RIPLATSEQLLKLQKSTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMPAANELPSEKA-T 438
           R    T ++ ++L+                                   A  LP  KA  
Sbjct: 436 RYSPNTDQRFVELK-----------------------------------AKVLPQFKAPI 460

Query: 439 ILFVPTRHHVEYISQ-LLRDCGYLISYIYGTLDQHARKNQLYNFRAGLTSILVVTDVAAR 497
           I+F+  ++  ++++Q   ++  Y ++ ++G+  Q  R++ L   R G   I++ T++AAR
Sbjct: 461 IIFINYKNTADWLAQKFQQETAYKVTILHGSKSQEQREHSLQLLRTGKAQIMIATNIAAR 520

Query: 498 GVDIPMLANVINYTLPGSSKIFVHRVGRTARAGNKGWAYSIVA 540
           G+DIP ++ VIN+ +  +   +VHR+GRT RAGN G A + V 
Sbjct: 521 GLDIPNVSLVINFQMSKNFDDYVHRIGRTGRAGNSGTAITFVG 563

>AGL112C Chr7 complement(495879..497855) [1977 bp, 658 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR194C
           (MSS116)
          Length = 658

 Score =  163 bits (412), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 130/418 (31%), Positives = 203/418 (48%), Gaps = 78/418 (18%)

Query: 147 LSKIVLNNIKRKGFRQPTPIQRKTIPLILQS-RDIVGMARTGSGKTAAFILPMVEKLKSH 205
           LS  +   ++ +GF + TP+Q+KT+  ILQ+  D+V  A+TG+GKT AF++P+ ++L   
Sbjct: 133 LSNELYEMLQSRGFDKLTPVQQKTLKPILQTEHDVVARAKTGTGKTLAFLMPLFQRLLEG 192

Query: 206 SGKIGARAVILSPSRELAMQTFNVFKDFARGT----ELRSVLLTGGDSLEEQF-SMMMSN 260
                 +AV+++P+R+LA Q FN   +            +V++ GG S  E F S+    
Sbjct: 193 PPSENVKAVVIAPTRDLAAQIFNEINEMRNANRKLRRFNAVVMMGGSSRTETFRSLERRR 252

Query: 261 PDVIIATPGRFLHLKVEMNLD-LKSVEYVVFDEADRLFEMGFQ---EQLNELLASL---- 312
           P++++ATPGR + +           V++ V DEAD L E+GF+   EQ+N++L  L    
Sbjct: 253 PNIVVATPGRLIDMLEACGPKYFTEVDFKVLDEADTLLEIGFKQALEQINDILNQLNQKG 312

Query: 313 PTTRQTLLFSAT-------LPNSLVDFVKAGLVNPVLVRLDAETKVSENLEMLFLSSKN- 364
            T  +TLL SAT       L NS+++  K   ++ V      E   +EN+    + SK+ 
Sbjct: 313 TTHIRTLLVSATLDDKVQSLANSIMNHAKCLFIDTV---DPNEQATNENIAQKVVISKDF 369

Query: 365 ADREANLLYILQEVIRIPLATSEQLLKLQKSTXXXXXXXXXXXXXXXXXXXXXXXXXXXX 424
           AD     LY ++E                                               
Sbjct: 370 ADNITASLYKIRE----------------------------------------------- 382

Query: 425 XMPAANELPSEKATILFVPTRHHVEYISQLLRD-C-GYLISYIYGTLDQHARKNQLYNFR 482
               A+  P  KA I+F+PT   VEY  +LL+  C G  +   +G L Q  R + +  FR
Sbjct: 383 ---EASANPKLKA-IVFMPTIVAVEYWGELLQSQCRGTPVLLFHGGLSQGRRNSTMKRFR 438

Query: 483 AGLTSILVVTDVAARGVDIPMLANVINYTLPGSSKIFVHRVGRTARAGNKGWAYSIVA 540
           A  + ILV TDVAARG+D+  + +V    +P S   ++HR+GRT RAG KG +   +A
Sbjct: 439 AMDSGILVCTDVAARGMDVSDVQHVYQVGVPTSPDNYIHRIGRTGRAGRKGSSTIFLA 496

>TBLA0H03240 Chr8 complement(787863..790166) [2304 bp, 767 aa] {ON}
           Anc_8.402 YDR194C
          Length = 767

 Score =  164 bits (415), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 124/426 (29%), Positives = 204/426 (47%), Gaps = 51/426 (11%)

Query: 147 LSKIVLNNIKRKGFRQPTPIQRKTIPLILQ--SRDIVGMARTGSGKTAAFILPMVEKLKS 204
           + K +   + R GF+  TP+Q+KTI  IL+    D++  A+TG+GKT AF+LP+ +KL  
Sbjct: 170 IDKKLFTAVHRLGFKSLTPVQQKTIKPILKDSGNDVIARAKTGTGKTFAFLLPLFQKLIE 229

Query: 205 HSGKIGARAVILSPSRELAMQ----TFNVFKDFARGTELRSVLLTGGDSLEEQFS-MMMS 259
                  ++VI++P+R+LA+Q       ++K+ +   +   + + GG +       +   
Sbjct: 230 SPNSAMVKSVIMAPTRDLALQIEQEILKLYKNNSALRQYNCLSIVGGTNYSYSLQRLHRE 289

Query: 260 NPDVIIATPGRFLHLKVEMNLDLKS-VEYVVFDEADRLFEMGFQEQLNELLASLPTTR-- 316
            P++I+ATPGR L +  +      S V++ V DEADRL E+GF+E L  +  SL +    
Sbjct: 290 RPNIIVATPGRMLAVLSDFGDKFFSEVDFKVLDEADRLLEIGFKEDLVAISNSLDSVNSN 349

Query: 317 -----QTLLFSATLPNSLVDFVKAGLVNPVLVRLDA----ETKVSENLEMLFLSSKNADR 367
                +TLLFSATL + +       +     + LD     E +  EN+    + S   D 
Sbjct: 350 GADHIRTLLFSATLDDKVQTLANDIMNKEECLFLDTIDKNEPEAHENINQNLVVS---DA 406

Query: 368 EANLLYILQEVIR-------IPLA--TSEQLLKLQKSTXXXXXXXXXXXXXXXXXXXXXX 418
            ++ +Y + E IR       +P+A  T+E+  K++                         
Sbjct: 407 FSHSIYAVIEHIRSRLHPTELPIAEVTTEEETKVEAGVESVEETEVITKATK-------- 458

Query: 419 XXXXXXXMPAANELPSEKATILFVPTRHHVEYISQLLRD----CGYLISYIYGTLDQHAR 474
                   P           ILF PT    +++SQL++      G  I   +G +DQ+ R
Sbjct: 459 --------PFDKHDTQNYKAILFTPTVKCTKFLSQLIKREFQIEGIPIYEFHGKIDQNRR 510

Query: 475 KNQLYNFRAGLTSILVVTDVAARGVDIPMLANVINYTLPGSSKIFVHRVGRTARAGNKGW 534
              +  F+   + ILV TDV ARG+D P +  V+   +P     +VHR+GRTARAG KG 
Sbjct: 511 TRIVEKFKRANSGILVCTDVGARGMDFPNVQEVLQLGVPSELSNYVHRIGRTARAGKKGI 570

Query: 535 AYSIVA 540
           + + ++
Sbjct: 571 STAFLS 576

>SAKL0H11968g Chr8 (1022452..1024152) [1701 bp, 566 aa] {ON} similar
           to uniprot|P23394 Saccharomyces cerevisiae YDR243C PRP28
           RNA helicase in the DEAD-box family involved in RNA
           isomerization at the 5' splice site
          Length = 566

 Score =  161 bits (407), Expect = 6e-41,   Method: Compositional matrix adjust.
 Identities = 111/401 (27%), Positives = 200/401 (49%), Gaps = 74/401 (18%)

Query: 155 IKRKGFRQPTPIQRKTIPLILQSRDIVGMARTGSGKTAAFILPMVEKLKS-----HSGKI 209
           I++  + +PTPIQR TIP +   RD +G+A TGSGKT AF++P++ KL +        K+
Sbjct: 179 IRKLHYTEPTPIQRVTIPNVDNGRDFLGVAVTGSGKTLAFLIPIIIKLNTLPPLTEITKL 238

Query: 210 -GARAVILSPSRELAMQ----TFNVFKDFARGTELRSVLLTGGDSLEEQFSMMMSNPDVI 264
            G  ++IL+P+RELA Q       + + ++R   + S++  GG ++EE    +    +++
Sbjct: 239 NGPYSLILAPTRELAQQIEAEARKLTQYWSRPCNVVSIV--GGHAIEEISYNLSRGCEIL 296

Query: 265 IATPGRFLHLKVEMNLDLKSVEYVVFDEADRLFEMGFQEQLNELLASLPTT--RQTLLFS 322
           +ATPGR +       L L+ V  +V DEADR+ + GF++QL  +L+   ++  RQT++F+
Sbjct: 297 VATPGRLIDCLENHVLVLEQVNILVLDEADRMIDYGFEDQLTTILSKTSSSNKRQTMMFT 356

Query: 323 ATLPNSLVDFVKAGLVNPVLVRLDAETKVSENLEML-FLSSKNADREANLLYILQEVIRI 381
           AT+  ++       L  P  V +  E    +  ++L +L S+                  
Sbjct: 357 ATMSPTIEKIADGYLNKPAYVTIGGEETKPQITQILEYLPSE------------------ 398

Query: 382 PLATSEQLLKLQKSTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMPAANELPSEKA-TIL 440
                ++ LKL K                                     LP   A  I+
Sbjct: 399 ----EKRFLKLSKDI-----------------------------------LPHYPAPIII 419

Query: 441 FVPTRHHVEYISQLLRD-CGYLISYIYGTLDQHARKNQLYNFRAGLTSILVVTDVAARGV 499
           F+  +   +++++  +D   Y  + ++G+  Q  R+N L   R+G   I++ T+VA RG+
Sbjct: 420 FINYKRTADWLAKKFQDETKYRTTTLHGSKSQEQRENSLNLLRSGKADIMIATNVAGRGI 479

Query: 500 DIPMLANVINYTLPGSSKIFVHRVGRTARAGNKGWAYSIVA 540
           DIP ++ V+N+ +    + ++HR+GRT RAG +G++ + + 
Sbjct: 480 DIPNVSLVVNFQMATKLEDYIHRIGRTGRAGKEGYSITFLG 520

>KLLA0F10505g Chr6 complement(966736..969174) [2439 bp, 812 aa] {ON}
           similar to uniprot|Q754U8 Ashbya gossypii AFL027C PRP5
           Pre-mRNA-processing ATP-dependent RNA helicase PRP5 and
           weakly similar to YBR237W uniprot|P21372 Saccharomyces
           cerevisiae PRP5 RNA helicase in the DEAD-box family
          Length = 812

 Score =  162 bits (410), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 83/226 (36%), Positives = 140/226 (61%), Gaps = 14/226 (6%)

Query: 142 FPSFGLSKIVLNNIKRK-GFRQPTPIQRKTIPLILQSRDIVGMARTGSGKTAAFILPMVE 200
           +   GLS  +++ I  +  F   TPIQ + IP I+  RD++G+++TGSGKT AF+LP+V 
Sbjct: 247 WSQLGLSSEIMDLISNELQFVTLTPIQCQAIPAIMSGRDVIGISKTGSGKTVAFLLPLVR 306

Query: 201 KLKSH-------SGKIGARAVILSPSRELAMQTFNVFKDFARGTELRSVLLTGGDSLEEQ 253
           ++K+        +G IG   +IL+P+RELA+Q       F +G+ + S+   GG  L++Q
Sbjct: 307 QIKAQPPLAPDETGPIG---LILTPTRELAVQIQEEALKFCKGSGISSICCVGGSELKQQ 363

Query: 254 FSMMMSNPDVIIATPGRFLHLKVEMNLDLKS---VEYVVFDEADRLFEMGFQEQLNELLA 310
            + +    D+I+ATPGRF+ L    +  L S   + +VV DEADRLF++GF  Q+N+++ 
Sbjct: 364 INELKRGVDIIVATPGRFIDLMTLNSGHLLSPTRISFVVMDEADRLFDLGFGPQVNQIMG 423

Query: 311 SLPTTRQTLLFSATLPNSLVDFVKAGLVNPVLVRLDAETKVSENLE 356
            +   +Q +LFSAT P+ L  F    L NP+ + +++++ ++EN++
Sbjct: 424 CIRPDKQCVLFSATFPSKLKHFASRTLKNPIQITINSKSLINENIQ 469

 Score = 53.9 bits (128), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 32/105 (30%), Positives = 51/105 (48%)

Query: 435 EKATILFVPTRHHVEYISQLLRDCGYLISYIYGTLDQHARKNQLYNFRAGLTSILVVTDV 494
           ++ TI+FV ++   + +   L   G     I+       R   L  F+     IL+ T+V
Sbjct: 500 DEKTIIFVGSQQLCDLLYDELLLNGITTFPIHAGKPSAERLRNLQKFKETDNGILICTEV 559

Query: 495 AARGVDIPMLANVINYTLPGSSKIFVHRVGRTARAGNKGWAYSIV 539
            +RG+++P ++ VI Y    +   +VH VGRT R  N G A S V
Sbjct: 560 LSRGLNVPEVSLVIIYNAAKTIAQYVHTVGRTGRGTNNGVALSFV 604

>KAFR0D04630 Chr4 complement(909161..910624) [1464 bp, 487 aa] {ON}
           Anc_5.337 YHR065C
          Length = 487

 Score =  157 bits (398), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 97/276 (35%), Positives = 144/276 (52%), Gaps = 16/276 (5%)

Query: 104 SDDENNISGQTQAGEEEDDVNEYFSTNNLEKQKHKKGSFPSFGLSKIVLNNIKRKGFRQP 163
           SD+E  I  +  A EE+   +E F             SF    L   ++   K   + +P
Sbjct: 43  SDEEKGIIVKNNAAEEDAGNDETFE------------SFTELNLVPELIQACKNLNYEKP 90

Query: 164 TPIQRKTIPLILQSRDIVGMARTGSGKTAAFILPMVEKLKSHSGKIGARAVILSPSRELA 223
           TPIQ K+IP  L  +DI+G+A+TGSGKTAAF +P++  L     ++   A ILSP+RELA
Sbjct: 91  TPIQSKSIPPALNGKDIIGLAQTGSGKTAAFAIPILNSL--WHDQLPYYACILSPTRELA 148

Query: 224 MQTFNVFKDFARGTELRSVLLTGGDSLEEQFSMMMSNPDVIIATPGRFL-HLKVEMNLDL 282
            Q    F        +R+V + GG ++ +Q   +M  P +IIATPGR + HL+      L
Sbjct: 149 QQIKETFDSLGSLMGVRTVCIVGGMNMMDQARDLMRKPHIIIATPGRLMDHLENTRGFSL 208

Query: 283 KSVEYVVFDEADRLFEMGFQEQLNELLASLPTT-RQTLLFSATLPNSLVDFVKAGLVNPV 341
           + + Y+V DEADRL +M F   L+ +L  LPT  R T LFSAT+ + +    +A L NPV
Sbjct: 209 RKLRYLVMDEADRLLDMEFGPVLDRILKILPTEGRTTYLFSATMTSKIDKLQRASLTNPV 268

Query: 342 LVRLDAETKVSENLEMLFLSSKNADREANLLYILQE 377
              +  + +  + L    +      +   L+Y+L E
Sbjct: 269 KCAVSNKYQTVDTLVQTLMVVPGGLKNTFLIYLLNE 304

 Score = 94.0 bits (232), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 52/123 (42%), Positives = 72/123 (58%)

Query: 436 KATILFVPTRHHVEYISQLLRDCGYLISYIYGTLDQHARKNQLYNFRAGLTSILVVTDVA 495
           K  I+F  T+ + E I+ L     +  + ++G L+Q+ R   L  F+AG  SILV TDVA
Sbjct: 308 KTFIIFTRTKANAERIAGLANLLEFNATALHGDLNQNQRTGALDLFKAGKRSILVATDVA 367

Query: 496 ARGVDIPMLANVINYTLPGSSKIFVHRVGRTARAGNKGWAYSIVAXXXXXXXXXXXXXXG 555
           ARG+DIP +  VINY +P  SK ++HRVGRTARAG  G + S+V+              G
Sbjct: 368 ARGLDIPSVDIVINYDIPVDSKSYIHRVGRTARAGRSGKSISLVSQYDLELILRIEEVLG 427

Query: 556 KKI 558
           KK+
Sbjct: 428 KKL 430

>ZYRO0C14234g Chr3 complement(1116350..1117834) [1485 bp, 494 aa]
           {ON} highly similar to uniprot|Q75EW9 Ashbya gossypii
           AAL041C RRP3 ATP-dependent rRNA helicase RRP3 and
           similar to YHR065C uniprot|P38712 Saccharomyces
           cerevisiae YHR065C RRP3 Required for maturation of the
           35S primary transcript of pre-rRNA and is required for
           cleavages leading to mature 18S RNA RRP3 is a DEAD box
           gene homologous to eIF- 4a which encodes an
           RNA-dependent ATPase possessing helicase activity which
           is not specific for RNA
          Length = 494

 Score =  156 bits (394), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 97/280 (34%), Positives = 151/280 (53%), Gaps = 11/280 (3%)

Query: 109 NISGQTQ---AGEEEDDVNEYFSTNNLEKQKHKKG----SFPSFGLSKIVLNNIKRKGFR 161
           N   QTQ   +GEE+D+  ++      E++   +G    SF    L   ++   K   F 
Sbjct: 34  NQEKQTQKEASGEEKDESKKHKKAKVQEEEPEYQGEDLQSFNDLNLVPELIEACKNLNFD 93

Query: 162 QPTPIQRKTIPLILQSRDIVGMARTGSGKTAAFILPMVEKLKSHSGKIGARAVILSPSRE 221
           +PTPIQ + IP  L+ RDI+G+A+TGSGKTAAF +P++ +L     K    A +L+P+RE
Sbjct: 94  KPTPIQARAIPPALEGRDIIGLAQTGSGKTAAFAIPILNRL--WEDKQPYYACVLAPTRE 151

Query: 222 LAMQTFNVFKDFARGTELRSVLLTGGDSLEEQFSMMMSNPDVIIATPGRFL-HLKVEMNL 280
           LA QT   F        +RS  + GG ++ +Q   +M  P +IIATPGR + HL+     
Sbjct: 152 LAQQTKETFDSLGALMGVRSTCIVGGMNMMDQARELMRKPHIIIATPGRLMDHLENTKGF 211

Query: 281 DLKSVEYVVFDEADRLFEMGFQEQLNELLASLPTT-RQTLLFSATLPNSLVDFVKAGLVN 339
            L+ + ++V DEADRL +M F   L+++L  +PT  R T LFSAT+ + +    +A L  
Sbjct: 212 SLRKLRFLVMDEADRLLDMEFGPVLDKILKVIPTQDRTTYLFSATMTSKIDKLQRASLTE 271

Query: 340 PVLVRLDAETKVSENLEMLFLSSKNADREANLLYILQEVI 379
           PV   +  + +  + L    +   +  +   L+Y+L E I
Sbjct: 272 PVKCAVSNKYQTVDTLVQTLMVVPSGLKNTYLIYLLNENI 311

 Score = 97.1 bits (240), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 52/123 (42%), Positives = 72/123 (58%)

Query: 436 KATILFVPTRHHVEYISQLLRDCGYLISYIYGTLDQHARKNQLYNFRAGLTSILVVTDVA 495
           K  I+F  T+ + E +S L     +  + ++G L+Q+ R   L  F+AG  SILV TDVA
Sbjct: 313 KTVIIFTRTKANAERLSALCNLLEFNATALHGDLNQNQRTGALDLFKAGRRSILVATDVA 372

Query: 496 ARGVDIPMLANVINYTLPGSSKIFVHRVGRTARAGNKGWAYSIVAXXXXXXXXXXXXXXG 555
           ARG+DIP +  VINY +P  SK ++HRVGRTARAG  G + S+V+              G
Sbjct: 373 ARGLDIPSVDIVINYDIPVDSKSYIHRVGRTARAGRSGKSISLVSQYDLELILRIEEVLG 432

Query: 556 KKI 558
           KK+
Sbjct: 433 KKL 435

>CAGL0L08976g Chr12 complement(981008..982861) [1854 bp, 617 aa]
           {ON} highly similar to uniprot|P25808 Saccharomyces
           cerevisiae YFL002c SPB4
          Length = 617

 Score =  157 bits (397), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 119/397 (29%), Positives = 190/397 (47%), Gaps = 62/397 (15%)

Query: 155 IKRKGFRQPTPIQRKTIPLILQSRDIVGMARTGSGKTAAFILPMVEKLKSHS------GK 208
           I   GF   TP+Q  TIP+  +++D+V  + TGSGKT AF++P++EK+ S         K
Sbjct: 22  INVSGFDSMTPVQASTIPMFAKNKDVVVESVTGSGKTIAFVIPILEKIISEGINNSKFKK 81

Query: 209 IGARAVILSPSRELAMQTFNVFKDFARGTE-----LRSVLLTGGD--SLEEQFSMMMSN- 260
               ++IL+P+REL+MQ  NV   F          +RS L+ G +  S+ +  + ++   
Sbjct: 82  GHFYSLILAPTRELSMQIQNVVSSFLEHYPEDQYPIRSQLVVGTNEKSVRDDVNTLLDER 141

Query: 261 PDVIIATPGRFLHLKVEMNLDLKSVEYVVFDEADRLFEMGFQEQLNELLASLPTTRQTLL 320
           P ++I TPGR L      ++   S   VV DEADRL ++ F + + ++L  LP  R+T L
Sbjct: 142 PQILIGTPGRVLDFLQSPSVKTSSCGMVVLDEADRLLDVSFFKDVEKILNVLPKQRRTGL 201

Query: 321 FSATLPNSLVDFVKAGLVNPVLVRLDAETKVSENLEMLFLSS-KNADREANLLYILQEVI 379
           FSAT+ ++     K GL NPV + ++++ K +     LF S  K  ++  NL++I+  + 
Sbjct: 202 FSATISSAGTLIFKTGLRNPVKITVNSQGKNAPTTLNLFYSVMKPEEKLQNLIHIMNNI- 260

Query: 380 RIPLATSEQLLKLQKSTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMPAANELPSEKATI 439
                      + +K                                       +  +  
Sbjct: 261 -----------RFKKCIVY---------------------------------FSTCVSVT 276

Query: 440 LFVPTRHHVEYISQLLRDCGYLISYIYGTLDQHARKNQLYNFRAGLT-SILVVTDVAARG 498
            F     +++   + LR+   +IS I+G L   +R+  L  F   L+  IL+ TDVAARG
Sbjct: 277 FFYQYLKYLQQTDKTLREDLQVIS-IHGKLTTQSRRKALSTFTESLSDCILLTTDVAARG 335

Query: 499 VDIPMLANVINYTLPGSSKIFVHRVGRTARAGNKGWA 535
           +DIP +  V+    P  + IF+HR GRT RA   G A
Sbjct: 336 IDIPDVDLVLQIDPPTDADIFLHRCGRTGRANKIGRA 372

>TPHA0N01130 Chr14 complement(237020..239653) [2634 bp, 877 aa] {ON}
           Anc_6.148 YBR237W
          Length = 877

 Score =  159 bits (403), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 78/209 (37%), Positives = 131/209 (62%), Gaps = 10/209 (4%)

Query: 160 FRQPTPIQRKTIPLILQSRDIVGMARTGSGKTAAFILPMVEKLKSH----SGKIGARAVI 215
           +  PTPIQ + IP I+  RD++G+++TGSGKT ++ LP++  +K+     + + G   +I
Sbjct: 302 YDTPTPIQSQAIPAIMTGRDVIGISKTGSGKTISYALPLIRHVKAQRPLSNSETGPLGLI 361

Query: 216 LSPSRELAMQTFNVFKDFARGT-ELRSVLLTGGDSLEEQFSMMMSNPDVIIATPGRFLHL 274
           ++P+RELA+Q     + F +    +RS+  TGG  L+ Q        ++++ATPGRF+ L
Sbjct: 362 IAPTRELAIQINEEIQKFIKSDPSIRSICCTGGSELKNQIYEFKRGIEIVVATPGRFIDL 421

Query: 275 KVEMN----LDLKSVEYVVFDEADRLFEMGFQEQLNELLASLPTTRQTLLFSATLPNSLV 330
            + +N    L+ K +  V+ DEADRLF+MGF+ Q+ +++ ++   +Q +LFSAT P  L 
Sbjct: 422 -LTLNTGKLLNTKRITSVILDEADRLFDMGFEPQVTQIMKTIRPDKQCVLFSATFPIKLQ 480

Query: 331 DFVKAGLVNPVLVRLDAETKVSENLEMLF 359
            FVK  L NP+ + +D++T V+EN+   F
Sbjct: 481 AFVKRVLHNPLTITIDSKTMVNENVHQAF 509

 Score = 52.0 bits (123), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 28/99 (28%), Positives = 50/99 (50%)

Query: 441 FVPTRHHVEYISQLLRDCGYLISYIYGTLDQHARKNQLYNFRAGLTSILVVTDVAARGVD 500
           FV ++   + ++  L    Y +  I+       R + L  F+    SIL+ T+V +RG++
Sbjct: 556 FVSSQQTCDAVAANLEKYDYDVFSIHAGRSYQERVSNLEKFKKTKNSILLCTEVLSRGLN 615

Query: 501 IPMLANVINYTLPGSSKIFVHRVGRTARAGNKGWAYSIV 539
           +P ++ VI Y        +VH  GRTAR   +G A +++
Sbjct: 616 VPEVSLVIIYNAVNKFSQYVHTTGRTARGTRRGNAITLL 654

>KLTH0A02244g Chr1 (190077..191873) [1797 bp, 598 aa] {ON} similar
           to uniprot|P25808 Saccharomyces cerevisiae YFL002C SPB4
           involved in the maturation of 25S ribosomal RNA
           ATP-dependent RNA helicase
          Length = 598

 Score =  156 bits (395), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 115/410 (28%), Positives = 196/410 (47%), Gaps = 62/410 (15%)

Query: 145 FGLSKIVLNNIKRKGFRQPTPIQRKTIPLILQSRDIVGMARTGSGKTAAFILPMVEKLKS 204
           + L   +   I   GF   TP+Q  TIP+   ++D+V  + TGSGKT AF +P++EK+  
Sbjct: 12  YELQPWIRTAIDAMGFEIMTPVQASTIPMFSGNKDVVVESVTGSGKTIAFTIPILEKVVK 71

Query: 205 H--SGKIGAR----AVILSPSRELAMQTFNVFKDF-----ARGTELRSVLLTGGDS--LE 251
              SG    R    ++I+SP+REL+ Q  +V + F     +    ++S L+ G  S  + 
Sbjct: 72  EVLSGSPLKRGHFYSLIISPTRELSKQIQDVVEAFLAYYPSESCPIKSQLIVGTSSCSVR 131

Query: 252 EQFSMMMSN-PDVIIATPGRFLHLKVEMNLDLKSVEYVVFDEADRLFEMGFQEQLNELLA 310
           +  S  + N P ++I TPGR L       +   S   VV DEADRL ++ F++ +  +L 
Sbjct: 132 DDVSKFLENAPQILIGTPGRVLDFMKASTVKTSSCGVVVLDEADRLLDVSFEKDVESILG 191

Query: 311 SLPTTRQTLLFSATLPNSLVDFVKAGLVNPVLVRLDAETKVSENLEMLFLSSKNADREAN 370
            LP  R+T LFSAT+ ++     + G+ NPV + + ++ +  E+L++ ++  K  ++  +
Sbjct: 192 MLPKQRRTGLFSATISSAGNQIYRTGMRNPVKIAVKSKVQNPESLQINYIVVKPEEKLHH 251

Query: 371 LLYILQEVIRIPLATSEQLLKLQKSTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMPAAN 430
           LL I+              ++ +K                                    
Sbjct: 252 LLNIINN------------MRYRKCIVY-------------------------------- 267

Query: 431 ELPSEKATILFVPTRHHVEYISQLLRDCGYLISYIYGTLDQHARKNQLYNFRAGL-TSIL 489
             P+ +A   F     H+  IS+   D    +  ++G L  ++R   L  F   L  ++L
Sbjct: 268 -FPTCQAVTYFYSFLKHLSDISKTRDDLE--VYSLHGKLQTNSRIGTLAKFSTSLNIAVL 324

Query: 490 VVTDVAARGVDIPMLANVINYTLPGSSKIFVHRVGRTARAGNKGWAYSIV 539
           + TDVAARG+DIP +  V+ +  P ++++F+HR GRT RA   G A + +
Sbjct: 325 LTTDVAARGIDIPEVDLVLQFDPPTNAEMFLHRCGRTGRANRAGKAITFI 374

>ZYRO0F04312g Chr6 complement(366863..368671) [1809 bp, 602 aa] {ON}
           highly similar to uniprot|P25808 Saccharomyces
           cerevisiae YFL002C SPB4 involved in the maturation of
           25S ribosomal RNA ATP-dependent RNA helicase
          Length = 602

 Score =  155 bits (392), Expect = 7e-39,   Method: Compositional matrix adjust.
 Identities = 118/405 (29%), Positives = 187/405 (46%), Gaps = 79/405 (19%)

Query: 159 GFRQPTPIQRKTIPLILQSRDIVGMARTGSGKTAAFILPMVEKLKSHSG------KIGAR 212
           GF   TP+Q  TIP+  +++D+V  + TGSGKT AF++P++EK+ +         K    
Sbjct: 26  GFDTMTPVQTSTIPMFARNKDVVVESVTGSGKTVAFVIPILEKIIAEEANTPNLKKGHFH 85

Query: 213 AVILSPSRELAMQTFNVFKDFARGTE-----LRSVLLTGGD--SLEEQFSMMMSN-PDVI 264
           ++I++P+REL+ Q  +V + F          +RS LL G +  S+ +  +  + N P ++
Sbjct: 86  SLIVTPTRELSNQIQSVIQSFLEHYPDDEHPIRSQLLVGTNQSSVRDDLANFLQNRPQIL 145

Query: 265 IATPGRFLHLKVEMNLDLKSVEYVVFDEADRLFEMGFQEQLNELLASLPTTRQTLLFSAT 324
           + TPGR L       +  KS   +V DEADRL ++ F   + ++L +LP  R+T LFSAT
Sbjct: 146 VGTPGRVLDFLQMSAVQTKSCSVLVLDEADRLLDLSFFGDIEKILKTLPKQRRTGLFSAT 205

Query: 325 LPNSLVDFVKAGLVNPVLVRLDAETKVSENLEMLFLSSKNADREANLLYILQEVIRIPLA 384
           + ++     K GL NPV + + ++TK   +L               L Y + E    P A
Sbjct: 206 IGSAGSQIFKTGLRNPVKITVSSKTKAPTSL--------------GLFYTVIE----PEA 247

Query: 385 TSEQLLKLQKSTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMPAANELPSEKATILFVPT 444
             +QLL +  +                                        K  I++ PT
Sbjct: 248 KIQQLLSIMNNYKF-------------------------------------KKCIVYFPT 270

Query: 445 RHHVEYISQLL----RDCGYL-----ISYIYGTLDQHARKNQLYNFRAGL-TSILVVTDV 494
              V Y    +    RD   L        ++G L   +R+  L +F      ++L  TDV
Sbjct: 271 CISVTYFYSFMQYLQRDKKLLDEEVEFFSLHGKLQTSSRQKTLDSFGKSFGKAVLFTTDV 330

Query: 495 AARGVDIPMLANVINYTLPGSSKIFVHRVGRTARAGNKGWAYSIV 539
           AARG+DIP +  VI    P  + +F+HR GRT RA  +G A + +
Sbjct: 331 AARGIDIPDVDLVIQLDPPSDTTMFLHRCGRTGRANKEGRAITFL 375

>TPHA0D01990 Chr4 complement(411607..413103) [1497 bp, 498 aa] {ON}
           Anc_5.337 YHR065C
          Length = 498

 Score =  153 bits (386), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 89/241 (36%), Positives = 131/241 (54%), Gaps = 4/241 (1%)

Query: 141 SFPSFGLSKIVLNNIKRKGFRQPTPIQRKTIPLILQSRDIVGMARTGSGKTAAFILPMVE 200
           SF    L   ++       F +PTPIQ K+IP  L+  DI+G+A+TGSGKTAAF +P++ 
Sbjct: 76  SFNELDLVPELIQACHNLNFSKPTPIQSKSIPPALEGHDIIGLAQTGSGKTAAFAIPILN 135

Query: 201 KLKSHSGKIGARAVILSPSRELAMQTFNVFKDFARGTELRSVLLTGGDSLEEQFSMMMSN 260
           KL          A IL+P+RELA Q    F        +RSV + GG ++ +Q   +M  
Sbjct: 136 KLWEDQQPY--YACILAPTRELAQQIKETFDSLGSLMGVRSVCIVGGMNMMDQSRELMRK 193

Query: 261 PDVIIATPGRFL-HLKVEMNLDLKSVEYVVFDEADRLFEMGFQEQLNELLASLPTT-RQT 318
           P +IIATPGR + HL+      L+ ++++V DEADRL +M F   L+ +L  +PT  R T
Sbjct: 194 PHIIIATPGRLMDHLENTKGFSLRKLKFLVMDEADRLLDMEFGPVLDRILKIIPTQDRTT 253

Query: 319 LLFSATLPNSLVDFVKAGLVNPVLVRLDAETKVSENLEMLFLSSKNADREANLLYILQEV 378
            LFSAT+ + +    +A L NPV   +  + +  E L    +      +   L+Y+L E 
Sbjct: 254 YLFSATMTSKIEKLQRASLTNPVKCAVSNKYQTVETLVQTLMVVPGGLKNTYLIYLLNEF 313

Query: 379 I 379
           I
Sbjct: 314 I 314

 Score = 90.5 bits (223), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 50/123 (40%), Positives = 71/123 (57%)

Query: 436 KATILFVPTRHHVEYISQLLRDCGYLISYIYGTLDQHARKNQLYNFRAGLTSILVVTDVA 495
           K+ I+F  T+ + E +S L     +  + ++G L+Q+ R   L  F+AG   ILV  DVA
Sbjct: 316 KSIIVFTRTKANAERLSALSNLLEFSSTALHGDLNQNQRTGALDLFKAGKRQILVAIDVA 375

Query: 496 ARGVDIPMLANVINYTLPGSSKIFVHRVGRTARAGNKGWAYSIVAXXXXXXXXXXXXXXG 555
           ARG+DIP +  VINY +P  SK ++HRVGRTARAG  G + S+V+              G
Sbjct: 376 ARGLDIPSVDIVINYDIPVDSKSYIHRVGRTARAGRSGKSISLVSQYDLELILRIEDVLG 435

Query: 556 KKI 558
           KK+
Sbjct: 436 KKL 438

>NDAI0C04250 Chr3 (968216..969730) [1515 bp, 504 aa] {ON} Anc_5.337
          Length = 504

 Score =  152 bits (385), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 96/264 (36%), Positives = 140/264 (53%), Gaps = 11/264 (4%)

Query: 118 EEEDDVNEYFSTNNLEKQKHKKGSFPSFGLSKIVLNNIKRKGFRQPTPIQRKTIPLILQS 177
           EEED+     S    E       +F    L   ++   K   + +PTPIQ K+IP  L+ 
Sbjct: 69  EEEDEDENSTSYETFE-------TFSELNLVPELIQACKNLNYSKPTPIQSKSIPPALKG 121

Query: 178 RDIVGMARTGSGKTAAFILPMVEKLKSHSGKIGARAVILSPSRELAMQTFNVFKDFARGT 237
            DI+G+A+TGSGKTAAF +P++  L  H  +    A IL+P+RELA Q    F       
Sbjct: 122 HDIIGLAQTGSGKTAAFAIPILNSL-WHDQQ-PYYACILAPTRELAQQIKETFDSLGSLM 179

Query: 238 ELRSVLLTGGDSLEEQFSMMMSNPDVIIATPGRFL-HLKVEMNLDLKSVEYVVFDEADRL 296
            +RSV + GG ++ +Q   +M  P VIIATPGR + HL+      L+ ++Y+V DEADRL
Sbjct: 180 GVRSVCIVGGMNMMDQARDLMRKPHVIIATPGRLMDHLENTKGFSLRKLKYLVMDEADRL 239

Query: 297 FEMGFQEQLNELLASLPTT-RQTLLFSATLPNSLVDFVKAGLVNPVLVRLDAETKVSENL 355
            +M F   L+ +L  LPT  R T LFSAT+ + +    +A L NPV   +  + +  + L
Sbjct: 240 LDMEFGPVLDRILKILPTQGRTTYLFSATMTSKIDKLQRASLTNPVKCAVSNKYQTVDTL 299

Query: 356 EMLFLSSKNADREANLLYILQEVI 379
               +      +   L+Y+L E I
Sbjct: 300 VQTLIVVPGGLKNTFLIYLLNEYI 323

 Score = 98.2 bits (243), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 53/123 (43%), Positives = 74/123 (60%)

Query: 436 KATILFVPTRHHVEYISQLLRDCGYLISYIYGTLDQHARKNQLYNFRAGLTSILVVTDVA 495
           K+TI+F  T+ + E IS L     +  + ++G L+Q+ R   L  F+AG  +ILV TDVA
Sbjct: 325 KSTIIFTRTKANAERISGLCNLLEFNATALHGDLNQNQRTGALDLFKAGRKTILVATDVA 384

Query: 496 ARGVDIPMLANVINYTLPGSSKIFVHRVGRTARAGNKGWAYSIVAXXXXXXXXXXXXXXG 555
           ARG+DIP +  VINY +P  SK ++HRVGRTARAG  G + S+V+              G
Sbjct: 385 ARGLDIPSVDIVINYDIPVDSKSYIHRVGRTARAGRSGKSISLVSQYDLELILRIEEVLG 444

Query: 556 KKI 558
           KK+
Sbjct: 445 KKL 447

>Kwal_26.8470 s26 complement(798445..799722) [1278 bp, 425 aa] {ON}
           YBR237W (PRP5) - RNA helicase homolog [contig 61] FULL
          Length = 425

 Score =  150 bits (379), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 105/363 (28%), Positives = 167/363 (46%), Gaps = 56/363 (15%)

Query: 141 SFPSFGLSKIVLNNIKRKGFRQPTPIQRKTIPLILQSRDIVGMARTGSGKTAAFILPMVE 200
           SF   G  + VL+ +K +GF +PT IQ +  P+ L  RD++G+A TGSGKT ++ LP + 
Sbjct: 113 SFDEAGFPEYVLSEVKAEGFEKPTGIQCQGWPMALSGRDMIGVAATGSGKTLSYCLPGIV 172

Query: 201 KLKSH---SGKIGARAVILSPSRELAMQTFNVFKDFARGTELRSVLLTGGDSLEEQFSMM 257
            + +    S   G   ++LSP+RELA+Q       F + + +R+  + GG     Q   +
Sbjct: 173 HINAQPLLSPGDGPIVLVLSPTRELAVQIQTECSKFGKSSRIRNTCVYGGVPRGHQIREL 232

Query: 258 MSNPDVIIATPGRFLHLKVEMNLDLKSVEYVVFDEADRLFEMGFQEQLNELLASLPTTRQ 317
               +++IATPGR + +      +LK V Y+V DEADR+ +MGF+ Q+ +++  +   RQ
Sbjct: 233 SRGAEIVIATPGRLIDMLEIGKTNLKRVTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQ 292

Query: 318 TLLFSATLPNSLVDFVKAGLVNPVLVRLDA-ETKVSENLEMLFLSSKNADREANLLYILQ 376
           TL++SAT P  +    +  L +P+ V + + E   S N++ +       D+   LL  L+
Sbjct: 293 TLMWSATWPKEVQQLARDYLHDPIQVNVGSLELAASHNIKQVVEVVSEMDKRDRLLKHLE 352

Query: 377 EVIRIPLATSEQLLKLQKSTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMPAANELPSEK 436
                                                               A+E    K
Sbjct: 353 ---------------------------------------------------TASEDKDSK 361

Query: 437 ATILFVPTRHHVEYISQLLRDCGYLISYIYGTLDQHARKNQLYNFRAGLTSILVVTDVAA 496
             I     R   E    L +D G+    I+G   Q+ R   L  FR+G + I+V TDVAA
Sbjct: 362 ILIFASTKRTCDEVTRVLRQD-GWPALAIHGDKAQNERDWVLQEFRSGNSPIMVATDVAA 420

Query: 497 RGV 499
           RG+
Sbjct: 421 RGI 423

>KNAG0B04660 Chr2 complement(900857..902341) [1485 bp, 494 aa] {ON}
           Anc_5.337 YHR065C
          Length = 494

 Score =  152 bits (383), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 85/231 (36%), Positives = 130/231 (56%), Gaps = 4/231 (1%)

Query: 151 VLNNIKRKGFRQPTPIQRKTIPLILQSRDIVGMARTGSGKTAAFILPMVEKLKSHSGKIG 210
           +L   K   + +PTPIQ ++IP  L+ +DI+G+A+TGSGKTAAF +P++  L        
Sbjct: 85  LLEACKNLNYSKPTPIQSRSIPPALKGKDIIGLAQTGSGKTAAFAIPILNSLWHDQQPY- 143

Query: 211 ARAVILSPSRELAMQTFNVFKDFARGTELRSVLLTGGDSLEEQFSMMMSNPDVIIATPGR 270
             A ILSP+RELA Q    F        +RSV + GG ++ +Q   +M  P +II TPGR
Sbjct: 144 -YACILSPTRELAQQIKETFDSLGSLMGVRSVCIVGGMNMMDQARDLMRKPHIIIGTPGR 202

Query: 271 FL-HLKVEMNLDLKSVEYVVFDEADRLFEMGFQEQLNELLASLPTT-RQTLLFSATLPNS 328
            + HL+      L++++Y+V DEADRL +M F   L+ +L  +PT  R T LFSAT+ + 
Sbjct: 203 LMDHLENTRGFSLRNLKYLVMDEADRLLDMEFGPVLDRILKIIPTQGRTTYLFSATMTSK 262

Query: 329 LVDFVKAGLVNPVLVRLDAETKVSENLEMLFLSSKNADREANLLYILQEVI 379
           +    +A L NPV   +  + +  + L    +      ++  L+Y+L E I
Sbjct: 263 IDKLQRASLTNPVKCAVSTKYQTVDTLVQTLMVVPGGVKDTYLVYLLNEFI 313

 Score = 96.7 bits (239), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 53/123 (43%), Positives = 73/123 (59%)

Query: 436 KATILFVPTRHHVEYISQLLRDCGYLISYIYGTLDQHARKNQLYNFRAGLTSILVVTDVA 495
           K+ I+F  T+ + E IS L     +  + ++G L+Q+ R   L  F+AG  SILV TDVA
Sbjct: 315 KSMIIFTRTKANAERISGLANLLQFSATALHGDLNQNQRTGALDLFKAGRRSILVATDVA 374

Query: 496 ARGVDIPMLANVINYTLPGSSKIFVHRVGRTARAGNKGWAYSIVAXXXXXXXXXXXXXXG 555
           ARG+DIP +  VINY +P  SK ++HRVGRTARAG  G + S+V+              G
Sbjct: 375 ARGLDIPSVDVVINYDIPVDSKSYIHRVGRTARAGRSGKSISLVSQYDLELILRIEEVLG 434

Query: 556 KKI 558
           KK+
Sbjct: 435 KKL 437

>Ecym_7324 Chr7 complement(689228..691021) [1794 bp, 597 aa] {ON}
           similar to Ashbya gossypii AGL004C
          Length = 597

 Score =  154 bits (388), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 114/396 (28%), Positives = 182/396 (45%), Gaps = 62/396 (15%)

Query: 159 GFRQPTPIQRKTIPLILQSRDIVGMARTGSGKTAAFILPMVEKLKSHSGKIGA------R 212
           GF   TP+Q  TIPL   ++D+V  + TGSGKT AF++P++EK+        A       
Sbjct: 26  GFEAMTPVQASTIPLFAGNKDVVVESVTGSGKTVAFVIPILEKIIKDGANSAAFRKGHFH 85

Query: 213 AVILSPSRELAMQTFNVFKDFAR-----GTELRSVLLTGGDSL---EEQFSMMMSNPDVI 264
           ++I+SP+RELA Q   V + F          +RS ++ G + +   ++    M + P ++
Sbjct: 86  SLIVSPTRELASQIQLVVQSFLNYYPDNCYPIRSQIIVGTNQVTVRDDVAEFMQNRPQIL 145

Query: 265 IATPGRFLHLKVEMNLDLKSVEYVVFDEADRLFEMGFQEQLNELLASLPTTRQTLLFSAT 324
           I TPGR L     + +   S   VV DEAD+L +  F + ++ +L  LP  R+T LFSAT
Sbjct: 146 IGTPGRLLDFLKMVGVKTTSCGIVVLDEADKLLDYNFGKDVDNILKFLPKQRRTGLFSAT 205

Query: 325 LPNSLVDFVKAGLVNPVLVRLDAETKVSENLEMLFLSSKNADREANLLYILQEVIRIPLA 384
           + ++  +  K G+ NPV + + +  K  ++L+M ++  +   +   LL IL         
Sbjct: 206 ISSAGDEVFKTGMRNPVKISVKSHKKAPQSLKMNYVVVEPEKKFELLLSIL--------- 256

Query: 385 TSEQLLKLQKSTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMPAANELPSEKATILFVPT 444
                 + +K                                     LP+  +   F   
Sbjct: 257 ---NYYRFKKCIVY---------------------------------LPTCISVTYFYAI 280

Query: 445 RHHVEYISQLLRDCGYLISYIYGTLDQHARKNQLYNFRAGLT-SILVVTDVAARGVDIPM 503
             H+  + Q+  D    I  ++G L   +R   L  F   L  S+L+ TDVAARG+DIP 
Sbjct: 281 IQHLTKLGQMDEDLK--IYSLHGKLQTTSRMKTLEKFTQDLNKSVLLTTDVAARGIDIPN 338

Query: 504 LANVINYTLPGSSKIFVHRVGRTARAGNKGWAYSIV 539
           +  V+    P  + IF+HR GRT RA   G A  ++
Sbjct: 339 IDLVLQMDPPTDTDIFLHRCGRTGRANRVGKAIVLL 374

>Ecym_8261 Chr8 complement(528229..530556) [2328 bp, 775 aa] {ON}
           similar to Ashbya gossypii ACR040W
          Length = 775

 Score =  155 bits (393), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 85/214 (39%), Positives = 131/214 (61%), Gaps = 6/214 (2%)

Query: 130 NNLEKQKHKKGSFPSFGLSKIVLNNIKRKGFRQPTPIQRKTIPLILQSRDIVGMARTGSG 189
           N+    K    SF    +S++ L  +K  GF + T IQR +IP+ L+  DI+G A+TGSG
Sbjct: 31  NDFGATKCTASSFDELPISEVTLKGLKESGFIKLTDIQRDSIPMALKGHDILGAAKTGSG 90

Query: 190 KTAAFILPMVEKL--KSHSGKIGARAVILSPSRELAMQTFNVFKDFARGTELRSVLLTGG 247
           KT AF++P++EKL  +  +   G  A+I+SP+RELAMQ + V     + T   + L+ GG
Sbjct: 91  KTLAFLIPVIEKLYREKWTEFDGLGALIISPTRELAMQIYEVLIKIGKHTSFSAGLVIGG 150

Query: 248 DSLEEQFSM-MMSNPDVIIATPGRFL-HLKVEMNLDLKSVEYVVFDEADRLFEMGFQEQL 305
             +  +F M  +S  +++I TPGR L H+   + L   +++ +V DEADR  +MGF++ L
Sbjct: 151 KDV--KFEMDRISKINILIGTPGRILQHMDQAVGLTSSNLQILVLDEADRCLDMGFKKTL 208

Query: 306 NELLASLPTTRQTLLFSATLPNSLVDFVKAGLVN 339
           + ++++LP  RQTLLFSAT   SL D  +  LV+
Sbjct: 209 DAIVSNLPPDRQTLLFSATQSQSLADLARLSLVD 242

 Score = 63.2 bits (152), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 30/98 (30%), Positives = 48/98 (48%), Gaps = 2/98 (2%)

Query: 438 TILFVPTRHHVEYISQLLRDC--GYLISYIYGTLDQHARKNQLYNFRAGLTSILVVTDVA 495
           T++F+ +   V ++ +  R    G  + +++G   Q AR   L  F     + L  TDV 
Sbjct: 291 TVVFLSSSKQVHFVYETFRKLQPGISLMHLHGRQKQTARTETLDKFSRAQHACLFSTDVV 350

Query: 496 ARGVDIPMLANVINYTLPGSSKIFVHRVGRTARAGNKG 533
           ARG+D P +  V+    P     ++HR GR+AR G  G
Sbjct: 351 ARGIDFPTVDWVVQVDCPEDVDTYIHRAGRSARYGKSG 388

>NCAS0F02790 Chr6 (561303..562811) [1509 bp, 502 aa] {ON} Anc_5.337
          Length = 502

 Score =  151 bits (381), Expect = 5e-38,   Method: Compositional matrix adjust.
 Identities = 88/241 (36%), Positives = 131/241 (54%), Gaps = 4/241 (1%)

Query: 141 SFPSFGLSKIVLNNIKRKGFRQPTPIQRKTIPLILQSRDIVGMARTGSGKTAAFILPMVE 200
           SF    L   +L   K   + +PTPIQ ++IP  L+  DI+G+A+TGSGKTAAF +P++ 
Sbjct: 83  SFSELDLVPELLQACKNLNYTKPTPIQSRSIPPALKGNDIIGLAQTGSGKTAAFAIPILN 142

Query: 201 KLKSHSGKIGARAVILSPSRELAMQTFNVFKDFARGTELRSVLLTGGDSLEEQFSMMMSN 260
            L          A IL+P+RELA Q    F        +RS  + GG ++ +Q   +M  
Sbjct: 143 SLWHDQQPY--YACILAPTRELAQQIKETFDSLGSLMGVRSTCIVGGMNMMDQARDLMRK 200

Query: 261 PDVIIATPGRFL-HLKVEMNLDLKSVEYVVFDEADRLFEMGFQEQLNELLASLPTT-RQT 318
           P +IIATPGR + HL+      L+ ++Y+V DEADRL +M F   L+ +L  LPT  R T
Sbjct: 201 PHIIIATPGRLMDHLENTKGFSLRKLKYLVMDEADRLLDMEFGPVLDRILKILPTQGRTT 260

Query: 319 LLFSATLPNSLVDFVKAGLVNPVLVRLDAETKVSENLEMLFLSSKNADREANLLYILQEV 378
            LFSAT+ + +    +A L NPV   +  + +  + L    +      ++  L+Y+L E 
Sbjct: 261 YLFSATMTSKIDKLQRASLTNPVKCAVSNKYQTVDTLVQTLIVVPGGLKDTYLVYLLNEF 320

Query: 379 I 379
           I
Sbjct: 321 I 321

 Score = 99.0 bits (245), Expect = 9e-21,   Method: Compositional matrix adjust.
 Identities = 54/123 (43%), Positives = 73/123 (59%)

Query: 436 KATILFVPTRHHVEYISQLLRDCGYLISYIYGTLDQHARKNQLYNFRAGLTSILVVTDVA 495
           K TI+F  T+ + E IS L     +  + ++G L+Q+ R   L  F+AG  SILV TDVA
Sbjct: 323 KTTIIFTRTKANAERISGLCNLLEFNATALHGDLNQNQRTGALDLFKAGRKSILVATDVA 382

Query: 496 ARGVDIPMLANVINYTLPGSSKIFVHRVGRTARAGNKGWAYSIVAXXXXXXXXXXXXXXG 555
           ARG+DIP +  VINY +P  SK ++HRVGRTARAG  G + S+V+              G
Sbjct: 383 ARGLDIPSVDIVINYDIPVDSKSYIHRVGRTARAGRSGKSISLVSQYDLELILRIEEVLG 442

Query: 556 KKI 558
           KK+
Sbjct: 443 KKL 445

>NDAI0C06300 Chr3 complement(1459510..1461354) [1845 bp, 614 aa]
           {ON} Anc_8.87
          Length = 614

 Score =  152 bits (384), Expect = 9e-38,   Method: Compositional matrix adjust.
 Identities = 122/413 (29%), Positives = 190/413 (46%), Gaps = 90/413 (21%)

Query: 159 GFRQPTPIQRKTIPLILQSRDIVGMARTGSGKTAAFILPMVEKLKSHSG------KIGAR 212
           GF Q TP+Q  TIP+  Q++D+V  + TGSGKT AF++P++E++ S         K    
Sbjct: 27  GFDQMTPVQASTIPMFSQNKDVVVESVTGSGKTVAFVIPVLERIISEGANKKSFKKGHFH 86

Query: 213 AVILSPSRELAMQTFNVFKDFARGTE-----LRSVLLTGGD--SLEEQFSMMMSN-PDVI 264
           ++I+SP+RELA QT  V  +F +        +++ LL G +  ++ +  +  + N P ++
Sbjct: 87  SLIISPTRELAKQTKIVIDEFLKQYPDDMYPIKAQLLVGTNENTVRDDVNDFLENKPQIL 146

Query: 265 IATPGRFLHLKVEMNLDLKSVEYVVFDEADRLFEMGFQEQLNELLASLPTTRQTLLFSAT 324
           + TPGR L      ++   S   V+ DEADRL ++ F + + ++L+ LP  R+T LFSAT
Sbjct: 147 VGTPGRLLDFLQMTSVKTSSCGMVIIDEADRLLDISFVKDVEKILSVLPKQRRTGLFSAT 206

Query: 325 LPNSLVDFVKAGLVNPVLVRLDAETKVSENLEMLFLSSKNADREANLLYILQEVIRIPLA 384
           + ++     K GL NPV ++               ++SKN    A  L  L  V+  P  
Sbjct: 207 ISSAGDSIFKTGLRNPVKIK---------------VNSKNV---APSLLKLNYVVVDPEL 248

Query: 385 TSEQLLKLQKSTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMPAANELPSEKATILFVPT 444
             + LL L  +                                        K  I++ PT
Sbjct: 249 KFQYLLNLLNNYRF-------------------------------------KKCIVYFPT 271

Query: 445 RHHVEYISQLLRDCGYL-----------------ISYIYGTLDQHARKNQLYNFRAGLT- 486
              V Y    ++   YL                 I  ++G L   +R   L +F   LT 
Sbjct: 272 CISVTYFYSFMQ---YLQNEFKNSKHPFLNEDLQIFSLHGKLQTASRMKTLDSFTETLTN 328

Query: 487 SILVVTDVAARGVDIPMLANVINYTLPGSSKIFVHRVGRTARAGNKGWAYSIV 539
           ++L+ TDVAARG+DIP +  V+    P  S IF+HR GRT RA   G A + +
Sbjct: 329 AVLLTTDVAARGIDIPDVDLVVQLDPPTDSDIFLHRCGRTGRANRIGQAITFL 381

>KLTH0H15686g Chr8 complement(1353647..1354725,1354841..1355081)
           [1320 bp, 439 aa] {ON} similar to uniprot|Q07478
           Saccharomyces cerevisiae YDL084W SUB2 Suppresses the
           cold-sensitive snRNP biogenesis brr1-1 mutation RNA
           helicase
          Length = 439

 Score =  149 bits (375), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 120/455 (26%), Positives = 207/455 (45%), Gaps = 73/455 (16%)

Query: 100 ILELSDDENNI----SGQTQAGEEEDDVNEYFSTNNLEKQKHKKG----SFPSFGLSKIV 151
           +LE SD+E  I    S   +AG +  D  E  +T   +K+    G     F  F L   +
Sbjct: 9   LLEYSDNEQEIQVEASKAAEAGADTKDSGE--TTGEADKKGSYVGIHSTGFKDFLLKPEL 66

Query: 152 LNNIKRKGFRQPTPIQRKTIPLILQSRDIVGMARTGSGKTAAFILPMVEKLKSHSGKIGA 211
              I   GF  P+ +Q+ TIP  +   D++  A++G GKTA F+L  +++L    G++  
Sbjct: 67  SRAIIDCGFEHPSEVQQHTIPQSIHGTDVLCQAKSGLGKTAVFVLSTLQQLDPVPGEVS- 125

Query: 212 RAVILSPSRELAMQTFNVFKDFARGT-ELRSVLLTGGDSLEEQFSMMM---SNPDVIIAT 267
             V++  +RELA Q  N +  F++   ++++ +  GG  + +   ++    + P +++AT
Sbjct: 126 -VVVICNARELAYQIRNEYLRFSKYMPDVKTAVFYGGTPITKDAELLKNKETAPHIVVAT 184

Query: 268 PGRFLHLKVEMNLDLKSVEYVVFDEADRLF-EMGFQEQLNELLASLPTTRQTLLFSATLP 326
           PGR   L  +  +DL SV+  V DE D++  E+G ++ + ++  + P  +Q ++FSATL 
Sbjct: 185 PGRLKALVRDKIIDLSSVKNFVIDECDKVLEELGMRKDVQDIFRATPRDKQVMMFSATLS 244

Query: 327 NSLVDFVKAGLVNPVLVRLDAETKVS-ENLEMLFLSSKNADREANLLYILQEVIRIPLAT 385
             +    +  L NP+ + +D E K++   L+  ++  +  ++   L  +L ++       
Sbjct: 245 QEMRPICRRFLQNPLEIFVDDEAKLTLHGLQQYYIKLEEREKNRKLAQLLDDL------E 298

Query: 386 SEQLLKLQKSTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMPAANELPSEKATILFVPTR 445
             Q++   KST                                ANEL             
Sbjct: 299 FNQVIIFVKSTNR------------------------------ANEL------------- 315

Query: 446 HHVEYISQLLRDCGYLISYIYGTLDQHARKNQLYNFRAGLTSILVVTDVAARGVDIPMLA 505
                 ++LL    +    ++G + Q  R  +   F+     I V TDV  RG+DI  + 
Sbjct: 316 ------TKLLNASNFPAITVHGGMKQEERIARYKAFKEFEKRICVSTDVFGRGIDIERIN 369

Query: 506 NVINYTLPGSSKIFVHRVGRTARAGNKGWAYSIVA 540
             INY LP  +  ++HRVGR  R G KG A S VA
Sbjct: 370 LAINYDLPSEADQYLHRVGRAGRFGTKGLAISFVA 404

>Skud_15.210 Chr15 complement(374410..375858) [1449 bp, 482 aa] {ON}
           YOR046C (REAL)
          Length = 482

 Score =  149 bits (377), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 114/408 (27%), Positives = 188/408 (46%), Gaps = 69/408 (16%)

Query: 141 SFPSFGLSKIVLNNIKRKGFRQPTPIQRKTIPLILQS--RDIVGMARTGSGKTAAFILPM 198
           SF   GL+  +L  I    F++P+ IQ + +PL+L +  R+++  +++G+GKTAAF L M
Sbjct: 93  SFDELGLAPELLKGIYAMKFQKPSKIQERALPLLLHNPPRNMIAQSQSGTGKTAAFSLTM 152

Query: 199 VEKLKSHSGKIGARAVILSPSRELAMQTFNVFKDFARGTELRSVLLTGGDSLEEQFSMMM 258
           + ++         +A+ L+PSRELA QT +V ++  + TE+ S L+   DS E+   +  
Sbjct: 153 LTRVNPEDA--SPQAICLAPSRELARQTLDVIQEMGKFTEITSQLIV-PDSFEKNKQI-- 207

Query: 259 SNPDVIIATPGRFLHLKVEMNLDLKSVEYVVFDEADRLF-EMGFQEQLNELLASLPTTRQ 317
            N  VI+ TPG  L L     + L+ ++  V DEAD +  + G  +Q   +   LP   Q
Sbjct: 208 -NAQVIVGTPGTVLDLMRRKLVQLQKIKIFVLDEADNMLDQQGLGDQCIRVKRFLPKDAQ 266

Query: 318 TLLFSATLPNSLVDFVKAGLVNPVLVRLDAETKVSENLEMLFLSSKNADREANLLYILQE 377
            +LFSAT   ++  + K  + N   + L       + ++ L++  KN   EA+   +L E
Sbjct: 267 LVLFSATFAEAVRQYAKKIVPNANTLELQTNEVNVDAIKQLYMDCKN---EADKFEVLTE 323

Query: 378 VIRIPLATSEQLLKLQKSTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMPAANELPSEKA 437
           +  +    S  +    K T                                        A
Sbjct: 324 LYGLMTIGSSIIFVATKKT----------------------------------------A 343

Query: 438 TILFVPTRHHVEYISQLLRDCGYLISYIYGTLDQHARKNQLYNFRAGLTSILVVTDVAAR 497
            +L+   ++    +S L           +G L    R   + +FR G + +L+ T+V AR
Sbjct: 344 NVLYGKLKNEGHEVSIL-----------HGDLQTQERDRLIDDFREGRSKVLITTNVLAR 392

Query: 498 GVDIPMLANVINYTLP------GSSKIFVHRVGRTARAGNKGWAYSIV 539
           G+DIP ++ V+NY LP           ++HR+GRT R G KG A S V
Sbjct: 393 GIDIPTVSMVVNYDLPTLANGQADPATYIHRIGRTGRFGRKGVAISFV 440

>Smik_6.81 Chr6 complement(152467..154287) [1821 bp, 606 aa] {ON}
           YFL002C (REAL)
          Length = 606

 Score =  152 bits (383), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 118/410 (28%), Positives = 188/410 (45%), Gaps = 62/410 (15%)

Query: 145 FGLSKIVLNNIKRKGFRQPTPIQRKTIPLILQSRDIVGMARTGSGKTAAFILPMVEKL-- 202
           F L   +   +   GF   TP+Q  TIP++  ++D+V  + TGSGKTAAF++P++EK+  
Sbjct: 12  FSLLPWIRTGLDVMGFETMTPVQASTIPMLAGNKDVVVDSVTGSGKTAAFVIPILEKIVK 71

Query: 203 ----KSHSGKIGARAVILSPSRELAMQTFNVFKDFARGTE-----LRSVLLTGGD--SLE 251
                S   K    ++I++P+REL+ Q  +V   F          +R  LL G +  ++ 
Sbjct: 72  EEANSSKFKKAQFHSLIVAPTRELSRQIESVVLSFLEHYPSDLFPIRCQLLIGTNEATVR 131

Query: 252 EQFSMMMSN-PDVIIATPGRFLHLKVEMNLDLKSVEYVVFDEADRLFEMGFQEQLNELLA 310
           +  S  + N P ++I TPGR L       +   +   VV DEADRL ++ F + +  +L 
Sbjct: 132 DDVSDFLRNRPQILIGTPGRVLDFLQMPAVKTSACSMVVLDEADRLLDVSFIKDIERILR 191

Query: 311 SLPTTRQTLLFSATLPNSLVDFVKAGLVNPVLVRLDAETKVSENLEMLFLSSKNADREAN 370
            LP  R+T LFSAT+ ++  D  K GL NPV + ++++ +   +L+M +      ++   
Sbjct: 192 LLPKQRRTGLFSATMRSAGSDIFKTGLRNPVRITVNSKNQAPSSLKMNYCVVNPVEKLQL 251

Query: 371 LLYILQEVIRIPLATSEQLLKLQKSTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMPAAN 430
           L+ IL               K +KS                                   
Sbjct: 252 LVSILNN------------YKFKKSIVY-------------------------------- 267

Query: 431 ELPSEKATILFVPTRHHVEYISQLLRDCGYLISYIYGTLDQHARKNQLYNFRAGLT-SIL 489
             P+  +   F     H+     L+ +    +  ++G L   AR   L  F   L+ S+L
Sbjct: 268 -FPTCVSVSYFYSFVQHLAKRKTLINEVE--VFSLHGKLQTSARTKTLAAFTNSLSNSVL 324

Query: 490 VVTDVAARGVDIPMLANVINYTLPGSSKIFVHRVGRTARAGNKGWAYSIV 539
             TDVAARG+DIP +  VI    P +S +F+HR GRT RA   G A + +
Sbjct: 325 FTTDVAARGIDIPQVDLVIQLDPPTNSDMFMHRCGRTGRANRVGKAITFL 374

>Kpol_1005.11 s1005 complement(18157..19677) [1521 bp, 506 aa] {ON}
           complement(18157..19677) [1521 nt, 507 aa]
          Length = 506

 Score =  150 bits (378), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 86/241 (35%), Positives = 131/241 (54%), Gaps = 4/241 (1%)

Query: 141 SFPSFGLSKIVLNNIKRKGFRQPTPIQRKTIPLILQSRDIVGMARTGSGKTAAFILPMVE 200
           SF    L   ++   K   F +PTPIQ ++IP  LQ  DI+G+A+TGSGKTAAF +P++ 
Sbjct: 87  SFSDLDLVPELIEACKNLNFAKPTPIQARSIPPALQGHDIIGLAQTGSGKTAAFAIPILN 146

Query: 201 KLKSHSGKIGARAVILSPSRELAMQTFNVFKDFARGTELRSVLLTGGDSLEEQFSMMMSN 260
           +L          A IL+P+RELA Q    F        +RS  + GG ++ +Q   +M  
Sbjct: 147 RLWHDQQPY--YACILAPTRELAQQIKETFDSLGSLMGVRSACIVGGMNMMDQARDLMRK 204

Query: 261 PDVIIATPGRFL-HLKVEMNLDLKSVEYVVFDEADRLFEMGFQEQLNELLASLPTT-RQT 318
           P +IIATPGR + HL+      L+ ++++V DEADRL +M F   L+ +L  +PT  R T
Sbjct: 205 PHIIIATPGRLMDHLENTRGFSLRKLKFLVMDEADRLLDMEFGPVLDRILKIIPTQGRTT 264

Query: 319 LLFSATLPNSLVDFVKAGLVNPVLVRLDAETKVSENLEMLFLSSKNADREANLLYILQEV 378
            LFSAT+ + +    +A L NPV   +  + +  + L    +      +   L+Y++ E 
Sbjct: 265 YLFSATMTSKIDKLQRASLTNPVKCAVSNKYQTVDTLVQTLIVVPGGLKNTYLIYLMNEF 324

Query: 379 I 379
           I
Sbjct: 325 I 325

 Score = 95.1 bits (235), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 49/105 (46%), Positives = 68/105 (64%)

Query: 436 KATILFVPTRHHVEYISQLLRDCGYLISYIYGTLDQHARKNQLYNFRAGLTSILVVTDVA 495
           K  I+F  T+ + E I+ L     +  + ++G L+Q+ R   L  F+AG  SILV TDVA
Sbjct: 327 KTIIVFTRTKANAERITTLANLLEFSATALHGDLNQNQRTGSLDLFKAGRRSILVATDVA 386

Query: 496 ARGVDIPMLANVINYTLPGSSKIFVHRVGRTARAGNKGWAYSIVA 540
           ARG+DIP +  VINY +P  SK ++HRVGRTARAG  G + S+V+
Sbjct: 387 ARGLDIPSVDIVINYDIPVDSKSYIHRVGRTARAGRSGKSISLVS 431

>Smik_2.380 Chr2 (678057..680609) [2553 bp, 850 aa] {ON} YBR237W
           (REAL)
          Length = 850

 Score =  154 bits (388), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 82/244 (33%), Positives = 150/244 (61%), Gaps = 14/244 (5%)

Query: 145 FGLSKIVLNNIKRK-GFRQPTPIQRKTIPLILQSRDIVGMARTGSGKTAAFILPMVEKLK 203
            GLS   +  I  K  F   TPIQ + +P I+  RD++G+++TGSGKT +++LP++ ++K
Sbjct: 260 LGLSTDTMTLITEKLRFESLTPIQSQALPAIMSGRDVIGISKTGSGKTISYLLPLLRQVK 319

Query: 204 SH----SGKIGARAVILSPSRELAMQTFNVFKDFARGTE--LRSVLLTGGDSLEEQFSMM 257
           +       + G   +IL+P+RELA+Q     + F  G E  +RSV  TGG  +++Q + +
Sbjct: 320 AQRPLSKHETGPLGLILAPTRELALQIHEEVRKFT-GAEALIRSVCCTGGSEMKKQITDL 378

Query: 258 MSNPDVIIATPGRFLHLKVEMN----LDLKSVEYVVFDEADRLFEMGFQEQLNELLASLP 313
               ++++ATPGRF+ + + +N    L  K + +V+ DEADRLF++GF+ Q+ +++ ++ 
Sbjct: 379 KRGAEIVVATPGRFIDI-LTLNDGKLLSTKRITFVIMDEADRLFDLGFEPQITQIMKTVR 437

Query: 314 TTRQTLLFSATLPNSLVDFVKAGLVNPVLVRLDAETKVSENLEMLF-LSSKNADREANLL 372
             +Q +LFSAT PN L  F    L +P+ + ++++  V+EN++  F + + + ++  NL+
Sbjct: 438 PDKQCVLFSATFPNKLRSFAVRVLRSPISITINSKGLVNENVKQKFKICNSDDEKFDNLV 497

Query: 373 YILQ 376
            I+ 
Sbjct: 498 QIVH 501

 Score = 61.6 bits (148), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 30/101 (29%), Positives = 55/101 (54%)

Query: 439 ILFVPTRHHVEYISQLLRDCGYLISYIYGTLDQHARKNQLYNFRAGLTSILVVTDVAARG 498
           I+FV ++   ++IS+ L++ G +   I+       R   L  F+    S+L+ T+V +RG
Sbjct: 529 IIFVSSQQICDFISKKLQNAGIITCAIHAGKPYQERLMNLEKFKREKNSVLLCTEVLSRG 588

Query: 499 VDIPMLANVINYTLPGSSKIFVHRVGRTARAGNKGWAYSIV 539
           +++P ++ VI Y    +   +VH  GRTAR    G A +++
Sbjct: 589 LNVPEVSLVIIYNAVKTFAQYVHTTGRTARGSRSGTAITLL 629

>Skud_6.72 Chr6 complement(140844..142664) [1821 bp, 606 aa] {ON}
           YFL002C (REAL)
          Length = 606

 Score =  151 bits (382), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 122/418 (29%), Positives = 188/418 (44%), Gaps = 78/418 (18%)

Query: 145 FGLSKIVLNNIKRKGFRQPTPIQRKTIPLILQSRDIVGMARTGSGKTAAFILPMVEKLKS 204
           F L   +   +   GF   TP+Q  TIP++  ++D+V  + TGSGKTAAF++P++EK+  
Sbjct: 12  FSLLPWIRTGLDVMGFETMTPVQASTIPMLAGNKDVVVDSVTGSGKTAAFVIPILEKIVK 71

Query: 205 HSG------KIGARAVILSPSRELAMQTFNVFKDFARGTE-----LRSVLLTGGD--SLE 251
                    K    ++I++P+REL+ Q   V   F          ++  LL G +  S+ 
Sbjct: 72  EEANTFKFKKAHFHSLIIAPTRELSRQIETVVLSFLEHYPSDLFPVKCQLLVGTNEGSVR 131

Query: 252 EQFSMMMSN-PDVIIATPGRFLHLKVEMNLDLKSVEYVVFDEADRLFEMGFQEQLNELLA 310
           +  S+ + N P +++ TPGR L       +   +   V+ DEADRL +M F + +  +L 
Sbjct: 132 DDVSIFLENRPQILVGTPGRVLDFLQMPAVKTSACSMVILDEADRLLDMSFIKDIERILR 191

Query: 311 SLPTTRQTLLFSATLPNSLVDFVKAGLVNPVLVRLDAETKVSENLEMLFLSSKNADREAN 370
            LP  R+T LFSAT+ ++  D  K GL NPV + ++++ +   +L++ +          N
Sbjct: 192 LLPKQRRTGLFSATMRSAGSDIFKTGLRNPVRITVNSKHQAPSSLKLDYCV-------VN 244

Query: 371 LLYILQEVIRIPLATSEQLLKLQKSTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMPAAN 430
            L  LQ ++ I                                                N
Sbjct: 245 PLEKLQLLVSI-----------------------------------------------LN 257

Query: 431 ELPSEKATILFVPTRHHVEYIS---QLLRDCGYLIS-----YIYGTLDQHARKNQLYNFR 482
               +K  + F PT   V Y     Q L     LIS      ++G L   AR   L +F 
Sbjct: 258 NYKFKKCIVYF-PTCVSVSYFYSFIQRLSKKNILISELEVFSLHGKLQTSARTKTLASFT 316

Query: 483 AGL-TSILVVTDVAARGVDIPMLANVINYTLPGSSKIFVHRVGRTARAGNKGWAYSIV 539
             L  S+L  TDVAARG+DIP +  VI    P +S +F+HR GRT RA   G A + +
Sbjct: 317 ESLNNSVLFTTDVAARGIDIPEVDLVIQLDPPTNSDMFMHRCGRTGRANRIGKAITFL 374

>SAKL0G09328g Chr7 (797795..799312) [1518 bp, 505 aa] {ON} highly
           similar to uniprot|P38712 Saccharomyces cerevisiae
           YHR065C RRP3 Required for maturation of the 35S primary
           transcript of pre-rRNA and is required for cleavages
           leading to mature 18S RNA RRP3 is a DEAD box gene
           homologous to eIF-4a which encodes an RNA-dependent
           ATPase possessing helicase activity which is not
           specific for RNA
          Length = 505

 Score =  149 bits (377), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 87/241 (36%), Positives = 130/241 (53%), Gaps = 4/241 (1%)

Query: 141 SFPSFGLSKIVLNNIKRKGFRQPTPIQRKTIPLILQSRDIVGMARTGSGKTAAFILPMVE 200
           SF    L   ++   K  GF +PTPIQ K IP  L+  DI+G+A+TGSGKTAAF +P++ 
Sbjct: 86  SFSDLNLVPELIEACKNLGFSKPTPIQAKAIPPALEGSDIIGLAQTGSGKTAAFAIPILN 145

Query: 201 KLKSHSGKIGARAVILSPSRELAMQTFNVFKDFARGTELRSVLLTGGDSLEEQFSMMMSN 260
           +L          A IL+P+RELA Q    F        +R+  + GG ++ +Q   +M  
Sbjct: 146 RLWHDQQPY--YACILAPTRELAQQIKETFDSLGALMGVRATCIVGGMNMMDQARDLMRK 203

Query: 261 PDVIIATPGRFL-HLKVEMNLDLKSVEYVVFDEADRLFEMGFQEQLNELLASLPTT-RQT 318
           P +IIATPGR + HL+      L+ + ++V DEADRL +M F   L+ +L  +PT  R T
Sbjct: 204 PHIIIATPGRLMDHLENTRGFSLRKLRFLVMDEADRLLDMEFGPVLDRILKIIPTQGRTT 263

Query: 319 LLFSATLPNSLVDFVKAGLVNPVLVRLDAETKVSENLEMLFLSSKNADREANLLYILQEV 378
            LFSAT+ + +    +A L NPV   +  + +  + L    +      +   L+Y+L E 
Sbjct: 264 YLFSATMTSKIDKLQRASLTNPVKCAVSNKYQTVDTLVQTLMVVPGGLKNTFLIYLLNEF 323

Query: 379 I 379
           I
Sbjct: 324 I 324

 Score = 96.3 bits (238), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 52/123 (42%), Positives = 72/123 (58%)

Query: 436 KATILFVPTRHHVEYISQLLRDCGYLISYIYGTLDQHARKNQLYNFRAGLTSILVVTDVA 495
           K  I+F  T+ + E IS L     +  + ++G L+Q+ R   L  F+AG  SILV TDVA
Sbjct: 326 KTVIVFTRTKANAERISTLCNLLEFSATALHGDLNQNQRTGALDLFKAGKRSILVATDVA 385

Query: 496 ARGVDIPMLANVINYTLPGSSKIFVHRVGRTARAGNKGWAYSIVAXXXXXXXXXXXXXXG 555
           ARG+DIP +  V+NY +P  SK ++HRVGRTARAG  G + S+V+              G
Sbjct: 386 ARGLDIPSVDIVVNYDIPVDSKSYIHRVGRTARAGRSGKSISLVSQYDLELILRIEDVLG 445

Query: 556 KKI 558
           KK+
Sbjct: 446 KKL 448

>KLLA0C14608g Chr3 (1276354..1277817) [1464 bp, 487 aa] {ON} highly
           similar to uniprot|P38712 Saccharomyces cerevisiae
           YHR065C RRP3 Required for maturation of the 35S primary
           transcript of pre-rRNA and is required for cleavages
           leading to mature 18S RNA RRP3 is a DEAD box gene
           homologous to eIF-4a which encodes an RNA-dependent
           ATPase possessing helicase activity which is not
           specific for RNA
          Length = 487

 Score =  149 bits (376), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 85/231 (36%), Positives = 128/231 (55%), Gaps = 4/231 (1%)

Query: 151 VLNNIKRKGFRQPTPIQRKTIPLILQSRDIVGMARTGSGKTAAFILPMVEKLKSHSGKIG 210
           ++   K   + +PTPIQ K IP  L+  DI+G+A+TGSGKTAAF +P++ +L        
Sbjct: 78  LIEACKNLNYNKPTPIQSKAIPPALKGSDIIGLAQTGSGKTAAFAIPILNQLWHDQQPY- 136

Query: 211 ARAVILSPSRELAMQTFNVFKDFARGTELRSVLLTGGDSLEEQFSMMMSNPDVIIATPGR 270
             A IL+P+RELA Q    F        +RS  + GG S+ +Q   +M  P +IIATPGR
Sbjct: 137 -YACILAPTRELAQQIKETFDSLGSLMGVRSTCIVGGMSMMDQARDLMRKPHIIIATPGR 195

Query: 271 FL-HLKVEMNLDLKSVEYVVFDEADRLFEMGFQEQLNELLASLPTT-RQTLLFSATLPNS 328
            + HL+     +L+ ++Y+V DEADRL +M F   L+ +L  +PT  R T LFSAT+ + 
Sbjct: 196 LMDHLENTKGFNLRKLKYLVMDEADRLLDMEFGPVLDRILNIIPTQGRTTYLFSATMTSK 255

Query: 329 LVDFVKAGLVNPVLVRLDAETKVSENLEMLFLSSKNADREANLLYILQEVI 379
           +    +A L NPV   +  + +  + L    +      +   L+Y+L E I
Sbjct: 256 IDKLQRASLTNPVKCAVSNKYQTVDTLVQTLMVVPGGLKNTFLIYLLNEFI 306

 Score =  100 bits (248), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 54/123 (43%), Positives = 74/123 (60%)

Query: 436 KATILFVPTRHHVEYISQLLRDCGYLISYIYGTLDQHARKNQLYNFRAGLTSILVVTDVA 495
           K+TI+F  T+ + E IS L     +  + ++G L+Q+ R   L  F+AG  SILV TDVA
Sbjct: 308 KSTIVFTRTKANAERISNLCNLLEFSATALHGDLNQNQRTGALDLFKAGKRSILVATDVA 367

Query: 496 ARGVDIPMLANVINYTLPGSSKIFVHRVGRTARAGNKGWAYSIVAXXXXXXXXXXXXXXG 555
           ARG+DIP +  VINY +P  SK ++HRVGRTARAG  G + S+V+              G
Sbjct: 368 ARGLDIPSVDIVINYDIPVDSKSYIHRVGRTARAGRSGKSISLVSQYDLELILRIEDVLG 427

Query: 556 KKI 558
           KK+
Sbjct: 428 KKL 430

>Skud_2.369 Chr2 (660665..663211) [2547 bp, 848 aa] {ON} YBR237W
           (REAL)
          Length = 848

 Score =  153 bits (387), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 82/245 (33%), Positives = 150/245 (61%), Gaps = 14/245 (5%)

Query: 142 FPSFGLSKIVLNNIKRK-GFRQPTPIQRKTIPLILQSRDIVGMARTGSGKTAAFILPMVE 200
           +   GLS  ++  I  K  F   TPIQ + +P I+  RD++G+++TGSGKT +++LP++ 
Sbjct: 255 WSQLGLSTDIMTLITGKLHFDSLTPIQSQALPAIMSGRDVIGISKTGSGKTISYLLPLLR 314

Query: 201 KLKSHSG----KIGARAVILSPSRELAMQTFNVFKDFARGTE--LRSVLLTGGDSLEEQF 254
           ++K+       + G   +IL+P+RELA+Q       F  GT+  +RSV  TGG  +++Q 
Sbjct: 315 QVKAQRSLSKHETGPLGLILAPTRELALQIHEEVTKFT-GTDASIRSVCCTGGSEMKKQI 373

Query: 255 SMMMSNPDVIIATPGRFLHLKVEMN----LDLKSVEYVVFDEADRLFEMGFQEQLNELLA 310
           + +    ++++ATPGRF+ + + +N    L  K + +V+ DEADRLF++GF+ Q+ +++ 
Sbjct: 374 TDLKRGAEIVVATPGRFIDI-LTLNDGKLLSTKRITFVIMDEADRLFDLGFEPQITQIMK 432

Query: 311 SLPTTRQTLLFSATLPNSLVDFVKAGLVNPVLVRLDAETKVSENLEMLF-LSSKNADREA 369
           ++   +Q +LFSAT PN L  F    L +P+ + ++++  V+EN++  F +   + ++  
Sbjct: 433 TVRPDKQCVLFSATFPNKLRSFAVRVLRSPISITINSKGLVNENVKQKFKICHSDDEKFE 492

Query: 370 NLLYI 374
           NL+ I
Sbjct: 493 NLIQI 497

 Score = 57.4 bits (137), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 31/101 (30%), Positives = 53/101 (52%)

Query: 439 ILFVPTRHHVEYISQLLRDCGYLISYIYGTLDQHARKNQLYNFRAGLTSILVVTDVAARG 498
           I+FV ++   + IS+ L + G +   I+       R   L  F+    SIL+ T+V +RG
Sbjct: 527 IIFVSSQQICDLISKKLTNAGIVAYAIHAGKPYQERLMNLEKFKREKNSILLCTEVLSRG 586

Query: 499 VDIPMLANVINYTLPGSSKIFVHRVGRTARAGNKGWAYSIV 539
           +++P ++ VI Y    +   +VH  GRTAR    G A +++
Sbjct: 587 LNVPEVSLVIIYNAVKTFAQYVHTTGRTARGSRSGTAITLL 627

>Ecym_3217 Chr3 complement(411925..413385) [1461 bp, 486 aa] {ON}
           similar to Ashbya gossypii AAL041C
          Length = 486

 Score =  149 bits (376), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 91/261 (34%), Positives = 138/261 (52%), Gaps = 11/261 (4%)

Query: 121 DDVNEYFSTNNLEKQKHKKGSFPSFGLSKIVLNNIKRKGFRQPTPIQRKTIPLILQSRDI 180
           D+V +  +T N E       SF    +   ++   +   F +PTPIQ K IP  LQ  DI
Sbjct: 54  DEVLDNETTENFE-------SFRDLDIVPELIEACENLKFTKPTPIQSKAIPPALQGNDI 106

Query: 181 VGMARTGSGKTAAFILPMVEKLKSHSGKIGARAVILSPSRELAMQTFNVFKDFARGTELR 240
           +G+A+TGSGKTAAF +P++ +L          A IL+P+RELA Q    F        +R
Sbjct: 107 IGLAQTGSGKTAAFAIPILNQLWHDQQPY--YACILAPTRELAQQIKETFDSLGSLMGVR 164

Query: 241 SVLLTGGDSLEEQFSMMMSNPDVIIATPGRFL-HLKVEMNLDLKSVEYVVFDEADRLFEM 299
           S  + GG ++ +Q   +M  P +IIATPGR + HL+      L+ + ++V DEADRL +M
Sbjct: 165 STCIMGGMNMMDQARDLMRKPHIIIATPGRLMDHLENTKGFSLRKLRFLVIDEADRLLDM 224

Query: 300 GFQEQLNELLASLPTT-RQTLLFSATLPNSLVDFVKAGLVNPVLVRLDAETKVSENLEML 358
            F   L+ +L ++PT  R T LFSAT+ + +    +A L NPV   +  + +  + L   
Sbjct: 225 EFGAVLDRILKNIPTKGRTTYLFSATMTSKIDKLQRASLTNPVKCSVSNKYQTVDTLIQT 284

Query: 359 FLSSKNADREANLLYILQEVI 379
            +      +   L+Y+L E I
Sbjct: 285 LMVVPGGLKNTYLIYLLNEFI 305

 Score = 99.8 bits (247), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 54/123 (43%), Positives = 74/123 (60%)

Query: 436 KATILFVPTRHHVEYISQLLRDCGYLISYIYGTLDQHARKNQLYNFRAGLTSILVVTDVA 495
           K+TI+F  T+ + E IS L     +  + ++G L+Q+ R   L  F+AG  SILV TDVA
Sbjct: 307 KSTIVFTRTKANAERISGLCNLLEFSATALHGDLNQNQRTGALDLFKAGRRSILVATDVA 366

Query: 496 ARGVDIPMLANVINYTLPGSSKIFVHRVGRTARAGNKGWAYSIVAXXXXXXXXXXXXXXG 555
           ARG+DIP +  VINY +P  SK ++HRVGRTARAG  G + S+V+              G
Sbjct: 367 ARGLDIPSVDIVINYDIPVDSKSYIHRVGRTARAGRSGKSISLVSQYDLELILRIEDVLG 426

Query: 556 KKI 558
           KK+
Sbjct: 427 KKL 429

>TDEL0E02890 Chr5 (550708..552213) [1506 bp, 501 aa] {ON} Anc_5.337
           YHR065C
          Length = 501

 Score =  149 bits (376), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 87/241 (36%), Positives = 130/241 (53%), Gaps = 4/241 (1%)

Query: 141 SFPSFGLSKIVLNNIKRKGFRQPTPIQRKTIPLILQSRDIVGMARTGSGKTAAFILPMVE 200
           SF    +   +L   K   F +PTPIQ K IP  L+ +DI+G+A+TGSGKTAAF LP++ 
Sbjct: 82  SFSGLNIVPELLQACKNLNFTKPTPIQAKAIPPALEGKDIIGLAQTGSGKTAAFALPILN 141

Query: 201 KLKSHSGKIGARAVILSPSRELAMQTFNVFKDFARGTELRSVLLTGGDSLEEQFSMMMSN 260
           +L          A ILSP+RELA Q    F         R+  + GG ++ +Q   +M  
Sbjct: 142 RLWHDQSPY--YACILSPTRELAQQIKETFDSLGTIMGARTTCIVGGMNMMDQARDLMRK 199

Query: 261 PDVIIATPGRFL-HLKVEMNLDLKSVEYVVFDEADRLFEMGFQEQLNELLASLPTT-RQT 318
           P +IIATPGR + HL+      L+ ++++V DEADRL +M F   L+ +L  +PT  R T
Sbjct: 200 PHIIIATPGRLMDHLENTKGFSLRKLKFLVMDEADRLLDMEFGPVLDRILKIIPTQGRTT 259

Query: 319 LLFSATLPNSLVDFVKAGLVNPVLVRLDAETKVSENLEMLFLSSKNADREANLLYILQEV 378
            LFSAT+ + +    +A L +PV   +  + +  + L    +      +   L+Y+L E 
Sbjct: 260 YLFSATMTSKIDKLQRASLTDPVKCAVSNKYQTVDTLVQTLMVVPGGLKNTFLIYLLNEF 319

Query: 379 I 379
           I
Sbjct: 320 I 320

 Score = 99.0 bits (245), Expect = 9e-21,   Method: Compositional matrix adjust.
 Identities = 54/123 (43%), Positives = 73/123 (59%)

Query: 436 KATILFVPTRHHVEYISQLLRDCGYLISYIYGTLDQHARKNQLYNFRAGLTSILVVTDVA 495
           K TI+F  T+ + E IS L     +  + ++G L+Q+ R   L  F+AG  SILV TDVA
Sbjct: 322 KTTIIFTRTKANAERISGLCNLLEFNATALHGDLNQNQRTGALDLFKAGRRSILVATDVA 381

Query: 496 ARGVDIPMLANVINYTLPGSSKIFVHRVGRTARAGNKGWAYSIVAXXXXXXXXXXXXXXG 555
           ARG+DIP +  VINY +P  SK ++HRVGRTARAG  G + S+V+              G
Sbjct: 382 ARGLDIPSVDIVINYDIPVDSKSYIHRVGRTARAGRSGKSISLVSQYDLELILRIEEVLG 441

Query: 556 KKI 558
           KK+
Sbjct: 442 KKL 444

>SAKL0H13574g Chr8 (1161196..1163202) [2007 bp, 668 aa] {ON} similar
           to uniprot|P15424 Saccharomyces cerevisiae YDR194C
           MSS116 DEAD-box protein required for efficient splicing
           of mitochondrial Group I and II introns presumed RNA
           helicase due to DEAD-box motif
          Length = 668

 Score =  152 bits (383), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 116/413 (28%), Positives = 194/413 (46%), Gaps = 76/413 (18%)

Query: 147 LSKIVLNNIKRKGFRQPTPIQRKTI-PLILQSRDIVGMARTGSGKTAAFILPMVEKLKSH 205
           +  ++  +I R GF   TP+Q+KTI P++  + D++  A+TG+GKT AF++PM E L ++
Sbjct: 127 IDNMLYKSIDRMGFPALTPVQQKTIKPILATTNDVIARAKTGTGKTLAFLIPMFEHLLAN 186

Query: 206 --SGKIGARAVILSPSRELAMQTFNVFKDFARGT----ELRSVLLTGGDSLEEQF-SMMM 258
               +   + V+++P+R+LA+Q  +  +   +      + +SV L GG + +     M  
Sbjct: 187 RTDSQYMVKCVVVAPTRDLALQIDSEIQKIHKNNYGLQKFKSVCLIGGTNFDSSIKKMFK 246

Query: 259 SNPDVIIATPGRFLHLKVEMNLD-LKSVEYVVFDEADRLFEMGFQE-------QLNELLA 310
             P++I+ATPGR   +  + +    K V++ + DEADRL E+GF++       QLN +  
Sbjct: 247 ERPNIIVATPGRLQDVMSKFSGKFFKFVDFKILDEADRLLEIGFKQDLENISSQLNSINE 306

Query: 311 SLPTTRQTLLFSATLPNSLVDFVKAGLVNPVLVRLDA----ETKVSENLEMLFLSSKNAD 366
             P   +TLLFSATL + + +     +     + LD     E +  E ++   + S   +
Sbjct: 307 KGPEHIRTLLFSATLDDRVQELANDIMNREECLFLDTVDKNEPEAHEKIDQHLVIS---E 363

Query: 367 REANLLYILQEVIRIPLATSEQLLKLQKSTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXM 426
           + A+ LY   E I+  LA +E L                                     
Sbjct: 364 KFAHNLYAPIEEIKSQLAENENL------------------------------------- 386

Query: 427 PAANELPSEKATILFVPTRHHVEY----ISQLLRDCGYLISYIYGTLDQHARKNQLYNFR 482
                       ILFVPT    ++    + Q+L D  + I   +G ++Q  R   +  F+
Sbjct: 387 ----------KAILFVPTVKFAKFFCRSLEQILPD--FPILEFHGKIEQRRRTRIVQEFK 434

Query: 483 AGLTSILVVTDVAARGVDIPMLANVINYTLPGSSKIFVHRVGRTARAGNKGWA 535
                +LV TDV ARG+D P +  V    +P     ++HR+GRTAR G +G A
Sbjct: 435 RAKRGLLVSTDVGARGMDFPNIDEVFQIGVPSELANYIHRIGRTARGGKEGRA 487

>NCAS0H01280 Chr8 complement(243749..246412) [2664 bp, 887 aa] {ON}
           Anc_6.148
          Length = 887

 Score =  153 bits (387), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 84/245 (34%), Positives = 146/245 (59%), Gaps = 10/245 (4%)

Query: 142 FPSFGLSKIVLNNI-KRKGFRQPTPIQRKTIPLILQSRDIVGMARTGSGKTAAFILPMVE 200
           +   GL+   +N I K   +   TPIQ + IP I+  RD++G+++TGSGKT +++LP++ 
Sbjct: 292 WSQLGLNTDTMNLITKNLRYETLTPIQSQAIPAIMSGRDVIGISKTGSGKTISYLLPLLR 351

Query: 201 KLKSH----SGKIGARAVILSPSRELAMQTFNVFKDFARGTE-LRSVLLTGGDSLEEQFS 255
            +K+       + G   +IL+P+RELA+Q  +  + F    E +RS+  TGG  L++Q +
Sbjct: 352 HIKAQRPLSKNETGPLGLILAPTRELALQIHDEIERFIVHDENIRSICCTGGSELKKQIN 411

Query: 256 MMMSNPDVIIATPGRFLHLKVEMNLDLKSVE---YVVFDEADRLFEMGFQEQLNELLASL 312
            +     +++ATPGRF+ L       L S E   +V+ DEADRLF++GF+ Q+ +++ ++
Sbjct: 412 DLKRGVQIVVATPGRFIDLLTLNTGKLVSTERITFVIMDEADRLFDLGFEPQITQIMKTI 471

Query: 313 PTTRQTLLFSATLPNSLVDFVKAGLVNPVLVRLDAETKVSENLEM-LFLSSKNADREANL 371
              +Q +LFSAT PN L +F    L +P+ + +++   V+EN+E  + +   ++ +   L
Sbjct: 472 RPDKQCVLFSATFPNKLRNFAMRILNSPLSITINSNNLVNENVEQKVAICETDSAKFQEL 531

Query: 372 LYILQ 376
           L ILQ
Sbjct: 532 LTILQ 536

 Score = 59.3 bits (142), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 32/105 (30%), Positives = 55/105 (52%)

Query: 435 EKATILFVPTRHHVEYISQLLRDCGYLISYIYGTLDQHARKNQLYNFRAGLTSILVVTDV 494
           +K TI+FV ++   + +   L + GY +  I+       R   L  F+    SIL+ T+V
Sbjct: 560 DKKTIIFVASQQICDLLYSQLVNFGYSLFAIHAGKPYQERITNLEGFKNTKNSILICTEV 619

Query: 495 AARGVDIPMLANVINYTLPGSSKIFVHRVGRTARAGNKGWAYSIV 539
            +RG+++P ++ VI Y    +   +VH  GRTAR    G A +++
Sbjct: 620 LSRGLNVPEVSLVIIYNAVKTFAQYVHTTGRTARGNLHGIAITLL 664

>Smik_8.136 Chr8 complement(202825..204330) [1506 bp, 501 aa] {ON}
           YHR065C (REAL)
          Length = 501

 Score =  149 bits (376), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 96/288 (33%), Positives = 147/288 (51%), Gaps = 24/288 (8%)

Query: 104 SDDENNIS----------GQTQAGEEEDDVNEYFSTNNLEKQKHKKGSFPSFGLSKIVLN 153
           SD E N+S           +T +  E ++VNE  S            +F    L   ++ 
Sbjct: 45  SDSEENVSVKEKKTLKPKMKTISSTENENVNEDESFE----------TFSELNLVPELIQ 94

Query: 154 NIKRKGFRQPTPIQRKTIPLILQSRDIVGMARTGSGKTAAFILPMVEKLKSHSGKIGARA 213
             K   + +PTPIQ K+IP  L+  DI+G+A+TGSGKTAAF +P++ +L          A
Sbjct: 95  ACKNLNYSKPTPIQSKSIPPALEGHDIIGLAQTGSGKTAAFAIPILNRLWHDQEPY--YA 152

Query: 214 VILSPSRELAMQTFNVFKDFARGTELRSVLLTGGDSLEEQFSMMMSNPDVIIATPGRFL- 272
            IL+P+RELA Q    F        +RS  + GG ++ +Q   +M  P +IIATPGR + 
Sbjct: 153 CILAPTRELAQQIKETFDSLGSLMGVRSTCIVGGMNMMDQARDLMRKPHIIIATPGRLMD 212

Query: 273 HLKVEMNLDLKSVEYVVFDEADRLFEMGFQEQLNELLASLPTT-RQTLLFSATLPNSLVD 331
           HL+      L+ ++++V DEADRL +M F   L+ +L  +PT  R T LFSAT+ + +  
Sbjct: 213 HLENTKGFSLRKLKFLVMDEADRLLDMEFGPVLDRILKIIPTQERTTYLFSATMTSKIDK 272

Query: 332 FVKAGLVNPVLVRLDAETKVSENLEMLFLSSKNADREANLLYILQEVI 379
             +A L NPV   +  + +  + L    +      +   L+Y+L E I
Sbjct: 273 LQRASLTNPVKCAVSNKYQTVDTLVQTLMVVPGGLKNTYLIYLLNEFI 320

 Score = 95.1 bits (235), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 51/123 (41%), Positives = 72/123 (58%)

Query: 436 KATILFVPTRHHVEYISQLLRDCGYLISYIYGTLDQHARKNQLYNFRAGLTSILVVTDVA 495
           K  I+F  T+ + E +S L     +  + ++G L+Q+ R   L  F+AG  SILV TDVA
Sbjct: 322 KTMIIFTRTKANAERLSGLCNLLEFSATALHGDLNQNQRMGALDLFKAGKRSILVATDVA 381

Query: 496 ARGVDIPMLANVINYTLPGSSKIFVHRVGRTARAGNKGWAYSIVAXXXXXXXXXXXXXXG 555
           ARG+DIP +  V+NY +P  SK ++HRVGRTARAG  G + S+V+              G
Sbjct: 382 ARGLDIPSVDIVVNYDIPVDSKSYIHRVGRTARAGRSGKSISLVSQYDLELILRIEEVLG 441

Query: 556 KKI 558
           KK+
Sbjct: 442 KKL 444

>NCAS0J00580 Chr10 (87108..88943) [1836 bp, 611 aa] {ON} Anc_8.87
          Length = 611

 Score =  150 bits (380), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 124/408 (30%), Positives = 189/408 (46%), Gaps = 78/408 (19%)

Query: 155 IKRKGFRQPTPIQRKTIPLILQSRDIVGMARTGSGKTAAFILPMVEKLKSHSG------K 208
           I+  GF Q TP+Q  TIPL  +++D+V  + TGSGKT +F++P++EK+ + +       K
Sbjct: 22  IEVMGFDQMTPVQASTIPLFAKNKDVVVESVTGSGKTVSFVIPILEKVIAENANTKNFKK 81

Query: 209 IGARAVILSPSRELAMQTFNVFKDFARGTE-----LRSVLLTGGD--SLEEQFSMMMSN- 260
                +I+SP+REL+ Q  +V   F          +R+ LL G +  ++ +  + ++ N 
Sbjct: 82  AHFHTLIVSPTRELSKQIKSVIDQFLEHYPEDQYPIRAQLLVGTNESTVRDDVNDLIENR 141

Query: 261 PDVIIATPGRFLHLKVEMNLDLKSVEYVVFDEADRLFEMGFQEQLNELLASLPTTRQTLL 320
           P +++ TPGR L       +   S   V+ DEADRL ++ F + +  +L+ LP  R+T L
Sbjct: 142 PQILVGTPGRILDFLQMPVVKTTSCSMVILDEADRLLDVSFVKDVERILSVLPKQRRTGL 201

Query: 321 FSATLPNSLVDFVKAGLVNPVLVRLDAETKVSENLEMLFLSSKNADREANLLYILQEVIR 380
           FSAT+ ++     K GL NPV        K++ N      S  +A     L YI+ +   
Sbjct: 202 FSATISSAGNTIFKTGLRNPV--------KITVN------SKNHAPSSLKLNYIVVD--- 244

Query: 381 IPLATSEQLLKLQKSTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMPAANELPSEKATIL 440
            P    +QLL +                                     N    +K  + 
Sbjct: 245 -PELKFQQLLSI------------------------------------VNNYRYKKCIVY 267

Query: 441 FVPTRHHVEYIS---QLLRDCGYL-----ISYIYGTLDQHARKNQLYNFRAGL-TSILVV 491
           F PT   V Y     Q L+  G +     I  ++G L   +R   L  F   L  S+L+ 
Sbjct: 268 F-PTCISVTYFYSFIQFLQSKGIINENLSIFSLHGKLQTVSRMKTLEKFTETLDNSVLLT 326

Query: 492 TDVAARGVDIPMLANVINYTLPGSSKIFVHRVGRTARAGNKGWAYSIV 539
           TDVAARG+DIP +  VI    P  S IF+HR GRT RA   G A + +
Sbjct: 327 TDVAARGIDIPDVDLVIQLDPPTDSDIFLHRCGRTGRANRIGKAITFL 374

>YHR065C Chr8 complement(227532..229037) [1506 bp, 501 aa] {ON}
           RRP3Protein involved in rRNA processing; required for
           maturation of the 35S primary transcript of pre-rRNA and
           for cleavage leading to mature 18S rRNA; homologous to
           eIF-4a, which is a DEAD box RNA-dependent ATPase with
           helicase activity
          Length = 501

 Score =  149 bits (375), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 86/241 (35%), Positives = 130/241 (53%), Gaps = 4/241 (1%)

Query: 141 SFPSFGLSKIVLNNIKRKGFRQPTPIQRKTIPLILQSRDIVGMARTGSGKTAAFILPMVE 200
           SF    L   ++   K   + +PTPIQ K IP  L+  DI+G+A+TGSGKTAAF +P++ 
Sbjct: 82  SFSELNLVPELIQACKNLNYSKPTPIQSKAIPPALEGHDIIGLAQTGSGKTAAFAIPILN 141

Query: 201 KLKSHSGKIGARAVILSPSRELAMQTFNVFKDFARGTELRSVLLTGGDSLEEQFSMMMSN 260
           +L          A IL+P+RELA Q    F        +RS  + GG ++ +Q   +M  
Sbjct: 142 RLWHDQEPY--YACILAPTRELAQQIKETFDSLGSLMGVRSTCIVGGMNMMDQARDLMRK 199

Query: 261 PDVIIATPGRFL-HLKVEMNLDLKSVEYVVFDEADRLFEMGFQEQLNELLASLPTT-RQT 318
           P +IIATPGR + HL+      L+ ++++V DEADRL +M F   L+ +L  +PT  R T
Sbjct: 200 PHIIIATPGRLMDHLENTKGFSLRKLKFLVMDEADRLLDMEFGPVLDRILKIIPTQERTT 259

Query: 319 LLFSATLPNSLVDFVKAGLVNPVLVRLDAETKVSENLEMLFLSSKNADREANLLYILQEV 378
            LFSAT+ + +    +A L NPV   +  + +  + L    +      +   L+Y+L E 
Sbjct: 260 YLFSATMTSKIDKLQRASLTNPVKCAVSNKYQTVDTLVQTLMVVPGGLKNTYLIYLLNEF 319

Query: 379 I 379
           I
Sbjct: 320 I 320

 Score = 95.5 bits (236), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 51/123 (41%), Positives = 72/123 (58%)

Query: 436 KATILFVPTRHHVEYISQLLRDCGYLISYIYGTLDQHARKNQLYNFRAGLTSILVVTDVA 495
           K  I+F  T+ + E +S L     +  + ++G L+Q+ R   L  F+AG  SILV TDVA
Sbjct: 322 KTMIIFTRTKANAERLSGLCNLLEFSATALHGDLNQNQRMGSLDLFKAGKRSILVATDVA 381

Query: 496 ARGVDIPMLANVINYTLPGSSKIFVHRVGRTARAGNKGWAYSIVAXXXXXXXXXXXXXXG 555
           ARG+DIP +  V+NY +P  SK ++HRVGRTARAG  G + S+V+              G
Sbjct: 382 ARGLDIPSVDIVVNYDIPVDSKSYIHRVGRTARAGRSGKSISLVSQYDLELILRIEEVLG 441

Query: 556 KKI 558
           KK+
Sbjct: 442 KKL 444

>Suva_8.98 Chr8 complement(177272..178720) [1449 bp, 482 aa] {ON}
           YOR046C (REAL)
          Length = 482

 Score =  148 bits (374), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 113/408 (27%), Positives = 188/408 (46%), Gaps = 69/408 (16%)

Query: 141 SFPSFGLSKIVLNNIKRKGFRQPTPIQRKTIPLILQ--SRDIVGMARTGSGKTAAFILPM 198
           SF   GL+  +L  I    F++P+ IQ + +PL+L   +R+++  +++G+GKTAAF L M
Sbjct: 93  SFDELGLAPELLKGIYAMKFQKPSKIQERALPLLLHNPARNMIAQSQSGTGKTAAFSLTM 152

Query: 199 VEKLKSHSGKIGARAVILSPSRELAMQTFNVFKDFARGTELRSVLLTGGDSLEEQFSMMM 258
           + ++         +A+ L+PSRELA QT  V ++  + T++ S L+   DS E+   +  
Sbjct: 153 LTRVNPEDA--SPQAICLAPSRELARQTLEVVQEMGKFTKITSQLIV-PDSFEKNKQI-- 207

Query: 259 SNPDVIIATPGRFLHLKVEMNLDLKSVEYVVFDEADRLF-EMGFQEQLNELLASLPTTRQ 317
            N  VI+ TPG  L L     + L+ ++  V DEAD +  + G  +Q   +   LP   Q
Sbjct: 208 -NAQVIVGTPGTVLDLMRRKLMQLQKIKIFVLDEADNMLDQQGLGDQCIRVKRFLPKDTQ 266

Query: 318 TLLFSATLPNSLVDFVKAGLVNPVLVRLDAETKVSENLEMLFLSSKNADREANLLYILQE 377
            +LFSAT  +++  + K  + N   + L       + ++ L++  KN   EA+   +L E
Sbjct: 267 LVLFSATFADAVRQYAKKIVPNANTLELQTNEVNVDAIKQLYMDCKN---EADKFEVLTE 323

Query: 378 VIRIPLATSEQLLKLQKSTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMPAANELPSEKA 437
           +  +    S  +    K T                                        A
Sbjct: 324 LYGLMTIGSSIIFVATKKT----------------------------------------A 343

Query: 438 TILFVPTRHHVEYISQLLRDCGYLISYIYGTLDQHARKNQLYNFRAGLTSILVVTDVAAR 497
            +L+   ++    +S L           +G L    R   + +FR G + +L+ T+V AR
Sbjct: 344 NVLYGKLKNEGHEVSIL-----------HGDLQTQERDRLIDDFREGRSKVLITTNVLAR 392

Query: 498 GVDIPMLANVINYTLP------GSSKIFVHRVGRTARAGNKGWAYSIV 539
           G+DIP ++ V+NY LP           ++HR+GRT R G KG A S V
Sbjct: 393 GIDIPTVSMVVNYDLPTLANGQADPATYIHRIGRTGRFGRKGVAISFV 440

>Smik_15.224 Chr15 complement(380539..381972) [1434 bp, 477 aa] {ON}
           YOR046C (REAL)
          Length = 477

 Score =  148 bits (373), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 112/408 (27%), Positives = 188/408 (46%), Gaps = 69/408 (16%)

Query: 141 SFPSFGLSKIVLNNIKRKGFRQPTPIQRKTIPLILQS--RDIVGMARTGSGKTAAFILPM 198
           SF   GL+  +L  I    F++P+ IQ + +PL+L +  R+++  +++G+GKTAAF L M
Sbjct: 88  SFDELGLAPELLKGIYAMKFQKPSKIQERALPLLLHNPPRNMIAQSQSGTGKTAAFSLTM 147

Query: 199 VEKLKSHSGKIGARAVILSPSRELAMQTFNVFKDFARGTELRSVLLTGGDSLEEQFSMMM 258
           + ++         +A+ L+PSRELA QT  V ++  + T++ S L+   DS E+   +  
Sbjct: 148 LTRVNPEDA--SPQAICLAPSRELARQTLEVVQEMGKFTKITSQLIV-PDSFEKNKQI-- 202

Query: 259 SNPDVIIATPGRFLHLKVEMNLDLKSVEYVVFDEADRLF-EMGFQEQLNELLASLPTTRQ 317
            N  +I+ TPG  L L     + L+ ++  V DEAD +  + G  +Q   +   LP   Q
Sbjct: 203 -NSQIIVGTPGTVLDLMRRKLMQLQKIKIFVLDEADNMLDQQGLGDQCIRVKRFLPKDTQ 261

Query: 318 TLLFSATLPNSLVDFVKAGLVNPVLVRLDAETKVSENLEMLFLSSKNADREANLLYILQE 377
            +LFSAT  +++  + K  + N   + L       + ++ L++  KN   EA+   +L E
Sbjct: 262 LVLFSATFADAVRQYAKKIVPNANTLELQTNEVNVDAIKQLYMDCKN---EADKFDVLTE 318

Query: 378 VIRIPLATSEQLLKLQKSTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMPAANELPSEKA 437
           +  +    S  +    K T                                        A
Sbjct: 319 LYGLMTIGSSIIFVATKKT----------------------------------------A 338

Query: 438 TILFVPTRHHVEYISQLLRDCGYLISYIYGTLDQHARKNQLYNFRAGLTSILVVTDVAAR 497
            +L+   ++    +S L           +G L    R   + +FR G + +L+ T+V AR
Sbjct: 339 NVLYGKLKNEGHEVSIL-----------HGDLQTQERDRLIDDFREGRSKVLITTNVLAR 387

Query: 498 GVDIPMLANVINYTLP------GSSKIFVHRVGRTARAGNKGWAYSIV 539
           G+DIP ++ V+NY LP           ++HR+GRT R G KG A S V
Sbjct: 388 GIDIPTVSMVVNYDLPTLANGKADPATYIHRIGRTGRFGRKGVAISFV 435

>KAFR0E01640 Chr5 complement(335123..337405) [2283 bp, 760 aa] {ON}
           Anc_5.241 YJL033W
          Length = 760

 Score =  152 bits (383), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 82/201 (40%), Positives = 124/201 (61%), Gaps = 4/201 (1%)

Query: 142 FPSFGLSKIVLNNIKRKGFRQPTPIQRKTIPLILQSRDIVGMARTGSGKTAAFILPMVEK 201
           F    +S   L  +    F Q T IQR +IP+ L+  D++G ARTGSGKT AF++P++EK
Sbjct: 43  FKDLPISAQTLKGLNESAFIQLTGIQRDSIPVSLKGHDVLGAARTGSGKTLAFLIPVLEK 102

Query: 202 L--KSHSGKIGARAVILSPSRELAMQTFNVFKDFARGTELRSVLLTGGDSLEEQFSMMMS 259
           L  +  +   G  A+I+SP+RELAMQ + V     R T   + L+ GG  ++ + S  +S
Sbjct: 103 LYREKWTAFDGLGALIISPTRELAMQIYEVLIKIGRHTSFSAGLVIGGKDVKFE-SERIS 161

Query: 260 NPDVIIATPGRFL-HLKVEMNLDLKSVEYVVFDEADRLFEMGFQEQLNELLASLPTTRQT 318
             +++I TPGR L HL   + L   +++ +V DEADR  +MGF++ L+ ++++LP +RQT
Sbjct: 162 KINILIGTPGRVLQHLDQAVGLSTSNLQMLVLDEADRCLDMGFKKTLDAIVSNLPASRQT 221

Query: 319 LLFSATLPNSLVDFVKAGLVN 339
           LLFSAT  NSL D  +  L +
Sbjct: 222 LLFSATQSNSLADLARLSLTD 242

 Score = 65.1 bits (157), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 33/97 (34%), Positives = 47/97 (48%), Gaps = 2/97 (2%)

Query: 439 ILFVPTRHHVEYISQLLRDC--GYLISYIYGTLDQHARKNQLYNFRAGLTSILVVTDVAA 496
           I+F+ +   V ++ +  R    G  + +++G   Q AR   L  F       L  TDV A
Sbjct: 295 IVFLSSSKQVHFVYETFRKMQPGISLMHLHGRQKQKARTETLDKFNRAQHVCLFATDVVA 354

Query: 497 RGVDIPMLANVINYTLPGSSKIFVHRVGRTARAGNKG 533
           RG+D P +  VI    P     ++HRVGRT R G KG
Sbjct: 355 RGIDFPAVNWVIQVDCPEDVDTYIHRVGRTGRYGKKG 391

>KLTH0F08382g Chr6 (724794..726767) [1974 bp, 657 aa] {ON} similar
           to uniprot|P15424 Saccharomyces cerevisiae YDR194C
           MSS116 DEAD-box protein required for efficient splicing
           of mitochondrial Group I and II introns presumed RNA
           helicase due to DEAD-box motif
          Length = 657

 Score =  150 bits (380), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 121/405 (29%), Positives = 195/405 (48%), Gaps = 75/405 (18%)

Query: 155 IKRKGFRQPTPIQRKTIPLILQS-RDIVGMARTGSGKTAAFILPMVEKL---KSHSGKIG 210
           + R  F   TP+Q+KTI  IL++  D++  A+TG+GKT AF++P+ E L   ++ S  + 
Sbjct: 118 VSRMNFESLTPVQQKTIKPILETEHDVIARAKTGTGKTLAFLVPIFEHLIKTRTESPSM- 176

Query: 211 ARAVILSPSRELAMQTFNVFKDFARGT----ELRSVLLTGGDSLEEQFSMMMSN-PDVII 265
            + VI++P+R+LA+Q  +  +   +      + +S+ L GG + +     M  + P++++
Sbjct: 177 VKCVIVAPTRDLALQIDSEIEKLHKNNHALRKFKSIALIGGSNFQVAIKRMFKDTPNIVV 236

Query: 266 ATPGRFLHLKVEMNLD-LKSVEYVVFDEADRLFEMGFQEQ-------LNELLASLPTTRQ 317
           ATPGR + +  + +    K V++ V DEADRL E+GF E        LN + A+ P   +
Sbjct: 237 ATPGRLMDVMSKFSDKFFKHVDFKVLDEADRLLEIGFDEDLRDISKTLNSINATGPEHIR 296

Query: 318 TLLFSATLPNSLVDFVKAGLVNP----VLVRLDA-ETKVSENLEMLFLSSKNADREANLL 372
           TLLFSATL ++ V  + AG++N      L  +D  E +  E ++   + S+N    A+ L
Sbjct: 297 TLLFSATLGDN-VQKLAAGIMNRKESLFLDTVDVNEPEAHEKIDQRLVISENF---ASNL 352

Query: 373 YILQEVIRIPLATSEQLLKLQKSTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMPAANEL 432
           Y     I+  LAT+ +  K                                         
Sbjct: 353 YAPISAIKNRLATNNEPFK----------------------------------------- 371

Query: 433 PSEKATILFVPTRHHVEYISQLL-RDCGYLISY-IYGTLDQHARKNQLYNFRAGLTSILV 490
                 ILFVPT    ++   +L R    L  Y  +G +DQ  R   +  F+     I V
Sbjct: 372 -----AILFVPTVKFTKFYCTILERLFPSLPVYEFHGKIDQRKRTKMVGLFKRAHEGIFV 426

Query: 491 VTDVAARGVDIPMLANVINYTLPGSSKIFVHRVGRTARAGNKGWA 535
            TDV ARG+D P +  V+   +P     ++HR+GRTAR G +G A
Sbjct: 427 CTDVGARGMDFPGVEEVLQLGVPSELSNYIHRIGRTARGGKEGKA 471

>TPHA0N00940 Chr14 (202770..205085) [2316 bp, 771 aa] {ON} Anc_5.241
           YJL033W
          Length = 771

 Score =  152 bits (383), Expect = 5e-37,   Method: Compositional matrix adjust.
 Identities = 82/201 (40%), Positives = 123/201 (61%), Gaps = 4/201 (1%)

Query: 142 FPSFGLSKIVLNNIKRKGFRQPTPIQRKTIPLILQSRDIVGMARTGSGKTAAFILPMVEK 201
           F    LS   +  +    F + T IQR +IP+ L+  DI+G A+TGSGKT AF++P++EK
Sbjct: 43  FKDLPLSSATVKGLNEASFVKVTEIQRDSIPISLKGHDILGAAKTGSGKTLAFLIPVLEK 102

Query: 202 L--KSHSGKIGARAVILSPSRELAMQTFNVFKDFARGTELRSVLLTGGDSLEEQFSMMMS 259
           L  +  S   G  A+I+SP+RELAMQT+ V       T   + L+ GG  ++ + S  +S
Sbjct: 103 LYREKWSEFDGLGALIISPTRELAMQTYEVLTKIGTHTSFSAGLVIGGKDVKFE-SARIS 161

Query: 260 NPDVIIATPGRFL-HLKVEMNLDLKSVEYVVFDEADRLFEMGFQEQLNELLASLPTTRQT 318
             +++I TPGR L H+   + L   +++ +V DEADR  +MGFQ+ L+ ++++LP TRQT
Sbjct: 162 KINILIGTPGRILQHMDQAVGLSTSNLQMLVLDEADRCLDMGFQKTLDAIVSNLPPTRQT 221

Query: 319 LLFSATLPNSLVDFVKAGLVN 339
           LLFSAT   SL D  +  L +
Sbjct: 222 LLFSATQSQSLTDLARLSLTD 242

 Score = 64.3 bits (155), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 31/97 (31%), Positives = 48/97 (49%), Gaps = 2/97 (2%)

Query: 439 ILFVPTRHHVEYISQLLRDC--GYLISYIYGTLDQHARKNQLYNFRAGLTSILVVTDVAA 496
           I+F+ +   V ++ +  R    G  + +++G   Q AR   L  F       L  TDV A
Sbjct: 295 IVFLSSSKQVHFVYETFRKMQPGISLMHLHGRQKQRARTETLDKFSRAQQVCLFATDVVA 354

Query: 497 RGVDIPMLANVINYTLPGSSKIFVHRVGRTARAGNKG 533
           RG+D P +  V+    P     ++HRVGR+AR G +G
Sbjct: 355 RGIDFPSVDWVVQLDCPEDVDTYIHRVGRSARYGKQG 391

>Skud_8.122 Chr8 complement(200848..202359) [1512 bp, 503 aa] {ON}
           YHR065C (REAL)
          Length = 503

 Score =  147 bits (372), Expect = 7e-37,   Method: Compositional matrix adjust.
 Identities = 86/241 (35%), Positives = 131/241 (54%), Gaps = 4/241 (1%)

Query: 141 SFPSFGLSKIVLNNIKRKGFRQPTPIQRKTIPLILQSRDIVGMARTGSGKTAAFILPMVE 200
           SF    L   ++   K   + +PTPIQ K+IP  L+  DI+G+A+TGSGKTAAF +P++ 
Sbjct: 84  SFNELNLVPELIQACKNLNYSKPTPIQSKSIPPALKGHDIIGLAQTGSGKTAAFAIPILN 143

Query: 201 KLKSHSGKIGARAVILSPSRELAMQTFNVFKDFARGTELRSVLLTGGDSLEEQFSMMMSN 260
           +L          A IL+P+RELA Q    F        +RS  + GG ++ +Q   +M  
Sbjct: 144 RLWHDQEPY--YACILAPTRELAQQIKEAFDSLGSLMGVRSTCIVGGMNMMDQARDLMRK 201

Query: 261 PDVIIATPGRFL-HLKVEMNLDLKSVEYVVFDEADRLFEMGFQEQLNELLASLPTT-RQT 318
           P +IIATPGR + HL+      L+ ++++V DEADRL +M F   L+ +L  +PT  R T
Sbjct: 202 PHIIIATPGRLMDHLENTKGFSLRKLKFLVMDEADRLLDMEFGPVLDRILKIIPTQERTT 261

Query: 319 LLFSATLPNSLVDFVKAGLVNPVLVRLDAETKVSENLEMLFLSSKNADREANLLYILQEV 378
            LFSAT+ + +    +A L NPV   +  + +  + L    +      +   L+Y+L E 
Sbjct: 262 YLFSATMTSKIDKLQRASLTNPVKCAVSNKYQTVDTLVQALMVVPGGLKNTYLIYLLNES 321

Query: 379 I 379
           I
Sbjct: 322 I 322

 Score = 94.0 bits (232), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 48/105 (45%), Positives = 68/105 (64%)

Query: 436 KATILFVPTRHHVEYISQLLRDCGYLISYIYGTLDQHARKNQLYNFRAGLTSILVVTDVA 495
           K  I+F  T+ + E +S L     +  + ++G L+Q+ R   L  F+AG  SILV TDVA
Sbjct: 324 KTMIIFTRTKANAERLSGLCNLLEFSATALHGDLNQNQRMGALDLFKAGKRSILVATDVA 383

Query: 496 ARGVDIPMLANVINYTLPGSSKIFVHRVGRTARAGNKGWAYSIVA 540
           ARG+DIP +  V+NY +P  SK ++HRVGRTARAG  G + S+V+
Sbjct: 384 ARGLDIPSVDIVVNYDIPVDSKSYIHRVGRTARAGRSGKSISLVS 428

>Ecym_4165 Chr4 (350595..352571) [1977 bp, 658 aa] {ON} similar to
           Ashbya gossypii AGL112C
          Length = 658

 Score =  150 bits (378), Expect = 7e-37,   Method: Compositional matrix adjust.
 Identities = 121/409 (29%), Positives = 192/409 (46%), Gaps = 85/409 (20%)

Query: 155 IKRKGFRQPTPIQRKTI-PLILQSRDIVGMARTGSGKTAAFILPMVEKL----KSHSGKI 209
           +K + F   TP+Q++TI P+++ S D+V  A+TG+GKT AF++PM ++L      +S K+
Sbjct: 130 VKMQNFESLTPVQQRTIKPILMTSNDVVARAKTGTGKTMAFLIPMFQRLFMTQNEYSDKV 189

Query: 210 GARAVILSPSRELAMQT-FNVFKDFARGTELR---SVLLTGGDSLEEQFSMMMSN-PDVI 264
             + V+++P+R+LA Q  F V K       LR   S+ L GG SL      M  + P ++
Sbjct: 190 --KCVVVAPTRDLAEQIQFEVLKLQKANKALRKFSSICLIGGTSLVNSMRRMDRHAPSIV 247

Query: 265 IATPGRFLH-LKVEMNLDLKSVEYVVFDEADRLFEMGFQEQLNELLASLPTTRQ------ 317
           IATPGR L  +    +    +V++ V DEAD L ++GF+  L  + ++L +  Q      
Sbjct: 248 IATPGRLLDVMGNSGDKYFNAVDFKVLDEADTLLDIGFKADLQRISSTLNSLNQKGAEHI 307

Query: 318 -TLLFSATLPNSLVDFVKAGLVNPVLVRLD--------AETKVSENLEMLFLSSKNADRE 368
            TLLFSAT+ +++ +     +     + +D        A  K+++N   L +S   A   
Sbjct: 308 RTLLFSATISSNVQELANNIMNGDTCLFIDTVHKDEPEAHEKITQN---LIVSESYAH-- 362

Query: 369 ANLLYILQEVIRIPLATSEQLLKLQKSTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMPA 428
            NL+         P+ T E+ LK +K                                  
Sbjct: 363 -NLV--------APVETIEKHLKKRKF--------------------------------- 380

Query: 429 ANELPSEKATILFVPTRHHVEYISQLLRDC--GYLISYIYGTLDQHARKNQLYNFRAGLT 486
                     ILF+PT   VE+   LL+       IS  +G + Q  R   +  F+A   
Sbjct: 381 --------KAILFLPTVKSVEFYGNLLKKLFRSLPISLFHGKVSQQRRSRLVKEFKASKH 432

Query: 487 SILVVTDVAARGVDIPMLANVINYTLPGSSKIFVHRVGRTARAGNKGWA 535
            + + TDV ARG+D P + +V    +P     +VHR+GRTAR G +G A
Sbjct: 433 GLFICTDVGARGMDFPEVDHVYQLGVPSGLSNYVHRIGRTARGGREGEA 481

>KLLA0E21935g Chr5 (1959770..1961083) [1314 bp, 437 aa] {ON} highly
           similar to uniprot|Q07478 Saccharomyces cerevisiae
           YDL084W SUB2 Suppresses the cold-sensitive snRNP
           biogenesis brr1-1 mutation RNA helicase
          Length = 437

 Score =  146 bits (368), Expect = 9e-37,   Method: Compositional matrix adjust.
 Identities = 117/455 (25%), Positives = 203/455 (44%), Gaps = 75/455 (16%)

Query: 100 ILELSDDENNISGQTQAGEEEDDVNEYFSTNNLEKQKHKKGS--------FPSFGLSKIV 151
           +LE SD+E  +    +A E    VN   +  +  K   KKGS        F  F L   +
Sbjct: 9   LLEYSDNEQEVQVDNKATE----VNAEGNGESQAKDSDKKGSYVGIHSTGFKDFLLKPEL 64

Query: 152 LNNIKRKGFRQPTPIQRKTIPLILQSRDIVGMARTGSGKTAAFILPMVEKLKSHSGKIGA 211
              I   GF  P+ +Q+ TIP  +   D++  A++G GKTA F+L  +++L    G++  
Sbjct: 65  SRAIIDCGFEHPSEVQQHTIPQSIHGTDVLCQAKSGLGKTAVFVLSTLQQLDPVQGEVS- 123

Query: 212 RAVILSPSRELAMQTFNVFKDFARGT-ELRSVLLTGGDSLEEQFSMMM---SNPDVIIAT 267
             V+L  +RELA Q  N +  F++   ++++ +  GG   +    ++    + P +I+AT
Sbjct: 124 -VVVLCNARELAYQIRNEYLRFSKYMPDVKTAVFYGGTEYKNDIDLLSKKETVPHIIVAT 182

Query: 268 PGRFLHLKVEMNLDLKSVEYVVFDEADRLF-EMGFQEQLNELLASLPTTRQTLLFSATLP 326
           PGR   L  + ++DL  V+  V DE D++  E+  +  + ++  + P  +Q ++FSATL 
Sbjct: 183 PGRLKALVRDKHIDLSHVKNFVIDECDKVLEELDMRRDVQDIFRATPRDKQVMMFSATLS 242

Query: 327 NSLVDFVKAGLVNPVLVRLDAETKVS-ENLEMLFLSSKNADREANLLYILQEVIRIPLAT 385
             +    +  L NP+ + +D E K++   L+  ++     ++   L  +L ++       
Sbjct: 243 QEIRPICRRFLQNPLEIFVDDEAKLTLHGLQQYYIKLNEKEKNRKLAQLLDDL------E 296

Query: 386 SEQLLKLQKSTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMPAANELPSEKATILFVPTR 445
             Q++   KST                                ANEL             
Sbjct: 297 FNQVIIFVKSTVR------------------------------ANEL------------- 313

Query: 446 HHVEYISQLLRDCGYLISYIYGTLDQHARKNQLYNFRAGLTSILVVTDVAARGVDIPMLA 505
                 ++LL    +    ++G + Q  R  +   F+     I V TDV  RG+DI  + 
Sbjct: 314 ------TKLLNASNFPAITVHGHMKQEERIARYKAFKEFEKRICVSTDVFGRGIDIERIN 367

Query: 506 NVINYTLPGSSKIFVHRVGRTARAGNKGWAYSIVA 540
             INY +P  +  ++HRVGR  R G KG A S+++
Sbjct: 368 LAINYDMPNEADQYLHRVGRAGRFGTKGLAISMIS 402

>Suva_15.254 Chr15 complement(429201..430712) [1512 bp, 503 aa] {ON}
           YHR065C (REAL)
          Length = 503

 Score =  147 bits (371), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 86/241 (35%), Positives = 130/241 (53%), Gaps = 4/241 (1%)

Query: 141 SFPSFGLSKIVLNNIKRKGFRQPTPIQRKTIPLILQSRDIVGMARTGSGKTAAFILPMVE 200
           +F    L   +L   K   + +PTPIQ K+IP  L   DI+G+A+TGSGKTAAF +P++ 
Sbjct: 84  TFNELNLVPELLQACKNLNYSKPTPIQSKSIPPALAGHDIIGLAQTGSGKTAAFAIPILN 143

Query: 201 KLKSHSGKIGARAVILSPSRELAMQTFNVFKDFARGTELRSVLLTGGDSLEEQFSMMMSN 260
           +L          A IL+P+RELA Q    F        +RS  + GG ++ +Q   +M  
Sbjct: 144 RLWHDQEPY--YACILAPTRELAQQIKEAFDSLGSLMGVRSTCIVGGMNMMDQARDLMRK 201

Query: 261 PDVIIATPGRFL-HLKVEMNLDLKSVEYVVFDEADRLFEMGFQEQLNELLASLPTT-RQT 318
           P +IIATPGR + HL+      L+ ++++V DEADRL +M F   L+ +L  +PT  R T
Sbjct: 202 PHIIIATPGRLMDHLENTKGFSLRKLKFLVMDEADRLLDMEFGPVLDRILKIIPTQERTT 261

Query: 319 LLFSATLPNSLVDFVKAGLVNPVLVRLDAETKVSENLEMLFLSSKNADREANLLYILQEV 378
            LFSAT+ + +    +A L NPV   +  + +  + L    +      +   L+Y+L E 
Sbjct: 262 YLFSATMTSKIDKLQRASLTNPVKCAVSNKYQTVDTLVQTLMVVPGGLKNTYLIYLLNEF 321

Query: 379 I 379
           I
Sbjct: 322 I 322

 Score = 93.2 bits (230), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 50/123 (40%), Positives = 72/123 (58%)

Query: 436 KATILFVPTRHHVEYISQLLRDCGYLISYIYGTLDQHARKNQLYNFRAGLTSILVVTDVA 495
           K  I+F  T+ + E +S L     +  + ++G L+Q+ R   L  F+AG  +ILV TDVA
Sbjct: 324 KTMIIFTRTKANAERLSGLCNLLEFSATALHGDLNQNQRMGALDLFKAGKRAILVATDVA 383

Query: 496 ARGVDIPMLANVINYTLPGSSKIFVHRVGRTARAGNKGWAYSIVAXXXXXXXXXXXXXXG 555
           ARG+DIP +  V+NY +P  SK ++HRVGRTARAG  G + S+V+              G
Sbjct: 384 ARGLDIPSVDIVVNYDIPVDSKSYIHRVGRTARAGRSGKSVSLVSQYDLELILRIEEVLG 443

Query: 556 KKI 558
           KK+
Sbjct: 444 KKL 446

>Ecym_6049 Chr6 (94618..95934) [1317 bp, 438 aa] {ON} similar to
           Ashbya gossypii ADR260C
          Length = 438

 Score =  146 bits (368), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 116/452 (25%), Positives = 205/452 (45%), Gaps = 68/452 (15%)

Query: 100 ILELSDDENNISGQ-TQAGEEEDDVNEYFSTNNLEKQKHKKG----SFPSFGLSKIVLNN 154
           +LE SD+E  I  + T++ E    V E     + +K+    G     F  F L   +   
Sbjct: 9   LLEYSDNEQEIQVENTKSAEAVGGVEESGEGKDTDKKGSYVGIHSTGFKDFLLKPELSRA 68

Query: 155 IKRKGFRQPTPIQRKTIPLILQSRDIVGMARTGSGKTAAFILPMVEKLKSHSGKIGARAV 214
           I   GF  P+ +Q+ TIP  +   D++  A++G GKTA F+L  +++L   +G++    V
Sbjct: 69  IIDCGFEHPSEVQQHTIPQSIHGTDVLCQAKSGLGKTAVFVLSTLQQLDPVAGEVS--VV 126

Query: 215 ILSPSRELAMQTFNVFKDFARGT-ELRSVLLTGGDSLEEQFSMMM---SNPDVIIATPGR 270
           +L  +RELA Q  N +  F++   ++++ +  GG    +   ++    + P +++ATPGR
Sbjct: 127 VLCNARELAYQIRNEYLRFSKYMPDVKTAVFYGGTDTRKDIELLKNKETAPHIVVATPGR 186

Query: 271 FLHLKVEMNLDLKSVEYVVFDEADRLF-EMGFQEQLNELLASLPTTRQTLLFSATLPNSL 329
              L  + N+DL  V+  V DE D++  E+  +  + ++  + P  +Q ++FSATL   +
Sbjct: 187 LKALVRDNNIDLSHVKNFVIDECDKVLEELDMRRDVQDIFRATPRDKQVMMFSATLSQEI 246

Query: 330 VDFVKAGLVNPVLVRLDAETKVS-ENLEMLFLSSKNADREANLLYILQEVIRIPLATSEQ 388
               +  L NP+ + +D E K++   L+  ++  +  ++   L  +L ++         Q
Sbjct: 247 RPICRRFLQNPLEIFVDDEAKLTLHGLQQYYIKLEEREKNRKLAQLLDDL------EFNQ 300

Query: 389 LLKLQKSTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMPAANELPSEKATILFVPTRHHV 448
           ++   KST                                ANEL                
Sbjct: 301 VIIFVKSTLR------------------------------ANEL---------------- 314

Query: 449 EYISQLLRDCGYLISYIYGTLDQHARKNQLYNFRAGLTSILVVTDVAARGVDIPMLANVI 508
              ++LL    +    ++G + Q  R  +   F+     I V TDV  RG+DI  +   I
Sbjct: 315 ---TKLLNASNFPAITVHGHMKQEKRIARYKAFKEFEKRICVSTDVFGRGIDIERINLAI 371

Query: 509 NYTLPGSSKIFVHRVGRTARAGNKGWAYSIVA 540
           NY +P  +  ++HRVGR  R G KG A S+V+
Sbjct: 372 NYDMPSEADQYLHRVGRAGRFGTKGLAISLVS 403

>TBLA0C03500 Chr3 complement(835236..836756) [1521 bp, 506 aa] {ON}
           Anc_5.337 YHR065C
          Length = 506

 Score =  147 bits (371), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 86/244 (35%), Positives = 135/244 (55%), Gaps = 7/244 (2%)

Query: 141 SFPSFGLSKIV---LNNIKRKGFRQPTPIQRKTIPLILQSRDIVGMARTGSGKTAAFILP 197
           +F SF   K+V   +   K   + +PTPIQ + IP  L+ +DI+G+A+TGSGKTAAF +P
Sbjct: 84  TFSSFSELKLVPELVEACKNLNYEKPTPIQSRAIPPALEGKDIIGLAQTGSGKTAAFAIP 143

Query: 198 MVEKLKSHSGKIGARAVILSPSRELAMQTFNVFKDFARGTELRSVLLTGGDSLEEQFSMM 257
           ++ KL          A I++P+RELA Q    F        +RSV + GG ++ +Q   +
Sbjct: 144 ILNKLWEDQQPY--YACIMAPTRELAQQIKEQFDSLGALMGVRSVCIVGGMNMMDQARDL 201

Query: 258 MSNPDVIIATPGRFL-HLKVEMNLDLKSVEYVVFDEADRLFEMGFQEQLNELLASLPTT- 315
           M  P +IIATPGR + HL+      L+ ++++V DEADRL ++ F   L+ +L  LPT  
Sbjct: 202 MRKPHIIIATPGRLMDHLENTRGFSLRKLKFLVMDEADRLLDLEFGPVLDRILKILPTQG 261

Query: 316 RQTLLFSATLPNSLVDFVKAGLVNPVLVRLDAETKVSENLEMLFLSSKNADREANLLYIL 375
           R T LFSAT+ + +    +A L NPV   +  + +  + L    +      +   L+Y++
Sbjct: 262 RTTYLFSATMTSKIDKLQRASLTNPVKCAVSNKYQTVDTLIQTLMVVPGGLKNTYLIYLI 321

Query: 376 QEVI 379
            E +
Sbjct: 322 NEFV 325

 Score = 94.0 bits (232), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 51/123 (41%), Positives = 72/123 (58%)

Query: 436 KATILFVPTRHHVEYISQLLRDCGYLISYIYGTLDQHARKNQLYNFRAGLTSILVVTDVA 495
           K+ I+F  T+ + E +S L     +    ++G L+Q+ R   L  F+AG  SIL+ TDVA
Sbjct: 327 KSIIIFTRTKANAERLSLLSNTLEFDAIALHGDLNQNQRTGALDLFKAGKKSILIATDVA 386

Query: 496 ARGVDIPMLANVINYTLPGSSKIFVHRVGRTARAGNKGWAYSIVAXXXXXXXXXXXXXXG 555
           ARG+DIP +  VINY +P  SK ++HRVGRTARAG  G + S+V+              G
Sbjct: 387 ARGLDIPSVDIVINYDIPVDSKSYIHRVGRTARAGRSGKSISLVSQYDLELILRIEDVLG 446

Query: 556 KKI 558
           KK+
Sbjct: 447 KKL 449

>Kpol_340.2 s340 complement(3233..5245) [2013 bp, 670 aa] {ON}
           complement(3233..5245) [2013 nt, 671 aa]
          Length = 670

 Score =  149 bits (376), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 122/406 (30%), Positives = 191/406 (47%), Gaps = 75/406 (18%)

Query: 154 NIKRKGFRQPTPIQRKTIPLILQS--RDIVGMARTGSGKTAAFILPMVEKL---KSHSGK 208
           +I R GF   T +Q+KTI  IL++  RD++  A+TG+GKT AF++P+ E L   +  S  
Sbjct: 129 SISRMGFPNLTAVQQKTIKPILENEDRDVIARAKTGTGKTFAFLIPLFEHLIRTRRESPD 188

Query: 209 IGARAVILSPSRELAMQTFN-VFKDFARGTELR---SVLLTGGDSLEEQ-FSMMMSNPDV 263
           +  +AV+L+P+R+LA+Q    V K  +    L+    + + GG    +  F +  + P++
Sbjct: 189 M-VKAVVLAPTRDLALQIEQEVHKIHSNNYALKKFGCMSVVGGTKFGQSLFQLKKTRPNI 247

Query: 264 IIATPGRFLHLKVEMNLD-LKSVEYVVFDEADRLFEMGFQEQLNELLASLPTTR------ 316
           IIATPGRF+     +  +  K V++ V DEADRL E+GF++ L  +  SL          
Sbjct: 248 IIATPGRFIATVEAVGAEYFKHVDFKVLDEADRLLEIGFKDDLEYISTSLNGLNDVGKDH 307

Query: 317 -QTLLFSATLPNSLVDFVKAGLVNPVLVRLDA----ETKVSENLEMLFLSSKNADREANL 371
            +TLLFSATL   +       +     + LD     E +  E +E   + S+N       
Sbjct: 308 IRTLLFSATLDEKVQTLADDVMNKSECLFLDTVDKNEPESHEKIEQSLVVSQNFAEST-- 365

Query: 372 LYILQEVIRIPLATSEQLLKLQKSTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMPAANE 431
                       A  + LLK  K+                                    
Sbjct: 366 -----------YAVIDHLLKQTKN------------------------------------ 378

Query: 432 LPSEKATILFVPTRHHVEYISQLLRDC--GYLISYIYGTLDQHARKNQLYNFRAGLTSIL 489
           +P+ KA ILF PT    +++S LL+     Y +   +G +DQ  R   + +F+     +L
Sbjct: 379 VPNYKA-ILFTPTIKATKFLSNLLKKSLHRYPVYEFHGKIDQAKRTRIVGSFKGAPAGLL 437

Query: 490 VVTDVAARGVDIPMLANVINYTLPGSSKIFVHRVGRTARAGNKGWA 535
           V TDV ARG+D P +  V+   +P     +VHR+GRTAR G +G +
Sbjct: 438 VCTDVGARGMDFPNVTEVLQLGVPSELSNYVHRIGRTARGGKEGAS 483

>CAGL0J10912g Chr10 (1063600..1065081) [1482 bp, 493 aa] {ON} highly
           similar to uniprot|P38712 Saccharomyces cerevisiae
           YHR065c RRP3
          Length = 493

 Score =  146 bits (369), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 84/241 (34%), Positives = 130/241 (53%), Gaps = 4/241 (1%)

Query: 141 SFPSFGLSKIVLNNIKRKGFRQPTPIQRKTIPLILQSRDIVGMARTGSGKTAAFILPMVE 200
           SF    L   ++   +   F +PTPIQ + IP  L   D++G+A+TGSGKTAAF +P++ 
Sbjct: 74  SFAQLNLVPELIQACQNLNFTKPTPIQARAIPPALAGSDVIGLAQTGSGKTAAFAIPILN 133

Query: 201 KLKSHSGKIGARAVILSPSRELAMQTFNVFKDFARGTELRSVLLTGGDSLEEQFSMMMSN 260
           KL          A +L+P+RELA Q    F        +R+  + GG ++ +Q   +M  
Sbjct: 134 KLWEDQQPY--YACVLAPTRELAQQIKETFDSLGSLMGVRTTCIVGGMNMMDQARDLMRK 191

Query: 261 PDVIIATPGRFL-HLKVEMNLDLKSVEYVVFDEADRLFEMGFQEQLNELLASLPTT-RQT 318
           P +IIATPGR + HL+      LK+++++V DEADRL +M F   L+ +L  +PT  R T
Sbjct: 192 PHIIIATPGRLMDHLENTKGFSLKNLKFLVMDEADRLLDMEFGPVLDRILKIIPTKGRTT 251

Query: 319 LLFSATLPNSLVDFVKAGLVNPVLVRLDAETKVSENLEMLFLSSKNADREANLLYILQEV 378
            LFSAT+ + +    +A L NPV   +  + +  + L    +      +   L+Y+L E 
Sbjct: 252 YLFSATMTSKIDKLQRASLTNPVKCAVSNKYQTVDTLVQTLMVVPGGLKNTFLIYLLNEF 311

Query: 379 I 379
           I
Sbjct: 312 I 312

 Score = 95.9 bits (237), Expect = 9e-20,   Method: Compositional matrix adjust.
 Identities = 52/123 (42%), Positives = 72/123 (58%)

Query: 436 KATILFVPTRHHVEYISQLLRDCGYLISYIYGTLDQHARKNQLYNFRAGLTSILVVTDVA 495
           K  I+F  T+ + E +S L     +  + ++G L+Q+ R   L  F+AG  SILV TDVA
Sbjct: 314 KTVIIFTRTKANAERLSGLCNLLEFSATALHGDLNQNQRTGALDLFKAGKRSILVATDVA 373

Query: 496 ARGVDIPMLANVINYTLPGSSKIFVHRVGRTARAGNKGWAYSIVAXXXXXXXXXXXXXXG 555
           ARG+DIP +  VINY +P  SK ++HRVGRTARAG  G + S+V+              G
Sbjct: 374 ARGLDIPSVDIVINYDIPVDSKSYIHRVGRTARAGRSGKSISLVSQYDLELILRIEEVLG 433

Query: 556 KKI 558
           KK+
Sbjct: 434 KKL 436

>ZYRO0C04378g Chr3 complement(342717..344762) [2046 bp, 681 aa] {ON}
           similar to uniprot|P15424 Saccharomyces cerevisiae
           YDR194C MSS116 DEAD-box protein required for efficient
           splicing of mitochondrial Group I and II introns
           presumed RNA helicase due to DEAD-box motif
          Length = 681

 Score =  149 bits (376), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 124/406 (30%), Positives = 182/406 (44%), Gaps = 85/406 (20%)

Query: 159 GFRQPTPIQRKTIPLIL--QSRDIVGMARTGSGKTAAFILPMVEKL--KSHSGKIGARAV 214
           GF   TP+Q+K I  IL  QS+D++  A+TG+GKT AF++PM + L           + V
Sbjct: 97  GFTGLTPVQQKAIRPILENQSQDVITRAKTGTGKTFAFLIPMFQHLINTKRENPSAVKYV 156

Query: 215 ILSPSRELAMQ----------TFNVFKDFARGTELRSVLLTGGDSLEEQFS-MMMSNPDV 263
           I++P+R+LA+Q             V K F       S+ L GG +     + ++   P V
Sbjct: 157 IVAPTRDLALQIEMETRRIQAAHPVLKRF------HSLTLVGGTNFAASVTDLIRRKPQV 210

Query: 264 IIATPGRFLHLKVEMNLDLKSVEYVVFDEADRLFEMGFQEQLNELLASL-------PTTR 316
           +IATPGR L +        K V+  V DEADRL E+GFQ+ L ++ + L       P   
Sbjct: 211 VIATPGRLLDILQRYEKHFKQVDVKVLDEADRLLEIGFQQDLEKISSILNKINETGPDHI 270

Query: 317 QTLLFSATLPNSLVDFVKAGLVNPVLVRLDA----ETKVSENLEMLFLSSKNADREANLL 372
           +TLLFSATL   + D  ++ +     + LD     E +  E +    + ++N     ++L
Sbjct: 271 RTLLFSATLDAKVQDLSQSIMGKDECLFLDTVDKNEPQAHEKISQSAVIAENLGH--SIL 328

Query: 373 YILQEVIRIPLATSEQLLKLQKSTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMPAANEL 432
             +  V R  LA                                                
Sbjct: 329 ATMDHVKRQVLAN----------------------------------------------- 341

Query: 433 PSEKATILFVPTRHHVEYISQLL---RDCGYLISYIYGTLDQHARKNQLYNFRAGLTSIL 489
           P+ KA ILF PT      IS+LL   +D    I   +G   Q+ R   +  F+   + IL
Sbjct: 342 PNYKA-ILFTPTIKCTTLISELLHAQQDVAVPILEFHGKKTQNVRTKMVQKFKRDRSGIL 400

Query: 490 VVTDVAARGVDIPMLANVINYTLPGSSKIFVHRVGRTARAGNKGWA 535
           V TDVAARG+D P +  V+   +P     ++HR+GRTARAG  G A
Sbjct: 401 VCTDVAARGLDFPDVGEVLQIGVPAIMSQYIHRIGRTARAGKTGKA 446

>CAGL0L10021g Chr12 complement(1076197..1077711) [1515 bp, 504 aa]
           {ON} highly similar to uniprot|P20449 Saccharomyces
           cerevisiae YOR046c DBP5 RNA helicase
          Length = 504

 Score =  146 bits (368), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 118/446 (26%), Positives = 204/446 (45%), Gaps = 73/446 (16%)

Query: 141 SFPSFGLSKIVLNNIKRKGFRQPTPIQRKTIPLILQS--RDIVGMARTGSGKTAAFILPM 198
           SF   GLS  +L  I    F++P+ IQ + +PL+L +  R+++  +++G+GKTAAF L M
Sbjct: 115 SFDELGLSPELLKGIYAMKFQKPSKIQERALPLLLSNPPRNMIAQSQSGTGKTAAFSLTM 174

Query: 199 VEKLKSHSGKIGARAVILSPSRELAMQTFNVFKDFARGTELRSVLLTGGDSLEEQFSMMM 258
           + ++         +A+ L+PSRELA QT  V ++  + T++ + L+   DS E+   +  
Sbjct: 175 LSRVDETQN--VPQAICLAPSRELARQTLEVIQEMGKYTKITTQLIV-PDSFEKNTKI-- 229

Query: 259 SNPDVIIATPGRFLHLKVEMNLDLKSVEYVVFDEADRLFE-MGFQEQLNELLASLPTTRQ 317
            N +V++ TPG  L L     + L++V+  V DEAD + +  G  +Q   +   LP   Q
Sbjct: 230 -NANVVVGTPGTLLDLIRRKLIQLQNVKIFVLDEADNMLDKQGLGDQCIRVKKFLPKDTQ 288

Query: 318 TLLFSATLPNSLVDFVKAGLVNPVLVRLDAETKVSENLEMLFLSSKNADREANLLYILQE 377
            +LFSAT  +++  + +  + N   + L       + ++ L++   + + EA+   +L E
Sbjct: 289 LVLFSATFADAVKAYAQKVIPNANTLELQRNEVNVKAIKQLYM---DCNDEAHKYEVLCE 345

Query: 378 VIRIPLATSEQLLKLQKSTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMPAANELPSEKA 437
           +  +    S  +   +K T                                        A
Sbjct: 346 LYGLLTIGSSIIFVAKKDT----------------------------------------A 365

Query: 438 TILFVPTRHHVEYISQLLRDCGYLISYIYGTLDQHARKNQLYNFRAGLTSILVVTDVAAR 497
            +L+   +H            G+ +S ++  L    R   + +FR G + +L+ T+V AR
Sbjct: 366 NLLYGKLKHE-----------GHQVSILHSDLRTDERDRLIDDFREGRSKVLITTNVLAR 414

Query: 498 GVDIPMLANVINYTLPG------SSKIFVHRVGRTARAGNKGWAYSIVAXXXXXXXXXXX 551
           G+DIP ++ V+NY LP           +VHR+GRT R G  G A S V            
Sbjct: 415 GIDIPSVSMVVNYDLPTLPNGMPDYATYVHRIGRTGRFGRTGVAISFVHDKKSFKILSAI 474

Query: 552 XXXGKKILLTPM----YDSLVDVMKK 573
               K I LT +    +D + D++KK
Sbjct: 475 QDYFKDIELTRVPTDDWDEVEDIVKK 500

>NCAS0B01730 Chr2 complement(286249..288105) [1857 bp, 618 aa] {ON}
           Anc_8.614
          Length = 618

 Score =  148 bits (373), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 84/253 (33%), Positives = 138/253 (54%), Gaps = 18/253 (7%)

Query: 141 SFPSFGLSKIVLNNIKRKGFRQPTPIQRKTIPLILQSRDIVGMARTGSGKTAAFILPM-- 198
           +F S  L +++L NIK   F +PTP+Q+ ++P++   RD++  A+TGSGKT  F+ P+  
Sbjct: 146 AFTSPPLDELLLENIKLARFTKPTPVQKYSVPIVAAGRDLMACAQTGSGKTGGFLFPVLS 205

Query: 199 ---------VEKLKSHS---GKIGARAVILSPSRELAMQTFNVFKDFARGTELRSVLLTG 246
                    V+  +SH     K    AVI++P+RELA Q F+  K F   + ++  ++ G
Sbjct: 206 ESFKTGPTVVDNAQSHGYYQKKAYPTAVIMAPTRELATQIFDEAKKFCYRSWVQPCVVYG 265

Query: 247 GDSLEEQFSMMMSNPDVIIATPGRFLHLKVEMNLDLKSVEYVVFDEADRLFEMGFQEQLN 306
           G  +  Q   M    D+++ATPGR   L     + L +V+Y+V DEADR+ +MGF+ Q+ 
Sbjct: 266 GSPIGNQMREMDRGCDLLVATPGRLSDLIDRGKISLSNVKYLVLDEADRMLDMGFEPQIR 325

Query: 307 ELLASLPTT----RQTLLFSATLPNSLVDFVKAGLVNPVLVRLDAETKVSENLEMLFLSS 362
            ++     T    RQTL+FSAT P  +    +  L + + + +      SEN+    L  
Sbjct: 326 AIVEGADMTPVGERQTLMFSATFPADIQHLARDFLADYIFLSVGRVGSTSENITQRVLYV 385

Query: 363 KNADREANLLYIL 375
           +N D+++ LL +L
Sbjct: 386 ENQDKKSALLDLL 398

 Score = 86.3 bits (212), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 43/98 (43%), Positives = 61/98 (62%)

Query: 438 TILFVPTRHHVEYISQLLRDCGYLISYIYGTLDQHARKNQLYNFRAGLTSILVVTDVAAR 497
           T++FV T+   + ++  L    +  + I+G   Q  R+  L  FR+G  ++LV T VAAR
Sbjct: 406 TLIFVETKRMADQLTDFLIMQDFRATAIHGDRTQQERERALAAFRSGRANLLVATAVAAR 465

Query: 498 GVDIPMLANVINYTLPGSSKIFVHRVGRTARAGNKGWA 535
           G+DIP + +VINY LPG    +VHR+GRT RAGN G A
Sbjct: 466 GLDIPNVTHVINYDLPGDIDDYVHRIGRTGRAGNTGVA 503

>AAL041C Chr1 complement(270739..272202) [1464 bp, 487 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YHR065C
           (RRP3)
          Length = 487

 Score =  145 bits (366), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 94/272 (34%), Positives = 147/272 (54%), Gaps = 7/272 (2%)

Query: 113 QTQAGEEEDDVNEYFSTNNLEKQKHKKG--SFPSFGLSKIVLNNIKRKGFRQPTPIQRKT 170
           ++QA EE +  +E  +    E  + ++G  SF    L   ++       F +PTPIQ K 
Sbjct: 37  ESQATEEANTASETEAAVIEETAEPEEGFSSFRELDLVPELIEACDNLNFTKPTPIQSKA 96

Query: 171 IPLILQSRDIVGMARTGSGKTAAFILPMVEKLKSHSGKIGARAVILSPSRELAMQTFNVF 230
           IP  LQ +DI+G+A+TGSGKTAAF +P++ +L  H  +    A IL+P+RELA Q    F
Sbjct: 97  IPPALQGKDIIGLAQTGSGKTAAFAIPILNRL-WHDQQ-PYYACILAPTRELAQQIKETF 154

Query: 231 KDFARGTELRSVLLTGGDSLEEQFSMMMSNPDVIIATPGRFL-HLKV-EMNLDLKSVEYV 288
                   +R+  + GG ++ +Q   +M  P +IIATPGR + HL+V +    L+  +++
Sbjct: 155 DSLGSLMGVRTTCIVGGMNMMDQARDLMRKPHIIIATPGRLMDHLEVHKRGFALRKQQFL 214

Query: 289 VFDEADRLFEMGFQEQLNELLASLPT-TRQTLLFSATLPNSLVDFVKAGLVNPVLVRLDA 347
           V DEADRL  M F   L+ +L ++PT  R T LFSAT+ + +    +A L N V   +  
Sbjct: 215 VMDEADRLLNMKFGPVLDRILKNIPTKVRTTYLFSATMTSKIDKLQRASLTNTVKCAVSN 274

Query: 348 ETKVSENLEMLFLSSKNADREANLLYILQEVI 379
           + +  + L    +      +   L+Y+L E I
Sbjct: 275 KYQTVDTLVQTLIVVPGGLKNTFLIYLLNEFI 306

 Score = 99.0 bits (245), Expect = 7e-21,   Method: Compositional matrix adjust.
 Identities = 54/123 (43%), Positives = 73/123 (59%)

Query: 436 KATILFVPTRHHVEYISQLLRDCGYLISYIYGTLDQHARKNQLYNFRAGLTSILVVTDVA 495
           K TI+F  T+ + E IS L     +  + ++G L+Q+ R   L  F+AG  SILV TDVA
Sbjct: 308 KTTIVFTRTKANAERISGLCNLLEFSATALHGDLNQNQRTGALDLFKAGKKSILVATDVA 367

Query: 496 ARGVDIPMLANVINYTLPGSSKIFVHRVGRTARAGNKGWAYSIVAXXXXXXXXXXXXXXG 555
           ARG+DIP +  VINY +P  SK ++HRVGRTARAG  G + S+V+              G
Sbjct: 368 ARGLDIPSVDLVINYDIPVDSKSYIHRVGRTARAGRSGKSVSLVSQYDLELILRIEEVLG 427

Query: 556 KKI 558
           KK+
Sbjct: 428 KKL 430

>Kpol_2001.67 s2001 (185153..186607) [1455 bp, 484 aa] {ON}
           (185153..186607) [1455 nt, 485 aa]
          Length = 484

 Score =  144 bits (364), Expect = 6e-36,   Method: Compositional matrix adjust.
 Identities = 76/208 (36%), Positives = 119/208 (57%), Gaps = 2/208 (0%)

Query: 138 KKGSFPSFGLSKIVLNNIKRKGFRQPTPIQRKTIPLILQSRDIVGMARTGSGKTAAFILP 197
           K  +F  F L + +L  I   GF +P+PIQ ++IP+ L  RDI+  A+ G+GKTAAF++P
Sbjct: 32  KGNTFEDFYLKRELLMGIFEAGFEKPSPIQEESIPVALAGRDILARAKNGTGKTAAFVIP 91

Query: 198 MVEKLKSHSGKIGARAVILSPSRELAMQTFNVFKDFARGTELRSVLLTGGDSLEEQFSMM 257
            +EK+KS   KI  +A+I+ P+RELA+QT  V +   +   +  ++ TGG +L +    +
Sbjct: 92  TLEKVKSKHNKI--QALIMVPTRELALQTSQVVRTLGKHCGISCMVTTGGTNLRDDILRL 149

Query: 258 MSNPDVIIATPGRFLHLKVEMNLDLKSVEYVVFDEADRLFEMGFQEQLNELLASLPTTRQ 317
                +++ TPGR L L      DL      + DEAD++    F+  + ++L  LP   Q
Sbjct: 150 NETVHILVGTPGRVLDLASRKVADLSECNLFIMDEADKMLSRDFKSIIEQILVFLPKNHQ 209

Query: 318 TLLFSATLPNSLVDFVKAGLVNPVLVRL 345
           +LLFSAT P S+ +F+   L  P  + L
Sbjct: 210 SLLFSATFPLSVKEFMVNHLHKPYEINL 237

 Score = 73.9 bits (180), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 42/150 (28%), Positives = 72/150 (48%), Gaps = 5/150 (3%)

Query: 439 ILFVPTRHHVEYISQLLRDCGYLISYIYGTLDQHARKNQLYNFRAGLTSILVVTDVAARG 498
           I+F  + + VE +++ + D GY   Y +  + Q  R    + FR G    LV +D+  RG
Sbjct: 275 IIFCNSTNRVELLAKKITDLGYSCYYSHARMKQQERNRVFHEFRQGKVRTLVCSDLLTRG 334

Query: 499 VDIPMLANVINYTLPGSSKIFVHRVGRTARAGNKGWAYSIVAXXXXXXXXXXXXXXGKKI 558
           +DI  +  VIN+  P +++ ++HR+GR+ R G+ G A +++               G +I
Sbjct: 335 IDIQAVNVVINFDFPKTAETYLHRIGRSGRFGHLGLAINLINWNDRFNLYKIEQELGTEI 394

Query: 559 LLTPMYDSLVDVMKKRWVEEGNSAYNFQLP 588
              P   + +D  K  +V   NSA     P
Sbjct: 395 QAIP---ATID--KSLYVANDNSAVPVPFP 419

>SAKL0F11088g Chr6 complement(866571..868064) [1494 bp, 497 aa] {ON}
           highly similar to uniprot|P39517 Saccharomyces
           cerevisiae YDL160C DHH1 Cytoplasmic DExD/H-box helicase
           stimulates mRNA decapping coordinates distinct steps in
           mRNA function and decay interacts with both the
           decapping and deadenylase complexes may have a role in
           mRNA export and translation
          Length = 497

 Score =  144 bits (364), Expect = 8e-36,   Method: Compositional matrix adjust.
 Identities = 77/208 (37%), Positives = 119/208 (57%), Gaps = 2/208 (0%)

Query: 138 KKGSFPSFGLSKIVLNNIKRKGFRQPTPIQRKTIPLILQSRDIVGMARTGSGKTAAFILP 197
           K  +F  F L + +L  I   GF +P+PIQ + IP+ L  RDI+  A+ G+GKTAAF++P
Sbjct: 27  KGNTFEDFYLKRELLMGIFEAGFEKPSPIQEEAIPIALAGRDILARAKNGTGKTAAFVIP 86

Query: 198 MVEKLKSHSGKIGARAVILSPSRELAMQTFNVFKDFARGTELRSVLLTGGDSLEEQFSMM 257
            +EK+K    KI  +A+IL P+RELA+QT  V +   +   +  ++ TGG +L +    +
Sbjct: 87  TLEKIKPKVNKI--QALILVPTRELALQTSQVVRTLGKHCGISCMVTTGGTNLRDDIMRL 144

Query: 258 MSNPDVIIATPGRFLHLKVEMNLDLKSVEYVVFDEADRLFEMGFQEQLNELLASLPTTRQ 317
                V++ TPGR L L      DL      V DEAD++    F+  + ++L+  P +RQ
Sbjct: 145 HEPVHVLVGTPGRVLDLASRKVADLSECPLFVMDEADKMLSRDFKSIIEQILSFFPQSRQ 204

Query: 318 TLLFSATLPNSLVDFVKAGLVNPVLVRL 345
           +LLFSAT P ++ +F+   L  P  + L
Sbjct: 205 SLLFSATFPLTVKEFMVNHLNKPYEINL 232

 Score = 73.6 bits (179), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 32/101 (31%), Positives = 58/101 (57%)

Query: 439 ILFVPTRHHVEYISQLLRDCGYLISYIYGTLDQHARKNQLYNFRAGLTSILVVTDVAARG 498
           I+F  + + VE +++ + D GY   Y +  + Q  R    + FR G    LV +D+  RG
Sbjct: 270 IIFCNSTNRVELLAKKITDLGYSCYYSHARMKQQERNKVFHEFRQGKVRTLVCSDLLTRG 329

Query: 499 VDIPMLANVINYTLPGSSKIFVHRVGRTARAGNKGWAYSIV 539
           +DI  +  VIN+  P +++ ++HR+GR+ R G+ G A +++
Sbjct: 330 IDIQAVNVVINFDFPKTAETYLHRIGRSGRFGHLGLAINLI 370

>NCAS0A14060 Chr1 (2765451..2766983) [1533 bp, 510 aa] {ON}
           Anc_7.336
          Length = 510

 Score =  144 bits (364), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 75/208 (36%), Positives = 121/208 (58%), Gaps = 2/208 (0%)

Query: 138 KKGSFPSFGLSKIVLNNIKRKGFRQPTPIQRKTIPLILQSRDIVGMARTGSGKTAAFILP 197
           K  +F  F L + +L  I   GF +P+PIQ ++IP+ +  RDI+  A+ G+GKTAAF++P
Sbjct: 41  KGNTFEDFYLKRELLMGIFEAGFEKPSPIQEESIPIAITGRDILARAKNGTGKTAAFVIP 100

Query: 198 MVEKLKSHSGKIGARAVILSPSRELAMQTFNVFKDFARGTELRSVLLTGGDSLEEQFSMM 257
            +EK+K    KI  +A+I+ P+RELA+QT  V +   +   +  ++ TGG +L +    +
Sbjct: 101 TLEKIKPKLNKI--QALIMVPTRELALQTSQVVRTLGKHCGISCMVTTGGTNLRDDILRL 158

Query: 258 MSNPDVIIATPGRFLHLKVEMNLDLKSVEYVVFDEADRLFEMGFQEQLNELLASLPTTRQ 317
             +  V++ TPGR L L      DL   +  + DEAD++    F+  + ++L  LP   Q
Sbjct: 159 NESVHVLVGTPGRVLDLASRKVADLSDCQLFIMDEADKMLSRDFKTIIEQILIFLPKKHQ 218

Query: 318 TLLFSATLPNSLVDFVKAGLVNPVLVRL 345
           +LLFSAT P ++ +F+   L NP  + L
Sbjct: 219 SLLFSATFPLTVKEFMVKHLTNPYEINL 246

 Score = 75.1 bits (183), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 33/101 (32%), Positives = 58/101 (57%)

Query: 439 ILFVPTRHHVEYISQLLRDCGYLISYIYGTLDQHARKNQLYNFRAGLTSILVVTDVAARG 498
           I+F  + + VE +++ + D GY   Y +  + Q  R    + FR G    LV +D+  RG
Sbjct: 284 IIFCNSTNRVELLAKKITDLGYSCYYSHARMKQQERNRVFHEFRQGKVRTLVCSDLLTRG 343

Query: 499 VDIPMLANVINYTLPGSSKIFVHRVGRTARAGNKGWAYSIV 539
           +DI  +  VIN+  P +S+ ++HR+GR+ R G+ G A +++
Sbjct: 344 IDIQAVNVVINFDFPKTSETYLHRIGRSGRFGHLGLAINLI 384

>Suva_16.191 Chr16 complement(333913..335769) [1857 bp, 618 aa] {ON}
           YPL119C (REAL)
          Length = 618

 Score =  146 bits (368), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 83/252 (32%), Positives = 138/252 (54%), Gaps = 19/252 (7%)

Query: 142 FPSFGLSKIVLNNIKRKGFRQPTPIQRKTIPLILQSRDIVGMARTGSGKTAAFILPMVEK 201
           F S  L  ++L NIK  GF +PTP+Q+ ++P++  +RD++  A+TGSGKT  F+ P+  +
Sbjct: 154 FDSPPLDALLLENIKLAGFNKPTPVQKYSVPIVTNNRDLMACAQTGSGKTGGFLFPVFTE 213

Query: 202 LKSHSGKIGA--------------RAVILSPSRELAMQTFNVFKDFARGTELRSVLLTGG 247
           L  HSG   A               A++L+P+RELA Q F   + F   + +R  ++ GG
Sbjct: 214 L-FHSGPSPAPEKAQSFYSRKGYPSALVLAPTRELATQIFEEARKFTYRSWVRPCVVYGG 272

Query: 248 DSLEEQFSMMMSNPDVIIATPGRFLHLKVEMNLDLKSVEYVVFDEADRLFEMGFQEQLNE 307
             +  Q   +    D+++ATPGR   L     + L +++Y+V DEADR+ +MGF+ Q+  
Sbjct: 273 APIGNQMREVDRGCDLLVATPGRLNDLLERGKISLANIKYLVLDEADRMLDMGFEPQIRH 332

Query: 308 LL--ASLPTT--RQTLLFSATLPNSLVDFVKAGLVNPVLVRLDAETKVSENLEMLFLSSK 363
           ++    +P+   RQTL+FSAT P  +    +  L N + + +      SEN+    L   
Sbjct: 333 IVEECDMPSVGNRQTLMFSATFPVDIQHLARDFLDNYIFLSVGRVGSTSENITQRILYVD 392

Query: 364 NADREANLLYIL 375
           + D+++ LL +L
Sbjct: 393 DMDKKSALLDLL 404

 Score = 83.2 bits (204), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 43/104 (41%), Positives = 61/104 (58%)

Query: 435 EKATILFVPTRHHVEYISQLLRDCGYLISYIYGTLDQHARKNQLYNFRAGLTSILVVTDV 494
           E  T++FV T+   + ++  L    +  + I+G   Q  R+  L  F++ +  ILV T V
Sbjct: 409 EGLTLIFVETKRMADQLTDFLIMQNFRATAIHGDRTQAERERALSAFKSNVADILVATAV 468

Query: 495 AARGVDIPMLANVINYTLPGSSKIFVHRVGRTARAGNKGWAYSI 538
           AARG+DIP + +VINY LP     +VHR+GRT RAGN G A S 
Sbjct: 469 AARGLDIPNVTHVINYDLPSDIDDYVHRIGRTGRAGNTGVATSF 512

>ADR260C Chr4 complement(1152257..1153573) [1317 bp, 438 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDL084W
           (SUB2)
          Length = 438

 Score =  142 bits (359), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 116/452 (25%), Positives = 203/452 (44%), Gaps = 68/452 (15%)

Query: 100 ILELSDDENNIS-GQTQAGEEEDDVNEYFSTNNLEKQKHKKG----SFPSFGLSKIVLNN 154
           +LE SD+E  I    T+A E   +  E     + +K+    G     F  F L   +   
Sbjct: 9   LLEYSDNEQEIQVDNTKATEVAGNGEEAADGKDGDKKGSYVGIHSTGFKDFLLKPELSRA 68

Query: 155 IKRKGFRQPTPIQRKTIPLILQSRDIVGMARTGSGKTAAFILPMVEKLKSHSGKIGARAV 214
           I   GF  P+ +Q+ TIP  +   D++  A++G GKTA F+L  +++L    G++    V
Sbjct: 69  IIDCGFEHPSEVQQHTIPQSIHGTDVLCQAKSGLGKTAVFVLSTLQQLDPVPGEVS--VV 126

Query: 215 ILSPSRELAMQTFNVFKDFARGT-ELRSVLLTGGDSLEEQFSMMM---SNPDVIIATPGR 270
           +L  +RELA Q  N +  F++   ++++ +  GG    +   ++    + P +++ATPGR
Sbjct: 127 VLCNARELAYQIRNEYLRFSKYMPDVKTAVFYGGTDTRKDIELLKNKDTAPHIVVATPGR 186

Query: 271 FLHLKVEMNLDLKSVEYVVFDEADRLF-EMGFQEQLNELLASLPTTRQTLLFSATLPNSL 329
              L  + N+DL  V+  V DE D++  E+  +  + ++  + P  +Q ++FSATL   +
Sbjct: 187 LKALVRDNNIDLSHVKNFVIDECDKVLEELDMRRDVQDIFRATPRDKQVMMFSATLSQEI 246

Query: 330 VDFVKAGLVNPVLVRLDAETKVS-ENLEMLFLSSKNADREANLLYILQEVIRIPLATSEQ 388
               +  L NP+ + +D E K++   L+  ++  +  ++   L  +L ++         Q
Sbjct: 247 RPICRRFLQNPLEIFVDDEAKLTLHGLQQYYIRLEEREKNRKLAQLLDDL------EFNQ 300

Query: 389 LLKLQKSTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMPAANELPSEKATILFVPTRHHV 448
           ++   KST                                ANEL                
Sbjct: 301 VIIFVKSTLR------------------------------ANEL---------------- 314

Query: 449 EYISQLLRDCGYLISYIYGTLDQHARKNQLYNFRAGLTSILVVTDVAARGVDIPMLANVI 508
              ++LL    +    ++G + Q  R  +   F+     I V TDV  RG+DI  +   I
Sbjct: 315 ---TKLLNASNFPAITVHGHMRQEERIARYKAFKEFEKRICVSTDVFGRGIDIERINLAI 371

Query: 509 NYTLPGSSKIFVHRVGRTARAGNKGWAYSIVA 540
           NY +P  +  ++HRVGR  R G KG A S+V+
Sbjct: 372 NYDMPSEADQYLHRVGRAGRFGTKGLAISLVS 403

>SAKL0B02794g Chr2 complement(266645..268441) [1797 bp, 598 aa] {ON}
           highly similar to gnl|GLV|KLLA0E14410g Kluyveromyces
           lactis KLLA0E14410g and similar to YFL002C
           uniprot|P25808 Saccharomyces cerevisiae YFL002C SPB4
           involved in the maturation of 25S ribosomal RNA ATP-
           dependent RNA helicase
          Length = 598

 Score =  145 bits (366), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 113/408 (27%), Positives = 185/408 (45%), Gaps = 78/408 (19%)

Query: 155 IKRKGFRQPTPIQRKTIPLILQSRDIVGMARTGSGKTAAFILPMVEKL---KSHSGKIGA 211
           I   GF   TP+Q  TIP+   ++D+V  + TGSGKT +F++P++EK+   ++H+ K+  
Sbjct: 22  IDTMGFETMTPVQASTIPMFSGNKDVVVESVTGSGKTVSFVIPILEKIIADEAHTAKLKK 81

Query: 212 ---RAVILSPSRELAMQTFNVFKDFA-----RGTELRSVLLTGGD--SLEEQFSMMMSN- 260
               ++I+SP+REL+ Q   V + F          + S LL G +  ++ +  +  M N 
Sbjct: 82  GHFYSLIISPTRELSSQIQTVIESFLNHYPEENCPISSQLLIGTNKSTVRDDVNSYMENR 141

Query: 261 PDVIIATPGRFLHLKVEMNLDLKSVEYVVFDEADRLFEMGFQEQLNELLASLPTTRQTLL 320
           P +++ TPGR L       +   S   VV DEAD+L +  F++ +  +L  LP  R+T L
Sbjct: 142 PQILVGTPGRILDFLNMPTVKSSSCGVVVLDEADKLLDASFEKDVETILKLLPKQRRTGL 201

Query: 321 FSATLPNSLVDFVKAGLVNPVLVRLDAETKVSENLEMLFLSSKNADREANLLYILQEVIR 380
           FSAT+ ++     K G+ NPV + + ++ +   +L                        +
Sbjct: 202 FSATINSAGTQIFKTGMRNPVKISVKSKHQAPSSL------------------------K 237

Query: 381 IPLATSEQLLKLQKSTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMPAANELPSEKATIL 440
           I  A  +  LK Q                                +   N    +K  + 
Sbjct: 238 IKCAVVKPELKFQ------------------------------LLLTVLNHYNYKKCIVY 267

Query: 441 FVPTRHHVEYISQLLRDCGYL--------ISYIYGTLDQHARKNQLYNFRAGL-TSILVV 491
           F PT   V Y    ++    L        I  ++G L  ++R   L  F   L T++L+ 
Sbjct: 268 F-PTCVSVTYFYAFMQHLLKLGLINEDLDIFSLHGKLQTNSRMKTLERFTESLNTAVLLT 326

Query: 492 TDVAARGVDIPMLANVINYTLPGSSKIFVHRVGRTARAGNKGWAYSIV 539
           TDVAARG+DIP +  V+ +  P  + +F+HR GRT RA   G A + +
Sbjct: 327 TDVAARGIDIPDVDLVLQFDPPTDADMFLHRCGRTGRASRVGRAITFL 374

>Kwal_33.14325 s33 (619599..621101) [1503 bp, 500 aa] {ON} YHR065C
           (RRP3) - RRP3 is a DEAD box gene homologous to eIF-4a
           which encodes an RNA-dependent ATPase possessing
           helicase activity which is not specific for RNA [contig
           104] FULL
          Length = 500

 Score =  144 bits (362), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 85/246 (34%), Positives = 134/246 (54%), Gaps = 13/246 (5%)

Query: 142 FPSFGLSKIV------LNNIKRKGFRQPTPIQRKTIPLILQSRDIVGMARTGSGKTAAFI 195
           F SF   K+V        N+K   + +PTPIQ + IP  L+ +DI+G+A+TGSGKTAAF 
Sbjct: 78  FESFSELKLVPELIEACENLK---YSKPTPIQAEAIPPALEGKDIIGLAQTGSGKTAAFA 134

Query: 196 LPMVEKLKSHSGKIGARAVILSPSRELAMQTFNVFKDFARGTELRSVLLTGGDSLEEQFS 255
           +P++ +L          A +L+P+RELA Q    F        +R+  + GG ++ +Q  
Sbjct: 135 IPILNQLWHDQQPY--YACVLAPTRELAQQIKETFDSLGGAMGVRTTCIVGGMNMIDQAR 192

Query: 256 MMMSNPDVIIATPGRFL-HLKVEMNLDLKSVEYVVFDEADRLFEMGFQEQLNELLASLPT 314
            +M  P +IIATPGR + HL+      ++ ++Y+V DEADRL +M F   L+ +L  +PT
Sbjct: 193 DLMRKPHIIIATPGRLMDHLENTKGFSMRKLKYLVMDEADRLLDMEFGPVLDRILKIIPT 252

Query: 315 T-RQTLLFSATLPNSLVDFVKAGLVNPVLVRLDAETKVSENLEMLFLSSKNADREANLLY 373
             R T LFSAT+ + +    +A L NPV   +  + +  + L    +      +   L+Y
Sbjct: 253 QGRTTYLFSATMTSKIDKLQRASLTNPVKCAVSTKYQTVDTLIQTLMVVPGGLKNTFLIY 312

Query: 374 ILQEVI 379
           +L E +
Sbjct: 313 LLNEFL 318

 Score = 97.4 bits (241), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 50/105 (47%), Positives = 68/105 (64%)

Query: 436 KATILFVPTRHHVEYISQLLRDCGYLISYIYGTLDQHARKNQLYNFRAGLTSILVVTDVA 495
           K  I+F  T+ + E IS L     +  + ++G L+Q+ R   L  F+AG  SILV TDVA
Sbjct: 320 KTVIIFTRTKANAERISTLCNLLEFSSTALHGDLNQNQRTGALDLFKAGRRSILVATDVA 379

Query: 496 ARGVDIPMLANVINYTLPGSSKIFVHRVGRTARAGNKGWAYSIVA 540
           ARG+DIP +  VINY +P  SK ++HRVGRTARAG  G + S+V+
Sbjct: 380 ARGLDIPSVDIVINYDIPVDSKSYIHRVGRTARAGRSGKSISLVS 424

>Kwal_23.3235 s23 (209691..211721) [2031 bp, 676 aa] {ON} YDR194C
           (MSS116) - Mitochondrial DEAD box RNA helicase [contig
           250] FULL
          Length = 676

 Score =  146 bits (368), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 115/403 (28%), Positives = 182/403 (45%), Gaps = 71/403 (17%)

Query: 155 IKRKGFRQPTPIQRKTI-PLILQSRDIVGMARTGSGKTAAFILPMVEKL--KSHSGKIGA 211
           + R  F   TP+Q+KT+ P++    D++  A+TG+GKT AF++P+ E L           
Sbjct: 119 VSRMNFESLTPVQQKTMKPILATEHDVIARAKTGTGKTLAFLVPIFEHLIKTRVESPYMV 178

Query: 212 RAVILSPSRELAMQ----TFNVFKDFARGTELRSVLLTGGDSLEEQFSMMM-SNPDVIIA 266
           + VI++P+R+LA+Q       + K+     + +S+ L GG + +     M    P++++A
Sbjct: 179 KCVIVAPTRDLALQIDSEVAKLHKNNYALKKFKSIALIGGSNFQAAIKRMFKERPNIVVA 238

Query: 267 TPGRFLHLKVEMNLD-LKSVEYVVFDEADRLFEMGFQEQLNELLASL-------PTTRQT 318
           TPGR + +  + + +  K V++ V DEADRL E+GF E L E+  +L       P   +T
Sbjct: 239 TPGRLMDVMSKFSHEFFKHVDFKVLDEADRLLEIGFDEDLREISKNLSSINAAGPEHIRT 298

Query: 319 LLFSATLPNSLVDFVKAGLVNPVLVRLDA----ETKVSENLEMLFLSSKNADREANLLYI 374
           LLFSATL +++       +     + LD     E +  E +E   + S   D  A+ +Y 
Sbjct: 299 LLFSATLGDNVQKLASGIMDRKQCLFLDTVDKNEPEAHERIEQSLVIS---DTFAHNMYA 355

Query: 375 LQEVIRIPLATSEQLLKLQKSTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMPAANELPS 434
               I+  +A +++  K                                           
Sbjct: 356 PISAIKDRIAENDKPFK------------------------------------------- 372

Query: 435 EKATILFVPTRHHVE-YISQLLRDCGYLISY-IYGTLDQHARKNQLYNFRAGLTSILVVT 492
               ILFVPT    + Y S L R    L  Y  +G +DQ  R   +  F+     I V T
Sbjct: 373 ---AILFVPTVKFTKFYCSVLERLFPSLPVYEFHGKIDQRKRTKMVQLFKRAHEGIFVCT 429

Query: 493 DVAARGVDIPMLANVINYTLPGSSKIFVHRVGRTARAGNKGWA 535
           DV ARG+D P +  V    +P     ++HR+GRTAR G  G A
Sbjct: 430 DVGARGMDFPDVEEVYQLGVPSELSNYIHRIGRTARGGKDGKA 472

>CAGL0L03846g Chr12 complement(443677..444047,445148..446411) [1635
           bp, 544 aa] {ON} highly similar to uniprot|P24783
           Saccharomyces cerevisiae YNL112w DBP2 ATP-dependent RNA
           helicase of DEAD box family
          Length = 544

 Score =  144 bits (363), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 75/222 (33%), Positives = 126/222 (56%), Gaps = 4/222 (1%)

Query: 141 SFPSFGLSKIVLNNIKRKGFRQPTPIQRKTIPLILQSRDIVGMARTGSGKTAAFILPMVE 200
           +F   G    VL  +K +GF +PT IQ +  P+ L  RD+VG+A TGSGKT ++ LP + 
Sbjct: 111 TFDEAGFPDYVLKEVKAEGFDKPTSIQCQGWPMALSGRDMVGIAATGSGKTLSYCLPGIV 170

Query: 201 KLKSH---SGKIGARAVILSPSRELAMQTFNVFKDFARGTELRSVLLTGGDSLEEQFSMM 257
            + +    S   G   ++L+P+RELA+Q       F + + +R+  + GG    +Q   +
Sbjct: 171 HINAQPLLSPGDGPIVLVLAPTRELAVQIQKECSKFGKSSRIRNTCVYGGVPRGQQIREL 230

Query: 258 MSNPDVIIATPGRFLHLKVEMNLDLKSVEYVVFDEADRLFEMGFQEQLNELLASLPTTRQ 317
           +   +++IATPGR + +      +LK V Y+V DEADR+ +MGF+ Q+ +++  +   RQ
Sbjct: 231 IRGAEIVIATPGRLIDMLEAGKTNLKRVTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQ 290

Query: 318 TLLFSATLPNSLVDFVKAGLVNPVLVRLDA-ETKVSENLEML 358
           TL++SAT P  +    +  L +P+ V++ + E   S N+  L
Sbjct: 291 TLMWSATWPKEVQQLARDYLNDPIQVQIGSLELAASHNITQL 332

 Score = 86.3 bits (212), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 43/104 (41%), Positives = 61/104 (58%)

Query: 435 EKATILFVPTRHHVEYISQLLRDCGYLISYIYGTLDQHARKNQLYNFRAGLTSILVVTDV 494
           E   ++F  T+   + I+  LR  G+    I+G  DQ  R   L  FR G + I+V TDV
Sbjct: 357 ESKILIFASTKRTCDEITSYLRQDGWPALAIHGDKDQRERDWVLNEFRTGNSPIMVATDV 416

Query: 495 AARGVDIPMLANVINYTLPGSSKIFVHRVGRTARAGNKGWAYSI 538
           AARG+D+  +  V+NY +PG+ + +VHR+GRT RAG  G A S 
Sbjct: 417 AARGIDVKGINFVVNYDMPGNIEDYVHRIGRTGRAGATGTAISF 460

>TDEL0F05260 Chr6 complement(983324..985291) [1968 bp, 655 aa] {ON}
           Anc_8.402 YDR194C
          Length = 655

 Score =  145 bits (367), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 121/413 (29%), Positives = 189/413 (45%), Gaps = 74/413 (17%)

Query: 147 LSKIVLNNIKRKGFRQPTPIQRKTIPLILQS--RDIVGMARTGSGKTAAFILPMVEKL-- 202
           L K +  +I R  F   T +Q+KTI  I+QS  +D++  A+TG+GKT AF++P+ + L  
Sbjct: 105 LDKTLHKSISRMNFTGLTSVQQKTIKPIVQSEEQDVIARAKTGTGKTFAFLIPIFQHLIN 164

Query: 203 KSHSGKIGARAVILSPSRELAMQT-FNVFKDFARGTELR---SVLLTGGDSLEEQFSMMM 258
                +   + VI++P+R+LA+Q    V K       L+    V L GG +       M 
Sbjct: 165 TRRDSQYMVKCVIVAPTRDLALQIETEVHKIHEHNYALKKFGCVSLVGGTNFGSAMRKMS 224

Query: 259 S-NPDVIIATPGRFLH-LKVEMNLDLKSVEYVVFDEADRLFEMGFQEQ-------LNELL 309
           S  P+++IATPGR +  L    +   K V++ + DEADRL E+GF+E        LNE+ 
Sbjct: 225 SVRPNIVIATPGRLMAVLDQYADRYFKFVDFKILDEADRLLEIGFKEDLESISDTLNEIN 284

Query: 310 ASLPTTRQTLLFSATLPNSLVDFVKAGLVNPVLVRLDA----ETKVSENLEMLFLSSKNA 365
              P   +TLLFSATL + +       +     V LD     E +  E +E   + S   
Sbjct: 285 DKSPDHIRTLLFSATLDDKVQKLASKIMNKDECVFLDTVDKNEPEAHEKIEQSMVIS--- 341

Query: 366 DREANLLYILQEVIRIPLATSEQLLKLQKSTXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 425
           +R A+ +Y   + I+  + +                                        
Sbjct: 342 ERMAHSIYAAVDHIKQKMVSE--------------------------------------- 362

Query: 426 MPAANELPSEKATILFVPTRHHVEYISQLLR---DCGYLISYIYGTLDQHARKNQLYNFR 482
                  P+ KA ILF PT     ++S +LR        +   +G +DQ  R N +  F+
Sbjct: 363 -------PNYKA-ILFTPTVKFTRFLSAILRRELRSKLPVLEFHGQIDQRRRTNLVNQFK 414

Query: 483 AGLTSILVVTDVAARGVDIPMLANVINYTLPGSSKIFVHRVGRTARAGNKGWA 535
              + +LV TDV ARG+D P +  V+   +P     ++HR+GRTAR G +G +
Sbjct: 415 RDKSGLLVCTDVGARGMDFPNVTEVLQIGVPSELANYIHRIGRTARGGQEGSS 467

>Smik_6.318 Chr6 (498013..499854) [1842 bp, 613 aa] {ON} YPL119C
           (REAL)
          Length = 613

 Score =  145 bits (365), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 82/251 (32%), Positives = 138/251 (54%), Gaps = 17/251 (6%)

Query: 142 FPSFGLSKIVLNNIKRKGFRQPTPIQRKTIPLILQSRDIVGMARTGSGKTAAFILPMV-- 199
           F S  L  +++ NIK  GF +PTP+Q+ +IP++ + RD++  A+TGSGKT  F+ P+   
Sbjct: 152 FGSPPLDALLMENIKLAGFNKPTPVQKYSIPIVTKGRDLMACAQTGSGKTGGFLFPLFTE 211

Query: 200 ----------EKLKSHSGKIG-ARAVILSPSRELAMQTFNVFKDFARGTELRSVLLTGGD 248
                     EK +S   + G   A++L+P+RELA Q F   + F   + +R  ++ GG 
Sbjct: 212 LFRFGPSPVPEKTQSFYSRKGYPSALVLAPTRELATQIFEEARKFTYRSWVRPCVVYGGA 271

Query: 249 SLEEQFSMMMSNPDVIIATPGRFLHLKVEMNLDLKSVEYVVFDEADRLFEMGFQEQLNEL 308
            +  Q   +    D+++ATPGR   L     + L +++Y+V DEADR+ +MGF+ Q+  +
Sbjct: 272 PIGNQMREVDRGCDLLVATPGRLNDLLERGKISLANIKYLVLDEADRMLDMGFEPQIRHI 331

Query: 309 L--ASLPTT--RQTLLFSATLPNSLVDFVKAGLVNPVLVRLDAETKVSENLEMLFLSSKN 364
           +    +P+   RQTL+FSAT P  +    +  L N + + +      SEN+    L   +
Sbjct: 332 VEGCDMPSVGNRQTLMFSATFPVDIQHLARDFLDNYIFLSVGRVGSTSENITQRILYVDD 391

Query: 365 ADREANLLYIL 375
            D+++ LL +L
Sbjct: 392 LDKKSALLDLL 402

 Score = 84.0 bits (206), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 42/101 (41%), Positives = 60/101 (59%)

Query: 438 TILFVPTRHHVEYISQLLRDCGYLISYIYGTLDQHARKNQLYNFRAGLTSILVVTDVAAR 497
           T++FV T+   + ++  L    +  + I+G   Q  R+  L+ F+  +  ILV T VAAR
Sbjct: 410 TLIFVETKRMADQLTDFLIMQNFKATAIHGDRTQAERERALFAFKTNVADILVATAVAAR 469

Query: 498 GVDIPMLANVINYTLPGSSKIFVHRVGRTARAGNKGWAYSI 538
           G+DIP + +VINY LP     +VHR+GRT RAGN G A S 
Sbjct: 470 GLDIPNVTHVINYDLPSDIDDYVHRIGRTGRAGNTGVASSF 510

>Skud_15.370 Chr15 (661915..663744) [1830 bp, 609 aa] {ON} YOR204W
           (REAL)
          Length = 609

 Score =  145 bits (365), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 82/251 (32%), Positives = 137/251 (54%), Gaps = 17/251 (6%)

Query: 142 FPSFGLSKIVLNNIKRKGFRQPTPIQRKTIPLILQSRDIVGMARTGSGKTAAFILPMV-E 200
           F S  L  ++L NIK   F +PTP+Q+ ++P++   RD++  A+TGSGKT  F+ P++ E
Sbjct: 148 FTSPPLDSLLLENIKLARFTKPTPVQKYSVPIVANGRDLMACAQTGSGKTGGFLFPVLSE 207

Query: 201 KLKS------------HSGKIGARAVILSPSRELAMQTFNVFKDFARGTELRSVLLTGGD 248
             K+            +  K    AVI++P+RELA Q F+  K F   + +++ ++ GG 
Sbjct: 208 SFKTGPSPQPESQGSFYQKKAYPTAVIMAPTRELATQIFDESKKFTYRSWVKACVVYGGS 267

Query: 249 SLEEQFSMMMSNPDVIIATPGRFLHLKVEMNLDLKSVEYVVFDEADRLFEMGFQEQLNEL 308
            +  Q   +    D+++ATPGR   L     + L +V+Y+V DEADR+ +MGF+ Q+  +
Sbjct: 268 PIGNQLREIERGCDLLVATPGRLNDLLERGKISLSNVKYLVLDEADRMLDMGFEPQIRHI 327

Query: 309 LASLPTT----RQTLLFSATLPNSLVDFVKAGLVNPVLVRLDAETKVSENLEMLFLSSKN 364
           +     T    RQTL+FSAT P  +    +  L + + + +      SEN+    L  +N
Sbjct: 328 VEDCDMTPVGARQTLMFSATFPADIQHLARDFLSDYIFLSVGRVGSTSENITQKVLYVEN 387

Query: 365 ADREANLLYIL 375
            D+++ LL +L
Sbjct: 388 QDKKSALLDLL 398

 Score = 86.7 bits (213), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 43/98 (43%), Positives = 60/98 (61%)

Query: 438 TILFVPTRHHVEYISQLLRDCGYLISYIYGTLDQHARKNQLYNFRAGLTSILVVTDVAAR 497
           T++FV T+   + ++  L    +  + I+G   Q  R+  L  FR+G  S+LV T VAAR
Sbjct: 406 TLIFVETKRMADQLTDFLIMQNFRATAIHGDRTQSERERALAAFRSGTASLLVATAVAAR 465

Query: 498 GVDIPMLANVINYTLPGSSKIFVHRVGRTARAGNKGWA 535
           G+DIP + +VINY LP     +VHR+GRT RAGN G A
Sbjct: 466 GLDIPNVTHVINYDLPSDVDDYVHRIGRTGRAGNTGVA 503

>ZYRO0A10802g Chr1 complement(869465..871780) [2316 bp, 771 aa] {ON}
           similar to uniprot|P20448 Saccharomyces cerevisiae
           YJL033W HCA4 Putative nucleolar DEAD box RNA helicase
           high- copy number suppression of a U14 snoRNA processing
           mutant suggests an involvement in 18S rRNA synthesis
          Length = 771

 Score =  146 bits (369), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 86/232 (37%), Positives = 134/232 (57%), Gaps = 4/232 (1%)

Query: 111 SGQTQAGEEEDDVNEYFSTNNLEKQKHKKGSFPSFGLSKIVLNNIKRKGFRQPTPIQRKT 170
           S + Q  + ED   E   T   E    K   F    LS  VL  +K   + + T IQR +
Sbjct: 10  SQRKQIRKREDQYIEELHTKTQEFNNPKATYFQDLPLSNAVLRGLKDASYVKLTDIQRDS 69

Query: 171 IPLILQSRDIVGMARTGSGKTAAFILPMVEKL--KSHSGKIGARAVILSPSRELAMQTFN 228
           IP+ L+  D++G A+TGSGKT AF++P++EKL  +  +   G  A+I+SP+RELAMQ + 
Sbjct: 70  IPVSLKGNDVLGAAKTGSGKTLAFLIPVLEKLYRERWTEYDGVGALIISPTRELAMQIYE 129

Query: 229 VFKDFARGTELRSVLLTGGDSLEEQFSMMMSNPDVIIATPGRFL-HLKVEMNLDLKSVEY 287
           V           + L+ GG  ++ + +  +S  +++I TPGR L HL   + L++ +++ 
Sbjct: 130 VLIKIGTHCSFSAGLVIGGKDVKFE-AERISKINILIGTPGRLLQHLDQSVGLNIDNLQM 188

Query: 288 VVFDEADRLFEMGFQEQLNELLASLPTTRQTLLFSATLPNSLVDFVKAGLVN 339
           +V DEADR  +MGF++ L+ ++++LP  RQTLLFSAT   SL D  +  L +
Sbjct: 189 LVLDEADRCLDMGFKKTLDAIVSNLPPIRQTLLFSATQSQSLNDLARLSLTD 240

 Score = 67.0 bits (162), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 49/220 (22%), Positives = 91/220 (41%), Gaps = 33/220 (15%)

Query: 439 ILFVPTRHHVEYISQLLRDC--GYLISYIYGTLDQHARKNQLYNFRAGLTSILVVTDVAA 496
           I+F  +   V ++ +  R    G  + +++G   Q AR   L  F       L+ TDV +
Sbjct: 290 IVFFSSSKQVHFVYETFRKLQPGISLMHLHGRQKQRARTETLDKFSRAQQVCLIATDVVS 349

Query: 497 RGVDIPMLANVINYTLPGSSKIFVHRVGRTARAGNKGWAYSIVAXXXXXXXXXXXXXXGK 556
           RG+D P +  V+    P +   ++HRVGR+AR G +G   S++               G+
Sbjct: 350 RGIDFPAVDWVVQVDCPENVDTYIHRVGRSARYGKQG--KSLIMLTPQENEPFLQRLKGR 407

Query: 557 KI-------------LLTPMYDSL---------------VDVMKKRWVEEGNSAYNF-QL 587
           +I              + P   SL               +  ++  ++++ +  + F QL
Sbjct: 408 RIEPNMLNIKQSKKKSIKPQLQSLLFKDPELKYLGQKAFISYVRSIYIQKDHEVFKFDQL 467

Query: 588 PKLSYTKRLVLGSCPRLDVEGLGDLYKNLMTSNFDLQLAK 627
           P   + + L L   P++ + G+G + ++    N   QL K
Sbjct: 468 PTEEFAQSLGLPGAPKIKLRGMGAIERSKDLKNAPRQLLK 507

>NDAI0C02320 Chr3 (527244..529538) [2295 bp, 764 aa] {ON} Anc_5.241
          Length = 764

 Score =  146 bits (369), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 87/243 (35%), Positives = 143/243 (58%), Gaps = 13/243 (5%)

Query: 142 FPSFGLSKIVLNNIKRKGFRQPTPIQRKTIPLILQSRDIVGMARTGSGKTAAFILPMVEK 201
           F    LS   L  +    F + T IQR++IP+ L+  D++G A+TGSGKT AF++P++EK
Sbjct: 43  FKDLPLSPPTLKGLNGAAFLKLTDIQRESIPISLKGYDVLGSAKTGSGKTLAFLIPILEK 102

Query: 202 L--KSHSGKIGARAVILSPSRELAMQTFNVFKDFARGTELRSVLLTGGDSLEEQFSMMMS 259
           L  +  +   G  A+++SP+RELAMQ + V       T L + L+ GG  ++ + S  +S
Sbjct: 103 LYREKWTEFDGLGALVISPTRELAMQIYEVLLKIGTYTSLSAGLVIGGKDVKFE-SERLS 161

Query: 260 NPDVIIATPGRFL-HLKVEMNLDLKSVEYVVFDEADRLFEMGFQEQLNELLASLPTTRQT 318
             +++I TPGR L HL   + L+  +++ +V DEADR  +MGF++ L+ ++++LP +RQT
Sbjct: 162 KINILIGTPGRILQHLDQAIALNTSNLQMLVLDEADRCLDMGFKKTLDAIVSNLPASRQT 221

Query: 319 LLFSATLPN--------SLVDFVKAGLVNPVLVRLDAETKVSENLEMLFLSSKNADREAN 370
           LLFSAT           SL D+   G ++P   + D      + LE  ++ ++ AD+  +
Sbjct: 222 LLFSATQSQSLGDLARLSLTDYKTVGTMDPSKDKTDEGAATPKTLEQSYVETELADK-LD 280

Query: 371 LLY 373
           +LY
Sbjct: 281 ILY 283

 Score = 65.9 bits (159), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 33/97 (34%), Positives = 48/97 (49%), Gaps = 2/97 (2%)

Query: 439 ILFVPTRHHVEYISQLLRDC--GYLISYIYGTLDQHARKNQLYNFRAGLTSILVVTDVAA 496
           I+F+ +   V ++ +  R    G  + +++G   Q AR   L  F       L  TDV A
Sbjct: 295 IVFLSSSKQVHFVYETFRKLQPGISLMHLHGRQKQKARTETLDKFSRAQQVCLFATDVVA 354

Query: 497 RGVDIPMLANVINYTLPGSSKIFVHRVGRTARAGNKG 533
           RG+D P +  VI    P  +  ++HRVGR AR G KG
Sbjct: 355 RGIDFPSVDWVIQVDCPEDADTYIHRVGRAARYGKKG 391

>KLTH0F07106g Chr6 (618637..620214) [1578 bp, 525 aa] {ON} highly
           similar to uniprot|P38712 Saccharomyces cerevisiae
           YHR065C RRP3 Required for maturation of the 35S primary
           transcript of pre-rRNA and is required for cleavages
           leading to mature 18S RNA RRP3 is a DEAD box gene
           homologous to eIF-4a which encodes an RNA-dependent
           ATPase possessing helicase activity which is not
           specific for RNA
          Length = 525

 Score =  143 bits (361), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 80/241 (33%), Positives = 131/241 (54%), Gaps = 4/241 (1%)

Query: 141 SFPSFGLSKIVLNNIKRKGFRQPTPIQRKTIPLILQSRDIVGMARTGSGKTAAFILPMVE 200
           SF    L   ++   +   + +PTPIQ + IP  L+ +DI+G+A+TGSGKTAAF +P++ 
Sbjct: 106 SFSELNLVPELIEACENLKYSKPTPIQAEAIPPALEGKDIIGLAQTGSGKTAAFAIPILN 165

Query: 201 KLKSHSGKIGARAVILSPSRELAMQTFNVFKDFARGTELRSVLLTGGDSLEEQFSMMMSN 260
           +L          A +L+P+RELA Q    F        +R+  + GG ++ +Q   +M  
Sbjct: 166 QLWHDQQPY--YACVLAPTRELAQQIKETFDSLGGAMGVRTTCIVGGMNMIDQARDLMRK 223

Query: 261 PDVIIATPGRFL-HLKVEMNLDLKSVEYVVFDEADRLFEMGFQEQLNELLASLPTT-RQT 318
           P +IIATPGR + HL+      ++ ++++V DEADRL +M F   L+ +L  +PT  R T
Sbjct: 224 PHIIIATPGRLMDHLENTKGFSMRKLKFLVMDEADRLLDMEFGPVLDRILKIIPTQGRTT 283

Query: 319 LLFSATLPNSLVDFVKAGLVNPVLVRLDAETKVSENLEMLFLSSKNADREANLLYILQEV 378
            LFSAT+ + +    +A L NPV   +  + +  + L    +      +   L+Y+L E 
Sbjct: 284 YLFSATMTSKIDKLQRASLTNPVKCAVSTKYQTVDTLIQTLMVVPGGLKNTFLIYLLNEF 343

Query: 379 I 379
           +
Sbjct: 344 L 344

 Score = 96.7 bits (239), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 49/105 (46%), Positives = 68/105 (64%)

Query: 436 KATILFVPTRHHVEYISQLLRDCGYLISYIYGTLDQHARKNQLYNFRAGLTSILVVTDVA 495
           K  I+F  T+ + E I+ L     +  + ++G L+Q+ R   L  F+AG  SILV TDVA
Sbjct: 346 KTAIVFTRTKANAERIATLCNLLEFSATALHGDLNQNQRTGALDLFKAGRRSILVATDVA 405

Query: 496 ARGVDIPMLANVINYTLPGSSKIFVHRVGRTARAGNKGWAYSIVA 540
           ARG+DIP +  VINY +P  SK ++HRVGRTARAG  G + S+V+
Sbjct: 406 ARGLDIPSVDIVINYDIPVDSKSYIHRVGRTARAGRSGKSISLVS 450

>Skud_16.161 Chr16 complement(295968..297827) [1860 bp, 619 aa] {ON}
           YPL119C (REAL)
          Length = 619

 Score =  145 bits (365), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 83/251 (33%), Positives = 138/251 (54%), Gaps = 17/251 (6%)

Query: 142 FPSFGLSKIVLNNIKRKGFRQPTPIQRKTIPLILQSRDIVGMARTGSGKTAAFILPMVEK 201
           F S  L  +++ NIK  GF +PTP+Q+ +IP++ + RD++  A+TGSGKT  F+ P+  +
Sbjct: 156 FNSPPLDALLMENIKLAGFNKPTPVQKYSIPIVTKGRDLMACAQTGSGKTGGFLFPLFTE 215

Query: 202 L----------KSHS---GKIGARAVILSPSRELAMQTFNVFKDFARGTELRSVLLTGGD 248
           L          K+HS    K    A++L+P+RELA Q F   + F   + +R  ++ GG 
Sbjct: 216 LFQIGPSSVPEKAHSFYSRKGYPSALVLAPTRELATQIFEEARKFTYRSWVRPCVVYGGA 275

Query: 249 SLEEQFSMMMSNPDVIIATPGRFLHLKVEMNLDLKSVEYVVFDEADRLFEMGFQEQLNEL 308
            +  Q   +    D+++ATPGR   L     + L + +Y+V DEADR+ +MGF+ Q+  +
Sbjct: 276 PIGNQMREVDRGCDLLVATPGRLNDLLERGKISLANTKYLVLDEADRMLDMGFEPQIRHI 335

Query: 309 L--ASLPTT--RQTLLFSATLPNSLVDFVKAGLVNPVLVRLDAETKVSENLEMLFLSSKN 364
           +    +P+   RQTL+FSAT P  +    +  L N + + +      SEN+    L   +
Sbjct: 336 VEECDMPSVGNRQTLMFSATFPVDIQHLARDFLDNYIFLSVGRVGSTSENITQRILYVDD 395

Query: 365 ADREANLLYIL 375
            D+++ LL +L
Sbjct: 396 MDKKSALLDLL 406

 Score = 83.6 bits (205), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 43/101 (42%), Positives = 60/101 (59%)

Query: 438 TILFVPTRHHVEYISQLLRDCGYLISYIYGTLDQHARKNQLYNFRAGLTSILVVTDVAAR 497
           T++FV T+   + ++  L    +  + I+G   Q  R+  L  F+A +  ILV T VAAR
Sbjct: 414 TLIFVETKRMADQLTDFLIMQNFKATAIHGDRTQAERERALSAFKANIADILVATAVAAR 473

Query: 498 GVDIPMLANVINYTLPGSSKIFVHRVGRTARAGNKGWAYSI 538
           G+DIP + +VINY LP     +VHR+GRT RAGN G A S 
Sbjct: 474 GLDIPNVTHVINYDLPSDIDDYVHRIGRTGRAGNTGVATSF 514

>Skud_4.96 Chr4 complement(166027..167550) [1524 bp, 507 aa] {ON}
           YDL160C (REAL)
          Length = 507

 Score =  143 bits (360), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 75/211 (35%), Positives = 121/211 (57%), Gaps = 2/211 (0%)

Query: 138 KKGSFPSFGLSKIVLNNIKRKGFRQPTPIQRKTIPLILQSRDIVGMARTGSGKTAAFILP 197
           K  +F  F L + +L  I   GF +P+PIQ + IP+ +  RDI+  A+ G+GKTAAF++P
Sbjct: 44  KGNTFEDFYLKRELLMGIFEAGFEKPSPIQEEAIPVAITGRDILARAKNGTGKTAAFVIP 103

Query: 198 MVEKLKSHSGKIGARAVILSPSRELAMQTFNVFKDFARGTELRSVLLTGGDSLEEQFSMM 257
            +E++K    KI  +A+I+ P+RELA+QT  V +   +   +  ++ TGG +L +    +
Sbjct: 104 TLERVKPKLNKI--QALIMVPTRELALQTSQVVRTLGKHCGISCMVTTGGTNLRDDILRL 161

Query: 258 MSNPDVIIATPGRFLHLKVEMNLDLKSVEYVVFDEADRLFEMGFQEQLNELLASLPTTRQ 317
                +++ TPGR L L      DL      + DEAD++    F+  + ++L+ LPTT Q
Sbjct: 162 NETVHILVGTPGRVLDLASRKVADLSDCSLFIMDEADKMLSRDFKTIIEQILSFLPTTHQ 221

Query: 318 TLLFSATLPNSLVDFVKAGLVNPVLVRLDAE 348
           +LLFSAT P ++ +F+   L  P  + L  E
Sbjct: 222 SLLFSATFPLTVKEFMVKHLHKPYEINLMEE 252

 Score = 73.9 bits (180), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 32/101 (31%), Positives = 58/101 (57%)

Query: 439 ILFVPTRHHVEYISQLLRDCGYLISYIYGTLDQHARKNQLYNFRAGLTSILVVTDVAARG 498
           I+F  + + VE +++ + D GY   Y +  + Q  R    + FR G    LV +D+  RG
Sbjct: 287 IIFCNSTNRVELLAKKITDLGYSCYYSHARMKQQERNKVFHEFRQGKVRTLVCSDLLTRG 346

Query: 499 VDIPMLANVINYTLPGSSKIFVHRVGRTARAGNKGWAYSIV 539
           +DI  +  VIN+  P +++ ++HR+GR+ R G+ G A +++
Sbjct: 347 IDIQAVNVVINFDFPKTAETYLHRIGRSGRFGHLGLAINLI 387

>KLLA0A09669g Chr1 complement(847036..848529) [1494 bp, 497 aa] {ON}
           highly similar to uniprot|Q03532 Saccharomyces
           cerevisiae YMR290C HAS1 ATP-dependent RNA helicase
           localizes to both the nuclear periphery and nucleolus
           highly enriched in nuclear pore complex fractions
          Length = 497

 Score =  143 bits (360), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 88/266 (33%), Positives = 150/266 (56%), Gaps = 18/266 (6%)

Query: 117 GEEEDDVNEYFSTNNLEKQKHKKGSFPSFGLSKIVLNNIKRKGFRQPTPIQRKTIPLILQ 176
            E E  V +  +T  +E      GSF    LS   +  I + GF Q T +Q +TIP +L 
Sbjct: 17  AETETVVKDTATTGEVE------GSFSDLKLSDGTMKAIGKMGFTQMTAVQTRTIPPLLA 70

Query: 177 SRDIVGMARTGSGKTAAFILPMVEKLKSHSGKI----GARAVILSPSRELAMQTFNVFKD 232
            +D++G A+TGSGKT AF++P +E L  HS K     G   ++++P+RELA+Q F V ++
Sbjct: 71  GKDVLGAAKTGSGKTLAFLIPAIEML--HSLKFKPRNGTGVIVITPTRELALQIFGVARE 128

Query: 233 FARGTELRSVLLTGGDSLEEQFSMMMSNPDVIIATPGRFL-HLKVEMNLDLKSVEYVVFD 291
                     ++ GG +  ++   +M   +++IATPGR L HL+       K+++ +V D
Sbjct: 129 LMEFHSQTFGIVIGGANRRQEADKLMKGVNILIATPGRLLDHLQNTKGFIFKNLKALVID 188

Query: 292 EADRLFEMGFQEQLNELLASLPTT-RQTLLFSATLPNSLVDFVKAGL-VNPVLVRLDAE- 348
           EADR+ E+GF++++ +++  LP   RQ++LFSAT    + D  +  L   P+ + +D+E 
Sbjct: 189 EADRILEIGFEDEMRQIIKILPNEDRQSMLFSATQTTKVEDLARISLRPGPLFINVDSEK 248

Query: 349 -TKVSENLEMLFLSSKNADREANLLY 373
            T  ++ LE  ++  + +D+   LL+
Sbjct: 249 DTSTADGLEQGYVVCE-SDKRFLLLF 273

 Score = 73.2 bits (178), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 39/105 (37%), Positives = 60/105 (57%), Gaps = 1/105 (0%)

Query: 435 EKATILFVPTRHHVEYISQLLRDCGYLISYIYGTLDQHARKNQLYNFRAGLTSILVVTDV 494
           +K  I+F+ + + V+Y ++LL      +  ++G   Q  R N  + F      ILV TDV
Sbjct: 281 KKKVIVFLSSCNSVKYYAELLNYIDLPVLELHGKQKQQKRTNTFFEFCNAERGILVCTDV 340

Query: 495 AARGVDIPMLANVINYTLPGSSKIFVHRVGRTARAGNKGWAYSIV 539
           AARG+DIP +  +I +  P   + ++HRVGRTAR G KG   S++
Sbjct: 341 AARGLDIPAVDWIIQFDPPDDPRDYIHRVGRTAR-GTKGKGKSLM 384

>TPHA0D04520 Chr4 (985683..987191) [1509 bp, 502 aa] {ON} Anc_7.336
           YDL160C
          Length = 502

 Score =  143 bits (360), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 75/208 (36%), Positives = 120/208 (57%), Gaps = 2/208 (0%)

Query: 138 KKGSFPSFGLSKIVLNNIKRKGFRQPTPIQRKTIPLILQSRDIVGMARTGSGKTAAFILP 197
           K  +F  F L + +L  I   GF +P+PIQ ++IP+ +  RDI+  A+ G+GKTAAF++P
Sbjct: 30  KGNTFEDFYLKRELLMGIFEAGFEKPSPIQEESIPVAIAGRDILARAKNGTGKTAAFVIP 89

Query: 198 MVEKLKSHSGKIGARAVILSPSRELAMQTFNVFKDFARGTELRSVLLTGGDSLEEQFSMM 257
            +EK+KS   KI  +A+I+ P+RELA+QT  V +   +  E+  ++ TGG +L +    +
Sbjct: 90  TLEKVKSKINKI--QALIMVPTRELALQTSQVVRTLGKRCEISCMVTTGGTNLRDDIIRL 147

Query: 258 MSNPDVIIATPGRFLHLKVEMNLDLKSVEYVVFDEADRLFEMGFQEQLNELLASLPTTRQ 317
                +++ TPGR L L      DL      + DEAD++    F+  + ++L  LP   Q
Sbjct: 148 NETVHILVGTPGRVLDLASRGIADLSGCGLFIMDEADKMLSRDFKSIIEQILTFLPEQHQ 207

Query: 318 TLLFSATLPNSLVDFVKAGLVNPVLVRL 345
           +LLFSAT P ++ +F+   L  P  + L
Sbjct: 208 SLLFSATFPLTVKEFMVKHLHKPYEINL 235

 Score = 73.2 bits (178), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 41/150 (27%), Positives = 72/150 (48%), Gaps = 5/150 (3%)

Query: 439 ILFVPTRHHVEYISQLLRDCGYLISYIYGTLDQHARKNQLYNFRAGLTSILVVTDVAARG 498
           I+F  + + VE +++ + D G+   Y +  + Q  R    + FR G    LV +D+  RG
Sbjct: 273 IIFCNSTNRVELLAKKITDLGFSCYYSHARMKQQERNRVFHEFRHGKVRTLVCSDLLTRG 332

Query: 499 VDIPMLANVINYTLPGSSKIFVHRVGRTARAGNKGWAYSIVAXXXXXXXXXXXXXXGKKI 558
           +DI  +  VIN+  P +++ ++HR+GR+ R G+ G A +++               G +I
Sbjct: 333 IDIQAVNVVINFDFPKTAETYLHRIGRSGRFGHLGLAINLINWNDRFNLYKIEQELGTEI 392

Query: 559 LLTPMYDSLVDVMKKRWVEEGNSAYNFQLP 588
              P   + +D  K  +V   NSA     P
Sbjct: 393 AAIP---TTID--KSLYVANDNSAVPVPFP 417

>CAGL0I03476g Chr9 complement(294849..296372) [1524 bp, 507 aa] {ON}
           highly similar to uniprot|P39517 Saccharomyces
           cerevisiae YDL160c DHH1
          Length = 507

 Score =  142 bits (359), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 78/211 (36%), Positives = 118/211 (55%), Gaps = 2/211 (0%)

Query: 138 KKGSFPSFGLSKIVLNNIKRKGFRQPTPIQRKTIPLILQSRDIVGMARTGSGKTAAFILP 197
           K  SF  F L + +L  I   GF +P+PIQ + IP+ +  RDI+  A+ G+GKTAAF++P
Sbjct: 29  KGNSFEDFYLKRELLMGIFEAGFEKPSPIQEEAIPVAITGRDILARAKNGTGKTAAFVIP 88

Query: 198 MVEKLKSHSGKIGARAVILSPSRELAMQTFNVFKDFARGTELRSVLLTGGDSLEEQFSMM 257
            +EK+K    KI  +A+I+ P+RELA+QT  V +   R   +  ++ TGG +L +    +
Sbjct: 89  TLEKIKPKLNKI--QALIMVPTRELALQTSQVIRTLGRHCGVSCMVTTGGTNLRDDILRL 146

Query: 258 MSNPDVIIATPGRFLHLKVEMNLDLKSVEYVVFDEADRLFEMGFQEQLNELLASLPTTRQ 317
                V++ TPGR L L      DL      V DEAD++    F+  + ++L  LP   Q
Sbjct: 147 NETVHVLVGTPGRVLDLASRKVADLSECSLFVMDEADKMLSRDFKTIIEQVLTFLPKAHQ 206

Query: 318 TLLFSATLPNSLVDFVKAGLVNPVLVRLDAE 348
           +LLFSAT P ++ +F+   L  P  + L  E
Sbjct: 207 SLLFSATFPLTVKEFMVKHLHKPYEINLMEE 237

 Score = 74.3 bits (181), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 41/150 (27%), Positives = 75/150 (50%), Gaps = 5/150 (3%)

Query: 439 ILFVPTRHHVEYISQLLRDCGYLISYIYGTLDQHARKNQLYNFRAGLTSILVVTDVAARG 498
           I+F  + + VE +++ + D GY   Y +  + Q  R    ++FR G    LV +D+  RG
Sbjct: 272 IIFCNSTNRVELLAKKITDLGYSCYYSHARMKQQDRNKVFHDFRQGKVRTLVCSDLLTRG 331

Query: 499 VDIPMLANVINYTLPGSSKIFVHRVGRTARAGNKGWAYSIVAXXXXXXXXXXXXXXGKKI 558
           +DI  +  VIN+  P +++ ++HR+GR+ R G+ G A +++               G +I
Sbjct: 332 IDIQAVNVVINFDFPKTAETYLHRIGRSGRFGHLGLAINLINWNDRFNLYKIEQELGTEI 391

Query: 559 LLTPMYDSLVDVMKKRWVEEGNSAYNFQLP 588
              P   + +D  K  +V E ++A    +P
Sbjct: 392 AAIP---ATID--KSLYVAEDDTAVPVPVP 416

>TPHA0G02050 Chr7 (420332..421648) [1317 bp, 438 aa] {ON} Anc_2.384
           YDL084W
          Length = 438

 Score =  141 bits (355), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 118/455 (25%), Positives = 205/455 (45%), Gaps = 74/455 (16%)

Query: 100 ILELSDDENNISGQTQAGEEEDDVNEYFSTNNLEKQKHKKGS--------FPSFGLSKIV 151
           +LE SD+E +I  Q  A +  ++     +   +E +  KKGS        F  F L   +
Sbjct: 9   LLEYSDNEQDI--QVVADKAAENTETATADEGVEGED-KKGSYVGIHSTGFKDFLLKPEL 65

Query: 152 LNNIKRKGFRQPTPIQRKTIPLILQSRDIVGMARTGSGKTAAFILPMVEKLKSHSGKIGA 211
              I   GF  P+ +Q+ TIP  +   D++  A++G GKTA F+L  +++L    G++  
Sbjct: 66  SRAIIDCGFEHPSEVQQHTIPQSIHGTDVLCQAKSGLGKTAVFVLSTLQQLDPVPGEVS- 124

Query: 212 RAVILSPSRELAMQTFNVFKDFARGT-ELRSVLLTGGDSLEEQFSMMM---SNPDVIIAT 267
             V++  +RELA Q  N +  F++   E+++ +  GG  ++    ++    + P +I+AT
Sbjct: 125 -VVVICNARELAYQIRNEYLRFSKYMPEVKTAVFYGGTPIKNDADLLKNKETAPQIIVAT 183

Query: 268 PGRFLHLKVEMNLDLKSVEYVVFDEADRLF-EMGFQEQLNELLASLPTTRQTLLFSATLP 326
           PGR   L  +  +DL  V+  V DE D++  E+  +  + ++  + P  +Q ++FSATL 
Sbjct: 184 PGRLKALVRDKLIDLSHVKNFVIDECDKVLEELDMRRDVQDIFRATPRDKQVMMFSATLS 243

Query: 327 NSLVDFVKAGLVNPVLVRLDAETKVS-ENLEMLFLSSKNADREANLLYILQEVIRIPLAT 385
             +    +  L NP+ + +D E K++   L+  ++  +  ++   L  +L ++       
Sbjct: 244 EDIRPICRRFLQNPLEIFVDDEAKLTLHGLQQYYIKIEEREKNRKLAQLLDDL------E 297

Query: 386 SEQLLKLQKSTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMPAANELPSEKATILFVPTR 445
             Q++   KST                                ANEL             
Sbjct: 298 FNQVIIFVKSTKR------------------------------ANEL------------- 314

Query: 446 HHVEYISQLLRDCGYLISYIYGTLDQHARKNQLYNFRAGLTSILVVTDVAARGVDIPMLA 505
                 ++LL D  +    ++G + Q  R  +   F+     I V TDV  RG+DI  + 
Sbjct: 315 ------TKLLNDSNFPAITVHGHMKQAERIARYKAFKDFEKRICVSTDVFGRGIDIERIN 368

Query: 506 NVINYTLPGSSKIFVHRVGRTARAGNKGWAYSIVA 540
             INY L   +  ++HRVGR  R G KG A S V+
Sbjct: 369 LAINYDLTTEADQYLHRVGRAGRFGTKGLAVSFVS 403

>NCAS0A01400 Chr1 (274080..276368) [2289 bp, 762 aa] {ON} Anc_5.241
          Length = 762

 Score =  145 bits (367), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 90/260 (34%), Positives = 142/260 (54%), Gaps = 17/260 (6%)

Query: 124 NEYFS-----TNNLEKQKHKKGSFPSFGLSKIVLNNIKRKGFRQPTPIQRKTIPLILQSR 178
           NEY         N + +  K   F    +S   L  +    F + T IQR++IP+ L+  
Sbjct: 20  NEYIEDLNNKIENYDPKTAKTTFFKDLPISNATLKGLSEAAFLKLTDIQRESIPVSLKGY 79

Query: 179 DIVGMARTGSGKTAAFILPMVEKL--KSHSGKIGARAVILSPSRELAMQTFNVFKDFARG 236
           D++G A+TGSGKT AF++P++EKL  +  +   G  A+I+SP+RELAMQ + V       
Sbjct: 80  DVLGSAKTGSGKTLAFLIPVLEKLYRERWTEFDGLGALIISPTRELAMQIYEVLIKIGSH 139

Query: 237 TELRSVLLTGGDSLEEQFSMMMSNPDVIIATPGRFL-HLKVEMNLDLKSVEYVVFDEADR 295
           T   + L+ GG  ++ +   + S  +++I TPGR L HL   + L+  +++ +V DEADR
Sbjct: 140 TSFSAGLVIGGKDVKFELERI-SRINILIGTPGRILQHLDQAVGLNTSNLQMLVLDEADR 198

Query: 296 LFEMGFQEQLNELLASLPTTRQTLLFSATLPNSLVDFVKAGLVNPVLV--------RLDA 347
             +MGF++ L+ ++ +LP +RQTLLFSAT   SL D  +  L +   V        + DA
Sbjct: 199 CLDMGFKKTLDAIVGNLPPSRQTLLFSATQSQSLADLARLSLTDYKSVGTMDKANEKSDA 258

Query: 348 ETKVSENLEMLFLSSKNADR 367
           E      LE  ++  + AD+
Sbjct: 259 EAATPATLEQSYIEVELADK 278

 Score = 66.6 bits (161), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 33/97 (34%), Positives = 49/97 (50%), Gaps = 2/97 (2%)

Query: 439 ILFVPTRHHVEYISQLLRDC--GYLISYIYGTLDQHARKNQLYNFRAGLTSILVVTDVAA 496
           I+F+ +   V ++ +  R    G  + +++G   Q AR   L  F       L  TDV A
Sbjct: 295 IVFLSSSKQVHFVYETFRKLQPGISLMHLHGRQKQKARTETLDKFSRAQQVCLFATDVVA 354

Query: 497 RGVDIPMLANVINYTLPGSSKIFVHRVGRTARAGNKG 533
           RG+D P +  VI    P  +  ++HRVGR+AR G KG
Sbjct: 355 RGIDFPSVDWVIQLDCPEDADTYIHRVGRSARYGKKG 391

>Skud_4.171 Chr4 (300716..302056) [1341 bp, 446 aa] {ON} YDL084W
           (REAL)
          Length = 446

 Score =  141 bits (355), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 120/464 (25%), Positives = 203/464 (43%), Gaps = 84/464 (18%)

Query: 100 ILELSDDENNIS---------GQTQAGEEEDDVNEYFSTNNLEKQKHKKGS--------F 142
           +LE SD+E  I          G+T A     D ++    NN      KKGS        F
Sbjct: 9   LLEYSDNEQEIQIDASKAVEVGETGAAASATDGDD----NNNTAAGDKKGSYVGIHSTGF 64

Query: 143 PSFGLSKIVLNNIKRKGFRQPTPIQRKTIPLILQSRDIVGMARTGSGKTAAFILPMVEKL 202
             F L   +   I   GF  P+ +Q+ TIP  +   D++  A++G GKTA F+L  +++L
Sbjct: 65  KDFLLKPELSRAIIDCGFEHPSEVQQHTIPQSIHGTDVLCQAKSGLGKTAVFVLSTLQQL 124

Query: 203 KSHSGKIGARAVILSPSRELAMQTFNVFKDFARGT-ELRSVLLTGGDSLEEQFSMMM--- 258
               G++    V++  +RELA Q  N +  F++   ++++ +  GG  + +   ++    
Sbjct: 125 DPVPGEVA--VVVICNARELAYQIRNEYLRFSKYMPDVKTAVFYGGTPISKDAELLKNKD 182

Query: 259 SNPDVIIATPGRFLHLKVEMNLDLKSVEYVVFDEADRLF-EMGFQEQLNELLASLPTTRQ 317
           + P +++ATPGR   L  E  +DL  V+  V DE D++  E+  +  + E+  + P  +Q
Sbjct: 183 TAPHIVVATPGRLKALVREKYIDLSHVKNFVIDECDKVLEELDMRRDVQEIFRATPRDKQ 242

Query: 318 TLLFSATLPNSLVDFVKAGLVNPVLVRLDAETKVS-ENLEMLFLSSKNADREANLLYILQ 376
            ++FSATL   +    +  L NP+ + +D E K++   L+  ++  +  ++   L  +L 
Sbjct: 243 VMMFSATLSQEIRPICRRFLQNPLEIFVDDEAKLTLHGLQQYYIKLEEREKNRKLAQLLD 302

Query: 377 EVIRIPLATSEQLLKLQKSTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMPAANELPSEK 436
           ++         Q++   KST                                ANEL    
Sbjct: 303 DL------EFNQVIIFVKSTTR------------------------------ANEL---- 322

Query: 437 ATILFVPTRHHVEYISQLLRDCGYLISYIYGTLDQHARKNQLYNFRAGLTSILVVTDVAA 496
                          ++LL    +    ++G + Q  R  +   F+     I V TDV  
Sbjct: 323 ---------------TKLLNASNFPAITVHGHMKQEERIARYKAFKDFEKRICVSTDVFG 367

Query: 497 RGVDIPMLANVINYTLPGSSKIFVHRVGRTARAGNKGWAYSIVA 540
           RG+DI  +   INY L   +  ++HRVGR  R G KG A S V+
Sbjct: 368 RGIDIERINLAINYDLTNEADQYLHRVGRAGRFGTKGLAISFVS 411

>YOR204W Chr15 (722911..724725) [1815 bp, 604 aa] {ON}
           DED1ATP-dependent DEAD (Asp-Glu-Ala-Asp)-box RNA
           helicase, required for translation initiation of all
           yeast mRNAs; mutations in human DEAD-box DBY are a
           frequent cause of male infertility
          Length = 604

 Score =  144 bits (362), Expect = 5e-35,   Method: Compositional matrix adjust.
 Identities = 82/251 (32%), Positives = 137/251 (54%), Gaps = 17/251 (6%)

Query: 142 FPSFGLSKIVLNNIKRKGFRQPTPIQRKTIPLILQSRDIVGMARTGSGKTAAFILPMV-E 200
           F S  L  ++L NIK   F +PTP+Q+ ++P++   RD++  A+TGSGKT  F+ P++ E
Sbjct: 144 FTSPPLDGLLLENIKLARFTKPTPVQKYSVPIVANGRDLMACAQTGSGKTGGFLFPVLSE 203

Query: 201 KLKS------------HSGKIGARAVILSPSRELAMQTFNVFKDFARGTELRSVLLTGGD 248
             K+            +  K    AVI++P+RELA Q F+  K F   + +++ ++ GG 
Sbjct: 204 SFKTGPSPQPESQGSFYQRKAYPTAVIMAPTRELATQIFDEAKKFTYRSWVKACVVYGGS 263

Query: 249 SLEEQFSMMMSNPDVIIATPGRFLHLKVEMNLDLKSVEYVVFDEADRLFEMGFQEQLNEL 308
            +  Q   +    D+++ATPGR   L     + L +V+Y+V DEADR+ +MGF+ Q+  +
Sbjct: 264 PIGNQLREIERGCDLLVATPGRLNDLLERGKISLANVKYLVLDEADRMLDMGFEPQIRHI 323

Query: 309 LASLPTT----RQTLLFSATLPNSLVDFVKAGLVNPVLVRLDAETKVSENLEMLFLSSKN 364
           +     T    RQTL+FSAT P  +    +  L + + + +      SEN+    L  +N
Sbjct: 324 VEDCDMTPVGERQTLMFSATFPADIQHLARDFLSDYIFLSVGRVGSTSENITQKVLYVEN 383

Query: 365 ADREANLLYIL 375
            D+++ LL +L
Sbjct: 384 QDKKSALLDLL 394

 Score = 85.9 bits (211), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 42/102 (41%), Positives = 62/102 (60%)

Query: 434 SEKATILFVPTRHHVEYISQLLRDCGYLISYIYGTLDQHARKNQLYNFRAGLTSILVVTD 493
           ++  T++FV T+   + ++  L    +  + I+G   Q  R+  L  FR+G  ++LV T 
Sbjct: 398 TDGLTLIFVETKRMADQLTDFLIMQNFRATAIHGDRTQSERERALAAFRSGAATLLVATA 457

Query: 494 VAARGVDIPMLANVINYTLPGSSKIFVHRVGRTARAGNKGWA 535
           VAARG+DIP + +VINY LP     +VHR+GRT RAGN G A
Sbjct: 458 VAARGLDIPNVTHVINYDLPSDVDDYVHRIGRTGRAGNTGLA 499

>KNAG0C03820 Chr3 complement(748934..750475) [1542 bp, 513 aa] {ON}
           Anc_7.336 YDL160C
          Length = 513

 Score =  142 bits (358), Expect = 5e-35,   Method: Compositional matrix adjust.
 Identities = 77/213 (36%), Positives = 121/213 (56%), Gaps = 2/213 (0%)

Query: 136 KHKKGSFPSFGLSKIVLNNIKRKGFRQPTPIQRKTIPLILQSRDIVGMARTGSGKTAAFI 195
           K K  +F  F L + +L  I   GF +P+PIQ + IP+ +  RDI+  A+ G+GKTAAF+
Sbjct: 30  KTKGNTFEDFYLKRELLMGIFEAGFEKPSPIQEEAIPVAITGRDILARAKNGTGKTAAFV 89

Query: 196 LPMVEKLKSHSGKIGARAVILSPSRELAMQTFNVFKDFARGTELRSVLLTGGDSLEEQFS 255
           +P +EK+K    KI  +A+I+ P+RELA+QT  V +   +   +  ++ TGG +L +   
Sbjct: 90  IPTLEKVKPKLNKI--QALIMVPTRELALQTSQVVRSLGKHCGVSCMVTTGGTNLRDDIL 147

Query: 256 MMMSNPDVIIATPGRFLHLKVEMNLDLKSVEYVVFDEADRLFEMGFQEQLNELLASLPTT 315
            +     +++ TPGR L L      DL      V DEAD++    F+  + ++LA LP  
Sbjct: 148 RLNDTIHILVGTPGRVLDLASRKIADLSECGLFVMDEADKMLSRDFKTIIEQILAFLPKN 207

Query: 316 RQTLLFSATLPNSLVDFVKAGLVNPVLVRLDAE 348
            Q+LLFSAT P ++ +F++  L  P  + L  E
Sbjct: 208 HQSLLFSATFPLTVKEFMEKHLNKPYEINLMEE 240

 Score = 74.3 bits (181), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 32/101 (31%), Positives = 58/101 (57%)

Query: 439 ILFVPTRHHVEYISQLLRDCGYLISYIYGTLDQHARKNQLYNFRAGLTSILVVTDVAARG 498
           I+F  + + VE +++ + D GY   Y +  + Q  R    + FR G    LV +D+  RG
Sbjct: 275 IIFCNSTNRVELLAKKITDLGYSCYYSHARMKQQERNRVFHEFRQGKVRTLVCSDLLTRG 334

Query: 499 VDIPMLANVINYTLPGSSKIFVHRVGRTARAGNKGWAYSIV 539
           +DI  +  VIN+  P +++ ++HR+GR+ R G+ G A +++
Sbjct: 335 IDIQAVNVVINFDFPKTAETYLHRIGRSGRFGHLGLAINLI 375

>Smik_15.390 Chr15 (672576..674405) [1830 bp, 609 aa] {ON} YOR204W
           (REAL)
          Length = 609

 Score =  144 bits (362), Expect = 5e-35,   Method: Compositional matrix adjust.
 Identities = 82/251 (32%), Positives = 138/251 (54%), Gaps = 17/251 (6%)

Query: 142 FPSFGLSKIVLNNIKRKGFRQPTPIQRKTIPLILQSRDIVGMARTGSGKTAAFILPMV-E 200
           F S  L +++L NIK   F +PTP+Q+ ++P++   RD++  A+TGSGKT  F+ P++ E
Sbjct: 148 FTSPPLDELLLENIKLARFTKPTPVQKYSVPIVANGRDLMACAQTGSGKTGGFLFPVLSE 207

Query: 201 KLKS------------HSGKIGARAVILSPSRELAMQTFNVFKDFARGTELRSVLLTGGD 248
             K+            +  K    AVI++P+RELA Q F+  K F   + +++ ++ GG 
Sbjct: 208 SFKTGPSPQPESQGSFYQRKAYPTAVIMAPTRELATQIFDEAKKFTYRSWVKACVVYGGS 267

Query: 249 SLEEQFSMMMSNPDVIIATPGRFLHLKVEMNLDLKSVEYVVFDEADRLFEMGFQEQLNEL 308
            +  Q   +    D+++ATPGR   L     + L +V+Y+V DEADR+ +MGF+ Q+  +
Sbjct: 268 PIGNQLREIERGCDLLVATPGRLNDLLERGKISLVNVKYLVLDEADRMLDMGFEPQIRHI 327

Query: 309 LASLPTT----RQTLLFSATLPNSLVDFVKAGLVNPVLVRLDAETKVSENLEMLFLSSKN 364
           +     T    RQTL+FSAT P  +    +  L + + + +      SEN+    L  +N
Sbjct: 328 VEDCDMTPVGDRQTLMFSATFPADIQHLARDFLSDYIFLSVGRVGSTSENITQKVLYVEN 387

Query: 365 ADREANLLYIL 375
            D+++ LL +L
Sbjct: 388 QDKKSALLDLL 398

 Score = 87.0 bits (214), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 43/102 (42%), Positives = 62/102 (60%)

Query: 434 SEKATILFVPTRHHVEYISQLLRDCGYLISYIYGTLDQHARKNQLYNFRAGLTSILVVTD 493
           ++  T++FV T+   + ++  L    +  + I+G   Q  R+  L  FR+G  S+LV T 
Sbjct: 402 TDGLTLIFVETKRMADQLTDFLIMQNFRATAIHGDRTQSERERALAAFRSGAASLLVATA 461

Query: 494 VAARGVDIPMLANVINYTLPGSSKIFVHRVGRTARAGNKGWA 535
           VAARG+DIP + +VINY LP     +VHR+GRT RAGN G A
Sbjct: 462 VAARGLDIPNVTHVINYDLPSDVDDYVHRIGRTGRAGNTGLA 503

>SAKL0H08162g Chr8 complement(702292..704166) [1875 bp, 624 aa] {ON}
           similar to uniprot|P06634 Saccharomyces cerevisiae
           YOR204W DED1 ATP-dependent DEAD (Asp-Glu-Ala-Asp)-box
           RNA helicase required for translation initiation of all
           yeast mRNAs mutations in human DEAD-box DBY are a
           frequent cause of male infertility
          Length = 624

 Score =  144 bits (362), Expect = 6e-35,   Method: Compositional matrix adjust.
 Identities = 87/272 (31%), Positives = 150/272 (55%), Gaps = 20/272 (7%)

Query: 121 DDVNEYFSTNNLEKQKHKKGSFPSFGLSKIVLNNIKRKGFRQPTPIQRKTIPLILQSRDI 180
           DD+    S NN+ +   +  S P   L++++L+NIK   F +PTP+Q+ ++P++   RD+
Sbjct: 135 DDIPVEASGNNVPEPIVEFTSPP---LNELLLDNIKSARFTKPTPVQKYSVPIVAAGRDL 191

Query: 181 VGMARTGSGKTAAFILPMV------------EKLKS-HSGKIGARAVILSPSRELAMQTF 227
           +  A+TGSGKT  F+ P++            E+  S +  K    AV+L+P+RELA Q F
Sbjct: 192 MACAQTGSGKTGGFLFPVLSESFNNGPAPVPEQASSFYIRKAYPTAVVLAPTRELATQIF 251

Query: 228 NVFKDFARGTELRSVLLTGGDSLEEQFSMMMSNPDVIIATPGRFLHLKVEMNLDLKSVEY 287
           +  K F   + ++  ++ GG  +  Q   +    D+++ATPGR   L     + L +V+Y
Sbjct: 252 DEAKKFTYRSWVKPCVVYGGADIRSQIRELERGCDLLVATPGRLNDLLERGKISLCNVKY 311

Query: 288 VVFDEADRLFEMGFQEQLNELL--ASLPTT--RQTLLFSATLPNSLVDFVKAGLVNPVLV 343
           +V DEADR+ +MGF+ Q+  ++    +P+   RQTL+FSAT P  +    +  L + + +
Sbjct: 312 LVLDEADRMLDMGFEPQIRHIVQDCDMPSAENRQTLMFSATFPMDIQHLARDFLEDYIFL 371

Query: 344 RLDAETKVSENLEMLFLSSKNADREANLLYIL 375
            +      SEN+    L  ++AD+ + LL +L
Sbjct: 372 SVGRVGSTSENITQKVLYVEDADKRSALLDLL 403

 Score = 81.3 bits (199), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 42/98 (42%), Positives = 59/98 (60%)

Query: 438 TILFVPTRHHVEYISQLLRDCGYLISYIYGTLDQHARKNQLYNFRAGLTSILVVTDVAAR 497
           T++FV T+   + ++  L       + I+G   Q  R+  L  FR+G  ++LV T VAAR
Sbjct: 411 TLIFVETKRMADALTDFLIMQELKATAIHGDRSQPERERALAAFRSGRANLLVATAVAAR 470

Query: 498 GVDIPMLANVINYTLPGSSKIFVHRVGRTARAGNKGWA 535
           G+DIP + +VINY LP     +VHR+GRT RAGN G A
Sbjct: 471 GLDIPNVTHVINYDLPSDIDDYVHRIGRTGRAGNTGVA 508

>TDEL0E03850 Chr5 complement(723551..725836) [2286 bp, 761 aa] {ON}
           Anc_5.241 YJL033W
          Length = 761

 Score =  145 bits (365), Expect = 6e-35,   Method: Compositional matrix adjust.
 Identities = 87/262 (33%), Positives = 150/262 (57%), Gaps = 15/262 (5%)

Query: 142 FPSFGLSKIVLNNIKRKGFRQPTPIQRKTIPLILQSRDIVGMARTGSGKTAAFILPMVEK 201
           F    +S   L  +K   F + T IQR++IP+ L+  D++G A+TGSGKT AF++P++EK
Sbjct: 43  FRDLPISDATLKGLKEAAFVKLTEIQRESIPVSLKGHDLLGAAKTGSGKTLAFLIPVLEK 102

Query: 202 L--KSHSGKIGARAVILSPSRELAMQTFNVFKDFARGTELRSVLLTGGDSLEEQFSMMMS 259
           L  +  +   G  A+I+SP+RELAMQ + V       T   + L+ GG  ++ +   + S
Sbjct: 103 LYREKWTEFDGLGALIISPTRELAMQIYEVLTKIGGHTSFSAGLVIGGKDVKFELERI-S 161

Query: 260 NPDVIIATPGRFL-HLKVEMNLDLKSVEYVVFDEADRLFEMGFQEQLNELLASLPTTRQT 318
             ++++ TPGR L H+   + L+  +++ +V DEADR  +MGF++ L+ ++++LP +RQT
Sbjct: 162 RINILVGTPGRILQHMDQAVGLNADNLQMLVLDEADRCLDMGFKKTLDAIVSNLPPSRQT 221

Query: 319 LLFSATLPNSLVDFVKAGLVNPVLVRL-------DAETKVSENLEMLFLSSKNADREANL 371
           LLFSAT   SL D  +  L +   V         D+E    E L+  ++  + AD+   L
Sbjct: 222 LLFSATQSQSLADLARLSLTDYKSVGTADTVNGGDSEVSTPETLQQSYIVVELADKLDTL 281

Query: 372 LYILQEVIR----IPLATSEQL 389
              ++  ++    + L++S+Q+
Sbjct: 282 FSFIKTHLKSKMIVFLSSSKQV 303

 Score = 65.1 bits (157), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 31/97 (31%), Positives = 49/97 (50%), Gaps = 2/97 (2%)

Query: 439 ILFVPTRHHVEYISQLLRDC--GYLISYIYGTLDQHARKNQLYNFRAGLTSILVVTDVAA 496
           I+F+ +   V ++ +  R    G  + +++G   Q AR   L  F       L+ TDV A
Sbjct: 294 IVFLSSSKQVHFVYETFRKMQPGISLMHLHGRQKQTARTETLDKFSRAQQVCLIATDVVA 353

Query: 497 RGVDIPMLANVINYTLPGSSKIFVHRVGRTARAGNKG 533
           RG+D P +  V+    P     ++HRVGR+AR G +G
Sbjct: 354 RGIDFPAVDWVVQVDCPEDVDTYIHRVGRSARYGKQG 390

>TDEL0C02100 Chr3 complement(362760..364199) [1440 bp, 479 aa] {ON}
           Anc_7.336 YDL160C
          Length = 479

 Score =  141 bits (356), Expect = 7e-35,   Method: Compositional matrix adjust.
 Identities = 75/211 (35%), Positives = 121/211 (57%), Gaps = 2/211 (0%)

Query: 138 KKGSFPSFGLSKIVLNNIKRKGFRQPTPIQRKTIPLILQSRDIVGMARTGSGKTAAFILP 197
           K  SF  F L + +L  I   GF +P+PIQ ++IP+ +  RDI+  A+ G+GKTAAF++P
Sbjct: 29  KGNSFEDFYLKRELLMGIFEAGFEKPSPIQEESIPVAIAGRDILARAKNGTGKTAAFVIP 88

Query: 198 MVEKLKSHSGKIGARAVILSPSRELAMQTFNVFKDFARGTELRSVLLTGGDSLEEQFSMM 257
            +EK+K    KI  +A+I+ P+RELA+QT  V +   +   +  ++ TGG +L++    +
Sbjct: 89  ALEKVKPKLNKI--QALIMVPTRELALQTSQVVRTLGKHCGVSCMVTTGGTNLKDDIMRL 146

Query: 258 MSNPDVIIATPGRFLHLKVEMNLDLKSVEYVVFDEADRLFEMGFQEQLNELLASLPTTRQ 317
                +++ TPGR L L      DL      + DEAD++    F+  + ++L  LP + Q
Sbjct: 147 NETVHILVGTPGRVLDLASRKLADLSECSLFIMDEADKMLSRDFKTIIEQILIFLPQSHQ 206

Query: 318 TLLFSATLPNSLVDFVKAGLVNPVLVRLDAE 348
           +LLFSAT P ++ +F+   L  P  + L  E
Sbjct: 207 SLLFSATFPLTVKEFMVKHLHKPYEINLMEE 237

 Score = 73.2 bits (178), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 32/101 (31%), Positives = 58/101 (57%)

Query: 439 ILFVPTRHHVEYISQLLRDCGYLISYIYGTLDQHARKNQLYNFRAGLTSILVVTDVAARG 498
           I+F  + + VE +++ + D GY   Y +  + Q  R    + FR G    LV +D+  RG
Sbjct: 272 IIFCNSTNRVELLAKKITDLGYSCYYSHARMRQQERNRVFHEFRQGKVRTLVCSDLLTRG 331

Query: 499 VDIPMLANVINYTLPGSSKIFVHRVGRTARAGNKGWAYSIV 539
           +DI  +  VIN+  P +++ ++HR+GR+ R G+ G A +++
Sbjct: 332 IDIQAVNVVINFDFPKTAETYLHRIGRSGRFGHLGLAINLI 372

>YDL160C Chr4 complement(170410..171930) [1521 bp, 506 aa] {ON}
           DHH1Cytoplasmic DExD/H-box helicase, stimulates mRNA
           decapping; coordinates distinct steps in mRNA function
           and decay, interacts with both the decapping and
           deadenylase complexes, may have a role in mRNA export
           and translation; C-terminus of Dhh1p interacts with
           Ngr1p and promotes POR1, but not EDC1 mRNA decay
          Length = 506

 Score =  142 bits (357), Expect = 7e-35,   Method: Compositional matrix adjust.
 Identities = 75/211 (35%), Positives = 120/211 (56%), Gaps = 2/211 (0%)

Query: 138 KKGSFPSFGLSKIVLNNIKRKGFRQPTPIQRKTIPLILQSRDIVGMARTGSGKTAAFILP 197
           K  +F  F L + +L  I   GF +P+PIQ + IP+ +  RDI+  A+ G+GKTAAF++P
Sbjct: 44  KGNTFEDFYLKRELLMGIFEAGFEKPSPIQEEAIPVAITGRDILARAKNGTGKTAAFVIP 103

Query: 198 MVEKLKSHSGKIGARAVILSPSRELAMQTFNVFKDFARGTELRSVLLTGGDSLEEQFSMM 257
            +EK+K    KI  +A+I+ P+RELA+QT  V +   +   +  ++ TGG +L +    +
Sbjct: 104 TLEKVKPKLNKI--QALIMVPTRELALQTSQVVRTLGKHCGISCMVTTGGTNLRDDILRL 161

Query: 258 MSNPDVIIATPGRFLHLKVEMNLDLKSVEYVVFDEADRLFEMGFQEQLNELLASLPTTRQ 317
                +++ TPGR L L      DL      + DEAD++    F+  + ++L+ LP T Q
Sbjct: 162 NETVHILVGTPGRVLDLASRKVADLSDCSLFIMDEADKMLSRDFKTIIEQILSFLPPTHQ 221

Query: 318 TLLFSATLPNSLVDFVKAGLVNPVLVRLDAE 348
           +LLFSAT P ++ +F+   L  P  + L  E
Sbjct: 222 SLLFSATFPLTVKEFMVKHLHKPYEINLMEE 252

 Score = 73.6 bits (179), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 32/101 (31%), Positives = 58/101 (57%)

Query: 439 ILFVPTRHHVEYISQLLRDCGYLISYIYGTLDQHARKNQLYNFRAGLTSILVVTDVAARG 498
           I+F  + + VE +++ + D GY   Y +  + Q  R    + FR G    LV +D+  RG
Sbjct: 287 IIFCNSTNRVELLAKKITDLGYSCYYSHARMKQQERNKVFHEFRQGKVRTLVCSDLLTRG 346

Query: 499 VDIPMLANVINYTLPGSSKIFVHRVGRTARAGNKGWAYSIV 539
           +DI  +  VIN+  P +++ ++HR+GR+ R G+ G A +++
Sbjct: 347 IDIQAVNVVINFDFPKTAETYLHRIGRSGRFGHLGLAINLI 387

>KAFR0B01520 Chr2 (286962..288452) [1491 bp, 496 aa] {ON} Anc_5.40
           YMR290C
          Length = 496

 Score =  141 bits (356), Expect = 8e-35,   Method: Compositional matrix adjust.
 Identities = 90/277 (32%), Positives = 151/277 (54%), Gaps = 27/277 (9%)

Query: 106 DENNISGQTQAGEEEDDVNEYFSTNNLEKQKHKKGSFPSFGLSKIVLNNIKRKGFRQPTP 165
           DE+ I  Q      E DV E F   NL               S+  L  I + GF + TP
Sbjct: 15  DESTIQKQIVTDSTESDVVETFKELNL---------------SQPTLKAIDKMGFTKMTP 59

Query: 166 IQRKTIPLILQSRDIVGMARTGSGKTAAFILPMVEKLKSHSGKI----GARAVILSPSRE 221
           +Q +TIP ++  RD++G A+TGSGKT AF+LP +E L  HS K     G   ++++P+RE
Sbjct: 60  VQARTIPPLMAGRDVLGAAKTGSGKTLAFLLPAIEML--HSLKFKPRNGTGVIVITPTRE 117

Query: 222 LAMQTFNVFKDFARGTELRSVLLTGGDSLEEQFSMMMSNPDVIIATPGRFL-HLKVEMNL 280
           LA+Q F V ++          ++ GG +  ++   +M   +++IATPGR L HL+     
Sbjct: 118 LALQIFGVVRELMEFHSQTFGIVIGGANRRQEAEKLMKGVNILIATPGRLLDHLQNTKGF 177

Query: 281 DLKSVEYVVFDEADRLFEMGFQEQLNELLASLPTT-RQTLLFSATLPNSLVDFVKAGL-V 338
             K+++ +V DEADR+ E+GF++++ +++  LP   RQ++LFSAT    + D  +  L  
Sbjct: 178 VFKNLKALVIDEADRILEIGFEDEMRQIIKILPNEDRQSMLFSATQTTKVEDLARISLRK 237

Query: 339 NPVLVRLDAE--TKVSENLEMLFLSSKNADREANLLY 373
            P+ + + +E  +  ++ LE  ++  + +D+   LL+
Sbjct: 238 GPLFINVVSEKDSSTADGLEQGYVVCE-SDKRFLLLF 273

 Score = 72.4 bits (176), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 39/105 (37%), Positives = 60/105 (57%), Gaps = 1/105 (0%)

Query: 435 EKATILFVPTRHHVEYISQLLRDCGYLISYIYGTLDQHARKNQLYNFRAGLTSILVVTDV 494
           +K  I+F+ + + V+Y ++LL      +  ++G   Q  R N  + F      ILV TDV
Sbjct: 281 KKKIIVFLSSCNSVKYHAELLNYIDLPVLELHGKQKQQKRTNTFFEFCNAERGILVCTDV 340

Query: 495 AARGVDIPMLANVINYTLPGSSKIFVHRVGRTARAGNKGWAYSIV 539
           AARG+DIP +  +I +  P   + ++HRVGRTAR G KG   S++
Sbjct: 341 AARGLDIPAVDWIIQFDPPDDPRDYIHRVGRTAR-GTKGKGKSLM 384

>Suva_4.86 Chr4 complement(158173..159699) [1527 bp, 508 aa] {ON}
           YDL160C (REAL)
          Length = 508

 Score =  142 bits (357), Expect = 8e-35,   Method: Compositional matrix adjust.
 Identities = 76/211 (36%), Positives = 120/211 (56%), Gaps = 2/211 (0%)

Query: 138 KKGSFPSFGLSKIVLNNIKRKGFRQPTPIQRKTIPLILQSRDIVGMARTGSGKTAAFILP 197
           K  +F  F L + +L  I   GF +P+PIQ + IP+ +  RDI+  A+ G+GKTAAF++P
Sbjct: 44  KGNTFEDFYLKRELLMGIFEAGFEKPSPIQEEAIPVAITGRDILARAKNGTGKTAAFVIP 103

Query: 198 MVEKLKSHSGKIGARAVILSPSRELAMQTFNVFKDFARGTELRSVLLTGGDSLEEQFSMM 257
            +EK+K    KI  +A+I+ P+RELA+QT  V +   +   +  ++ TGG +L +    +
Sbjct: 104 TLEKVKPKLNKI--QALIMVPTRELALQTSQVVRTLGKHCGISCMVTTGGTNLRDDILRL 161

Query: 258 MSNPDVIIATPGRFLHLKVEMNLDLKSVEYVVFDEADRLFEMGFQEQLNELLASLPTTRQ 317
                V++ TPGR L L      DL      + DEAD++    F+  + ++L+ LP T Q
Sbjct: 162 NETVHVLVGTPGRVLDLASRKVADLSDCSLFIMDEADKMLSRDFKTIIEQILSFLPPTHQ 221

Query: 318 TLLFSATLPNSLVDFVKAGLVNPVLVRLDAE 348
           +LLFSAT P ++ +F+   L  P  + L  E
Sbjct: 222 SLLFSATFPLTVKEFMVKHLHKPYEINLMEE 252

 Score = 73.2 bits (178), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 32/101 (31%), Positives = 58/101 (57%)

Query: 439 ILFVPTRHHVEYISQLLRDCGYLISYIYGTLDQHARKNQLYNFRAGLTSILVVTDVAARG 498
           I+F  + + VE +++ + D GY   Y +  + Q  R    + FR G    LV +D+  RG
Sbjct: 287 IIFCNSTNRVELLAKKITDLGYSCYYSHARMKQQERNKVFHEFRQGKVRTLVCSDLLTRG 346

Query: 499 VDIPMLANVINYTLPGSSKIFVHRVGRTARAGNKGWAYSIV 539
           +DI  +  VIN+  P +++ ++HR+GR+ R G+ G A +++
Sbjct: 347 IDIQAVNVVINFDFPKTAETYLHRIGRSGRFGHLGLAINLI 387

>TPHA0B02850 Chr2 complement(650888..652774) [1887 bp, 628 aa] {ON}
           Anc_8.614 YOR204W
          Length = 628

 Score =  143 bits (361), Expect = 8e-35,   Method: Compositional matrix adjust.
 Identities = 83/251 (33%), Positives = 139/251 (55%), Gaps = 17/251 (6%)

Query: 142 FPSFGLSKIVLNNIKRKGFRQPTPIQRKTIPLILQSRDIVGMARTGSGKTAAFILPMV-- 199
           F S  L  ++L NI    F +PTP+Q+ ++P++ Q RD++  A+TGSGKT  F+ P++  
Sbjct: 157 FTSPPLDSLLLENIHLARFTKPTPVQKYSVPIVAQGRDLMACAQTGSGKTGGFLFPVLSQ 216

Query: 200 ----------EKLK-SHSGKIGARAVILSPSRELAMQTFNVFKDFARGTELRSVLLTGGD 248
                     E LK S   K    A++L+P+RELA Q ++  K F   + +R V++ GG 
Sbjct: 217 SFKNGPAPVPEDLKRSFLRKGNPTALVLAPTRELATQIYDEAKKFTYRSWVRPVVIYGGS 276

Query: 249 SLEEQFSMMMSNPDVIIATPGRFLHLKVEMNLDLKSVEYVVFDEADRLFEMGFQEQLNEL 308
            +  Q   +    D+++ATPGR   L     + L +V+Y+V DEADR+ +MGF+ Q+  +
Sbjct: 277 DVGTQIRELERGCDLLVATPGRLNDLLERGRVSLANVKYLVLDEADRMLDMGFEPQIRHI 336

Query: 309 L--ASLP--TTRQTLLFSATLPNSLVDFVKAGLVNPVLVRLDAETKVSENLEMLFLSSKN 364
           +    +P    RQTL+FSAT P+ +    +  L + + + +      SEN+    L  ++
Sbjct: 337 VDGCDMPDANNRQTLMFSATFPDDIQHLARDFLNDYIFLSVGRVGSTSENITQRILYVED 396

Query: 365 ADREANLLYIL 375
            D+++ LL +L
Sbjct: 397 MDKKSALLDLL 407

 Score = 84.3 bits (207), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 42/101 (41%), Positives = 61/101 (60%)

Query: 438 TILFVPTRHHVEYISQLLRDCGYLISYIYGTLDQHARKNQLYNFRAGLTSILVVTDVAAR 497
           T++FV T+   + ++  L    ++ + I+G   Q  R+  L  F+ G  ++LV T VAAR
Sbjct: 415 TLIFVETKRMADELTDFLIMQDFMATAIHGDRTQIERERALAAFKGGRANVLVATAVAAR 474

Query: 498 GVDIPMLANVINYTLPGSSKIFVHRVGRTARAGNKGWAYSI 538
           G+DIP + +VINY LP     +VHR+GRT RAGN G A S 
Sbjct: 475 GLDIPNVTHVINYDLPTDIDDYVHRIGRTGRAGNTGVATSF 515

>KAFR0B04560 Chr2 complement(947248..947615,948264..949527) [1632
           bp, 543 aa] {ON} Anc_2.164 YNL112W
          Length = 543

 Score =  142 bits (358), Expect = 8e-35,   Method: Compositional matrix adjust.
 Identities = 76/222 (34%), Positives = 124/222 (55%), Gaps = 4/222 (1%)

Query: 141 SFPSFGLSKIVLNNIKRKGFRQPTPIQRKTIPLILQSRDIVGMARTGSGKTAAFILPMVE 200
           +F   G    VL  +K +GF +PT IQ +  P+ L  RD+VG+A TGSGKT ++ LP + 
Sbjct: 111 NFEEAGFPDYVLKEVKAEGFDKPTSIQCQGWPMALSGRDMVGIAATGSGKTLSYCLPGIV 170

Query: 201 KLKSH---SGKIGARAVILSPSRELAMQTFNVFKDFARGTELRSVLLTGGDSLEEQFSMM 257
            + +    S   G   ++LSP+RELA+Q       F   + +R+  + GG    +Q   +
Sbjct: 171 HINAQPLLSPGDGPIVLVLSPTRELAVQIQKECSKFGHSSRIRNTCVYGGVPKGQQIRDL 230

Query: 258 MSNPDVIIATPGRFLHLKVEMNLDLKSVEYVVFDEADRLFEMGFQEQLNELLASLPTTRQ 317
           +   +++IATPGR + +      +LK V Y+V DEADR+ +MGF+ Q+ +++  +   RQ
Sbjct: 231 VRGAEIVIATPGRLIDMMEIGKTNLKRVTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQ 290

Query: 318 TLLFSATLPNSLVDFVKAGLVNPVLVRLDA-ETKVSENLEML 358
           TL++SAT P  +       L +P+ V++ + E   S N+  L
Sbjct: 291 TLMWSATWPKEVRQLAADYLNDPIQVQVGSLELSASHNITQL 332

 Score = 88.6 bits (218), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 44/100 (44%), Positives = 62/100 (62%)

Query: 439 ILFVPTRHHVEYISQLLRDCGYLISYIYGTLDQHARKNQLYNFRAGLTSILVVTDVAARG 498
           ++F  T+   + I++ LR  G+    I+G  DQ  R   L  FR G + I+V TDVAARG
Sbjct: 361 LVFASTKRTCDDITKYLRADGWPALAIHGDKDQKERDWVLNEFRCGRSPIMVATDVAARG 420

Query: 499 VDIPMLANVINYTLPGSSKIFVHRVGRTARAGNKGWAYSI 538
           +D+  +  VINY +PG+ + +VHR+GRT RAG KG A S 
Sbjct: 421 IDVKGINFVINYDMPGNIEDYVHRIGRTGRAGAKGTAISF 460

>YPL119C Chr16 complement(324411..326264) [1854 bp, 617 aa] {ON}
           DBP1Putative ATP-dependent RNA helicase of the DEAD-box
           protein family; mutants show reduced stability of the
           40S ribosomal subunit scanning through 5' untranslated
           regions of mRNAs
          Length = 617

 Score =  143 bits (360), Expect = 9e-35,   Method: Compositional matrix adjust.
 Identities = 81/251 (32%), Positives = 138/251 (54%), Gaps = 17/251 (6%)

Query: 142 FPSFGLSKIVLNNIKRKGFRQPTPIQRKTIPLILQSRDIVGMARTGSGKTAAFILPMV-- 199
           F S  L ++++ NIK   F +PTP+Q+ +IP++ + RD++  A+TGSGKT  F+ P+   
Sbjct: 156 FSSPPLDELLMENIKLASFTKPTPVQKYSIPIVTKGRDLMACAQTGSGKTGGFLFPLFTE 215

Query: 200 ----------EKLKSHSGKIG-ARAVILSPSRELAMQTFNVFKDFARGTELRSVLLTGGD 248
                     EK +S   + G   A++L+P+RELA Q F   + F   + +R  ++ GG 
Sbjct: 216 LFRSGPSPVPEKAQSFYSRKGYPSALVLAPTRELATQIFEEARKFTYRSWVRPCVVYGGA 275

Query: 249 SLEEQFSMMMSNPDVIIATPGRFLHLKVEMNLDLKSVEYVVFDEADRLFEMGFQEQLNEL 308
            +  Q   +    D+++ATPGR   L     + L +++Y+V DEADR+ +MGF+ Q+  +
Sbjct: 276 PIGNQMREVDRGCDLLVATPGRLNDLLERGKVSLANIKYLVLDEADRMLDMGFEPQIRHI 335

Query: 309 L--ASLPTT--RQTLLFSATLPNSLVDFVKAGLVNPVLVRLDAETKVSENLEMLFLSSKN 364
           +    +P+   RQTL+FSAT P  +    +  L N + + +      SEN+    L   +
Sbjct: 336 VEECDMPSVENRQTLMFSATFPVDIQHLARDFLDNYIFLSVGRVGSTSENITQRILYVDD 395

Query: 365 ADREANLLYIL 375
            D+++ LL +L
Sbjct: 396 MDKKSALLDLL 406

 Score = 83.6 bits (205), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 43/101 (42%), Positives = 60/101 (59%)

Query: 438 TILFVPTRHHVEYISQLLRDCGYLISYIYGTLDQHARKNQLYNFRAGLTSILVVTDVAAR 497
           T++FV T+   + ++  L    +  + I+G   Q  R+  L  F+A +  ILV T VAAR
Sbjct: 414 TLIFVETKRMADQLTDFLIMQNFKATAIHGDRTQAERERALSAFKANVADILVATAVAAR 473

Query: 498 GVDIPMLANVINYTLPGSSKIFVHRVGRTARAGNKGWAYSI 538
           G+DIP + +VINY LP     +VHR+GRT RAGN G A S 
Sbjct: 474 GLDIPNVTHVINYDLPSDIDDYVHRIGRTGRAGNTGVATSF 514

>TPHA0B02930 Chr2 (666924..668207) [1284 bp, 427 aa] {ON} Anc_6.148
           YBR237W
          Length = 427

 Score =  140 bits (352), Expect = 9e-35,   Method: Compositional matrix adjust.
 Identities = 71/208 (34%), Positives = 120/208 (57%), Gaps = 3/208 (1%)

Query: 141 SFPSFGLSKIVLNNIKRKGFRQPTPIQRKTIPLILQSRDIVGMARTGSGKTAAFILPMVE 200
           +F   G    VL  +K +GF +PT IQ +  P+ L  RD++G+A TGSGKT ++ LP + 
Sbjct: 115 NFDEAGFPDYVLEEVKAEGFDKPTAIQCQGWPMALSGRDMIGVAATGSGKTLSYCLPGIV 174

Query: 201 KLKSH---SGKIGARAVILSPSRELAMQTFNVFKDFARGTELRSVLLTGGDSLEEQFSMM 257
            + +    S   G   ++LSP+RELA+Q       F + + +R+  + GG    +Q   +
Sbjct: 175 HINAQPLLSPGDGPIVLVLSPTRELAVQIQKECSKFGQSSRIRNTCVYGGVPRGQQIRDL 234

Query: 258 MSNPDVIIATPGRFLHLKVEMNLDLKSVEYVVFDEADRLFEMGFQEQLNELLASLPTTRQ 317
           +   +++IATPGR + +      +LK V Y+V DEADR+ +MGF+ Q+ +++  +   RQ
Sbjct: 235 IRGAEIVIATPGRLIDMLEIGKTNLKRVTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQ 294

Query: 318 TLLFSATLPNSLVDFVKAGLVNPVLVRL 345
           TL++SAT P  +    +  L +P+ V++
Sbjct: 295 TLMWSATWPKEVQQLARDYLNDPIQVQI 322

 Score = 50.1 bits (118), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 25/65 (38%), Positives = 37/65 (56%)

Query: 435 EKATILFVPTRHHVEYISQLLRDCGYLISYIYGTLDQHARKNQLYNFRAGLTSILVVTDV 494
           E   ++F  T+   + I++ LR+ G+    I+G  DQ  R   L  FR G + I+V TDV
Sbjct: 361 ESKILIFASTKRTCDEITKYLREDGWPALAIHGDKDQRERDWVLQEFRDGRSPIMVATDV 420

Query: 495 AARGV 499
           AARG+
Sbjct: 421 AARGI 425

>Ecym_4646 Chr4 complement(1259564..1261036) [1473 bp, 490 aa] {ON}
           similar to Ashbya gossypii ACR197W
          Length = 490

 Score =  141 bits (355), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 75/208 (36%), Positives = 119/208 (57%), Gaps = 2/208 (0%)

Query: 138 KKGSFPSFGLSKIVLNNIKRKGFRQPTPIQRKTIPLILQSRDIVGMARTGSGKTAAFILP 197
           K  +F  F L + +L  I   GF +P+PIQ + IP+ L  RDI+  A+ G+GKTAAF++P
Sbjct: 28  KGNTFEDFYLKRELLMGIFEAGFEKPSPIQEEAIPIALTRRDILARAKNGTGKTAAFVIP 87

Query: 198 MVEKLKSHSGKIGARAVILSPSRELAMQTFNVFKDFARGTELRSVLLTGGDSLEEQFSMM 257
            +E +K    KI  +A+I+ P+RELA+QT  V +   +   L  ++ TGG +L +    +
Sbjct: 88  TLEIVKPKVNKI--QALIMVPTRELALQTSQVVRTLGKHCGLSCMVTTGGTNLRDDIMRL 145

Query: 258 MSNPDVIIATPGRFLHLKVEMNLDLKSVEYVVFDEADRLFEMGFQEQLNELLASLPTTRQ 317
                V++ TPGR L L      DL      + DEAD++    F+  + ++L+ LP++ Q
Sbjct: 146 NEPVHVLVGTPGRVLDLASRKVADLSECSLFIMDEADKMLSRDFKSLIEQILSFLPSSHQ 205

Query: 318 TLLFSATLPNSLVDFVKAGLVNPVLVRL 345
           +LLFSAT P ++ +F+   L  P  + L
Sbjct: 206 SLLFSATFPLTVKEFMVKHLNKPYEINL 233

 Score = 73.9 bits (180), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 32/101 (31%), Positives = 58/101 (57%)

Query: 439 ILFVPTRHHVEYISQLLRDCGYLISYIYGTLDQHARKNQLYNFRAGLTSILVVTDVAARG 498
           I+F  + + VE +++ + D GY   Y +  + Q  R    + FR G    LV +D+  RG
Sbjct: 271 IIFCNSTNRVELLAKKITDLGYSCYYSHARMKQQERNKVFHEFRQGKVRTLVCSDLLTRG 330

Query: 499 VDIPMLANVINYTLPGSSKIFVHRVGRTARAGNKGWAYSIV 539
           +DI  +  VIN+  P +++ ++HR+GR+ R G+ G A +++
Sbjct: 331 IDIQAVNVVINFDFPKTAETYLHRIGRSGRFGHLGLAINLI 371

>Kwal_23.2883 s23 complement(58087..60381) [2295 bp, 764 aa] {ON}
           YJL033W (HCA4) - putative RNA helicase [contig 246] FULL
          Length = 764

 Score =  144 bits (364), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 76/201 (37%), Positives = 125/201 (62%), Gaps = 4/201 (1%)

Query: 142 FPSFGLSKIVLNNIKRKGFRQPTPIQRKTIPLILQSRDIVGMARTGSGKTAAFILPMVEK 201
           F +  LS+     ++   F + T IQ+K+IP+ L+  D++  A+TGSGKT AF++P++EK
Sbjct: 43  FKNLPLSQHTQKGLRDSAFVKMTEIQQKSIPVSLKGHDLLAAAKTGSGKTLAFLIPVIEK 102

Query: 202 L--KSHSGKIGARAVILSPSRELAMQTFNVFKDFARGTELRSVLLTGGDSLEEQFSMMMS 259
           L  +  +   G  A+I+SP+RELAMQT+ V     R +   + L+ GG  ++ +   + S
Sbjct: 103 LYREKWTEFDGLGALIISPTRELAMQTYEVLTKIGRYSSFSAGLVIGGKDVKFELERI-S 161

Query: 260 NPDVIIATPGRFL-HLKVEMNLDLKSVEYVVFDEADRLFEMGFQEQLNELLASLPTTRQT 318
             ++++ TPGR L H+   + L+  +V+ +V DEADR  +MGF++ L+ ++++LP  RQT
Sbjct: 162 KINILVGTPGRILQHMDQAVGLNTSNVQVLVLDEADRCLDMGFKKTLDAIVSNLPPVRQT 221

Query: 319 LLFSATLPNSLVDFVKAGLVN 339
           LLFSAT   SL D  +  L +
Sbjct: 222 LLFSATQSQSLADLARLSLTD 242

 Score = 66.6 bits (161), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 32/97 (32%), Positives = 50/97 (51%), Gaps = 2/97 (2%)

Query: 439 ILFVPTRHHVEYISQLLRDC--GYLISYIYGTLDQHARKNQLYNFRAGLTSILVVTDVAA 496
           I+F+ +   V ++ +  R    G  + +++G   Q AR   L  F     + L  TDV A
Sbjct: 293 IVFLSSSKQVHFVYETFRKLQPGISLMHLHGRQKQTARTETLDKFSRAQHTCLFATDVVA 352

Query: 497 RGVDIPMLANVINYTLPGSSKIFVHRVGRTARAGNKG 533
           RG+D P +  V+    P S   ++HRVGR+AR G +G
Sbjct: 353 RGIDFPAVDWVVQADCPESVDTYIHRVGRSARYGKQG 389

>CAGL0J06908g Chr10 complement(662041..663855) [1815 bp, 604 aa]
           {ON} similar to uniprot|P24784 Saccharomyces cerevisiae
           YPL119c DBP1 or uniprot|P06634 Saccharomyces cerevisiae
           YOR204w
          Length = 604

 Score =  143 bits (360), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 79/251 (31%), Positives = 143/251 (56%), Gaps = 17/251 (6%)

Query: 142 FPSFGLSKIVLNNIKRKGFRQPTPIQRKTIPLILQSRDIVGMARTGSGKTAAFILPMVEK 201
           F S  L +++L N++   F +PTP+Q+ +IP++ ++RD++  A+TGSGKT  F+ P++ +
Sbjct: 140 FKSPPLDELLLENVELANFSKPTPVQKYSIPIVTKNRDLMACAQTGSGKTGGFLFPVLSE 199

Query: 202 L-------------KSHSGKIGARAVILSPSRELAMQTFNVFKDFARGTELRSVLLTGGD 248
           L              S+  K    A++L+P+RELA+Q F+  K +   + ++  ++ GG 
Sbjct: 200 LFLNGPAPLPEHTRHSYMRKCYPSALVLAPTRELAIQIFDEAKKYTYRSWVKPYVVYGGA 259

Query: 249 SLEEQFSMMMSNPDVIIATPGRFLHLKVEMNLDLKSVEYVVFDEADRLFEMGFQEQLNEL 308
            + +Q   M    ++++ATPGR   L     + L +V+Y+V DEADR+ +MGF+ Q+  +
Sbjct: 260 PIGQQMRDMDRGCNLLVATPGRLNDLLERGKISLVNVKYLVLDEADRMLDMGFEPQIRHI 319

Query: 309 L--ASLPTT--RQTLLFSATLPNSLVDFVKAGLVNPVLVRLDAETKVSENLEMLFLSSKN 364
           +    +P+   RQTL+FSAT P  +    +  L + + + +      SEN++   L  ++
Sbjct: 320 VEDCDMPSVNDRQTLMFSATFPREIQHLARDFLKDYIFLSVGRVGSTSENIQQKVLFVED 379

Query: 365 ADREANLLYIL 375
            D+ + LL IL
Sbjct: 380 YDKNSALLDIL 390

 Score = 87.4 bits (215), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 45/101 (44%), Positives = 62/101 (61%)

Query: 438 TILFVPTRHHVEYISQLLRDCGYLISYIYGTLDQHARKNQLYNFRAGLTSILVVTDVAAR 497
           T++FV T+   + ++  L    +  + I+G   Q  R+  L+ FR G+ +ILV T VAAR
Sbjct: 398 TLVFVETKRMADQLTDFLIVQNFKATAIHGDRTQAERERALHAFRNGIANILVATAVAAR 457

Query: 498 GVDIPMLANVINYTLPGSSKIFVHRVGRTARAGNKGWAYSI 538
           G+DIP + NVINY LP     +VHR+GRT RAGN G A S 
Sbjct: 458 GLDIPNVTNVINYDLPTDIDDYVHRIGRTGRAGNVGVATSF 498

>Kpol_1041.33 s1041 complement(82855..84180) [1326 bp, 441 aa] {ON}
           complement(82855..84180) [1326 nt, 442 aa]
          Length = 441

 Score =  140 bits (352), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 113/455 (24%), Positives = 201/455 (44%), Gaps = 71/455 (15%)

Query: 100 ILELSDDENNISGQTQAGEEEDDVNEYFSTNNLEKQKHKKGS--------FPSFGLSKIV 151
           +LE SD+E +I        E  +++   + +       KKGS        F  F L   +
Sbjct: 9   LLEYSDNEQDIQVDASKAAEPSELDATTAEDASNGDAEKKGSYVGIHSTGFKDFLLKPEL 68

Query: 152 LNNIKRKGFRQPTPIQRKTIPLILQSRDIVGMARTGSGKTAAFILPMVEKLKSHSGKIGA 211
              I   GF  P+ +Q+ TIP  +   D++  A++G GKTA F+L  +++L    G++  
Sbjct: 69  ARAIIDCGFEHPSEVQQHTIPQSIHGTDVLCQAKSGLGKTAVFVLSTLQQLDPVPGEVS- 127

Query: 212 RAVILSPSRELAMQTFNVFKDFARGT-ELRSVLLTGGDSLEEQFSMMM---SNPDVIIAT 267
             V++  +RELA Q  N +  F++   ++++ +  GG  + +   ++    + P +++AT
Sbjct: 128 -VVVICNARELAYQIRNEYLRFSKYMPDVKTAVFYGGTPINKDAELLKNKETAPHIVVAT 186

Query: 268 PGRFLHLKVEMNLDLKSVEYVVFDEADRLF-EMGFQEQLNELLASLPTTRQTLLFSATLP 326
           PGR   L  +  +DL  V+  V DE D++  E+  +  + ++  + P  +Q ++FSATL 
Sbjct: 187 PGRLKALVRDKLIDLSHVKNFVIDECDKVLEELDMRRDVQDIFRATPRDKQVMMFSATLS 246

Query: 327 NSLVDFVKAGLVNPVLVRLDAETKVS-ENLEMLFLSSKNADREANLLYILQEVIRIPLAT 385
             +    +  L NP+ + +D E K++   L+  +   +  ++   L  +L ++       
Sbjct: 247 EEIRPICRRFLQNPLEIFVDDEAKLTLHGLQQYYTKLQENEKNRKLAQLLDDL------E 300

Query: 386 SEQLLKLQKSTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMPAANELPSEKATILFVPTR 445
             Q++   KST                                ANEL             
Sbjct: 301 FNQVIIFVKSTKR------------------------------ANEL------------- 317

Query: 446 HHVEYISQLLRDCGYLISYIYGTLDQHARKNQLYNFRAGLTSILVVTDVAARGVDIPMLA 505
                 ++LL +  +    ++G + Q  R  +   F+     I V TDV  RG+DI  + 
Sbjct: 318 ------TKLLNESNFPAITVHGHMKQAERIARYKAFKEFEKRICVSTDVFGRGIDIERIN 371

Query: 506 NVINYTLPGSSKIFVHRVGRTARAGNKGWAYSIVA 540
             INY L   +  ++HRVGR  R G KG A S V+
Sbjct: 372 LAINYDLTTEADQYLHRVGRAGRFGTKGLAISFVS 406

>TBLA0C05580 Chr3 (1351338..1352610,1353450..1353799) [1623 bp, 540
           aa] {ON} Anc_2.164 YNL112W
          Length = 540

 Score =  142 bits (357), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 72/208 (34%), Positives = 120/208 (57%), Gaps = 3/208 (1%)

Query: 141 SFPSFGLSKIVLNNIKRKGFRQPTPIQRKTIPLILQSRDIVGMARTGSGKTAAFILPMVE 200
           +F   G    VLN +K +GF  PT IQ +  P+ L  RD+VG+A TGSGKT ++ LP + 
Sbjct: 114 NFDEAGFPDYVLNEVKAEGFANPTAIQCQGWPMALSGRDMVGIAATGSGKTLSYCLPGIV 173

Query: 201 KLKSH---SGKIGARAVILSPSRELAMQTFNVFKDFARGTELRSVLLTGGDSLEEQFSMM 257
            + +    +   G   ++LSP+RELA+Q       F + + +R+  + GG    +Q   +
Sbjct: 174 HINAQPLLAPGDGPIVLVLSPTRELAVQIQKECSKFGKSSRIRNTCVYGGVPKGQQIRDL 233

Query: 258 MSNPDVIIATPGRFLHLKVEMNLDLKSVEYVVFDEADRLFEMGFQEQLNELLASLPTTRQ 317
               +++IATPGR + +      +LK V Y+V DEADR+ +MGF+ Q+ +++  +   RQ
Sbjct: 234 SRGSEIVIATPGRLIDMLEIGKTNLKRVTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQ 293

Query: 318 TLLFSATLPNSLVDFVKAGLVNPVLVRL 345
           TL++SAT P  + +  +  L +P+ V++
Sbjct: 294 TLMWSATWPKEVQNLARDYLNDPIQVQI 321

 Score = 88.6 bits (218), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 44/104 (42%), Positives = 63/104 (60%)

Query: 435 EKATILFVPTRHHVEYISQLLRDCGYLISYIYGTLDQHARKNQLYNFRAGLTSILVVTDV 494
           E   ++F  T+   + I++ LR+ G+    I+G  DQ  R   L  FR G + I+V TDV
Sbjct: 360 ESKILVFASTKRTCDEITKYLREDGWPALAIHGDKDQRERDWVLAEFREGRSPIMVATDV 419

Query: 495 AARGVDIPMLANVINYTLPGSSKIFVHRVGRTARAGNKGWAYSI 538
           AARG+D+  +  VINY +PG+ + +VHR+GRT RAG  G A S 
Sbjct: 420 AARGIDVKGINYVINYDMPGNIEDYVHRIGRTGRAGATGTAISF 463

>Smik_4.77 Chr4 complement(147172..148692) [1521 bp, 506 aa] {ON}
           YDL160C (REAL)
          Length = 506

 Score =  141 bits (355), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 74/211 (35%), Positives = 121/211 (57%), Gaps = 2/211 (0%)

Query: 138 KKGSFPSFGLSKIVLNNIKRKGFRQPTPIQRKTIPLILQSRDIVGMARTGSGKTAAFILP 197
           K  +F  F L + +L  I   GF +P+PIQ + IP+ +  RDI+  A+ G+GKTAAF++P
Sbjct: 44  KGNTFEDFYLRRELLMGIFEAGFEKPSPIQEEAIPVAITGRDILARAKNGTGKTAAFVIP 103

Query: 198 MVEKLKSHSGKIGARAVILSPSRELAMQTFNVFKDFARGTELRSVLLTGGDSLEEQFSMM 257
            +EK+K    KI  +A+I+ P+RELA+QT  V +   +   +  ++ TGG +L +    +
Sbjct: 104 TLEKVKPKLNKI--QALIMVPTRELALQTSQVVRTLGKHCGISCMVTTGGTNLRDDILRL 161

Query: 258 MSNPDVIIATPGRFLHLKVEMNLDLKSVEYVVFDEADRLFEMGFQEQLNELLASLPTTRQ 317
                +++ TPGR L L      DL      + DEAD++    F+  + ++L+ LP++ Q
Sbjct: 162 NETVHILVGTPGRVLDLASRKVADLSDCSLFIMDEADKMLSRDFKTIIEQILSFLPSSHQ 221

Query: 318 TLLFSATLPNSLVDFVKAGLVNPVLVRLDAE 348
           +LLFSAT P ++ +F+   L  P  + L  E
Sbjct: 222 SLLFSATFPLTVKEFMVKHLHKPYEINLMEE 252

 Score = 73.6 bits (179), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 32/101 (31%), Positives = 58/101 (57%)

Query: 439 ILFVPTRHHVEYISQLLRDCGYLISYIYGTLDQHARKNQLYNFRAGLTSILVVTDVAARG 498
           I+F  + + VE +++ + D GY   Y +  + Q  R    + FR G    LV +D+  RG
Sbjct: 287 IIFCNSTNRVELLAKKITDLGYSCYYSHARMKQQERNKVFHEFRQGKVRTLVCSDLLTRG 346

Query: 499 VDIPMLANVINYTLPGSSKIFVHRVGRTARAGNKGWAYSIV 539
           +DI  +  VIN+  P +++ ++HR+GR+ R G+ G A +++
Sbjct: 347 IDIQAVNVVINFDFPKTAETYLHRIGRSGRFGHLGLAINLI 387

>Kpol_1004.13 s1004 (25289..27595) [2307 bp, 768 aa] {ON}
           (25289..27595) [2307 nt, 769 aa]
          Length = 768

 Score =  144 bits (363), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 86/226 (38%), Positives = 133/226 (58%), Gaps = 12/226 (5%)

Query: 118 EEEDDVNEYFSTNNLEKQKHKKGSFPSFGLSKIVLNNIKRKGFRQPTPIQRKTIPLILQS 177
           E E  ++EY ++ N      K   F    +S   L  +    F + T IQR +IP+ L+ 
Sbjct: 25  ELETKIDEYDASIN------KPVFFKDLPISNSTLKGLNDSAFLKLTDIQRDSIPMSLKG 78

Query: 178 RDIVGMARTGSGKTAAFILPMVEKL--KSHSGKIGARAVILSPSRELAMQTFNVFKDFAR 235
            DI+G A+TGSGKT AF++P++EKL  +  +   G  A+I+SP+RELAMQ + V      
Sbjct: 79  YDILGAAKTGSGKTLAFLIPVLEKLYRERWTEFDGLGALIISPTRELAMQIYEVLLKIGT 138

Query: 236 GTELRSVLLTGGDSLEEQFSM-MMSNPDVIIATPGRFL-HLKVEMNLDLKSVEYVVFDEA 293
            T   + L+ GG  +  +F M  +S  +++I TPGR L H+   + L+  +++ +V DEA
Sbjct: 139 STSFSAGLVIGGKDV--KFEMERISKINILIGTPGRILQHMDQAIGLNTSNLQMLVLDEA 196

Query: 294 DRLFEMGFQEQLNELLASLPTTRQTLLFSATLPNSLVDFVKAGLVN 339
           DR  +MGF++ L+ ++++LP TRQTLLFSAT   SL D  +  L +
Sbjct: 197 DRCLDMGFKKTLDAIVSNLPPTRQTLLFSATQSQSLEDLARLSLTD 242

 Score = 63.5 bits (153), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 31/97 (31%), Positives = 47/97 (48%), Gaps = 2/97 (2%)

Query: 439 ILFVPTRHHVEYISQLLRDC--GYLISYIYGTLDQHARKNQLYNFRAGLTSILVVTDVAA 496
           I+F+ +   V ++ +  R    G  + +++G   Q AR   L  F       L  TDV A
Sbjct: 297 IVFLSSSKQVHFVYETFRKMQPGISLMHLHGRQKQKARTETLDKFNRAQHVCLFATDVVA 356

Query: 497 RGVDIPMLANVINYTLPGSSKIFVHRVGRTARAGNKG 533
           RG+D P +  V+    P     ++HRVGR AR G +G
Sbjct: 357 RGIDFPAIDWVVQVDCPEDVDTYIHRVGRCARYGKQG 393

>Smik_13.506 Chr13 complement(832760..834277) [1518 bp, 505 aa] {ON}
           YMR290C (REAL)
          Length = 505

 Score =  141 bits (355), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 92/280 (32%), Positives = 152/280 (54%), Gaps = 24/280 (8%)

Query: 106 DENNISGQTQAGEEEDDVNEYFSTNNLEKQKHKKGSFPSFGLSKIVLNNIKRKGFRQPTP 165
           DE NI  QT A  EE+       T  +EK       F    LS+  L  I++ GF   T 
Sbjct: 21  DEKNIKKQTNAAPEEE------QTTYVEK-------FEELKLSQPTLKAIEKMGFTTMTS 67

Query: 166 IQRKTIPLILQSRDIVGMARTGSGKTAAFILPMVEKLKSHSGKI----GARAVILSPSRE 221
           +Q +TIP +L  RD++G A+TGSGKT AF++P +E L  HS K     G   ++++P+RE
Sbjct: 68  VQSRTIPPLLAGRDVLGAAKTGSGKTLAFLIPAIELL--HSLKFKPRNGTGIIVITPTRE 125

Query: 222 LAMQTFNVFKDFARGTELRSVLLTGGDSLEEQFSMMMSNPDVIIATPGRFL-HLKVEMNL 280
           LA+Q F V ++          ++ GG +  ++   +M   +++IATPGR L HL+     
Sbjct: 126 LALQIFGVARELMEFHSQTFGIVIGGANRRQEAEKLMKGVNMLIATPGRLLDHLQNTKGF 185

Query: 281 DLKSVEYVVFDEADRLFEMGFQEQLNELLASLPTT-RQTLLFSATLPNSLVDFVKAGL-V 338
             K+++ ++ DEADR+ E+GF++++ +++  LP   RQ++LFSAT    + D  +  L  
Sbjct: 186 VFKNLKALIIDEADRILEIGFEDEMRQIIKILPNEDRQSMLFSATQTTKVEDLARISLRP 245

Query: 339 NPVLVRLDAET--KVSENLEMLFLSSKNADREANLLYILQ 376
            P+ + +  ET    ++ LE  ++   + +R   L   L+
Sbjct: 246 GPLFINVVPETDNSTADGLEQGYVVCDSDNRFLLLFSFLK 285

 Score = 72.8 bits (177), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 38/105 (36%), Positives = 60/105 (57%), Gaps = 1/105 (0%)

Query: 435 EKATILFVPTRHHVEYISQLLRDCGYLISYIYGTLDQHARKNQLYNFRAGLTSILVVTDV 494
           +K  I+F+ + + V+Y ++LL      +  ++G   Q  R N  + F      IL+ TDV
Sbjct: 289 KKKIIVFLSSCNSVKYYAELLNYIDLPVLELHGKQKQQKRTNTFFEFCNAERGILICTDV 348

Query: 495 AARGVDIPMLANVINYTLPGSSKIFVHRVGRTARAGNKGWAYSIV 539
           AARG+DIP +  +I +  P   + ++HRVGRTAR G KG   S++
Sbjct: 349 AARGLDIPAVDWIIQFDPPDDPRDYIHRVGRTAR-GTKGKGKSLM 392

>YNL112W Chr14 (413639..414911,415914..416281) [1641 bp, 546 aa]
           {ON}  DBP2Essential ATP-dependent RNA helicase of the
           DEAD-box protein family, involved in nonsense-mediated
           mRNA decay and rRNA processing
          Length = 546

 Score =  141 bits (356), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 74/222 (33%), Positives = 124/222 (55%), Gaps = 4/222 (1%)

Query: 141 SFPSFGLSKIVLNNIKRKGFRQPTPIQRKTIPLILQSRDIVGMARTGSGKTAAFILPMVE 200
           +F   G    VLN +K +GF +PT IQ +  P+ L  RD+VG+A TGSGKT ++ LP + 
Sbjct: 114 TFDEAGFPDYVLNEVKAEGFDKPTGIQCQGWPMALSGRDMVGIAATGSGKTLSYCLPGIV 173

Query: 201 KLKSH---SGKIGARAVILSPSRELAMQTFNVFKDFARGTELRSVLLTGGDSLEEQFSMM 257
            + +    +   G   ++L+P+RELA+Q       F   + +R+  + GG    +Q   +
Sbjct: 174 HINAQPLLAPGDGPIVLVLAPTRELAVQIQTECSKFGHSSRIRNTCVYGGVPKSQQIRDL 233

Query: 258 MSNPDVIIATPGRFLHLKVEMNLDLKSVEYVVFDEADRLFEMGFQEQLNELLASLPTTRQ 317
               +++IATPGR + +      +LK V Y+V DEADR+ +MGF+ Q+ +++  +   RQ
Sbjct: 234 SRGSEIVIATPGRLIDMLEIGKTNLKRVTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQ 293

Query: 318 TLLFSATLPNSLVDFVKAGLVNPVLVRLDA-ETKVSENLEML 358
           TL++SAT P  +       L +P+ V++ + E   S N+  +
Sbjct: 294 TLMWSATWPKEVKQLAADYLNDPIQVQVGSLELSASHNITQI 335

 Score = 90.1 bits (222), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 45/105 (42%), Positives = 65/105 (61%)

Query: 434 SEKATILFVPTRHHVEYISQLLRDCGYLISYIYGTLDQHARKNQLYNFRAGLTSILVVTD 493
           +E  T++F  T+   + I++ LR+ G+    I+G  DQ  R   L  FR G + I+V TD
Sbjct: 359 NEYKTLIFASTKRMCDDITKYLREDGWPALAIHGDKDQRERDWVLQEFRNGRSPIMVATD 418

Query: 494 VAARGVDIPMLANVINYTLPGSSKIFVHRVGRTARAGNKGWAYSI 538
           VAARG+D+  +  VINY +PG+ + +VHR+GRT RAG  G A S 
Sbjct: 419 VAARGIDVKGINYVINYDMPGNIEDYVHRIGRTGRAGATGTAISF 463

>Kpol_165.1 s165 complement(441..1766) [1326 bp, 441 aa] {ON}
           complement(441..1766) [1326 nt, 442 aa]
          Length = 441

 Score =  139 bits (351), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 78/240 (32%), Positives = 130/240 (54%), Gaps = 4/240 (1%)

Query: 141 SFPSFGLSKIVLNNIKRKGFRQPTPIQRKTIPLILQSRDIVGMARTGSGKTAAFILPMVE 200
           SF   G    VL  +K +GF +PT IQ +  P+ L  RD++G+A TGSGKT ++ LP + 
Sbjct: 114 SFDEAGFPDYVLEEVKAEGFEKPTGIQCQGWPMALSGRDMIGVAATGSGKTLSYCLPGIV 173

Query: 201 KLKSH---SGKIGARAVILSPSRELAMQTFNVFKDFARGTELRSVLLTGGDSLEEQFSMM 257
            + +    S   G   ++L+P+RELA+Q       F   + +R+  + GG    +Q   +
Sbjct: 174 HINAQPLLSPGDGPIVLVLAPTRELAVQIQKECSKFGSSSRIRNSCVYGGVPRGQQIREL 233

Query: 258 MSNPDVIIATPGRFLHLKVEMNLDLKSVEYVVFDEADRLFEMGFQEQLNELLASLPTTRQ 317
               +++IATPGR + +      +LK V Y+V DEADR+ +MGF+ Q+ +++  +   RQ
Sbjct: 234 SRGAEIVIATPGRLIDMLEIGKTNLKRVTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQ 293

Query: 318 TLLFSATLPNSLVDFVKAGLVNPVLVRLDA-ETKVSENLEMLFLSSKNADREANLLYILQ 376
           TL++SAT P  +       L +P+ V++ + E   S N+  L     + ++   LL  L+
Sbjct: 294 TLMWSATWPKEVKQLAHDYLNDPIQVQIGSLELSASHNITQLVEVVSDFEKRDRLLKHLE 353

 Score = 48.5 bits (114), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 23/61 (37%), Positives = 36/61 (59%)

Query: 439 ILFVPTRHHVEYISQLLRDCGYLISYIYGTLDQHARKNQLYNFRAGLTSILVVTDVAARG 498
           ++F  T+   + +++ LR+ G+    I+G  DQ  R   L  FR G + I+V TDVAARG
Sbjct: 364 LVFASTKRTCDEVTKYLREDGWPALAIHGDKDQRERDWVLQEFREGRSPIMVATDVAARG 423

Query: 499 V 499
           +
Sbjct: 424 I 424

>NDAI0A01960 Chr1 complement(436462..438066) [1605 bp, 534 aa] {ON}
           Anc_7.336
          Length = 534

 Score =  141 bits (355), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 74/208 (35%), Positives = 120/208 (57%), Gaps = 2/208 (0%)

Query: 138 KKGSFPSFGLSKIVLNNIKRKGFRQPTPIQRKTIPLILQSRDIVGMARTGSGKTAAFILP 197
           K  +F  F L + +L  I   GF +P+PIQ ++IP+ +  RDI+  A+ G+GKTAAF++P
Sbjct: 35  KGNTFEDFFLKRELLMGIFEAGFEKPSPIQEESIPIAITGRDILARAKNGTGKTAAFVIP 94

Query: 198 MVEKLKSHSGKIGARAVILSPSRELAMQTFNVFKDFARGTELRSVLLTGGDSLEEQFSMM 257
            +E++K +  KI  +A+I+ P+RELA+QT  V +   +   +  ++ TGG +L +    +
Sbjct: 95  TLERIKPNLNKI--QALIMVPTRELALQTSQVVRTLGKHCGISCMVTTGGTNLRDDILRL 152

Query: 258 MSNPDVIIATPGRFLHLKVEMNLDLKSVEYVVFDEADRLFEMGFQEQLNELLASLPTTRQ 317
                V++ TPGR L L      DL      + DEAD++    F+  + ++L  LP   Q
Sbjct: 153 NETVHVLVGTPGRVLDLASRKVADLSDCSLFIMDEADKMLSRDFKTIIEQILIFLPKKHQ 212

Query: 318 TLLFSATLPNSLVDFVKAGLVNPVLVRL 345
           +LLFSAT P ++ +F+   L NP  + L
Sbjct: 213 SLLFSATFPLTVKEFMVKHLNNPYEINL 240

 Score = 74.7 bits (182), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 33/101 (32%), Positives = 58/101 (57%)

Query: 439 ILFVPTRHHVEYISQLLRDCGYLISYIYGTLDQHARKNQLYNFRAGLTSILVVTDVAARG 498
           I+F  + + VE +++ + D GY   Y +  + Q  R    + FR G    LV +D+  RG
Sbjct: 278 IIFCNSTNRVELLAKKITDLGYSCYYSHARMKQQERNRVFHEFRQGKVRTLVCSDLLTRG 337

Query: 499 VDIPMLANVINYTLPGSSKIFVHRVGRTARAGNKGWAYSIV 539
           +DI  +  VIN+  P +S+ ++HR+GR+ R G+ G A +++
Sbjct: 338 IDIQAVNVVINFDFPKTSETYLHRIGRSGRFGHLGLAINLI 378

>TBLA0B04200 Chr2 complement(970057..971952) [1896 bp, 631 aa] {ON}
           Anc_8.614 YOR204W
          Length = 631

 Score =  142 bits (358), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 81/251 (32%), Positives = 138/251 (54%), Gaps = 17/251 (6%)

Query: 142 FPSFGLSKIVLNNIKRKGFRQPTPIQRKTIPLILQSRDIVGMARTGSGKTAAFILPMVEK 201
           F S  L+ +++ NIK   F +PTP+Q+ +IP++ Q RD++  A+TGSGKT  F+ P++ +
Sbjct: 157 FTSPPLADLLMENIKLAHFTKPTPVQKYSIPIVEQGRDLMACAQTGSGKTGGFLFPVLSE 216

Query: 202 L-------------KSHSGKIGARAVILSPSRELAMQTFNVFKDFARGTELRSVLLTGGD 248
                          S+  K    AVIL+P+RELA Q F+  K F   + ++  ++ GG 
Sbjct: 217 SFSTGPADLPENTQSSYMRKAYPTAVILAPTRELATQIFDEAKKFTYRSWVKPCVVYGGA 276

Query: 249 SLEEQFSMMMSNPDVIIATPGRFLHLKVEMNLDLKSVEYVVFDEADRLFEMGFQEQLNEL 308
            +  Q   +     +++ATPGR   L     + L +V+Y+V DEADR+ +MGF+ Q+  +
Sbjct: 277 DIRNQIRELERGCALLVATPGRLNDLLERGRISLANVKYLVLDEADRMLDMGFEPQIRHI 336

Query: 309 L--ASLPTT--RQTLLFSATLPNSLVDFVKAGLVNPVLVRLDAETKVSENLEMLFLSSKN 364
           +    +P    RQTL+FSAT P+ +    +  L + + + +      SEN+    L  ++
Sbjct: 337 VDGCDMPPAGERQTLMFSATFPDDIQHLARDFLSDYIFLSVGRVGSTSENITQHILYVED 396

Query: 365 ADREANLLYIL 375
            D+++ LL +L
Sbjct: 397 MDKKSALLDLL 407

 Score = 84.3 bits (207), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 42/98 (42%), Positives = 59/98 (60%)

Query: 438 TILFVPTRHHVEYISQLLRDCGYLISYIYGTLDQHARKNQLYNFRAGLTSILVVTDVAAR 497
           T++FV T+   + ++  L    +  + I+G   Q  R+  L+ FR G   +LV T VAAR
Sbjct: 415 TLIFVETKRMADELTDFLIMQNFRATAIHGDRTQSERERALHAFRNGRADLLVATAVAAR 474

Query: 498 GVDIPMLANVINYTLPGSSKIFVHRVGRTARAGNKGWA 535
           G+DIP + +VINY LP     +VHR+GRT RAGN G A
Sbjct: 475 GLDIPNVTHVINYDLPSDIDDYVHRIGRTGRAGNTGTA 512

>CAGL0M13519g Chr13 complement(1330802..1332286) [1485 bp, 494 aa]
           {ON} highly similar to uniprot|Q03532 Saccharomyces
           cerevisiae YMR290c HAS1 helicase associated with SET1P
          Length = 494

 Score =  140 bits (352), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 82/242 (33%), Positives = 144/242 (59%), Gaps = 12/242 (4%)

Query: 141 SFPSFGLSKIVLNNIKRKGFRQPTPIQRKTIPLILQSRDIVGMARTGSGKTAAFILPMVE 200
           SF S  LS+  +  I++ GF + TP+Q +TIP ++  RD++G A+TGSGKT AF+LP +E
Sbjct: 30  SFKSLNLSQPTMRAIEKMGFSKMTPVQARTIPPLMAGRDVLGAAKTGSGKTLAFLLPTIE 89

Query: 201 KLKSHSGKI----GARAVILSPSRELAMQTFNVFKDFARGTELRSVLLTGGDSLEEQFSM 256
            L  HS K     G   +I++P+RELA+Q F V ++          ++ GG +  ++   
Sbjct: 90  LL--HSLKFKPRNGTGVIIITPTRELALQIFGVVRELMEFHSQTFGIVIGGANRRQEAEK 147

Query: 257 MMSNPDVIIATPGRFL-HLKVEMNLDLKSVEYVVFDEADRLFEMGFQEQLNELLASLPTT 315
           +M   ++++ATPGR L HL+       K+++ +V DEADR+ E+GF++++ +++  LP  
Sbjct: 148 LMKGVNLLVATPGRLLDHLQNTKGFIFKNLKALVIDEADRILEIGFEDEMRQIIKILPNE 207

Query: 316 -RQTLLFSATLPNSLVDFVKAGL-VNPVLVRLDAE--TKVSENLEMLFLSSKNADREANL 371
            RQ++LFSAT    + D  +  L   P+ + + +E  +  ++ LE  ++  + +D+   L
Sbjct: 208 DRQSMLFSATQTTKVEDLSRISLRPGPLFINVVSEHDSSTADGLEQGYVVCE-SDKRFLL 266

Query: 372 LY 373
           L+
Sbjct: 267 LF 268

 Score = 70.9 bits (172), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 35/97 (36%), Positives = 55/97 (56%)

Query: 435 EKATILFVPTRHHVEYISQLLRDCGYLISYIYGTLDQHARKNQLYNFRAGLTSILVVTDV 494
           +K  I+F+ + + V+Y ++LL      +  ++G   Q  R N  + F      IL+ TDV
Sbjct: 276 KKKIIVFLSSCNSVKYYAELLNYIDLPVLELHGKQKQQKRTNTFFEFCNAERGILICTDV 335

Query: 495 AARGVDIPMLANVINYTLPGSSKIFVHRVGRTARAGN 531
           AARG+DIP +  +I +  P   + ++HRVGRTAR  N
Sbjct: 336 AARGLDIPAVDWIIQFDPPDDPRDYIHRVGRTARGTN 372

>TPHA0G02585 Chr7 (535997..537313) [1317 bp, 438 aa] {ON}
          Length = 438

 Score =  139 bits (349), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 118/455 (25%), Positives = 205/455 (45%), Gaps = 74/455 (16%)

Query: 100 ILELSDDENNISGQTQAGEEEDDVNEYFSTNNLEKQKHKKGS--------FPSFGLSKIV 151
           +LE SD+E +I  Q  A +  ++     +   +E +  KKGS        F  F L   +
Sbjct: 9   LLEYSDNEQDI--QVVADKAAENTETAAADEGVEGED-KKGSYVGIHSTGFKDFLLKPEL 65

Query: 152 LNNIKRKGFRQPTPIQRKTIPLILQSRDIVGMARTGSGKTAAFILPMVEKLKSHSGKIGA 211
              I   GF  P+ +Q+ TIP  +   D++  A++G GKTA F+L  +++L    G++  
Sbjct: 66  SRAIIDCGFEHPSEVQQHTIPQSIHGTDVLCQAKSGLGKTAVFVLSTLQQLDPVPGEVS- 124

Query: 212 RAVILSPSRELAMQTFNVFKDFARGT-ELRSVLLTGGDSLEEQFSMMM---SNPDVIIAT 267
             V++  +RELA Q  N +  F++   E+++ +  GG  ++    ++    + P +I+AT
Sbjct: 125 -VVVICNARELAYQIRNEYLRFSKYMPEVKTAVFYGGTPIKNDADLLKNKETAPQIIVAT 183

Query: 268 PGRFLHLKVEMNLDLKSVEYVVFDEADRLF-EMGFQEQLNELLASLPTTRQTLLFSATLP 326
           PGR   L  +  +DL  V+  V DE D++  E+  +  + ++  + P  +Q ++FSATL 
Sbjct: 184 PGRLKALVRDKLIDLSHVKNFVIDECDKVLEELDMRRDVQDIFRATPRDKQVMMFSATLS 243

Query: 327 NSLVDFVKAGLVNPVLVRLDAETKVS-ENLEMLFLSSKNADREANLLYILQEVIRIPLAT 385
             +    +  L NP+ + +D E K++   L+  ++  +  ++   L  +L ++       
Sbjct: 244 EDIRPICRRFLQNPLEIFVDDEAKLTLHGLQQYYIKIEEREKNRKLAQLLDDL------E 297

Query: 386 SEQLLKLQKSTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMPAANELPSEKATILFVPTR 445
             Q++   KST                                ANEL             
Sbjct: 298 FNQVIIFVKSTKR------------------------------ANEL------------- 314

Query: 446 HHVEYISQLLRDCGYLISYIYGTLDQHARKNQLYNFRAGLTSILVVTDVAARGVDIPMLA 505
                 ++LL D  +    ++G + Q  R  +   F+     I V TDV  RG+DI  + 
Sbjct: 315 ------TKLLNDSNFPAITVHGHMKQAERIARYKAFKDFEKRICVSTDVFGRGIDIERIN 368

Query: 506 NVINYTLPGSSKIFVHRVGRTARAGNKGWAYSIVA 540
             INY L   +  ++HRVGR  R G KG A S V+
Sbjct: 369 LAINYDLTTEADQYLHRVGRAGRFGTKGLAVSFVS 403

>TBLA0B08880 Chr2 complement(2108994..2110322) [1329 bp, 442 aa]
           {ON} Anc_2.384 YDL084W
          Length = 442

 Score =  139 bits (349), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 106/410 (25%), Positives = 185/410 (45%), Gaps = 64/410 (15%)

Query: 137 HKKGSFPSFGLSKIVLNNIKRKGFRQPTPIQRKTIPLILQSRDIVGMARTGSGKTAAFIL 196
           H  G F  F L   +   I   GF  P+ +Q+ TIP  +   D++  A++G GKTA F+L
Sbjct: 56  HSTG-FKDFLLKPELSRAIIDCGFEHPSEVQQSTIPQSIHGTDVLCQAKSGLGKTAVFVL 114

Query: 197 PMVEKLKSHSGKIGARAVILSPSRELAMQTFNVFKDFARGT-ELRSVLLTGGDSLEEQFS 255
             +++L    G+  A  V++  +RELA Q  N +  F++   ++++ +  GG  + +   
Sbjct: 115 SSLQQLDPVPGE--ASVVVICNARELAYQIRNEYLRFSKYMPDVKTAVFYGGTPINKDAE 172

Query: 256 MMM---SNPDVIIATPGRFLHLKVEMNLDLKSVEYVVFDEADRLF-EMGFQEQLNELLAS 311
           ++    + P +++ATPGR   L  +  +DL  V+  + DE D++  E+  +  + ++  +
Sbjct: 173 LLKNKDTAPHIVVATPGRLKALVKDKLIDLSHVKNFIIDECDKVLEELDMRRDVQDIFRA 232

Query: 312 LPTTRQTLLFSATLPNSLVDFVKAGLVNPVLVRLDAETKVS-ENLEMLFLSSKNADREAN 370
            P  +Q ++FSATL   +    +  L NP+ + +D E K++   L+  F+    +D+   
Sbjct: 233 TPRDKQVMMFSATLSQEIRPICRRFLQNPLEIFVDDEAKLTLHGLQQFFIKLSESDKNRK 292

Query: 371 LLYILQEVIRIPLATSEQLLKLQKSTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMPAAN 430
           L  +L ++         Q++   KST                                AN
Sbjct: 293 LAQLLDDL------EFNQVIIFVKSTKR------------------------------AN 316

Query: 431 ELPSEKATILFVPTRHHVEYISQLLRDCGYLISYIYGTLDQHARKNQLYNFRAGLTSILV 490
           EL                   ++LL    +    ++G++ Q  R  +   F+     I V
Sbjct: 317 EL-------------------TKLLNASNFPAITVHGSMKQEERIARYKAFKDFEKRICV 357

Query: 491 VTDVAARGVDIPMLANVINYTLPGSSKIFVHRVGRTARAGNKGWAYSIVA 540
            TDV  RG+DI  +   INY L   +  ++HRVGR  R G KG A S V+
Sbjct: 358 STDVFGRGIDIERINLAINYDLTNEADQYLHRVGRAGRFGTKGLAISFVS 407

>KLTH0G07766g Chr7 complement(626094..628388) [2295 bp, 764 aa] {ON}
           highly similar to uniprot|P20448 Saccharomyces
           cerevisiae YJL033W HCA4 Putative nucleolar DEAD box RNA
           helicase high-copy number suppression of a U14 snoRNA
           processing mutant suggests an involvement in 18S rRNA
           synthesis
          Length = 764

 Score =  143 bits (360), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 76/201 (37%), Positives = 122/201 (60%), Gaps = 4/201 (1%)

Query: 142 FPSFGLSKIVLNNIKRKGFRQPTPIQRKTIPLILQSRDIVGMARTGSGKTAAFILPMVEK 201
           F    LS   L  ++   F + T IQ+ +IP+ L+  D++  A+TGSGKT AF++P++EK
Sbjct: 43  FKDLPLSHQTLKGLRDSAFIKMTEIQKMSIPVSLKGHDLLAAAKTGSGKTLAFLIPVIEK 102

Query: 202 L--KSHSGKIGARAVILSPSRELAMQTFNVFKDFARGTELRSVLLTGGDSLEEQFSMMMS 259
           L  +  +   G  A+I+SP+RELAMQT+ V     R T   + L+ GG  ++ +   + S
Sbjct: 103 LYREKWTEFDGLGALIISPTRELAMQTYEVLTKIGRYTSFSAGLVIGGKEVKFELDRI-S 161

Query: 260 NPDVIIATPGRFL-HLKVEMNLDLKSVEYVVFDEADRLFEMGFQEQLNELLASLPTTRQT 318
             ++++ TPGR L H+   + L+  +++ +V DEADR  +MGF++ L+ ++ +LP  RQT
Sbjct: 162 KINILVGTPGRILQHMDQAVGLNTSNLQVLVLDEADRCLDMGFKKTLDAIVMNLPPVRQT 221

Query: 319 LLFSATLPNSLVDFVKAGLVN 339
           LLFSAT   SL D  +  L +
Sbjct: 222 LLFSATQSQSLADLARLSLTD 242

 Score = 65.1 bits (157), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 31/97 (31%), Positives = 50/97 (51%), Gaps = 2/97 (2%)

Query: 439 ILFVPTRHHVEYISQLLRDC--GYLISYIYGTLDQHARKNQLYNFRAGLTSILVVTDVAA 496
           I+F+ +   V ++ +  R    G  + +++G   Q AR   L  F     + L  TDV A
Sbjct: 293 IVFLSSSKQVHFVYETFRKLQPGISLMHLHGRQKQTARTETLDKFSRAQHTCLFATDVVA 352

Query: 497 RGVDIPMLANVINYTLPGSSKIFVHRVGRTARAGNKG 533
           RG+D P +  V+    P +   ++HRVGR+AR G +G
Sbjct: 353 RGIDFPAVDWVVQADCPENVDTYIHRVGRSARYGKQG 389

>AFL221C Chr6 complement(22711..23108,23775..25050) [1674 bp, 557
           aa] {ON} Syntenic homolog of Saccharomyces cerevisiae
           YNL112W (DBP2); 1-intron
          Length = 557

 Score =  140 bits (354), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 81/264 (30%), Positives = 140/264 (53%), Gaps = 8/264 (3%)

Query: 121 DDVNEYFSTNNLEKQKHKKG----SFPSFGLSKIVLNNIKRKGFRQPTPIQRKTIPLILQ 176
           D+V ++   N ++   H       +F   G  + VL  +K +GF +PT IQ +  P+ L 
Sbjct: 91  DEVEQFRKENEMKIVGHDVPKPIRTFDEAGFPEYVLKEVKEEGFEKPTAIQCQGWPMALS 150

Query: 177 SRDIVGMARTGSGKTAAFILPMVEKLKSH---SGKIGARAVILSPSRELAMQTFNVFKDF 233
            RD++G+A TGSGKT ++ LP +  + +    S   G   ++L+P+RELA+Q       F
Sbjct: 151 GRDMIGVAATGSGKTLSYCLPGIVHINAQPLLSPGDGPVVLVLAPTRELAVQIQKECSKF 210

Query: 234 ARGTELRSVLLTGGDSLEEQFSMMMSNPDVIIATPGRFLHLKVEMNLDLKSVEYVVFDEA 293
            R + +R+  + GG    +Q   +    +++IATPGR + +      +LK V Y+V DEA
Sbjct: 211 GRSSRIRNTCVYGGVPKSQQIRDLQRGVEILIATPGRLIDMLEIGKTNLKRVTYLVLDEA 270

Query: 294 DRLFEMGFQEQLNELLASLPTTRQTLLFSATLPNSLVDFVKAGLVNPVLVRLDA-ETKVS 352
           DR+ +MGF+ Q+ +++  +   RQTL++SAT P  +    +  L +P+ V + + E   S
Sbjct: 271 DRMLDMGFEPQIRKIVDQIRPDRQTLMWSATWPKEVQQLARDYLHDPIQVNIGSLELAAS 330

Query: 353 ENLEMLFLSSKNADREANLLYILQ 376
             +  L     + D+   L+  L+
Sbjct: 331 HTITQLGEVVSDFDKRDRLVKHLE 354

 Score = 74.7 bits (182), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 38/99 (38%), Positives = 56/99 (56%)

Query: 439 ILFVPTRHHVEYISQLLRDCGYLISYIYGTLDQHARKNQLYNFRAGLTSILVVTDVAARG 498
           I+   T+   + I+  LR  G+    I+G          L ++R G + I+V TDV ARG
Sbjct: 365 IILHSTKRTCDEITSYLRQDGWPALAIHGPTPLQDIDCTLNDYRTGRSPIMVATDVVARG 424

Query: 499 VDIPMLANVINYTLPGSSKIFVHRVGRTARAGNKGWAYS 537
           +D+  +  VINY +PG+ + +VHR+GRT RAG  G A S
Sbjct: 425 IDVKGINFVINYDMPGNIEDYVHRIGRTGRAGATGTAIS 463

>KAFR0B00910 Chr2 complement(168186..169724) [1539 bp, 512 aa] {ON}
           Anc_7.336 YDL160C
          Length = 512

 Score =  140 bits (352), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 74/211 (35%), Positives = 119/211 (56%), Gaps = 2/211 (0%)

Query: 138 KKGSFPSFGLSKIVLNNIKRKGFRQPTPIQRKTIPLILQSRDIVGMARTGSGKTAAFILP 197
           K  +F  F L + +L  I   GF +P+PIQ ++IP+ +  RDI+  A+ G+GKTAAF++P
Sbjct: 43  KGNTFEDFHLKRELLMGIFEAGFEKPSPIQEESIPVAITGRDILARAKNGTGKTAAFVIP 102

Query: 198 MVEKLKSHSGKIGARAVILSPSRELAMQTFNVFKDFARGTELRSVLLTGGDSLEEQFSMM 257
            ++K+K    KI  +A+I+ P+RELA+QT  V +   +   +  ++ TGG +L +    +
Sbjct: 103 TLQKIKPKVNKI--QALIMVPTRELALQTSQVVRTLGKHCGISCMVTTGGTNLRDDILRL 160

Query: 258 MSNPDVIIATPGRFLHLKVEMNLDLKSVEYVVFDEADRLFEMGFQEQLNELLASLPTTRQ 317
                V++ TPGR L L      DL      + DEAD++    F+  + ++L  LP   Q
Sbjct: 161 NDTVHVLVGTPGRVLDLASRKIADLSECALFIMDEADKMLSRDFKTIIEQILIFLPKNHQ 220

Query: 318 TLLFSATLPNSLVDFVKAGLVNPVLVRLDAE 348
           +LLFSAT P ++ +F+   L  P  + L  E
Sbjct: 221 SLLFSATFPLTVKEFMVKHLNKPYEINLMEE 251

 Score = 74.3 bits (181), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 32/101 (31%), Positives = 58/101 (57%)

Query: 439 ILFVPTRHHVEYISQLLRDCGYLISYIYGTLDQHARKNQLYNFRAGLTSILVVTDVAARG 498
           I+F  + + VE +++ + D GY   Y +  + Q  R    + FR G    LV +D+  RG
Sbjct: 286 IIFCNSTNRVELLAKKITDLGYSCYYSHARMKQQERNKVFHEFRQGKVRTLVCSDLLTRG 345

Query: 499 VDIPMLANVINYTLPGSSKIFVHRVGRTARAGNKGWAYSIV 539
           +DI  +  VIN+  P +++ ++HR+GR+ R G+ G A +++
Sbjct: 346 IDIQAVNVVINFDFPKTAETYLHRIGRSGRFGHLGLAINLI 386

>ZYRO0F11440g Chr6 (939613..941184) [1572 bp, 523 aa] {ON} highly
           similar to uniprot|Q75BS4 Ashbya gossypii ACR197W DHH1
           ATP-dependent RNA helicase DHH1 and similar to YDL160C
           uniprot|P39517 Saccharomyces cerevisiae YDL160C DHH1
           Cytoplasmic DExD/H-box helicase stimulates mRNA
           decapping coordinates distinct steps in mRNA function
           and decay interacts with both the decapping and
           deadenylase complexes may have a role in mRNA export and
           translation
          Length = 523

 Score =  140 bits (352), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 77/211 (36%), Positives = 119/211 (56%), Gaps = 2/211 (0%)

Query: 138 KKGSFPSFGLSKIVLNNIKRKGFRQPTPIQRKTIPLILQSRDIVGMARTGSGKTAAFILP 197
           K  +F  F L + +L  I   GF +P+PIQ ++IP+ L  RDI+  A+ G+GKTAAF++P
Sbjct: 28  KGNTFEDFFLKRELLMGIFEAGFEKPSPIQEESIPVALAGRDILARAKNGTGKTAAFVIP 87

Query: 198 MVEKLKSHSGKIGARAVILSPSRELAMQTFNVFKDFARGTELRSVLLTGGDSLEEQFSMM 257
            +EK+K    KI  +A+I+ P+RELA+QT  V +   +   +  ++ TGG +L +    +
Sbjct: 88  TLEKVKPKINKI--QALIMVPTRELALQTSQVVRTLGKHCGVSCMVTTGGTNLRDDILRL 145

Query: 258 MSNPDVIIATPGRFLHLKVEMNLDLKSVEYVVFDEADRLFEMGFQEQLNELLASLPTTRQ 317
                V++ TPGR L L      DL      V DEAD++    F+  + ++L  LP   Q
Sbjct: 146 NETVHVLVGTPGRVLDLASRKVADLSECSLFVMDEADKMLSRDFKTIIEQILIFLPPQHQ 205

Query: 318 TLLFSATLPNSLVDFVKAGLVNPVLVRLDAE 348
           +LLFSAT P ++ +F+   L  P  + L  E
Sbjct: 206 SLLFSATFPITVKEFMVKHLHKPYEINLMEE 236

 Score = 73.2 bits (178), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 32/101 (31%), Positives = 58/101 (57%)

Query: 439 ILFVPTRHHVEYISQLLRDCGYLISYIYGTLDQHARKNQLYNFRAGLTSILVVTDVAARG 498
           I+F  + + VE +++ + D GY   Y +  + Q  R    + FR G    LV +D+  RG
Sbjct: 271 IIFCNSTNRVELLAKKITDLGYSCYYSHARMRQQERNKVFHEFRQGKVRTLVCSDLLTRG 330

Query: 499 VDIPMLANVINYTLPGSSKIFVHRVGRTARAGNKGWAYSIV 539
           +DI  +  VIN+  P +++ ++HR+GR+ R G+ G A +++
Sbjct: 331 IDIQAVNVVINFDFPKTAETYLHRIGRSGRFGHLGLAINLI 371

>CAGL0L06908g Chr12 complement(779554..780873) [1320 bp, 439 aa]
           {ON} highly similar to uniprot|Q07478 Saccharomyces
           cerevisiae YDL084w SUB2
          Length = 439

 Score =  138 bits (348), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 116/454 (25%), Positives = 198/454 (43%), Gaps = 71/454 (15%)

Query: 100 ILELSDDENNISGQTQAGEEEDDVNEYFSTNNLEKQK-------HKKGSFPSFGLSKIVL 152
           +LE SD+E  I    +    E       +  N E  K       H  G F  F L   + 
Sbjct: 9   LLEYSDNEQEIQVDNKETAVEGTTENEATQENGEADKKGSYVGIHSTG-FKDFLLKPELS 67

Query: 153 NNIKRKGFRQPTPIQRKTIPLILQSRDIVGMARTGSGKTAAFILPMVEKLKSHSGKIGAR 212
             I   GF  P+ +Q+ TIP  +   D++  A++G GKTA F+L  +++L    G++   
Sbjct: 68  RAIIDCGFEHPSEVQQHTIPQSIHGTDVLCQAKSGLGKTAVFVLSTLQQLDPVPGEVS-- 125

Query: 213 AVILSPSRELAMQTFNVFKDFARGT-ELRSVLLTGGDSLEEQFSMMM---SNPDVIIATP 268
            V++  +RELA Q  N +  F++   ++R+ +  GG  + +   ++    + P +++ATP
Sbjct: 126 VVVICNARELAYQIRNEYLRFSKYMPDVRTAVFYGGTPIAKDAELLKNKDTAPHIVVATP 185

Query: 269 GRFLHLKVEMNLDLKSVEYVVFDEADRLF-EMGFQEQLNELLASLPTTRQTLLFSATLPN 327
           GR   L  +  +DL  V+  V DE D++  E+  +  + E+  + P  +Q ++FSATL  
Sbjct: 186 GRLKALVRDKMIDLSHVKNFVIDECDKVLEELDMRRDVQEIFRATPRDKQVMMFSATLSQ 245

Query: 328 SLVDFVKAGLVNPVLVRLDAETKVS-ENLEMLFLSSKNADREANLLYILQEVIRIPLATS 386
            +    +  L NP+ + +D E K++   L+  ++  +  ++   L  +L ++        
Sbjct: 246 EIRPICRRFLQNPLEIFVDDEAKLTLHGLQQYYIKLEEREKNRKLAQLLDDL------EF 299

Query: 387 EQLLKLQKSTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMPAANELPSEKATILFVPTRH 446
            Q++   KST                                ANEL              
Sbjct: 300 NQVIIFVKSTSR------------------------------ANEL-------------- 315

Query: 447 HVEYISQLLRDCGYLISYIYGTLDQHARKNQLYNFRAGLTSILVVTDVAARGVDIPMLAN 506
                ++LL    +    ++G + Q  R  +   F+     I V TDV  RG+DI  +  
Sbjct: 316 -----TKLLNASNFPAITVHGHMKQEERIARYKAFKDFEKRICVSTDVFGRGIDIERINL 370

Query: 507 VINYTLPGSSKIFVHRVGRTARAGNKGWAYSIVA 540
            INY L   +  ++HRVGR  R G KG A S V+
Sbjct: 371 AINYDLLNEADQYLHRVGRAGRFGTKGLAISFVS 404

>KNAG0A05850 Chr1 (873957..875306) [1350 bp, 449 aa] {ON} Anc_2.384
           YDL084W
          Length = 449

 Score =  138 bits (348), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 104/410 (25%), Positives = 186/410 (45%), Gaps = 64/410 (15%)

Query: 137 HKKGSFPSFGLSKIVLNNIKRKGFRQPTPIQRKTIPLILQSRDIVGMARTGSGKTAAFIL 196
           H  G F  F L   +   I   GF  P+ +Q+ TIP  +   D++  A++G GKTA F+L
Sbjct: 63  HSTG-FKDFLLKPELSRAIIDCGFEHPSEVQQHTIPQSIHGTDVLCQAKSGLGKTAVFVL 121

Query: 197 PMVEKLKSHSGKIGARAVILSPSRELAMQTFNVFKDFARGT-ELRSVLLTGGDSLEEQFS 255
             +++L    G++    V++  +RELA Q  N +  F++   ++++ +  GG  + +   
Sbjct: 122 STLQQLDPIPGEVS--VVVICNARELAYQIRNEYLRFSKYMPDVKTAVFYGGTPINKDAE 179

Query: 256 MMM---SNPDVIIATPGRFLHLKVEMNLDLKSVEYVVFDEADRLF-EMGFQEQLNELLAS 311
           ++    ++P +++ATPGR   L  +  +DL  V+  V DE D++  E+  +  + ++  +
Sbjct: 180 LLKNKETSPHIVVATPGRLKALVRDKMIDLSHVKNFVIDECDKVLEELDMRRDVQDIFRA 239

Query: 312 LPTTRQTLLFSATLPNSLVDFVKAGLVNPVLVRLDAETKVS-ENLEMLFLSSKNADREAN 370
            P  +Q ++FSATL   +    +  L NP+ + +D E K++   L+  +   +  ++   
Sbjct: 240 TPRDKQVMMFSATLSQEIRPICRRFLQNPLEIFVDDEAKLTLHGLQQYYTKLEEREKNRK 299

Query: 371 LLYILQEVIRIPLATSEQLLKLQKSTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMPAAN 430
           L  +L ++         Q++   KST                                AN
Sbjct: 300 LAQLLDDL------EFNQVIIFVKSTNR------------------------------AN 323

Query: 431 ELPSEKATILFVPTRHHVEYISQLLRDCGYLISYIYGTLDQHARKNQLYNFRAGLTSILV 490
           EL                   ++LL +  +    ++G + Q  R  +   F+     I V
Sbjct: 324 EL-------------------TKLLNESNFPAITVHGHMKQEERIARYKAFKDFEKRICV 364

Query: 491 VTDVAARGVDIPMLANVINYTLPGSSKIFVHRVGRTARAGNKGWAYSIVA 540
            TDV  RG+DI  +   INY LP  +  ++HRVGR  R G KG A S ++
Sbjct: 365 STDVFGRGIDIERINLAINYDLPSEADQYLHRVGRAGRFGTKGLAISFIS 414

>Ecym_2213 Chr2 (419873..421537) [1665 bp, 554 aa] {ON} similar to
           Ashbya gossypii AFL080W
          Length = 554

 Score =  140 bits (353), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 81/240 (33%), Positives = 129/240 (53%), Gaps = 8/240 (3%)

Query: 122 DVNEYFSTNNLEKQKHKKGSF-PSFGLSKIVLNNIKRK---GFRQPTPIQRKTIPLILQS 177
           D+  +F  N +  +  +  +  P    S I LNN  +K    F +PTPIQ  + P +L  
Sbjct: 119 DIESFFKDNEVSVEDPESSNLRPLLSFSHISLNNEVQKVVAKFPKPTPIQAVSWPYLLSG 178

Query: 178 RDIVGMARTGSGKTAAFILPMVEKLKSH--SGKIGARAVILSPSRELAMQTFNVFKDFAR 235
           +D++G+A TGSGKT AF +P V  + S   +     + +I+SP+RELA Q ++   +   
Sbjct: 179 KDVIGVAETGSGKTFAFGVPAVNNIVSSGDASNKNVQCLIISPTRELASQIYDNLVELTN 238

Query: 236 GTELRSVLLTGGDSLEEQFSMMMSNPDVIIATPGRFLHLKVEMNLDLKSVEYVVFDEADR 295
              L    L GG   + Q  + + N  +++ATPGR L L  E   DL  V+Y+V DEADR
Sbjct: 239 KVSLNCCCLYGGVPKDAQ-RLQLKNSQIVVATPGRLLDLIQEGYADLSQVQYLVLDEADR 297

Query: 296 LFEMGFQEQLNELLASLPTT-RQTLLFSATLPNSLVDFVKAGLVNPVLVRLDAETKVSEN 354
           + E GF+E + +++     T RQTL+F+AT P  + +     + +PV + +    ++S N
Sbjct: 298 MLEKGFEEDIKKIIKETDVTRRQTLMFTATWPKEVRELASTFMKHPVKISIGNRDELSAN 357

 Score = 86.3 bits (212), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 40/101 (39%), Positives = 64/101 (63%)

Query: 438 TILFVPTRHHVEYISQLLRDCGYLISYIYGTLDQHARKNQLYNFRAGLTSILVVTDVAAR 497
            ++F   +     + + L+  GY ++ I+G L Q  R   L +F++G T++L+ TDVAAR
Sbjct: 393 VLIFALYKKEASRVERNLQYNGYNVAAIHGDLSQQQRTQALDDFKSGKTNLLLATDVAAR 452

Query: 498 GVDIPMLANVINYTLPGSSKIFVHRVGRTARAGNKGWAYSI 538
           G+DIP +  VIN T P + + +VHR+GRT RAG  G A+++
Sbjct: 453 GLDIPNVKTVINLTFPLTVEDYVHRIGRTGRAGASGTAHTL 493

>KNAG0F02610 Chr6 complement(488956..491244) [2289 bp, 762 aa] {ON}
           Anc_5.241 YJL033W
          Length = 762

 Score =  142 bits (358), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 83/224 (37%), Positives = 129/224 (57%), Gaps = 9/224 (4%)

Query: 124 NEYFSTNNLEKQKH-----KKGSFPSFGLSKIVLNNIKRKGFRQPTPIQRKTIPLILQSR 178
           NEY    N   Q++     +   F    L + VL  +    F + T IQR++IP+ LQ  
Sbjct: 20  NEYIEELNKRTQEYDPKLQRATFFKDLPLCRNVLKGLSASAFVKLTAIQRESIPVSLQGH 79

Query: 179 DIVGMARTGSGKTAAFILPMVEKL--KSHSGKIGARAVILSPSRELAMQTFNVFKDFARG 236
           D++  A+TGSGKT AF++P++EKL  +  +   G  A+I+SP+RELAMQ + V       
Sbjct: 80  DVLAAAKTGSGKTLAFLVPVLEKLYRERWTEFDGLGALIISPTRELAMQIYEVLVKVGSQ 139

Query: 237 TELRSVLLTGGDSLEEQFSMMMSNPDVIIATPGRFL-HLKVEMNLDLKSVEYVVFDEADR 295
               + L+ GG  ++ + S  +S  +++I TPGR L HL   + L+  +++ +V DEADR
Sbjct: 140 CSFSAGLVIGGKDVKYE-SERISKINILIGTPGRILQHLDQAVGLNASNLQMLVLDEADR 198

Query: 296 LFEMGFQEQLNELLASLPTTRQTLLFSATLPNSLVDFVKAGLVN 339
             +MGF++ L+ ++ +LP  RQTLLFSAT   SL D  +  L +
Sbjct: 199 CLDMGFKKTLDAIVGNLPPMRQTLLFSATQSASLADLARLSLTD 242

 Score = 67.0 bits (162), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 34/99 (34%), Positives = 51/99 (51%), Gaps = 2/99 (2%)

Query: 439 ILFVPTRHHVEYISQLLRDC--GYLISYIYGTLDQHARKNQLYNFRAGLTSILVVTDVAA 496
           I+F+ +   V +I +  R    G  + +++G   Q AR + L  F       L  TDV A
Sbjct: 297 IVFLSSGKQVHFIYETFRKMQPGISLMHLHGRQKQTARTDTLDKFVRAQQVCLFATDVVA 356

Query: 497 RGVDIPMLANVINYTLPGSSKIFVHRVGRTARAGNKGWA 535
           RG+D P +  V+    P  +  ++HRVGR+AR G KG A
Sbjct: 357 RGIDFPAVDWVVQVDCPEDADTYIHRVGRSARYGKKGKA 395

>Suva_4.163 Chr4 (294691..296031) [1341 bp, 446 aa] {ON} YDL084W
           (REAL)
          Length = 446

 Score =  138 bits (348), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 119/460 (25%), Positives = 200/460 (43%), Gaps = 76/460 (16%)

Query: 100 ILELSDDENNISGQTQAGEEEDDVNEYFST-----NNLEKQKHKKGS--------FPSFG 146
           +LE SD+E  I        E  +     ST     NN      KKGS        F  F 
Sbjct: 9   LLEYSDNEQEIQIDASKAAEAGETGAATSTTEGENNNNTAAGDKKGSYVGIHSTGFKDFL 68

Query: 147 LSKIVLNNIKRKGFRQPTPIQRKTIPLILQSRDIVGMARTGSGKTAAFILPMVEKLKSHS 206
           L   +   I   GF  P+ +Q+ TIP  +   D++  A++G GKTA F+L  +++L    
Sbjct: 69  LKPELSRAIIDCGFEHPSEVQQHTIPQSIHGTDVLCQAKSGLGKTAVFVLSTLQQLDPVP 128

Query: 207 GKIGARAVILSPSRELAMQTFNVFKDFARGT-ELRSVLLTGGDSLEEQFSMMM---SNPD 262
           G++    V++  +RELA Q  N +  F++   ++++ +  GG  + +   ++    + P 
Sbjct: 129 GEVA--VVVICNARELAYQIRNEYLRFSKYMPDVKTAVFYGGTPISKDAELLKNKDTAPH 186

Query: 263 VIIATPGRFLHLKVEMNLDLKSVEYVVFDEADRLF-EMGFQEQLNELLASLPTTRQTLLF 321
           +++ATPGR   L  E  +DL  V+  V DE D++  E+  +  + E+  + P  +Q ++F
Sbjct: 187 IVVATPGRLKALVREKYIDLSHVKNFVIDECDKVLEELDMRRDVQEIFRATPRDKQVMMF 246

Query: 322 SATLPNSLVDFVKAGLVNPVLVRLDAETKVS-ENLEMLFLSSKNADREANLLYILQEVIR 380
           SATL   +    +  L NP+ + +D E K++   L+  ++  +  ++   L  +L ++  
Sbjct: 247 SATLSQEIRPICRRFLQNPLEIFVDDEAKLTLHGLQQYYIKLEEREKNRKLAQLLDDL-- 304

Query: 381 IPLATSEQLLKLQKSTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMPAANELPSEKATIL 440
                  Q++   KST                                ANEL        
Sbjct: 305 ----EFNQVIIFVKSTNR------------------------------ANEL-------- 322

Query: 441 FVPTRHHVEYISQLLRDCGYLISYIYGTLDQHARKNQLYNFRAGLTSILVVTDVAARGVD 500
                      ++LL    +    ++G + Q  R  +   F+     I V TDV  RG+D
Sbjct: 323 -----------TKLLNASNFPAITVHGHMKQEERIARYKAFKDFEKRICVSTDVFGRGID 371

Query: 501 IPMLANVINYTLPGSSKIFVHRVGRTARAGNKGWAYSIVA 540
           I  +   INY L   +  ++HRVGR  R G KG A S V+
Sbjct: 372 IERINLAINYDLTNEADQYLHRVGRAGRFGTKGLAISFVS 411

>TBLA0C00640 Chr3 (129301..131040) [1740 bp, 579 aa] {ON} Anc_8.124
           YGL171W
          Length = 579

 Score =  140 bits (354), Expect = 5e-34,   Method: Compositional matrix adjust.
 Identities = 89/253 (35%), Positives = 148/253 (58%), Gaps = 22/253 (8%)

Query: 140 GSFPS----FGLSKIVLNNIKRKGFRQPTPIQRKTIPLILQSRDIVGMARTGSGKTAAFI 195
           GSF      F   K +LNN+    F +PTPIQ + IP+ L  RDIV  A TGSGKT AF+
Sbjct: 125 GSFDDLITRFSFDKRLLNNLIDNHFTEPTPIQSEAIPIALLDRDIVACAPTGSGKTMAFL 184

Query: 196 LPMVEKLKSHSGKIGARAVILSPSRELAMQTF--------NVFKDFARGTELRSVLLTGG 247
           +P+++++      +G + +I+SP++ELA Q F        ++F  F +   L+  LL+  
Sbjct: 185 IPLLQQIIDEKKVVGLKGLIISPTKELANQIFLECVKLSRSIF--FEKKRPLQVALLSKS 242

Query: 248 DSLEEQFSMMMSNP--DVIIATPGRFLHLKVEMNLDLKSVEYVVFDEADRLFEMGFQEQL 305
            S + + + ++SN   D+II+TP R + +    +LDL  V++++FDEAD+LF+  F EQ 
Sbjct: 243 LSAKLK-NKVISNSKYDIIISTPLRLIDVVRNESLDLSKVKHLIFDEADKLFDKTFVEQT 301

Query: 306 NELLASL--PTTRQTLLFSATLPNSLVDFVKAGLVNPVLVRLDAETKVSENLEMLFLSSK 363
           +++L+S   P  R++ +FSAT+P+S+ D  ++ + +PV V +  +   + N+E   +   
Sbjct: 302 DDILSSCTDPALRKS-MFSATIPSSVEDIAQSLMNDPVRVVIGHKEAANSNIEQKLIFCG 360

Query: 364 NADREANLLYILQ 376
           N   E  L+ I Q
Sbjct: 361 N--EEGKLIAIKQ 371

 Score = 66.2 bits (160), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 32/77 (41%), Positives = 45/77 (58%)

Query: 462 ISYIYGTLDQHARKNQLYNFRAGLTSILVVTDVAARGVDIPMLANVINYTLPGSSKIFVH 521
           +  I+       R   +  F++G    L+ TDV ARGVD   +  VINY +P SS+ +VH
Sbjct: 406 VDVIHAERTTIQRNKIIERFKSGELWCLICTDVLARGVDFKGVNLVINYDVPRSSQAYVH 465

Query: 522 RVGRTARAGNKGWAYSI 538
           R+GRT RAG KG A ++
Sbjct: 466 RIGRTGRAGRKGKAITL 482

>TBLA0D03400 Chr4 (844529..846856) [2328 bp, 775 aa] {ON} Anc_5.241
           YJL033W
          Length = 775

 Score =  142 bits (358), Expect = 5e-34,   Method: Compositional matrix adjust.
 Identities = 77/201 (38%), Positives = 125/201 (62%), Gaps = 4/201 (1%)

Query: 142 FPSFGLSKIVLNNIKRKGFRQPTPIQRKTIPLILQSRDIVGMARTGSGKTAAFILPMVEK 201
           F    +S   L  +K   F + T IQ+ +IP+ L+  D++G A+TGSGKT AF++P++EK
Sbjct: 44  FKDLPISNATLRGLKEASFVKLTEIQKNSIPISLKGYDVLGAAKTGSGKTLAFLIPVLEK 103

Query: 202 L--KSHSGKIGARAVILSPSRELAMQTFNVFKDFARGTELRSVLLTGGDSLEEQFSMMMS 259
           L  ++ +   G  A+I+SP+RELA+Q + V       T   + L+ GG  ++ + S  +S
Sbjct: 104 LYRENWTEFDGLGALIISPTRELAIQIYEVLLKIGSRTSFSAGLVIGGKDVKFE-SERIS 162

Query: 260 NPDVIIATPGRFL-HLKVEMNLDLKSVEYVVFDEADRLFEMGFQEQLNELLASLPTTRQT 318
             +++I TPGR L H+   + L+L +++ +V DEADR  +MGF++ L+ ++ +LP +RQT
Sbjct: 163 RINILIGTPGRILQHMDQAVGLNLNNLQMLVLDEADRCLDMGFKKTLDAIVNNLPISRQT 222

Query: 319 LLFSATLPNSLVDFVKAGLVN 339
           LLFSAT   SL D  +  L +
Sbjct: 223 LLFSATQSQSLDDLARLSLTD 243

 Score = 64.3 bits (155), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 43/156 (27%), Positives = 68/156 (43%), Gaps = 7/156 (4%)

Query: 439 ILFVPTRHHVEYISQLLRDC--GYLISYIYGTLDQHARKNQLYNFRAGLTSILVVTDVAA 496
           I+F+ +   V ++ +  R    G  + +++G   Q AR   L  F       L  TDV A
Sbjct: 296 IIFLSSSKQVHFVYETFRKLQPGISLMHLHGRQKQKARTETLDKFSRAQQVCLFATDVVA 355

Query: 497 RGVDIPMLANVINYTLPGSSKIFVHRVGRTARAGNKGWAYSIVAXXXXXXXXXXXXXXGK 556
           RG+D P +  V+    P     ++HRVGR AR G +G   S++                K
Sbjct: 356 RGIDFPSVDWVVQVDCPEDVDTYIHRVGRCARYGKQGK--SLIMLTPTEEAGFLKRLASK 413

Query: 557 KILLTPMYDSLVDVMKKRWVEEGNSAYNFQLPKLSY 592
           KI    +   ++   KKR ++    +  FQ P+L Y
Sbjct: 414 KIEPKKL---VIKQSKKRSIKPQLQSILFQDPELKY 446

>KNAG0A04660 Chr1 (663566..665707) [2142 bp, 713 aa] {ON} Anc_8.402
           YDR194C
          Length = 713

 Score =  142 bits (357), Expect = 5e-34,   Method: Compositional matrix adjust.
 Identities = 118/411 (28%), Positives = 189/411 (45%), Gaps = 73/411 (17%)

Query: 147 LSKIVLNNIKRKGFRQPTPIQRKTIPLILQSR--DIVGMARTGSGKTAAFILPMVEKL-- 202
           + K++  +I R GF + T +Q+KTI  IL+ +  D++  A+TG+GKT AF++P+ + L  
Sbjct: 139 IDKMLHKSISRMGFPELTSVQQKTIKPILEDKENDVIARAKTGTGKTFAFLIPIFQHLIN 198

Query: 203 KSHSGKIGARAVILSPSRELAMQT---FNVFKDFARGTE-LRSVLLTGGDSLEEQFSMMM 258
                +   ++VI++P+R+LA+Q         D   G +  + + L GG         M 
Sbjct: 199 TQFDSQYMVKSVIVAPTRDLALQIEAEVRKIHDNNYGLKKFQCISLVGGTDFRRAMDKMH 258

Query: 259 S-NPDVIIATPGRFLHLKVEMNLDLKS-VEYVVFDEADRLFEMGFQ---EQLNELLASLP 313
              P+++IATPGR + +  +        V++ V DEADRL E+GF+   EQ++E+L SL 
Sbjct: 259 KLRPNIVIATPGRLIDVMEKFGKKFFGWVDFKVLDEADRLLEIGFKEDLEQISEMLNSLN 318

Query: 314 TTRQ----TLLFSATLPNSLVDFVKAGLVNPVLVRLDA----ETKVSENLEMLFLSSKNA 365
              +    TLLFSATL   +       +  P  + +D     E +  E +E   + +K  
Sbjct: 319 GHSKDHIRTLLFSATLDEKVQGLANQIMNKPKCLFIDTVDKNEPETHEKIEQSLVVTKEF 378

Query: 366 DREANLLYILQEVIRIPLATSEQLLKLQKSTXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 425
               + +Y   E I+  L                                          
Sbjct: 379 ---GHNIYAAIEHIKAELL----------------------------------------- 394

Query: 426 MPAANELPSEKATILFVPTRHHVEYISQLL-RDC-GYL-ISYIYGTLDQHARKNQLYNFR 482
                E P     ILF PT    ++IS++L R+  G L +   +G + Q  R N +  F+
Sbjct: 395 -----EDPKNYKAILFTPTVKFTKFISRILDRELRGKLRVLEFHGQISQSRRTNLVKEFK 449

Query: 483 AGLTSILVVTDVAARGVDIPMLANVINYTLPGSSKIFVHRVGRTARAGNKG 533
                +LV TDV ARG+D P +  V+   LP     ++HR+GRTAR+G  G
Sbjct: 450 QDRPGLLVCTDVGARGMDFPNIKEVLQIGLPSELANYIHRIGRTARSGKSG 500

>YDL084W Chr4 (305237..306577) [1341 bp, 446 aa] {ON}  SUB2Component
           of the TREX complex required for nuclear mRNA export;
           member of the DEAD-box RNA helicase superfamily and is
           involved in early and late steps of spliceosome
           assembly; homolog of the human splicing factor hUAP56
          Length = 446

 Score =  138 bits (347), Expect = 5e-34,   Method: Compositional matrix adjust.
 Identities = 106/410 (25%), Positives = 184/410 (44%), Gaps = 64/410 (15%)

Query: 137 HKKGSFPSFGLSKIVLNNIKRKGFRQPTPIQRKTIPLILQSRDIVGMARTGSGKTAAFIL 196
           H  G F  F L   +   I   GF  P+ +Q+ TIP  +   D++  A++G GKTA F+L
Sbjct: 60  HSTG-FKDFLLKPELSRAIIDCGFEHPSEVQQHTIPQSIHGTDVLCQAKSGLGKTAVFVL 118

Query: 197 PMVEKLKSHSGKIGARAVILSPSRELAMQTFNVFKDFARGT-ELRSVLLTGGDSLEEQFS 255
             +++L    G++    V++  +RELA Q  N +  F++   ++++ +  GG  + +   
Sbjct: 119 STLQQLDPVPGEVA--VVVICNARELAYQIRNEYLRFSKYMPDVKTAVFYGGTPISKDAE 176

Query: 256 MMM---SNPDVIIATPGRFLHLKVEMNLDLKSVEYVVFDEADRLF-EMGFQEQLNELLAS 311
           ++    + P +++ATPGR   L  E  +DL  V+  V DE D++  E+  +  + E+  +
Sbjct: 177 LLKNKDTAPHIVVATPGRLKALVREKYIDLSHVKNFVIDECDKVLEELDMRRDVQEIFRA 236

Query: 312 LPTTRQTLLFSATLPNSLVDFVKAGLVNPVLVRLDAETKVS-ENLEMLFLSSKNADREAN 370
            P  +Q ++FSATL   +    +  L NP+ + +D E K++   L+  ++  +  ++   
Sbjct: 237 TPRDKQVMMFSATLSQEIRPICRRFLQNPLEIFVDDEAKLTLHGLQQYYIKLEEREKNRK 296

Query: 371 LLYILQEVIRIPLATSEQLLKLQKSTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMPAAN 430
           L  +L ++         Q++   KST                                AN
Sbjct: 297 LAQLLDDL------EFNQVIIFVKSTTR------------------------------AN 320

Query: 431 ELPSEKATILFVPTRHHVEYISQLLRDCGYLISYIYGTLDQHARKNQLYNFRAGLTSILV 490
           EL                   ++LL    +    ++G + Q  R  +   F+     I V
Sbjct: 321 EL-------------------TKLLNASNFPAITVHGHMKQEERIARYKAFKDFEKRICV 361

Query: 491 VTDVAARGVDIPMLANVINYTLPGSSKIFVHRVGRTARAGNKGWAYSIVA 540
            TDV  RG+DI  +   INY L   +  ++HRVGR  R G KG A S V+
Sbjct: 362 STDVFGRGIDIERINLAINYDLTNEADQYLHRVGRAGRFGTKGLAISFVS 411

>NCAS0A03950 Chr1 (799925..801265) [1341 bp, 446 aa] {ON} Anc_2.384
          Length = 446

 Score =  138 bits (347), Expect = 6e-34,   Method: Compositional matrix adjust.
 Identities = 115/460 (25%), Positives = 200/460 (43%), Gaps = 76/460 (16%)

Query: 100 ILELSDDENNISGQTQAGEEEDDVNEYFSTN-----NLEKQKHKKGS--------FPSFG 146
           +LE SD+E  I        E   + E  +         +    KKGS        F  F 
Sbjct: 9   LLEYSDNEQEIQVDANNAAETATITEANAATAEGEATTDGDADKKGSYVGIHSTGFKDFL 68

Query: 147 LSKIVLNNIKRKGFRQPTPIQRKTIPLILQSRDIVGMARTGSGKTAAFILPMVEKLKSHS 206
           L   +   I   GF  P+ +Q+ TIP  +   D++  A++G GKTA F+L  ++++    
Sbjct: 69  LKPELSRAIIDCGFEHPSEVQQHTIPQSIHGTDVLCQAKSGLGKTAVFVLSTLQQMDPVP 128

Query: 207 GKIGARAVILSPSRELAMQTFNVFKDFARGT-ELRSVLLTGGDSLEEQFSMMM---SNPD 262
           G++    V++  +RELA Q  N +  F++   ++++ +  GG  + +   ++    + P 
Sbjct: 129 GEVS--VVVICNARELAYQIRNEYLRFSKYMPDVKTAVFYGGTPIAKDAELLKNKDTAPH 186

Query: 263 VIIATPGRFLHLKVEMNLDLKSVEYVVFDEADRLF-EMGFQEQLNELLASLPTTRQTLLF 321
           +++ATPGR   L  +  +DL  V+  V DE D++  E+  +  + E+  + P  +Q ++F
Sbjct: 187 IVVATPGRLKALVRDKLIDLSHVKNFVIDECDKVLEELNMRRDVQEIFRATPRDKQVMMF 246

Query: 322 SATLPNSLVDFVKAGLVNPVLVRLDAETKVS-ENLEMLFLSSKNADREANLLYILQEVIR 380
           SATL   +    +  L NP+ + +D E K++   L+  ++  +  ++   L  +L ++  
Sbjct: 247 SATLSQEIRPICRRFLQNPLEIFVDDEAKLTLHGLQQYYIRLEEREKNRKLAQLLDDL-- 304

Query: 381 IPLATSEQLLKLQKSTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMPAANELPSEKATIL 440
                  Q++   KST                                ANEL        
Sbjct: 305 ----EFNQVIIFVKSTNR------------------------------ANEL-------- 322

Query: 441 FVPTRHHVEYISQLLRDCGYLISYIYGTLDQHARKNQLYNFRAGLTSILVVTDVAARGVD 500
                      ++LL D  +    ++G + Q  R  +   F+     I V TDV  RG+D
Sbjct: 323 -----------TKLLNDSNFPAITVHGHMKQEERIARYKAFKDFEKRICVSTDVFGRGID 371

Query: 501 IPMLANVINYTLPGSSKIFVHRVGRTARAGNKGWAYSIVA 540
           I  +   INY L   +  ++HRVGR  R G KG A S V+
Sbjct: 372 IERINLAINYDLTTEADQYLHRVGRAGRFGTKGLAISFVS 411

>Smik_4.152 Chr4 (281728..283068) [1341 bp, 446 aa] {ON} YDL084W
           (REAL)
          Length = 446

 Score =  138 bits (347), Expect = 6e-34,   Method: Compositional matrix adjust.
 Identities = 106/410 (25%), Positives = 184/410 (44%), Gaps = 64/410 (15%)

Query: 137 HKKGSFPSFGLSKIVLNNIKRKGFRQPTPIQRKTIPLILQSRDIVGMARTGSGKTAAFIL 196
           H  G F  F L   +   I   GF  P+ +Q+ TIP  +   D++  A++G GKTA F+L
Sbjct: 60  HSTG-FKDFLLKPELSRAIIDCGFEHPSEVQQHTIPQSIHGTDVLCQAKSGLGKTAVFVL 118

Query: 197 PMVEKLKSHSGKIGARAVILSPSRELAMQTFNVFKDFARGT-ELRSVLLTGGDSLEEQFS 255
             +++L    G++    V++  +RELA Q  N +  F++   ++++ +  GG  + +   
Sbjct: 119 STLQQLDPVPGEVA--VVVICNARELAYQIRNEYLRFSKYMPDVKTAVFYGGTPISKDAE 176

Query: 256 MMM---SNPDVIIATPGRFLHLKVEMNLDLKSVEYVVFDEADRLF-EMGFQEQLNELLAS 311
           ++    + P +++ATPGR   L  E  +DL  V+  V DE D++  E+  +  + E+  +
Sbjct: 177 LLKNKDTAPHIVVATPGRLKALVREKYIDLSHVKNFVIDECDKVLEELDMRRDVQEIFRA 236

Query: 312 LPTTRQTLLFSATLPNSLVDFVKAGLVNPVLVRLDAETKVS-ENLEMLFLSSKNADREAN 370
            P  +Q ++FSATL   +    +  L NP+ + +D E K++   L+  ++  +  ++   
Sbjct: 237 TPRDKQVMMFSATLSQEIRPICRRFLQNPLEIFVDDEAKLTLHGLQQYYIKLEEREKNRK 296

Query: 371 LLYILQEVIRIPLATSEQLLKLQKSTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMPAAN 430
           L  +L ++         Q++   KST                                AN
Sbjct: 297 LAQLLDDL------EFNQVIIFVKSTTR------------------------------AN 320

Query: 431 ELPSEKATILFVPTRHHVEYISQLLRDCGYLISYIYGTLDQHARKNQLYNFRAGLTSILV 490
           EL                   ++LL    +    ++G + Q  R  +   F+     I V
Sbjct: 321 EL-------------------TKLLNASNFPAITVHGHMKQEERIARYKAFKDFEKRICV 361

Query: 491 VTDVAARGVDIPMLANVINYTLPGSSKIFVHRVGRTARAGNKGWAYSIVA 540
            TDV  RG+DI  +   INY L   +  ++HRVGR  R G KG A S V+
Sbjct: 362 STDVFGRGIDIERINLAINYDLTNEADQYLHRVGRAGRFGTKGLAISFVS 411

>Ecym_4775 Chr4 (1507889..1509391) [1503 bp, 500 aa] {ON} similar to
           Ashbya gossypii AGR333C
          Length = 500

 Score =  139 bits (349), Expect = 6e-34,   Method: Compositional matrix adjust.
 Identities = 83/245 (33%), Positives = 140/245 (57%), Gaps = 11/245 (4%)

Query: 142 FPSFGLSKIVLNNIKRKGFRQPTPIQRKTIPLILQSRDIVGMARTGSGKTAAFILPMVEK 201
           F   GLSK  L  I++ GF   T +Q KTIP ++  RD++G A+TGSGKT AF++P +E 
Sbjct: 38  FDELGLSKQTLKAIEKMGFTTMTQVQAKTIPPLMAGRDVLGAAKTGSGKTLAFLIPAIEM 97

Query: 202 LKSHSGKI----GARAVILSPSRELAMQTFNVFKDFARGTELRSVLLTGGDSLEEQFSMM 257
           L  HS K     G   ++++P+RELA+Q F V ++          ++ GG +  ++   +
Sbjct: 98  L--HSLKFKPRNGTGVIVITPTRELALQIFGVARELMEFHSQTFGIVIGGANRRQEAEKL 155

Query: 258 MSNPDVIIATPGRFL-HLKVEMNLDLKSVEYVVFDEADRLFEMGFQEQLNELLASLPTT- 315
               ++IIATPGR L HL+       K+++ ++ DEADR+ E+GF++++ +++  LP   
Sbjct: 156 SKGVNLIIATPGRLLDHLQNTKGFIFKNLKALIIDEADRILEIGFEDEMKQIIKILPNED 215

Query: 316 RQTLLFSATLPNSLVDFVKAGL-VNPVLVRLDA--ETKVSENLEMLFLSSKNADREANLL 372
           RQ++LFSAT    + D  +  L   P+ + +D+  ET   + LE  ++  ++  R   L 
Sbjct: 216 RQSMLFSATQTTKVEDLARISLRPGPLFINVDSEKETSTVDGLEQGYVVCESDKRFLLLF 275

Query: 373 YILQE 377
             L++
Sbjct: 276 TFLKK 280

 Score = 72.8 bits (177), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 39/104 (37%), Positives = 58/104 (55%), Gaps = 1/104 (0%)

Query: 436 KATILFVPTRHHVEYISQLLRDCGYLISYIYGTLDQHARKNQLYNFRAGLTSILVVTDVA 495
           K  I+F+ + + V Y ++LL      +  ++G   Q  R N  + F      ILV TDVA
Sbjct: 284 KKIIVFLSSCNSVRYYAELLNYIDLPVLELHGKQKQQKRTNTFFEFCNAQRGILVCTDVA 343

Query: 496 ARGVDIPMLANVINYTLPGSSKIFVHRVGRTARAGNKGWAYSIV 539
           ARG+DIP +  +I +  P   + ++HRVGRTAR G KG   S++
Sbjct: 344 ARGLDIPAVDWIIQFDPPDDPRDYIHRVGRTAR-GTKGKGKSLM 386

>ZYRO0G08580g Chr7 complement(695127..696746) [1620 bp, 539 aa] {ON}
           similar to uniprot|P20447 Saccharomyces cerevisiae
           YGL078C DBP3 Putative ATP-dependent RNA helicase of the
           DEAD-box family involved in ribosomal biogenesis
          Length = 539

 Score =  139 bits (351), Expect = 6e-34,   Method: Compositional matrix adjust.
 Identities = 81/248 (32%), Positives = 137/248 (55%), Gaps = 12/248 (4%)

Query: 116 AGEEEDDVNEYFSTNNLEKQKHKKG------SFPSFGLSKIVLNNIKRKGFRQPTPIQRK 169
           A   + D++ ++  N +  +  +K       SF    L   + + I +  F +PTPIQ  
Sbjct: 98  ANVPQSDIDSFYKENEVSVEDSQKYNLRPLLSFSHLSLKPEIQSEISK--FPKPTPIQSV 155

Query: 170 TIPLILQSRDIVGMARTGSGKTAAFILPMVEKLKSH--SGKIGARAVILSPSRELAMQTF 227
           + P +L  RD++G+A TGSGKT AF +P +++L S+  + +   + +++SP+RELA QT+
Sbjct: 156 SWPYLLSGRDVIGVAETGSGKTFAFGVPAIDQLVSNGDAKRKSVKVLVISPTRELASQTY 215

Query: 228 NVFKDFARGTELRSVLLTGGDSLEEQFSMMMSNPDVIIATPGRFLHLKVEMNLDLKSVEY 287
           +          L    + GG   +EQ + +  N  V++ATPGR L L  E ++DL  V+Y
Sbjct: 216 DNLIILTNKVGLECCCVYGGVPKQEQRNQL-RNSQVVVATPGRLLDLINEQSVDLSQVQY 274

Query: 288 VVFDEADRLFEMGFQEQLNELLASLPT-TRQTLLFSATLPNSLVDFVKAGLVNPVLVRLD 346
           +V DEADR+ E GF+E +  ++    +  RQTL+F+AT P  + +     + +PV V + 
Sbjct: 275 LVLDEADRMLEKGFEEDIKNIINQTNSRDRQTLMFTATWPKEVRELASTFMRDPVKVSIG 334

Query: 347 AETKVSEN 354
              ++S N
Sbjct: 335 NRDELSAN 342

 Score = 87.8 bits (216), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 40/101 (39%), Positives = 64/101 (63%)

Query: 438 TILFVPTRHHVEYISQLLRDCGYLISYIYGTLDQHARKNQLYNFRAGLTSILVVTDVAAR 497
            ++F   +     +   L+  GY ++ I+G L Q  R + L +F+AG +++L+ TDVAAR
Sbjct: 378 VLIFALYKKEASRVENNLKYNGYDVAAIHGDLSQQQRTSALNDFKAGKSNLLLATDVAAR 437

Query: 498 GVDIPMLANVINYTLPGSSKIFVHRVGRTARAGNKGWAYSI 538
           G+DIP +  VIN T P + + +VHR+GRT RAG  G A+++
Sbjct: 438 GLDIPNVKTVINLTFPLTVEDYVHRIGRTGRAGQTGTAHTL 478

>TPHA0L02160 Chr12 complement(448305..449801) [1497 bp, 498 aa] {ON}
           Anc_5.40 YMR290C
          Length = 498

 Score =  139 bits (349), Expect = 6e-34,   Method: Compositional matrix adjust.
 Identities = 79/240 (32%), Positives = 142/240 (59%), Gaps = 8/240 (3%)

Query: 141 SFPSFGLSKIVLNNIKRKGFRQPTPIQRKTIPLILQSRDIVGMARTGSGKTAAFILPMVE 200
           SF    LS+  +  I++ GF   TP+Q +TIP +L  RD++G A+TGSGKT AF+LP +E
Sbjct: 35  SFADLKLSEPTMKAIEKMGFENMTPVQARTIPPLLAGRDVLGAAKTGSGKTLAFLLPAIE 94

Query: 201 KLKS--HSGKIGARAVILSPSRELAMQTFNVFKDFARGTELRSVLLTGGDSLEEQFSMMM 258
            L S  +  + G   ++++P+RELA+Q F V ++          ++ GG +  ++   ++
Sbjct: 95  MLHSLKYKPRNGTGVIVITPTRELALQIFGVARELMEFHSQTFGIVIGGANRRQEADKLV 154

Query: 259 SNPDVIIATPGRFL-HLKVEMNLDLKSVEYVVFDEADRLFEMGFQEQLNELLASLPTT-R 316
              +++IATPGR L HL+       K+++ ++ DEADR+ E+GF++++ +++  LP   R
Sbjct: 155 KGVNMLIATPGRLLDHLQNTKGFVYKNLKALIIDEADRILEIGFEDEMKQIIRILPKEDR 214

Query: 317 QTLLFSATLPNSLVDFVKAGL-VNPVLVRL--DAETKVSENLEMLFLSSKNADREANLLY 373
           Q++LFSAT    + D  +  L   P+ + +  D +T  ++ LE  ++  + +D+   LL+
Sbjct: 215 QSMLFSATQTTKVEDLARMSLRKGPLFINVVTDKDTSTADGLEQGYVVCE-SDKRFLLLF 273

 Score = 72.4 bits (176), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 38/105 (36%), Positives = 60/105 (57%), Gaps = 1/105 (0%)

Query: 435 EKATILFVPTRHHVEYISQLLRDCGYLISYIYGTLDQHARKNQLYNFRAGLTSILVVTDV 494
           +K  I+F+ + + V+Y ++LL      +  ++G   Q  R N  + F      ILV TDV
Sbjct: 281 KKKIIVFLSSCNSVKYYAELLNYIDLPVLELHGKQKQQKRTNTFFEFCNAERGILVCTDV 340

Query: 495 AARGVDIPMLANVINYTLPGSSKIFVHRVGRTARAGNKGWAYSIV 539
           AARG+DIP +  ++ +  P   + ++HRVGRTAR G KG   S++
Sbjct: 341 AARGLDIPAVDWIVQFDPPDDPRDYIHRVGRTAR-GTKGKGKSLM 384

>ACR197W Chr3 (695405..696859) [1455 bp, 484 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDL160C (DHH1)
          Length = 484

 Score =  138 bits (348), Expect = 6e-34,   Method: Compositional matrix adjust.
 Identities = 75/208 (36%), Positives = 117/208 (56%), Gaps = 2/208 (0%)

Query: 138 KKGSFPSFGLSKIVLNNIKRKGFRQPTPIQRKTIPLILQSRDIVGMARTGSGKTAAFILP 197
           K  +F  F L + +L  I   GF +P+PIQ + IP+ L  RDI+  A+ G+GKTAAF++P
Sbjct: 27  KGNTFEDFYLRRELLMGIFEAGFERPSPIQEEAIPIALARRDILARAKNGTGKTAAFVIP 86

Query: 198 MVEKLKSHSGKIGARAVILSPSRELAMQTFNVFKDFARGTELRSVLLTGGDSLEEQFSMM 257
            +E +K    KI  +A+I+ P+RELA+QT  V +   +   +  ++ TGG +L +    +
Sbjct: 87  TLEIVKPKVNKI--QALIMVPTRELALQTSQVVRTLGKHCGISCMVTTGGTNLRDDIMRL 144

Query: 258 MSNPDVIIATPGRFLHLKVEMNLDLKSVEYVVFDEADRLFEMGFQEQLNELLASLPTTRQ 317
                V++ TPGR L L      DL      V DEAD++    F+  + ++L+ LP   Q
Sbjct: 145 NEPVHVLVGTPGRVLDLASRKVADLSECSLFVMDEADKMLSRDFKSLVEQILSFLPQNHQ 204

Query: 318 TLLFSATLPNSLVDFVKAGLVNPVLVRL 345
           +LLFSAT P ++ +F+   L  P  + L
Sbjct: 205 SLLFSATFPLTVKEFMVKHLNKPYEINL 232

 Score = 74.7 bits (182), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 41/150 (27%), Positives = 70/150 (46%), Gaps = 5/150 (3%)

Query: 439 ILFVPTRHHVEYISQLLRDCGYLISYIYGTLDQHARKNQLYNFRAGLTSILVVTDVAARG 498
           I+F  + + VE +++ + D GY   Y +  + Q  R    + FR G    LV +D+  RG
Sbjct: 270 IIFCNSTNRVELLAKKITDLGYSCYYSHARMKQQERNKVFHEFRQGKVRTLVCSDLLTRG 329

Query: 499 VDIPMLANVINYTLPGSSKIFVHRVGRTARAGNKGWAYSIVAXXXXXXXXXXXXXXGKKI 558
           +DI  +  VIN+  P +++ ++HR+GR+ R G+ G A +++               G +I
Sbjct: 330 IDIQAVNVVINFDFPKTAETYLHRIGRSGRFGHLGLAINLINWNDRFNLYKIEQELGTEI 389

Query: 559 LLTPMYDSLVDVMKKRWVEEGNSAYNFQLP 588
              P       + K  +V E  SA     P
Sbjct: 390 AAIP-----AQIDKSLYVAEDTSAVPVPFP 414

>Kpol_1058.53 s1058 complement(136863..138191) [1329 bp, 442 aa]
           {ON} complement(136863..138191) [1329 nt, 443 aa]
          Length = 442

 Score =  137 bits (346), Expect = 7e-34,   Method: Compositional matrix adjust.
 Identities = 115/456 (25%), Positives = 199/456 (43%), Gaps = 72/456 (15%)

Query: 100 ILELSDDENNIS-GQTQAGEEEDDVNEYFSTNNLEKQKHKKGS--------FPSFGLSKI 150
           +LE SD+E  I    T   E   D     +         KKGS        F  F L   
Sbjct: 9   LLEYSDNEQEIQVDATNINESAVDATVSETAEGATTDSEKKGSYVGIHSTGFKDFLLKPE 68

Query: 151 VLNNIKRKGFRQPTPIQRKTIPLILQSRDIVGMARTGSGKTAAFILPMVEKLKSHSGKIG 210
           +   I   GF  P+ +Q+ TIP  +   D++  A++G GKTA F+L  +++L    G++ 
Sbjct: 69  LARAIIDCGFEHPSEVQQHTIPQSIHGTDVLCQAKSGLGKTAVFVLSTLQQLDPVPGEVS 128

Query: 211 ARAVILSPSRELAMQTFNVFKDFARGT-ELRSVLLTGGDSLEEQFSMMM---SNPDVIIA 266
              V++  +RELA Q  N +  F++   ++++ +  GG  + +   ++    + P +++A
Sbjct: 129 --VVVICNARELAYQIRNEYLRFSKYMPDVKTAVFYGGTPITKDAELLKNKETAPHIVVA 186

Query: 267 TPGRFLHLKVEMNLDLKSVEYVVFDEADRLF-EMGFQEQLNELLASLPTTRQTLLFSATL 325
           TPGR   L  +  +DL  V+  V DE D++  E+  +  + ++  + P  +Q ++FSATL
Sbjct: 187 TPGRLKALVRDKLIDLSHVKNFVIDECDKVLEELDMRRDVQDIFRATPRDKQVMMFSATL 246

Query: 326 PNSLVDFVKAGLVNPVLVRLDAETKVS-ENLEMLFLSSKNADREANLLYILQEVIRIPLA 384
              +    +  L NP+ + +D E K++   L+  ++  +  ++   L  +L ++      
Sbjct: 247 SEEIRPICRRFLQNPLEIFVDDEAKLTLHGLQQYYIKLQENEKNRKLAQLLDDL------ 300

Query: 385 TSEQLLKLQKSTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMPAANELPSEKATILFVPT 444
              Q++   KST                                ANEL            
Sbjct: 301 EFNQVIIFVKSTKR------------------------------ANEL------------ 318

Query: 445 RHHVEYISQLLRDCGYLISYIYGTLDQHARKNQLYNFRAGLTSILVVTDVAARGVDIPML 504
                  ++LL +  +    ++G + Q  R  +   F+     I V TDV  RG+DI  +
Sbjct: 319 -------TKLLNESNFPAITVHGNMKQAERIARYKAFKEFEKRICVSTDVFGRGIDIERI 371

Query: 505 ANVINYTLPGSSKIFVHRVGRTARAGNKGWAYSIVA 540
              INY L   +  ++HRVGR  R G KG A S V+
Sbjct: 372 NLAINYDLTTEADQYLHRVGRAGRFGTKGLAISFVS 407

>Skud_14.219 Chr14 (403781..405088) [1308 bp, 435 aa] {ON} YNL112W
           (REAL)
          Length = 435

 Score =  137 bits (345), Expect = 7e-34,   Method: Compositional matrix adjust.
 Identities = 72/208 (34%), Positives = 117/208 (56%), Gaps = 3/208 (1%)

Query: 141 SFPSFGLSKIVLNNIKRKGFRQPTPIQRKTIPLILQSRDIVGMARTGSGKTAAFILPMVE 200
           SF   G    VL  +K +GF +PT IQ +  P+ L  RD+VG+A TGSGKT ++ LP + 
Sbjct: 114 SFEEAGFPDYVLKEVKAEGFDKPTGIQCQGWPMALSGRDMVGIAATGSGKTLSYCLPGIV 173

Query: 201 KLKSH---SGKIGARAVILSPSRELAMQTFNVFKDFARGTELRSVLLTGGDSLEEQFSMM 257
            + +    +   G   ++LSP+RELA+Q       F   + +R+  + GG    +Q   +
Sbjct: 174 HINAQPLLAPGDGPIVLVLSPTRELAVQIQTECSKFGHSSRIRNTCVYGGVPKSQQIRDL 233

Query: 258 MSNPDVIIATPGRFLHLKVEMNLDLKSVEYVVFDEADRLFEMGFQEQLNELLASLPTTRQ 317
               +++IATPGR + +      +LK V Y+V DEADR+ +MGF+ Q+ +++  +   RQ
Sbjct: 234 SRGSEIVIATPGRLIDMLEIGKTNLKRVTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQ 293

Query: 318 TLLFSATLPNSLVDFVKAGLVNPVLVRL 345
           TL++SAT P  +       L +P+ V++
Sbjct: 294 TLMWSATWPKEVKQLAADYLNDPIQVQV 321

 Score = 50.1 bits (118), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 25/65 (38%), Positives = 38/65 (58%)

Query: 435 EKATILFVPTRHHVEYISQLLRDCGYLISYIYGTLDQHARKNQLYNFRAGLTSILVVTDV 494
           E  T++F  T+   + I++ LR+ G+    I+G  DQ  R   L  FR G + ++V TDV
Sbjct: 360 EYKTLVFASTKRMCDDITKYLREDGWPALAIHGDKDQRERDWVLQEFRNGRSPVMVATDV 419

Query: 495 AARGV 499
           AARG+
Sbjct: 420 AARGI 424

>ZYRO0F10934g Chr6 (890412..892223) [1812 bp, 603 aa] {ON} similar
           to uniprot|P06634 Saccharomyces cerevisiae YOR204W DED1
           ATP-dependent DEAD (Asp-Glu-Ala-Asp)-box RNA helicase
           required for translation initiation of all yeast mRNAs
           mutations in human DEAD-box DBY are a frequent cause of
           male infertility
          Length = 603

 Score =  140 bits (353), Expect = 8e-34,   Method: Compositional matrix adjust.
 Identities = 82/251 (32%), Positives = 136/251 (54%), Gaps = 17/251 (6%)

Query: 142 FPSFGLSKIVLNNIKRKGFRQPTPIQRKTIPLILQSRDIVGMARTGSGKTAAFILPMVEK 201
           F S  L +++L NIK   F +PTP+Q+ +IP++   RD++  A+TGSGKT  F+ P++ +
Sbjct: 135 FTSPPLDELLLENIKFAHFVKPTPVQKYSIPIVANKRDLMACAQTGSGKTGGFLFPVLSE 194

Query: 202 L-------------KSHSGKIGARAVILSPSRELAMQTFNVFKDFARGTELRSVLLTGGD 248
                          S+  K    AV+L+P+RELA Q F+  K F   + +R  ++ GG 
Sbjct: 195 SFFTGPSEIPEAARSSYMRKAFPTAVVLAPTRELATQIFDEAKKFTYRSWVRPTVVYGGS 254

Query: 249 SLEEQFSMMMSNPDVIIATPGRFLHLKVEMNLDLKSVEYVVFDEADRLFEMGFQEQLNEL 308
            +  Q   +    D+++ATPGR   L     + L  V+Y+V DEADR+ +MGF+ Q+  +
Sbjct: 255 DVGSQMRDLDRGCDLLVATPGRLNDLLERGKISLAKVKYLVLDEADRMLDMGFEPQIRNI 314

Query: 309 L--ASLPTT--RQTLLFSATLPNSLVDFVKAGLVNPVLVRLDAETKVSENLEMLFLSSKN 364
           +    +P    RQTL+FSAT P  +    +  L + + + +      SEN+    L  ++
Sbjct: 315 VEGCDMPGVDQRQTLMFSATFPVDIQHLARDFLSDYIFLSVGRVGSTSENITQRVLYVED 374

Query: 365 ADREANLLYIL 375
            D+++ LL +L
Sbjct: 375 EDKKSALLDLL 385

 Score = 85.5 bits (210), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 42/102 (41%), Positives = 62/102 (60%)

Query: 438 TILFVPTRHHVEYISQLLRDCGYLISYIYGTLDQHARKNQLYNFRAGLTSILVVTDVAAR 497
           T++FV T+   + ++  L    +  + I+G   Q  R+  L +F+ G   +LV T VAAR
Sbjct: 393 TLIFVETKRMADQLTDFLIMQNFRATAIHGDRTQSERERALGSFKTGKADLLVATAVAAR 452

Query: 498 GVDIPMLANVINYTLPGSSKIFVHRVGRTARAGNKGWAYSIV 539
           G+DIP + +VINY LPG    +VHR+GRT RAGN G A + +
Sbjct: 453 GLDIPNVTHVINYDLPGDVDDYVHRIGRTGRAGNTGLATAFL 494

>TDEL0G01420 Chr7 (287165..288703) [1539 bp, 512 aa] {ON} Anc_6.204
           YGL078C
          Length = 512

 Score =  139 bits (349), Expect = 8e-34,   Method: Compositional matrix adjust.
 Identities = 86/244 (35%), Positives = 135/244 (55%), Gaps = 8/244 (3%)

Query: 113 QTQAGEEEDDVNEYFSTNNLEKQKHKKGSFPSFGLSKIVLNNIKRKGFRQPTPIQRKTIP 172
           + +A  +E++V+  + T   EKQ     SF    L   +   I    F +PTPIQ  + P
Sbjct: 78  EVEAFYKENEVSVDYPT---EKQIQPVLSFDELSLDSKIQAAISV--FPKPTPIQSVSWP 132

Query: 173 LILQSRDIVGMARTGSGKTAAFILPMVEKLKSHSGKI-GARAVILSPSRELAMQTFNVFK 231
            +L  +D++G+A TGSGKT AF +P + KL +  GK  G + +++SP+RELA Q ++   
Sbjct: 133 YLLAGKDVIGVAETGSGKTFAFGVPAINKLVTEDGKKKGVQVLVISPTRELASQIYDNMI 192

Query: 232 DFARGTELRSVLLTGGDSLEEQFSMMMSNPDVIIATPGRFLHLKVEMNLDLKSVEYVVFD 291
                 +L    + GG    EQ    +    V++ATPGR L L  E ++DL +V Y+V D
Sbjct: 193 LLIEKADLECCCVYGGVPKYEQ-REKLKKAQVVVATPGRLLDLMQEGSVDLSNVSYLVLD 251

Query: 292 EADRLFEMGFQEQLNELLASLPT-TRQTLLFSATLPNSLVDFVKAGLVNPVLVRLDAETK 350
           EADR+ E GF+E +  ++ S  T +RQTL+F+AT P  + +     + +PV V +    +
Sbjct: 252 EADRMLEKGFEEDIKNIIRSTNTSSRQTLMFTATWPKEVRELASTFMSDPVKVSIGNRDE 311

Query: 351 VSEN 354
           +S N
Sbjct: 312 LSAN 315

 Score = 85.9 bits (211), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 39/101 (38%), Positives = 62/101 (61%)

Query: 438 TILFVPTRHHVEYISQLLRDCGYLISYIYGTLDQHARKNQLYNFRAGLTSILVVTDVAAR 497
            ++F   +     + + L+  GY ++ I+G L Q  R   L  F+ G +++L+ TDVAAR
Sbjct: 351 VLIFALYKKEATRVERNLKYNGYNVAAIHGDLSQQQRSQALNEFKTGASNLLLATDVAAR 410

Query: 498 GVDIPMLANVINYTLPGSSKIFVHRVGRTARAGNKGWAYSI 538
           G+DIP +  VIN T P + + +VHR+GRT RAG  G A+++
Sbjct: 411 GLDIPNVKTVINLTFPLTVEDYVHRIGRTGRAGQTGTAHTL 451

>KLLA0F23716g Chr6 complement(2215454..2215845,2216857..2218129)
           [1665 bp, 554 aa] {ON} similar to uniprot|P24783
           Saccharomyces cerevisiae YNL112W DBP2 Essential
           ATP-dependent RNA helicase of the DEAD-box protein
           family involved in nonsense-mediated mRNA decay and rRNA
           processing
          Length = 554

 Score =  139 bits (350), Expect = 9e-34,   Method: Compositional matrix adjust.
 Identities = 80/251 (31%), Positives = 135/251 (53%), Gaps = 12/251 (4%)

Query: 120 EDDVNEYFSTNNLEKQKHKKG----SFPSFGLSKIVLNNIKRKGFRQPTPIQRKTIPLIL 175
           E +V E+   N +    H       SF   G    VL+ +K++GF +PT IQ +  P+ L
Sbjct: 89  ESEVIEFRKENEMTISGHDVPKPIRSFDEAGFPSYVLDEVKQEGFAKPTGIQCQGWPMAL 148

Query: 176 QSRDIVGMARTGSGKTAAFILPMVEKLKSH---SGKIGARAVILSPSRELAMQTFNVFKD 232
             RD++G+A TGSGKT ++ LP +  + +    S   G   ++L+P+RELA+Q       
Sbjct: 149 SGRDMIGVAATGSGKTLSYCLPGIVHINAQPLLSPGDGPIVLVLAPTRELAVQIQKECSK 208

Query: 233 FARGTELRSVLLTGGDSLEEQFSMMMSNPDVIIATPGRFLHLKVEMNLDLKSVEYVVFDE 292
           F   + +R+  + GG    +Q   +    +++IATPGR + +      +LK V Y+V DE
Sbjct: 209 FGASSRIRNTCVYGGVPKSQQIRDLQRGVEILIATPGRLIDMLEIGKTNLKRVTYLVLDE 268

Query: 293 ADRLFEMGFQEQLNELLASLPTTRQTLLFSATLPNSLVDFVKAGLVNPVLVR-----LDA 347
           ADR+ +MGF+ Q+ +++  +   RQTL++SAT P  +       L +P+ V+     L A
Sbjct: 269 ADRMLDMGFEPQIRKIVDQIRPDRQTLMWSATWPKEVKQLASDYLHDPIQVQIGSLELSA 328

Query: 348 ETKVSENLEML 358
              +++ +E+L
Sbjct: 329 SHTITQIVEVL 339

 Score = 86.3 bits (212), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 43/100 (43%), Positives = 62/100 (62%)

Query: 439 ILFVPTRHHVEYISQLLRDCGYLISYIYGTLDQHARKNQLYNFRAGLTSILVVTDVAARG 498
           I+F  T+   + I+  LR  G+    I+G   Q+ R   L  FR+G + I+V TDVAARG
Sbjct: 364 IIFASTKRTCDEITSYLRTEGWPALAIHGDKAQNERDWVLAEFRSGRSPIMVATDVAARG 423

Query: 499 VDIPMLANVINYTLPGSSKIFVHRVGRTARAGNKGWAYSI 538
           +D+  +  VINY +PG+ + +VHR+GRT RAG+ G A S 
Sbjct: 424 IDVKGINYVINYDMPGNIEDYVHRIGRTGRAGSTGTAISF 463

>TDEL0F01190 Chr6 (211677..212937,213454..213842) [1650 bp, 549 aa]
           {ON} Anc_2.164 YNL112W
          Length = 549

 Score =  139 bits (350), Expect = 9e-34,   Method: Compositional matrix adjust.
 Identities = 73/222 (32%), Positives = 125/222 (56%), Gaps = 4/222 (1%)

Query: 141 SFPSFGLSKIVLNNIKRKGFRQPTPIQRKTIPLILQSRDIVGMARTGSGKTAAFILPMVE 200
           SF   G    VL  +K +GF +PT IQ +  P+ L  RD++G+A TGSGKT ++ LP + 
Sbjct: 110 SFDEAGFPDYVLKEVKAEGFDKPTGIQCQGWPMALSGRDMIGVAATGSGKTLSYCLPSIV 169

Query: 201 KLKSH---SGKIGARAVILSPSRELAMQTFNVFKDFARGTELRSVLLTGGDSLEEQFSMM 257
            + +    +   G   ++L+P+RELA+Q       F + + +R+  + GG    +Q   +
Sbjct: 170 HINAQPLLAPGDGPIVLVLAPTRELAVQIQKECSKFGKSSRIRNTCVYGGVPRGQQIRDL 229

Query: 258 MSNPDVIIATPGRFLHLKVEMNLDLKSVEYVVFDEADRLFEMGFQEQLNELLASLPTTRQ 317
               +++IATPGR + +      +LK V Y+V DEADR+ +MGF+ Q+ +++  +   RQ
Sbjct: 230 ARGAEIVIATPGRLIDMLEIGKTNLKRVTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQ 289

Query: 318 TLLFSATLPNSLVDFVKAGLVNPVLVRLDA-ETKVSENLEML 358
           TL++SAT P  +       L +P+ V++ + E   S N++ +
Sbjct: 290 TLMWSATWPKEVKQLASDYLHDPIQVQIGSLELAASHNIKQV 331

 Score = 90.5 bits (223), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 45/104 (43%), Positives = 63/104 (60%)

Query: 435 EKATILFVPTRHHVEYISQLLRDCGYLISYIYGTLDQHARKNQLYNFRAGLTSILVVTDV 494
           E   ++F  T+   + I++ LRD G+    I+G  DQ  R   L  FR G + I+V TDV
Sbjct: 356 ESKILVFASTKRTCDEITKYLRDDGWPALAIHGDKDQRERDWVLNEFRTGRSPIMVATDV 415

Query: 495 AARGVDIPMLANVINYTLPGSSKIFVHRVGRTARAGNKGWAYSI 538
           AARG+D+  +  VINY +PG+ + +VHR+GRT RAG  G A S 
Sbjct: 416 AARGIDVKGINYVINYDMPGNIEDYVHRIGRTGRAGATGTAISF 459

>TDEL0G03140 Chr7 (587922..589256) [1335 bp, 444 aa] {ON} Anc_2.384
           YDL084W
          Length = 444

 Score =  137 bits (345), Expect = 9e-34,   Method: Compositional matrix adjust.
 Identities = 117/459 (25%), Positives = 203/459 (44%), Gaps = 76/459 (16%)

Query: 100 ILELSDDENNI---SGQTQAGE--EEDDVNEYFSTNNLEKQK-------HKKGSFPSFGL 147
           +LE SD+E  I   S +  + E  +E D       NN +  K       H  G F  F L
Sbjct: 9   LLEYSDNEQEIQVDSKEAASAEVAKETDAEATGEANNADNDKKGSYVGIHSTG-FKDFLL 67

Query: 148 SKIVLNNIKRKGFRQPTPIQRKTIPLILQSRDIVGMARTGSGKTAAFILPMVEKLKSHSG 207
              +   I   GF  P+ +Q+ TIP  +   D++  A++G GKTA F+L  +++L    G
Sbjct: 68  EPELSRAIIDCGFEHPSEVQQHTIPQSIHGTDVLCQAKSGLGKTAVFVLSTLQQLDPVPG 127

Query: 208 KIGARAVILSPSRELAMQTFNVFKDFARGT-ELRSVLLTGGDSLEEQFSMMM---SNPDV 263
           ++    V++  +RELA Q  N +  F++   ++++ +  GG  + +   ++    + P +
Sbjct: 128 EVS--VVVICNARELAYQIRNEYLRFSKYMPDVKTAVFYGGTPIAKDAELLKNKETAPHI 185

Query: 264 IIATPGRFLHLKVEMNLDLKSVEYVVFDEADRLF-EMGFQEQLNELLASLPTTRQTLLFS 322
           ++ATPGR   L  +  +DL  V+  V DE D++  E+  +  + E+  + P  +Q ++FS
Sbjct: 186 VVATPGRLKALVRDKLIDLSHVKNFVIDECDKVLEELDMRRDVQEIFRATPRDKQVMMFS 245

Query: 323 ATLPNSLVDFVKAGLVNPVLVRLDAETKVS-ENLEMLFLSSKNADREANLLYILQEVIRI 381
           ATL   +    +  L NP+ + +D E K++   L+  ++  +  ++   L  +L ++   
Sbjct: 246 ATLSQEIRPICRRFLQNPLEIFVDDEAKLTLHGLQQYYIKLEEREKNRKLAKLLDDL--- 302

Query: 382 PLATSEQLLKLQKSTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMPAANELPSEKATILF 441
                 Q++   +ST                                ANEL         
Sbjct: 303 ---EFNQVIIFVRSTSR------------------------------ANEL--------- 320

Query: 442 VPTRHHVEYISQLLRDCGYLISYIYGTLDQHARKNQLYNFRAGLTSILVVTDVAARGVDI 501
                     ++LL    +    ++G + Q  R  +   F+     I V TDV  RG+DI
Sbjct: 321 ----------TKLLNASNFPALTVHGHMKQEERIARYKAFKDFEKRICVSTDVFGRGIDI 370

Query: 502 PMLANVINYTLPGSSKIFVHRVGRTARAGNKGWAYSIVA 540
             +   INY L   +  ++HRVGR  R G KG A S V+
Sbjct: 371 ERINLAINYDLTTEADQYLHRVGRAGRFGTKGLAISFVS 409

>KLTH0B08998g Chr2 complement(731722..733200) [1479 bp, 492 aa] {ON}
           highly similar to uniprot|Q03532 Saccharomyces
           cerevisiae YMR290C HAS1 ATP-dependent RNA helicase
           localizes to both the nuclear periphery and nucleolus
           highly enriched in nuclear pore complex fractions
          Length = 492

 Score =  138 bits (347), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 84/244 (34%), Positives = 140/244 (57%), Gaps = 12/244 (4%)

Query: 139 KGSFPSFGLSKIVLNNIKRKGFRQPTPIQRKTIPLILQSRDIVGMARTGSGKTAAFILPM 198
           K  F    LS   +  I + GF   T +Q +TIP +L  RD++G A+TGSGKT AF+LP 
Sbjct: 27  KEKFAELNLSPPTMKAIDKMGFTTMTQVQSRTIPPLLAGRDVLGAAKTGSGKTLAFLLPA 86

Query: 199 VEKLKSHSGKI----GARAVILSPSRELAMQTFNVFKDFARGTELRSVLLTGGDSLEEQF 254
           +E L  HS K     G   ++++P+RELA+Q F V K           ++ GG +  ++ 
Sbjct: 87  IEML--HSLKFKPRNGTGVIVITPTRELALQIFGVAKTLMEFHSQTFGIVIGGANRRQEA 144

Query: 255 SMMMSNPDVIIATPGRFL-HLKVEMNLDLKSVEYVVFDEADRLFEMGFQEQLNELLASLP 313
             +    +++IATPGR L HL+   +   K+++ +V DEADR+ E+GF++++ +++  LP
Sbjct: 145 DKLAKGVNLLIATPGRLLDHLQNTKDFVFKNLKALVIDEADRILEIGFEDEMRQIVKILP 204

Query: 314 T-TRQTLLFSATLPNSLVDFVKAGL-VNPVLVRLDAE--TKVSENLEMLFLSSKNADREA 369
           +  RQT+LFSAT    + D  +  L   P+ + +D+E  T  ++ LE  ++   ++D+  
Sbjct: 205 SEERQTMLFSATQTTKVEDLARISLRPGPLFINVDSEKQTSTADGLEQGYVVC-DSDKRF 263

Query: 370 NLLY 373
            LL+
Sbjct: 264 LLLF 267

 Score = 71.2 bits (173), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 38/105 (36%), Positives = 59/105 (56%), Gaps = 1/105 (0%)

Query: 435 EKATILFVPTRHHVEYISQLLRDCGYLISYIYGTLDQHARKNQLYNFRAGLTSILVVTDV 494
           +K  I+F+ + + V Y ++LL      +  ++G   Q  R N  + F       LV TDV
Sbjct: 275 KKKIIVFLSSCNSVRYYAELLNYIDLPVLELHGKQKQQKRTNTFFEFCNAERGTLVCTDV 334

Query: 495 AARGVDIPMLANVINYTLPGSSKIFVHRVGRTARAGNKGWAYSIV 539
           AARG+DIP +  +I +  P   + ++HRVGRTAR G+KG   S++
Sbjct: 335 AARGLDIPAVDWIIQFDPPDDPRDYIHRVGRTAR-GSKGKGKSLM 378

>Smik_14.215 Chr14 (393283..394555,395537..395907) [1644 bp, 547 aa]
           {ON} YNL112W (REAL)
          Length = 547

 Score =  139 bits (349), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 73/222 (32%), Positives = 124/222 (55%), Gaps = 4/222 (1%)

Query: 141 SFPSFGLSKIVLNNIKRKGFRQPTPIQRKTIPLILQSRDIVGMARTGSGKTAAFILPMVE 200
           +F   G    VL+ +K +GF +PT IQ +  P+ L  RD+VG+A TGSGKT ++ LP + 
Sbjct: 114 TFDEAGFPDYVLSEVKAEGFDKPTGIQCQGWPMALSGRDMVGIAATGSGKTLSYCLPGIV 173

Query: 201 KLKSH---SGKIGARAVILSPSRELAMQTFNVFKDFARGTELRSVLLTGGDSLEEQFSMM 257
            + +    +   G   ++L+P+RELA+Q       F   + +R+  + GG    +Q   +
Sbjct: 174 HINAQPLLAPGDGPIVLVLAPTRELAVQIQTECSKFGHSSRIRNTCVYGGVPKSQQIRDL 233

Query: 258 MSNPDVIIATPGRFLHLKVEMNLDLKSVEYVVFDEADRLFEMGFQEQLNELLASLPTTRQ 317
               +++IATPGR + +      +LK V Y+V DEADR+ +MGF+ Q+ +++  +   RQ
Sbjct: 234 SRGSEIVIATPGRLIDMLEIGKTNLKRVTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQ 293

Query: 318 TLLFSATLPNSLVDFVKAGLVNPVLVRLDA-ETKVSENLEML 358
           TL++SAT P  +       L +P+ V++ + E   S N+  +
Sbjct: 294 TLMWSATWPKEVKQLAADYLNDPIQVQVGSLELSASHNITQI 335

 Score = 89.7 bits (221), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 45/105 (42%), Positives = 65/105 (61%)

Query: 434 SEKATILFVPTRHHVEYISQLLRDCGYLISYIYGTLDQHARKNQLYNFRAGLTSILVVTD 493
           +E  T++F  T+   + I++ LR+ G+    I+G  DQ  R   L  FR G + I+V TD
Sbjct: 359 NEYKTLVFASTKRMCDDITKYLREDGWPALAIHGDKDQRERDWVLQEFRNGRSPIMVATD 418

Query: 494 VAARGVDIPMLANVINYTLPGSSKIFVHRVGRTARAGNKGWAYSI 538
           VAARG+D+  +  VINY +PG+ + +VHR+GRT RAG  G A S 
Sbjct: 419 VAARGIDVKGINYVINYDMPGNIEDYVHRIGRTGRAGATGTAISF 463

>Kwal_56.24005 s56 complement(809954..811555) [1602 bp, 533 aa] {ON}
           YGL078C (DBP3) - ATP-dependent RNA helicase CA3 of the
           DEAD/DEAH box family [contig 168] FULL
          Length = 533

 Score =  139 bits (349), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 83/243 (34%), Positives = 135/243 (55%), Gaps = 11/243 (4%)

Query: 120 EDDVNEYFSTNNLEKQKHKKG------SFPSFGLSKIVLNNIKRKGFRQPTPIQRKTIPL 173
           + +V+++F+ N +  +   K       +F    LS  + + I +  F +PTPIQ  + P 
Sbjct: 97  QSEVDQFFAENEVTVEDPGKLELRPLLAFDHISLSPEIQHEISK--FPKPTPIQSVSWPY 154

Query: 174 ILQSRDIVGMARTGSGKTAAFILPMVEKLKSHSGKI-GARAVILSPSRELAMQTFNVFKD 232
           +L  +D+VG+A TGSGKT AF +P V  L S   K  G + +++SP+RELA QT++    
Sbjct: 155 LLSGKDVVGVAETGSGKTFAFGVPAVNNLMSADAKKKGIQVLVISPTRELASQTYDNLIS 214

Query: 233 FARGTELRSVLLTGGDSLEEQFSMMMSNPDVIIATPGRFLHLKVEMNLDLKSVEYVVFDE 292
             +   +    + GG   +EQ + +     V++ATPGR L L  E +  L +V+Y+V DE
Sbjct: 215 LTKKAGVNCCCVYGGVPKDEQRAQL-KKAHVVVATPGRLLDLIEEGSARLSNVDYLVLDE 273

Query: 293 ADRLFEMGFQEQLNELLASLPTT-RQTLLFSATLPNSLVDFVKAGLVNPVLVRLDAETKV 351
           ADR+ E GF+E +  ++ S  +  RQTL+F+AT P  + +     + NPV V +    ++
Sbjct: 274 ADRMLEKGFEEDIKRIIGSTKSAGRQTLMFTATWPKEVRELASTFMNNPVKVSIGNRDEL 333

Query: 352 SEN 354
           S N
Sbjct: 334 SAN 336

 Score = 85.1 bits (209), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 39/101 (38%), Positives = 63/101 (62%)

Query: 438 TILFVPTRHHVEYISQLLRDCGYLISYIYGTLDQHARKNQLYNFRAGLTSILVVTDVAAR 497
            ++F   +     + + L+  GY ++ I+G L Q  R   L  F++G +++L+ TDVAAR
Sbjct: 372 VLIFALYKKEAARVERNLKYNGYSVAAIHGDLSQQQRTQALNEFKSGASNLLLATDVAAR 431

Query: 498 GVDIPMLANVINYTLPGSSKIFVHRVGRTARAGNKGWAYSI 538
           G+DIP +  VIN T P + + +VHR+GRT RAG  G A+++
Sbjct: 432 GLDIPNVKTVINLTFPLTVEDYVHRIGRTGRAGLTGTAHTL 472

>KLLA0C16599g Chr3 (1453655..1455199) [1545 bp, 514 aa] {ON} similar
           to uniprot|P39517 Saccharomyces cerevisiae YDL160C DHH1
           Cytoplasmic DExD/H-box helicase stimulates mRNA
           decapping coordinates distinct steps in mRNA function
           and decay interacts with both the decapping and
           deadenylase complexes may have a role in mRNA export and
           translation
          Length = 514

 Score =  138 bits (348), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 74/203 (36%), Positives = 115/203 (56%), Gaps = 2/203 (0%)

Query: 138 KKGSFPSFGLSKIVLNNIKRKGFRQPTPIQRKTIPLILQSRDIVGMARTGSGKTAAFILP 197
           K  SF  F L + +L  I   GF +P+PIQ + IP+ +  +DI+  A+ G+GKTAAF++P
Sbjct: 34  KGRSFEDFYLKRELLMGIFEAGFEKPSPIQEEAIPVAIAGKDILARAKNGTGKTAAFVIP 93

Query: 198 MVEKLKSHSGKIGARAVILSPSRELAMQTFNVFKDFARGTELRSVLLTGGDSLEEQFSMM 257
            +EK+K    KI  +A+I+ P+RELA+QT  V +   +   +  ++ TGG +L +    +
Sbjct: 94  TLEKVKPKLNKI--QALIMVPTRELALQTSQVVRTLGKHCGISCMVTTGGTNLRDDIMRL 151

Query: 258 MSNPDVIIATPGRFLHLKVEMNLDLKSVEYVVFDEADRLFEMGFQEQLNELLASLPTTRQ 317
                +++ TPGR L L      DL      + DEAD++    F+    ++L  LP  RQ
Sbjct: 152 NEPVHILVGTPGRVLDLASRRVTDLSECHLFIMDEADKMLSRDFKVLAEQILGFLPERRQ 211

Query: 318 TLLFSATLPNSLVDFVKAGLVNP 340
            LLFSAT P ++ +F+   L NP
Sbjct: 212 LLLFSATFPVTVKEFMVKHLKNP 234

 Score = 70.9 bits (172), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 30/101 (29%), Positives = 58/101 (57%)

Query: 439 ILFVPTRHHVEYISQLLRDCGYLISYIYGTLDQHARKNQLYNFRAGLTSILVVTDVAARG 498
           I+F  + + VE +++ + + G+   Y +  + Q  R    + FR G    LV +D+  RG
Sbjct: 277 IIFCNSTNRVELLAKKITELGFSCYYSHARMKQSERNKVFHEFRQGKVRTLVCSDLLTRG 336

Query: 499 VDIPMLANVINYTLPGSSKIFVHRVGRTARAGNKGWAYSIV 539
           +DI  +  VIN+  P +++ ++HR+GR+ R G+ G A +++
Sbjct: 337 IDIQAVNVVINFDFPKTAETYLHRIGRSGRFGHLGLAINLI 377

>NDAI0C03600 Chr3 complement(826718..828277) [1560 bp, 519 aa] {ON}
           Anc_5.40
          Length = 519

 Score =  138 bits (348), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 78/240 (32%), Positives = 141/240 (58%), Gaps = 8/240 (3%)

Query: 141 SFPSFGLSKIVLNNIKRKGFRQPTPIQRKTIPLILQSRDIVGMARTGSGKTAAFILPMVE 200
           +F    LS   +  I++ GF   TP+Q +TIP ++  RD++G A+TGSGKT AF++P +E
Sbjct: 52  NFNDLSLSSQTMKAIEKMGFESLTPVQARTIPPLMAGRDVLGAAKTGSGKTLAFLIPAIE 111

Query: 201 KLKSHSGKI--GARAVILSPSRELAMQTFNVFKDFARGTELRSVLLTGGDSLEEQFSMMM 258
            L S   K   G   ++++P+RELA+Q F V ++          ++ GG +  ++   +M
Sbjct: 112 LLYSLKFKPRNGTGIIVITPTRELALQIFGVVRELMEFHSQTFGIVIGGANRRQEAEKLM 171

Query: 259 SNPDVIIATPGRFL-HLKVEMNLDLKSVEYVVFDEADRLFEMGFQEQLNELLASLPTT-R 316
              +++IATPGR L HL+       K+++ ++ DEADR+ E+GF++++ +++  LP   R
Sbjct: 172 KGVNILIATPGRLLDHLQNTKGFIFKNLKALIIDEADRILEIGFEDEMKQIIRILPNEDR 231

Query: 317 QTLLFSATLPNSLVDFVKAGL-VNPVLVRLDAE--TKVSENLEMLFLSSKNADREANLLY 373
           Q++LFSAT    + D  +  L   P+ + +++E  T  ++ LE  ++   ++D+   LL+
Sbjct: 232 QSMLFSATQTTKVEDLARISLRKGPLFINVESEKDTSTADGLEQGYVVC-DSDKRFLLLF 290

 Score = 68.9 bits (167), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 36/105 (34%), Positives = 59/105 (56%), Gaps = 1/105 (0%)

Query: 435 EKATILFVPTRHHVEYISQLLRDCGYLISYIYGTLDQHARKNQLYNFRAGLTSILVVTDV 494
           ++ ++ F  + + V+Y ++LL      +  ++G   Q  R N  + F      ILV TDV
Sbjct: 298 KRKSLSFYSSCNSVKYYAELLNYIDLPVLELHGKQKQQKRTNTFFEFCNADKGILVCTDV 357

Query: 495 AARGVDIPMLANVINYTLPGSSKIFVHRVGRTARAGNKGWAYSIV 539
           AARG+DIP +  ++ +  P   + ++HRVGRTAR G KG   S++
Sbjct: 358 AARGLDIPAVDWIVQFDPPDDPRDYIHRVGRTAR-GTKGKGKSLM 401

>TBLA0F02360 Chr6 (582109..583866) [1758 bp, 585 aa] {ON} Anc_7.336
           YDL160C
          Length = 585

 Score =  139 bits (350), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 81/241 (33%), Positives = 131/241 (54%), Gaps = 12/241 (4%)

Query: 118 EEEDDVNEYFSTNNLEKQ----------KHKKGSFPSFGLSKIVLNNIKRKGFRQPTPIQ 167
           +++ D N++ S  N+ K+            K  SF  F L + +L  I   GF +P+PIQ
Sbjct: 5   QQQLDTNDWKSKLNIPKKDTRPQTEDVLNTKGNSFEDFYLKRELLMGIFEAGFEKPSPIQ 64

Query: 168 RKTIPLILQSRDIVGMARTGSGKTAAFILPMVEKLKSHSGKIGARAVILSPSRELAMQTF 227
            ++IP+ +  RDI+  A+ G+GKTAAF++P +EK+K    KI  +A+I+ P+RELA+QT 
Sbjct: 65  EESIPIAIAGRDILARAKNGTGKTAAFVIPTLEKVKPKINKI--QALIMVPTRELALQTS 122

Query: 228 NVFKDFARGTELRSVLLTGGDSLEEQFSMMMSNPDVIIATPGRFLHLKVEMNLDLKSVEY 287
            V +   +   +  ++ TGG +L +    +     V++ TPGR L L      DL     
Sbjct: 123 QVVRTLGKHCGISCMVTTGGTNLRDDIMRLNETIHVLVGTPGRVLDLASRKVADLSECSL 182

Query: 288 VVFDEADRLFEMGFQEQLNELLASLPTTRQTLLFSATLPNSLVDFVKAGLVNPVLVRLDA 347
            + DEAD++    F+  + ++L  LP   Q+LLFSAT P ++ +F+   L  P  + L  
Sbjct: 183 FIMDEADKMLSRDFKTIIEQILIFLPKHHQSLLFSATFPLTVKEFMVKHLTKPYEINLMD 242

Query: 348 E 348
           E
Sbjct: 243 E 243

 Score = 73.6 bits (179), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 43/150 (28%), Positives = 72/150 (48%), Gaps = 5/150 (3%)

Query: 439 ILFVPTRHHVEYISQLLRDCGYLISYIYGTLDQHARKNQLYNFRAGLTSILVVTDVAARG 498
           I+F  + + VE +++ + D GY   Y +  + Q  R    + FR G    LV +D+  RG
Sbjct: 278 IIFCNSTNRVELLAKKITDLGYSCYYSHARMKQQERNRVFHEFRQGKVRTLVCSDLLTRG 337

Query: 499 VDIPMLANVINYTLPGSSKIFVHRVGRTARAGNKGWAYSIVAXXXXXXXXXXXXXXGKKI 558
           +DI  +  VIN+  P +++ ++HR+GR+ R G+ G A +++               G +I
Sbjct: 338 IDIQAVNVVINFDFPKTAETYLHRIGRSGRFGHLGLAINLINWNDRFNLYKIEQELGTEI 397

Query: 559 LLTPMYDSLVDVMKKRWVEEGNSAYNFQLP 588
              P   S +D  K  +V   NSA     P
Sbjct: 398 AAIP---STID--KSLYVANDNSAVPIPFP 422

>KLTH0H01562g Chr8 complement(140915..142390) [1476 bp, 491 aa] {ON}
           similar to uniprot|P39517 Saccharomyces cerevisiae
           YDL160C DHH1 Cytoplasmic DExD/H-box helicase stimulates
           mRNA decapping coordinates distinct steps in mRNA
           function and decay interacts with both the decapping and
           deadenylase complexes may have a role in mRNA export and
           translation
          Length = 491

 Score =  137 bits (346), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 72/205 (35%), Positives = 116/205 (56%), Gaps = 2/205 (0%)

Query: 141 SFPSFGLSKIVLNNIKRKGFRQPTPIQRKTIPLILQSRDIVGMARTGSGKTAAFILPMVE 200
           +F  F L + +L  I   GF +P+PIQ + IP+ +  RD++  A+ G+GKTAAF++P +E
Sbjct: 30  TFEDFYLKRELLMGIFEAGFEKPSPIQEEAIPIAIAGRDVLARAKNGTGKTAAFVVPTLE 89

Query: 201 KLKSHSGKIGARAVILSPSRELAMQTFNVFKDFARGTELRSVLLTGGDSLEEQFSMMMSN 260
           K+K    KI  +A+I+ P+RELA+QT  V +   +   +  ++ TGG +L +    +   
Sbjct: 90  KVKPKVNKI--QALIMVPTRELALQTSQVVRTLGKHCGISCMVTTGGTNLRDDILRLNEP 147

Query: 261 PDVIIATPGRFLHLKVEMNLDLKSVEYVVFDEADRLFEMGFQEQLNELLASLPTTRQTLL 320
             +++ TPGR L L      DL      V DEAD++    F+  + ++L  LP   Q+LL
Sbjct: 148 VHILVGTPGRVLDLASRKVADLSECPLFVMDEADKMLSRDFKAIIEQILTFLPPVHQSLL 207

Query: 321 FSATLPNSLVDFVKAGLVNPVLVRL 345
           FSAT P ++ +F+   L  P  + L
Sbjct: 208 FSATFPLTVKEFMVKHLHKPYEINL 232

 Score = 73.9 bits (180), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 41/150 (27%), Positives = 71/150 (47%), Gaps = 5/150 (3%)

Query: 439 ILFVPTRHHVEYISQLLRDCGYLISYIYGTLDQHARKNQLYNFRAGLTSILVVTDVAARG 498
           I+F  + + VE +++ + D GY   Y +  + Q  R    + FR G    LV +D+  RG
Sbjct: 270 IIFCNSTNRVELLAKKITDLGYSCYYSHARMKQSERNKVFHEFRQGKVRTLVCSDLLTRG 329

Query: 499 VDIPMLANVINYTLPGSSKIFVHRVGRTARAGNKGWAYSIVAXXXXXXXXXXXXXXGKKI 558
           +DI  +  VIN+  P +++ ++HR+GR+ R G+ G A +++               G +I
Sbjct: 330 IDIQAVNVVINFDFPKTAETYLHRIGRSGRFGHLGLAINLINWNDRFNLYKIEQELGTEI 389

Query: 559 LLTPMYDSLVDVMKKRWVEEGNSAYNFQLP 588
              P       + K  +V E +SA     P
Sbjct: 390 AAIP-----AQIDKSLYVAEDDSAVPVPFP 414

>KNAG0I02050 Chr9 complement(399547..399554,399758..401021) [1272
           bp, 423 aa] {ON} Anc_2.164 YNL112W
          Length = 423

 Score =  135 bits (341), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 70/208 (33%), Positives = 117/208 (56%), Gaps = 3/208 (1%)

Query: 141 SFPSFGLSKIVLNNIKRKGFRQPTPIQRKTIPLILQSRDIVGMARTGSGKTAAFILPMVE 200
           +F   G    VL  +K +GF +PT IQ +  P+ L  RD+VG+A TGSGKT ++ LP + 
Sbjct: 111 TFDEAGFPDYVLTEVKAEGFDKPTGIQCQGWPMALSGRDMVGIAATGSGKTLSYCLPGIV 170

Query: 201 KLKSHS---GKIGARAVILSPSRELAMQTFNVFKDFARGTELRSVLLTGGDSLEEQFSMM 257
            + + +      G   ++L+P+RELA+Q       F   + +R+  + GG    +Q   +
Sbjct: 171 HINAQALLQPGDGPIVLVLAPTRELAVQIQKECSKFGHSSRIRNTCVYGGVPRGQQIRDL 230

Query: 258 MSNPDVIIATPGRFLHLKVEMNLDLKSVEYVVFDEADRLFEMGFQEQLNELLASLPTTRQ 317
               +++IATPGR + +      +LK V Y+V DEADR+ +MGF+ Q+ +++  +   RQ
Sbjct: 231 NRGSEIVIATPGRLIDMLELGKTNLKRVTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQ 290

Query: 318 TLLFSATLPNSLVDFVKAGLVNPVLVRL 345
           TL++SAT P  +       L +P+ V++
Sbjct: 291 TLMWSATWPKEVKQLAADYLSDPIQVQI 318

 Score = 51.6 bits (122), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 26/66 (39%), Positives = 38/66 (57%)

Query: 435 EKATILFVPTRHHVEYISQLLRDCGYLISYIYGTLDQHARKNQLYNFRAGLTSILVVTDV 494
           E   ++F  T+   + I++ LR+ G+    I+G  DQ  R   L  FR G + I+V TDV
Sbjct: 357 ESKILVFASTKRMCDDITKYLREDGWPALAIHGDKDQRERDWVLNEFRTGRSPIMVATDV 416

Query: 495 AARGVD 500
           AARG+D
Sbjct: 417 AARGID 422

>Suva_14.226 Chr14 (410416..411691,412742..413097) [1632 bp, 543 aa]
           {ON} YNL112W (REAL)
          Length = 543

 Score =  138 bits (347), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 71/208 (34%), Positives = 119/208 (57%), Gaps = 3/208 (1%)

Query: 141 SFPSFGLSKIVLNNIKRKGFRQPTPIQRKTIPLILQSRDIVGMARTGSGKTAAFILPMVE 200
           +F   G    VL+ +K +GF +PT IQ +  P+ L  RD+VG+A TGSGKT ++ LP + 
Sbjct: 115 TFDEAGFPDYVLSEVKAEGFAKPTGIQCQGWPMALSGRDMVGIAATGSGKTLSYCLPGIV 174

Query: 201 KLKSH---SGKIGARAVILSPSRELAMQTFNVFKDFARGTELRSVLLTGGDSLEEQFSMM 257
            + +    +   G   ++LSP+RELA+Q       F + + +R+  + GG    +Q   +
Sbjct: 175 HINAQPLLAPGDGPIVLVLSPTRELAVQIQTECSKFGQSSRIRNTCVYGGVPKSQQIRDL 234

Query: 258 MSNPDVIIATPGRFLHLKVEMNLDLKSVEYVVFDEADRLFEMGFQEQLNELLASLPTTRQ 317
               +++IATPGR + +      +LK V Y+V DEADR+ +MGF+ Q+ +++  +   RQ
Sbjct: 235 SRGSEIVIATPGRLIDMLEIGKTNLKRVTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQ 294

Query: 318 TLLFSATLPNSLVDFVKAGLVNPVLVRL 345
           TL++SAT P  +       L +P+ V++
Sbjct: 295 TLMWSATWPKEVKQLAADYLNDPIQVQV 322

 Score = 89.4 bits (220), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 45/104 (43%), Positives = 64/104 (61%)

Query: 435 EKATILFVPTRHHVEYISQLLRDCGYLISYIYGTLDQHARKNQLYNFRAGLTSILVVTDV 494
           E  T++F  T+   + I++ LR+ G+    I+G  DQ  R   L  FR G + I+V TDV
Sbjct: 361 EYKTLIFASTKRMCDDITKYLREDGWPALAIHGDKDQRERDWVLQEFRNGGSPIMVATDV 420

Query: 495 AARGVDIPMLANVINYTLPGSSKIFVHRVGRTARAGNKGWAYSI 538
           AARG+D+  +  VINY +PG+ + +VHR+GRT RAG  G A S 
Sbjct: 421 AARGIDVKGINYVINYDMPGNIEDYVHRIGRTGRAGATGTAVSF 464

>TDEL0C01160 Chr3 complement(198802..200613) [1812 bp, 603 aa] {ON}
           Anc_8.87 YFL002C
          Length = 603

 Score =  139 bits (349), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 107/396 (27%), Positives = 179/396 (45%), Gaps = 61/396 (15%)

Query: 159 GFRQPTPIQRKTIPLILQSRDIVGMARTGSGKTAAFILPMVEKLKSHSGKIGA------R 212
           GF   TP+Q  TIPL  +++D+V  + TGSGKT AF++P++E++ S      A       
Sbjct: 26  GFDAMTPVQASTIPLFSRNKDVVVESVTGSGKTVAFVVPILERIISDGANSTAFKKGHFH 85

Query: 213 AVILSPSRELAMQTFNVFKDF-----ARGTELRSVLLTGGDS---LEEQFSMMMSNPDVI 264
           ++I++P+REL+ Q  +V + F          ++S LL G       ++    +   P ++
Sbjct: 86  SLIVTPTRELSNQIQSVIQSFLDHYPGDSYPIKSQLLVGTSQKTVRDDVTKFLEERPQIL 145

Query: 265 IATPGRFLHLKVEMNLDLKSVEYVVFDEADRLFEMGFQEQLNELLASLPTTRQTLLFSAT 324
           + TPGR L      ++   S   VV DEADRL +  F + + ++L +LP  R+T LFSAT
Sbjct: 146 VGTPGRVLDFLQMPSVKTLSCNMVVLDEADRLLDSDFFKDVEKILRTLPKQRRTGLFSAT 205

Query: 325 LPNSLVDFVKAGLVNPVLVRLDAETKVSENLEMLFLSSKNADREANLLYILQEVIRIPLA 384
           +  +     K GL NPV V +++  K   +L + +      ++   L+ IL         
Sbjct: 206 ISEAGNQIFKTGLRNPVKVTVNSSKKGPASLGLFYTVIDPQEKLLQLINILNN------- 258

Query: 385 TSEQLLKLQKSTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMPAANELPSEKATILFVPT 444
                 K +K                                      P+  +   F   
Sbjct: 259 -----YKFKKCIAY---------------------------------FPTCISVTFFYSF 280

Query: 445 RHHVEYISQLLRDCGYLISYIYGTLDQHARKNQLYNFRAGLT-SILVVTDVAARGVDIPM 503
             +++   +LL D   ++  ++G L   +R   L NF   +  ++L+ TDVAARG+DI  
Sbjct: 281 LQYLQREKKLLSD-EVMVYSLHGKLQTASRMKTLENFTDTVNKAVLLTTDVAARGIDISD 339

Query: 504 LANVINYTLPGSSKIFVHRVGRTARAGNKGWAYSIV 539
           +  V+    P  + + +HR GRT RA   G A + +
Sbjct: 340 VDLVVQLDPPTDTSVLLHRCGRTGRANRIGKAITFI 375

>NCAS0E03920 Chr5 complement(769305..770618) [1314 bp, 437 aa] {ON} 
          Length = 437

 Score =  135 bits (341), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 79/199 (39%), Positives = 109/199 (54%), Gaps = 10/199 (5%)

Query: 138 KKGSFPSFGLSKIVLNNIKRKGFRQPTPIQRKTIPLILQSRDIVGMARTGSGKTAAFILP 197
           K  +F S GLS+ +   ++     QPT IQ+  IP IL+ RD +G A+TGSGKT AF  P
Sbjct: 5   KNATFKSLGLSRWLQEALQAMKINQPTAIQKACIPEILKGRDCIGGAKTGSGKTVAFAAP 64

Query: 198 MVEKLKSH-SGKIGARAVILSPSRELAMQTFNVFKDFARGTELRSVLLTGGDSLEEQFSM 256
           M+ K     SG  G   V+L+P+RELAMQ    F        +R  L+ GG+S+ +Q   
Sbjct: 65  MLTKWSEDPSGMFG---VVLTPTRELAMQIAEQFTALGSSMNIRVALVVGGESIVDQAIQ 121

Query: 257 MMSNPDVIIATPGRFLHLKVEMNLD----LKSVEYVVFDEADRLFEMGFQEQLNELLASL 312
           +   P  IIATPGR  H  +    D    LK  +++V DEAD L    F   L   + +L
Sbjct: 122 LQKKPHFIIATPGRLAHHIMSSGEDTIGGLKRAKFLVLDEADSLLTDTFASDLATCIGAL 181

Query: 313 PT--TRQTLLFSATLPNSL 329
           P+   RQTLLF+AT+ + +
Sbjct: 182 PSKDKRQTLLFTATITDQV 200

 Score = 86.3 bits (212), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 41/105 (39%), Positives = 60/105 (57%)

Query: 435 EKATILFVPTRHHVEYISQLLRDCGYLISYIYGTLDQHARKNQLYNFRAGLTSILVVTDV 494
           + + I+FV      E + + L      ++ ++  + Q  R N L+ FRA +  +L+ TDV
Sbjct: 259 DSSAIIFVNRTMTAEILRRTLYHLEVRVASLHSQMPQQERTNSLHRFRANVARVLIATDV 318

Query: 495 AARGVDIPMLANVINYTLPGSSKIFVHRVGRTARAGNKGWAYSIV 539
           A+RG+DIP +  VINY +P     F+HR GRTARAG  G A S V
Sbjct: 319 ASRGLDIPTVELVINYDIPADPDTFIHRAGRTARAGRSGDAISFV 363

>SAKL0H01430g Chr8 (149724..151226) [1503 bp, 500 aa] {ON} highly
           similar to uniprot|Q03532 Saccharomyces cerevisiae
           YMR290C HAS1 ATP-dependent RNA helicase localizes to
           both the nuclear periphery and nucleolus highly enriched
           in nuclear pore complex fractions
          Length = 500

 Score =  137 bits (344), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 80/242 (33%), Positives = 141/242 (58%), Gaps = 12/242 (4%)

Query: 141 SFPSFGLSKIVLNNIKRKGFRQPTPIQRKTIPLILQSRDIVGMARTGSGKTAAFILPMVE 200
           +F    LS+  +  I++ GF Q T +Q +TIP ++  RD++G A+TGSGKT AF++P +E
Sbjct: 38  TFKELNLSQQTVKAIEKMGFTQMTQVQSRTIPPLMAGRDVLGAAKTGSGKTLAFLIPAIE 97

Query: 201 KLKSHSGKI----GARAVILSPSRELAMQTFNVFKDFARGTELRSVLLTGGDSLEEQFSM 256
            L  HS K     G   ++++P+RELA+Q F V ++          ++ GG +  ++   
Sbjct: 98  ML--HSLKFKPRNGTGVIVITPTRELALQIFGVARELMEFHSQTFGIVIGGANRRQEAEK 155

Query: 257 MMSNPDVIIATPGRFL-HLKVEMNLDLKSVEYVVFDEADRLFEMGFQEQLNELLASLPTT 315
           ++   +++IATPGR L HL+       K+++ +  DEADR+ E+GF++++ +++  LP  
Sbjct: 156 LVKGVNLLIATPGRLLDHLQNTKGFVFKNLKALCIDEADRILEIGFEDEMKQIIKILPNE 215

Query: 316 -RQTLLFSATLPNSLVDFVKAGL-VNPVLVRLDA--ETKVSENLEMLFLSSKNADREANL 371
            RQ++LFSAT    + D  +  L   P+ + +D+  ET   E LE  ++  + +D+   L
Sbjct: 216 DRQSMLFSATQTTKVEDLARISLRPGPLFINVDSGKETSTVEGLEQGYVVCE-SDKRFLL 274

Query: 372 LY 373
           L+
Sbjct: 275 LF 276

 Score = 72.8 bits (177), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 39/105 (37%), Positives = 60/105 (57%), Gaps = 1/105 (0%)

Query: 435 EKATILFVPTRHHVEYISQLLRDCGYLISYIYGTLDQHARKNQLYNFRAGLTSILVVTDV 494
           +K  I+F+ + + V+Y ++LL      +  ++G   Q  R N  + F      ILV TDV
Sbjct: 284 KKKIIVFLSSCNSVKYYAELLNYIDLPVLELHGKQKQQKRTNTFFEFCNAERGILVCTDV 343

Query: 495 AARGVDIPMLANVINYTLPGSSKIFVHRVGRTARAGNKGWAYSIV 539
           AARG+DIP +  +I +  P   + ++HRVGRTAR G KG   S++
Sbjct: 344 AARGLDIPAVDWIIQFDPPDDPRDYIHRVGRTAR-GTKGKGKSLM 387

>ADL024C Chr4 complement(657270..658979) [1710 bp, 569 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGL171W
           (ROK1)
          Length = 569

 Score =  138 bits (347), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 89/251 (35%), Positives = 146/251 (58%), Gaps = 17/251 (6%)

Query: 140 GSFPS----FGLSKIVLNNIKRKGFRQPTPIQRKTIPLILQSRDIVGMARTGSGKTAAFI 195
           GSF      F L K +L+N+    F +PTPIQ + IP+ LQ+RDIV  A TGSGKT AF+
Sbjct: 119 GSFEDLVTRFKLDKRLLSNLIENNFTEPTPIQCEAIPISLQNRDIVACAPTGSGKTLAFL 178

Query: 196 LPMVEKLKSHSG-KIGARAVILSPSRELAMQTFNVFKDFARGTELR-----SVLLTGGDS 249
           +P+++++ S      G + +I+SP++ELA Q F+     A+   L      SV L     
Sbjct: 179 IPLLQQVISDKAVGTGVKGLIISPTKELANQIFDECSKLAQRIFLEKKRPLSVALLSKSL 238

Query: 250 LEEQFSMMMSNP--DVIIATPGRFLHLKVEMNLDLKSVEYVVFDEADRLFEMGFQEQLNE 307
             +  + ++S+   D+II+TP R + +    +LDL +V+Y++FDEAD+LF+  F EQ ++
Sbjct: 239 AAKLKNQIVSDKKYDIIISTPLRLIDIVKSESLDLSAVKYLIFDEADKLFDKTFVEQTDD 298

Query: 308 LLASL--PTTRQTLLFSATLPNSLVDFVKAGLVNPVLVRLDAETKVSENLEMLFLSSKNA 365
           +L++   P   + +LFSATLP+S+ +  ++ + +PV V +  +   + N+E   +   N 
Sbjct: 299 ILSACSHPNISK-VLFSATLPSSVEELAQSIMTDPVRVIIGHKEAANTNIEQKLVFCGN- 356

Query: 366 DREANLLYILQ 376
             E  L+ I Q
Sbjct: 357 -EEGKLVAIRQ 366

 Score = 43.9 bits (102), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 24/64 (37%), Positives = 38/64 (59%)

Query: 462 ISYIYGTLDQHARKNQLYNFRAGLTSILVVTDVAARGVDIPMLANVINYTLPGSSKIFVH 521
           +  I+    Q  R+  +  F++G    L+ TDV ARG+D   +  VINY +P S++ +VH
Sbjct: 401 VDVIHAERTQVQREKIIERFKSGDLWCLICTDVLARGIDFKGINLVINYDVPRSAQAYVH 460

Query: 522 RVGR 525
           R+GR
Sbjct: 461 RIGR 464

>ACR040W Chr3 (431343..433634) [2292 bp, 763 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YJL033W (HCA4)
          Length = 763

 Score =  139 bits (351), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 82/237 (34%), Positives = 136/237 (57%), Gaps = 12/237 (5%)

Query: 141 SFPSFGLSKIVLNNIKRKGFRQPTPIQRKTIPLILQSRDIVGMARTGSGKTAAFILPMVE 200
           +F    +S   +  +K   + + T IQR  IP+ L+  D++G A+TGSGKT AF++P++E
Sbjct: 42  TFQDLPISSGTVKGLKEAAYIKMTDIQRAAIPVALKGHDVLGAAKTGSGKTLAFLVPVLE 101

Query: 201 KL--KSHSGKIGARAVILSPSRELAMQTFNVFKDFARGTELRSVLLTGGDSLEEQFSM-M 257
           KL  +  +   G  A+++SP+RELAMQ + V     +     + L+ GG  +  +F M  
Sbjct: 102 KLYHERWTELDGLGALVISPTRELAMQIYEVLVKIGKYMSFSAGLVIGGKDV--KFEMER 159

Query: 258 MSNPDVIIATPGRFL-HLKVEMNLDLKSVEYVVFDEADRLFEMGFQEQLNELLASLPTTR 316
           +S  +++I TPGR L H+   + L+  +++ +V DEADR  +MGF++ L+ ++++LP +R
Sbjct: 160 VSKINILIGTPGRLLQHMDQSVGLNTSNLQILVLDEADRCLDMGFKKALDAIVSNLPPSR 219

Query: 317 QTLLFSATLPNSLVDFVKAGLVNPVLV-RLDAETK-----VSENLEMLFLSSKNADR 367
           QTLLFSAT   SL D  +  L +   V  +D  +        ENLE  ++     D+
Sbjct: 220 QTLLFSATQSQSLADLARLSLADYKTVGTMDGPSSKNKPATPENLEQFYIQVALPDK 276

 Score = 59.7 bits (143), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 31/97 (31%), Positives = 46/97 (47%), Gaps = 2/97 (2%)

Query: 439 ILFVPTRHHVEYISQLLRDC--GYLISYIYGTLDQHARKNQLYNFRAGLTSILVVTDVAA 496
           I+F+ +   V ++ +  R    G  + +++G   Q AR   L  F       L  TDV A
Sbjct: 293 IVFLSSSKQVHFVYETFRKMQPGISLMHLHGRQKQTARTETLDKFSRAQHVCLFSTDVVA 352

Query: 497 RGVDIPMLANVINYTLPGSSKIFVHRVGRTARAGNKG 533
           RG+D P +  VI    P     ++HR GR+AR G  G
Sbjct: 353 RGIDFPSVDWVIQTDCPEDVDTYIHRAGRSARYGKTG 389

>SAKL0E05148g Chr5 complement(419901..420979,421045..421372) [1407
           bp, 468 aa] {ON} highly similar to uniprot|Q07478
           Saccharomyces cerevisiae YDL084W SUB2 Suppresses the
           cold-sensitive snRNP biogenesis brr1-1 mutation RNA
           helicase
          Length = 468

 Score =  136 bits (342), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 104/410 (25%), Positives = 186/410 (45%), Gaps = 64/410 (15%)

Query: 137 HKKGSFPSFGLSKIVLNNIKRKGFRQPTPIQRKTIPLILQSRDIVGMARTGSGKTAAFIL 196
           H  G F  F L   +   I   GF  P+ +Q+ TIP  +   D++  A++G GKTA F+L
Sbjct: 82  HSTG-FKDFLLKPELSRAIIDCGFEHPSEVQQHTIPQSIHGTDVLCQAKSGLGKTAVFVL 140

Query: 197 PMVEKLKSHSGKIGARAVILSPSRELAMQTFNVFKDFARGT-ELRSVLLTGGDSLEEQFS 255
             +++L    G++    V++  +RELA Q  N +  F++   ++++ +  GG  +++   
Sbjct: 141 STLQQLDPVPGEVS--VVVICNARELAYQIRNEYLRFSKYMPDVKTAVFYGGTPIQKDAE 198

Query: 256 MMM---SNPDVIIATPGRFLHLKVEMNLDLKSVEYVVFDEADRLFE-MGFQEQLNELLAS 311
           ++    + P +++ATPGR   L  +  ++L  V+  V DE D++ E +  +  + ++  +
Sbjct: 199 LLKNKETAPHIVVATPGRLKALVRDKLINLGHVKNFVIDECDKVLEALDMRRDVQDIFRA 258

Query: 312 LPTTRQTLLFSATLPNSLVDFVKAGLVNPVLVRLDAETKVS-ENLEMLFLSSKNADREAN 370
            P  +Q ++FSATL   +    +  L NP+ + +D E K++   L+  ++  +  ++   
Sbjct: 259 TPRDKQVMMFSATLSQEIRPICRRFLQNPLEIFVDDEAKLTLHGLQQYYVKLEEREKNRK 318

Query: 371 LLYILQEVIRIPLATSEQLLKLQKSTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMPAAN 430
           L  +L ++         Q++   KST                                AN
Sbjct: 319 LAQLLDDL------EFNQVIIFVKSTLR------------------------------AN 342

Query: 431 ELPSEKATILFVPTRHHVEYISQLLRDCGYLISYIYGTLDQHARKNQLYNFRAGLTSILV 490
           EL                   ++LL    +    ++G + Q  R  +   F+     I V
Sbjct: 343 EL-------------------TKLLNASNFPAITVHGGMKQEERIARYKAFKEFEKRICV 383

Query: 491 VTDVAARGVDIPMLANVINYTLPGSSKIFVHRVGRTARAGNKGWAYSIVA 540
            TDV  RG+DI  +   INY LP  +  ++HRVGR  R G KG A S V+
Sbjct: 384 STDVFGRGIDIERINLAINYDLPNEADQYLHRVGRAGRFGTKGLAISFVS 433

>KAFR0F02940 Chr6 (582057..583388) [1332 bp, 443 aa] {ON} Anc_2.384
           YDL084W
          Length = 443

 Score =  135 bits (340), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 118/459 (25%), Positives = 201/459 (43%), Gaps = 77/459 (16%)

Query: 100 ILELSDDENNISGQTQAGEEEDDVNEYFSTNNLEKQK----HKKGS--------FPSFGL 147
           +LE SD+E  I  Q  A    +  N    T  +E +      KKGS        F  F L
Sbjct: 9   LLEYSDNEQEI--QVDASNAAEAGNAAEGTTGVEGESTTDGDKKGSYVGIHSTGFKDFLL 66

Query: 148 SKIVLNNIKRKGFRQPTPIQRKTIPLILQSRDIVGMARTGSGKTAAFILPMVEKLKSHSG 207
              +   I   GF  P+ +Q+ TIP  +   D++  A++G GKTA F+L  +++L    G
Sbjct: 67  KPELSRAIIDCGFEHPSEVQQHTIPQSIHGTDVLCQAKSGLGKTAVFVLSTLQQLDPVPG 126

Query: 208 KIGARAVILSPSRELAMQTFNVFKDFARGT-ELRSVLLTGGDSLEEQFSMMM---SNPDV 263
           ++    V++  +RELA Q  N +  F++   ++++ +  GG    +   ++    + P +
Sbjct: 127 EVS--VVVICNARELAYQIRNEYLRFSKYMPDVKTAVFYGGTPTSKDAEILKNKETAPHI 184

Query: 264 IIATPGRFLHLKVEMNLDLKSVEYVVFDEADRLF-EMGFQEQLNELLASLPTTRQTLLFS 322
           ++ATPGR   L  +  +DL  V+  V DE D++  E+  +  + E+  + P  +Q ++FS
Sbjct: 185 VVATPGRLKALVRDKYIDLSHVKNFVIDECDKVLEELDMRRDVQEIFRATPRDKQVMMFS 244

Query: 323 ATLPNSLVDFVKAGLVNPVLVRLDAETKVS-ENLEMLFLSSKNADREANLLYILQEVIRI 381
           ATL   +    +  L NP+ + +D E K++   L+  ++  +  ++   L  +L ++   
Sbjct: 245 ATLSQEIRPICRRFLQNPLEIFVDDEAKLTLHGLQQYYIKLEEREKNRKLAQLLDDL--- 301

Query: 382 PLATSEQLLKLQKSTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMPAANELPSEKATILF 441
                 Q++   KST                                ANEL         
Sbjct: 302 ---EFNQVIIFVKSTAR------------------------------ANEL--------- 319

Query: 442 VPTRHHVEYISQLLRDCGYLISYIYGTLDQHARKNQLYNFRAGLTSILVVTDVAARGVDI 501
                     ++LL    +    ++G + Q  R  +   F+     I V TDV  RG+DI
Sbjct: 320 ----------TKLLNASNFPAITVHGHMKQAERIARYKAFKDFEKRICVSTDVFGRGIDI 369

Query: 502 PMLANVINYTLPGSSKIFVHRVGRTARAGNKGWAYSIVA 540
             +   INY L   +  ++HRVGR  R G KG A S V+
Sbjct: 370 ERINLAINYDLSNEADQYLHRVGRAGRFGTKGLAISFVS 408

>KLTH0H04466g Chr8 (399689..401350) [1662 bp, 553 aa] {ON} similar
           to uniprot|P20447 Saccharomyces cerevisiae YGL078C DBP3
           Putative ATP-dependent RNA helicase of the DEAD-box
           family involved in ribosomal biogenesis
          Length = 553

 Score =  137 bits (345), Expect = 5e-33,   Method: Compositional matrix adjust.
 Identities = 78/216 (36%), Positives = 123/216 (56%), Gaps = 5/216 (2%)

Query: 141 SFPSFGLSKIVLNNIKRKGFRQPTPIQRKTIPLILQSRDIVGMARTGSGKTAAFILPMVE 200
           SF    LS  +   I +  F +PTPIQ  + P +L  +D+VG+A TGSGKT AF +P + 
Sbjct: 144 SFDQISLSSEIQEEISK--FPKPTPIQAVSWPYLLSGKDVVGVAETGSGKTFAFGVPAIH 201

Query: 201 KLKSHSGKI-GARAVILSPSRELAMQTFNVFKDFARGTELRSVLLTGGDSLEEQFSMMMS 259
            LK+   K  G + +++SP+RELA Q ++      +   +    + GG   +EQ S +  
Sbjct: 202 NLKTADAKSQGVQVLVISPTRELASQIYDNLILLTKKAGVNCCCVYGGVPKDEQRSQLKK 261

Query: 260 NPDVIIATPGRFLHLKVEMNLDLKSVEYVVFDEADRLFEMGFQEQLNELLASLPTT-RQT 318
           +  V++ATPGR L L  E +  L +V+Y+V DEADR+ E GF+E +  ++ S   T RQT
Sbjct: 262 S-QVVVATPGRLLDLIEEGSARLSNVKYLVLDEADRMLEKGFEEDIKRIIGSTKATGRQT 320

Query: 319 LLFSATLPNSLVDFVKAGLVNPVLVRLDAETKVSEN 354
           L+F+AT P  + +     + +PV + +    ++S N
Sbjct: 321 LMFTATWPKEVRELANTFMDSPVKISIGNRDELSAN 356

 Score = 84.0 bits (206), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 39/100 (39%), Positives = 63/100 (63%)

Query: 439 ILFVPTRHHVEYISQLLRDCGYLISYIYGTLDQHARKNQLYNFRAGLTSILVVTDVAARG 498
           ++F   +     + + L+  GY ++ I+G L Q  R   L  F++G +++L+ TDVAARG
Sbjct: 393 LIFALYKKEAARVERNLKYNGYNVAAIHGDLSQQQRTQALNEFKSGESNMLLATDVAARG 452

Query: 499 VDIPMLANVINYTLPGSSKIFVHRVGRTARAGNKGWAYSI 538
           +DIP +  VIN T P + + +VHR+GRT RAG  G A+++
Sbjct: 453 LDIPNVKTVINLTFPLTVEDYVHRIGRTGRAGLTGTAHTL 492

>ZYRO0D07546g Chr4 (657145..658629) [1485 bp, 494 aa] {ON} highly
           similar to uniprot|Q03532 Saccharomyces cerevisiae
           YMR290C HAS1 ATP-dependent RNA helicase localizes to
           both the nuclear periphery and nucleolus highly enriched
           in nuclear pore complex fractions
          Length = 494

 Score =  136 bits (342), Expect = 5e-33,   Method: Compositional matrix adjust.
 Identities = 86/264 (32%), Positives = 150/264 (56%), Gaps = 17/264 (6%)

Query: 119 EEDDVNEYFSTNNLEKQKHKKGSFPSFGLSKIVLNNIKRKGFRQPTPIQRKTIPLILQSR 178
           EE+DV ++  ++    Q     +F    LS+  L  I + GF   T +Q +TIP +L  R
Sbjct: 14  EENDVEQHEESSEKLSQ-----TFGELELSQPTLKAIDKMGFTTMTSVQARTIPPLLAGR 68

Query: 179 DIVGMARTGSGKTAAFILPMVEKLKSHSGKI----GARAVILSPSRELAMQTFNVFKDFA 234
           D++G A+TGSGKT AF++P +E+L  HS K     G   ++++P+RELA+Q F V ++  
Sbjct: 69  DVLGAAKTGSGKTLAFLIPAIERL--HSLKFKPRNGTGVIVITPTRELALQIFGVARELM 126

Query: 235 RGTELRSVLLTGGDSLEEQFSMMMSNPDVIIATPGRFL-HLKVEMNLDLKSVEYVVFDEA 293
                   ++ GG +  ++   ++   +++IATPGR L HL+       K+++ ++ DEA
Sbjct: 127 EFHSQTFGIVIGGANRRQEADKLVKGVNLLIATPGRLLDHLQNTKGFVFKNLKALIIDEA 186

Query: 294 DRLFEMGFQEQLNELLASLPTT-RQTLLFSATLPNSLVDFVKAGL-VNPVLVRLDAETKV 351
           DR+ E+GF+E++ +++  LP   RQ++LFSAT    + D  +  L   P+ + + +E   
Sbjct: 187 DRILEIGFEEEMRQIIKILPNEDRQSMLFSATQTTKVEDLARISLRAGPLFINVVSEKDN 246

Query: 352 S--ENLEMLFLSSKNADREANLLY 373
           S  E LE  ++   ++D+   LL+
Sbjct: 247 STVEGLEQGYVVC-DSDKRFLLLF 269

 Score = 71.2 bits (173), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 39/105 (37%), Positives = 60/105 (57%), Gaps = 1/105 (0%)

Query: 435 EKATILFVPTRHHVEYISQLLRDCGYLISYIYGTLDQHARKNQLYNFRAGLTSILVVTDV 494
           +K  I+F+ + + V+Y ++LL      +  ++G   Q  R N  + F      ILV TDV
Sbjct: 277 KKKIIVFLSSCNSVKYYAELLNYIDLPVLELHGKQKQQKRTNTFFEFCNAERGILVSTDV 336

Query: 495 AARGVDIPMLANVINYTLPGSSKIFVHRVGRTARAGNKGWAYSIV 539
           AARG+DIP +  +I +  P   + ++HRVGRTAR G KG   S++
Sbjct: 337 AARGLDIPAVDWIIQFDPPDDPRDYIHRVGRTAR-GAKGKGKSLM 380

>Kwal_56.24588 s56 (1065225..1066766) [1542 bp, 513 aa] {ON} YDL160C
           (DHH1) - (putative) DEAD box RNA helicase [contig 161]
           FULL
          Length = 513

 Score =  136 bits (343), Expect = 5e-33,   Method: Compositional matrix adjust.
 Identities = 72/205 (35%), Positives = 116/205 (56%), Gaps = 2/205 (0%)

Query: 141 SFPSFGLSKIVLNNIKRKGFRQPTPIQRKTIPLILQSRDIVGMARTGSGKTAAFILPMVE 200
           +F  F L + +L  I   GF +P+PIQ + IP+ +  RD++  A+ G+GKTAAF++P +E
Sbjct: 30  TFEDFYLKRELLMGIFEAGFEKPSPIQEEAIPIAIAGRDVLARAKNGTGKTAAFVIPTLE 89

Query: 201 KLKSHSGKIGARAVILSPSRELAMQTFNVFKDFARGTELRSVLLTGGDSLEEQFSMMMSN 260
           K++    KI  +A+I+ P+RELA+QT  V +   +   +  ++ TGG +L +    +   
Sbjct: 90  KVRPKLNKI--QALIMVPTRELALQTSQVVRTLGKHCGVSCMVTTGGTNLRDDILRLNEP 147

Query: 261 PDVIIATPGRFLHLKVEMNLDLKSVEYVVFDEADRLFEMGFQEQLNELLASLPTTRQTLL 320
             V++ TPGR L L      DL      V DEAD++    F+  + ++L  LP   Q+LL
Sbjct: 148 VHVLVGTPGRVLDLASRKVADLSECPLFVMDEADKMLSRDFKAIIEQILTFLPPVHQSLL 207

Query: 321 FSATLPNSLVDFVKAGLVNPVLVRL 345
           FSAT P ++ +F+   L  P  + L
Sbjct: 208 FSATFPLTVKEFMVKHLHKPYEINL 232

 Score = 73.9 bits (180), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 41/153 (26%), Positives = 73/153 (47%), Gaps = 5/153 (3%)

Query: 439 ILFVPTRHHVEYISQLLRDCGYLISYIYGTLDQHARKNQLYNFRAGLTSILVVTDVAARG 498
           I+F  + + VE +++ + D GY   Y +  + Q  R    + FR G    LV +D+  RG
Sbjct: 270 IIFCNSTNRVELLAKKITDLGYSCYYSHARMKQSERNKVFHEFRQGKVRTLVCSDLLTRG 329

Query: 499 VDIPMLANVINYTLPGSSKIFVHRVGRTARAGNKGWAYSIVAXXXXXXXXXXXXXXGKKI 558
           +DI  +  VIN+  P +++ ++HR+GR+ R G+ G A +++               G +I
Sbjct: 330 IDIQAVNVVINFDFPKTAETYLHRIGRSGRFGHLGLAINLINWNDRFNLYKIEQELGTEI 389

Query: 559 LLTPMYDSLVDVMKKRWVEEGNSAYNFQLPKLS 591
              P       + K  +V E +SA     P ++
Sbjct: 390 AAIP-----AQIDKSLYVAEDDSAVPVPFPLVT 417

>CAGL0J01045g Chr10 (101282..103579) [2298 bp, 765 aa] {ON} highly
           similar to uniprot|P20448 Saccharomyces cerevisiae
           YJL033w HCA4
          Length = 765

 Score =  139 bits (349), Expect = 6e-33,   Method: Compositional matrix adjust.
 Identities = 76/201 (37%), Positives = 118/201 (58%), Gaps = 4/201 (1%)

Query: 142 FPSFGLSKIVLNNIKRKGFRQPTPIQRKTIPLILQSRDIVGMARTGSGKTAAFILPMVEK 201
           F    +SK  L  +    F + T IQR +I   LQ  D+ G A+TGSGKT AF++P++EK
Sbjct: 43  FKDLPISKSTLKGLNEASFIKMTDIQRDSIVTSLQGHDVFGTAKTGSGKTLAFLVPVLEK 102

Query: 202 L--KSHSGKIGARAVILSPSRELAMQTFNVFKDFARGTELRSVLLTGGDSLEEQFSMMMS 259
           L  +  +   G  A+I+SP+RELAMQ + V       T+  + L+ GG  +  +   + +
Sbjct: 103 LYRERWTEFDGLGALIISPTRELAMQIYEVLVKIGSHTQFSAGLVIGGKDVNFELERI-A 161

Query: 260 NPDVIIATPGRFL-HLKVEMNLDLKSVEYVVFDEADRLFEMGFQEQLNELLASLPTTRQT 318
             +++I TPGR L H+   + L+  +++ +V DEADR  +MGFQ+ L+ ++ +LP  RQT
Sbjct: 162 KINILIGTPGRILQHMDQAVGLNTSNLQMLVLDEADRCLDMGFQKTLDAIVGNLPPDRQT 221

Query: 319 LLFSATLPNSLVDFVKAGLVN 339
           LLFSAT   S+ D  +  L +
Sbjct: 222 LLFSATQSQSISDLARLSLTD 242

 Score = 65.1 bits (157), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 40/143 (27%), Positives = 60/143 (41%), Gaps = 23/143 (16%)

Query: 439 ILFVPTRHHVEYISQLLRDC--GYLISYIYGTLDQHARKNQLYNFRAGLTSILVVTDVAA 496
           I+F  +   V ++ +  R    G  + +++G   Q AR   L  F       L  TDV A
Sbjct: 291 IVFFSSSKQVHFVYETFRKMQPGISLLHLHGRQKQRARTETLDKFFRAQQVCLFATDVVA 350

Query: 497 RGVDIPMLANVINYTLPGSSKIFVHRVGRTARAGNKGWAYSIVAXXXXXXXXXXXXXXGK 556
           RG+D P +  VI    P     ++HRVGR AR G KG +                     
Sbjct: 351 RGIDFPAVDWVIQVDCPEDVDTYIHRVGRAARYGKKGRSL-------------------- 390

Query: 557 KILLTPMYDSLVDVMKKRWVEEG 579
            I+LTP  ++ +  M  + +E G
Sbjct: 391 -IILTPQEEAFLTRMAAKKIEPG 412

>NDAI0E01750 Chr5 complement(346153..347505) [1353 bp, 450 aa] {ON}
           Anc_2.384
          Length = 450

 Score =  135 bits (339), Expect = 6e-33,   Method: Compositional matrix adjust.
 Identities = 100/388 (25%), Positives = 176/388 (45%), Gaps = 63/388 (16%)

Query: 159 GFRQPTPIQRKTIPLILQSRDIVGMARTGSGKTAAFILPMVEKLKSHSGKIGARAVILSP 218
           GF  P+ +Q+ TIP  +   D++  A++G GKTA F+L  +++L    G++    V++  
Sbjct: 85  GFEHPSEVQQHTIPQSIHGTDVLCQAKSGLGKTAVFVLSTLQQLDPVPGEVA--VVVICN 142

Query: 219 SRELAMQTFNVFKDFARGT-ELRSVLLTGGDSLEEQFSMMM---SNPDVIIATPGRFLHL 274
           +RELA Q  N +  F++   ++++ +  GG  + +   ++    + P +++ATPGR   L
Sbjct: 143 ARELAYQIRNEYLRFSKYMPDVKTAVFYGGTPINKDAELLKNKDTAPHIVVATPGRLKAL 202

Query: 275 KVEMNLDLKSVEYVVFDEADRLF-EMGFQEQLNELLASLPTTRQTLLFSATLPNSLVDFV 333
             +  +DL  V+  V DE D++  E+  +  + E+  + P  +Q ++FSATL   +    
Sbjct: 203 VRDKYIDLSHVKNFVIDECDKVLEELDMRRDVQEIFRATPRDKQVMMFSATLSQEIRPIC 262

Query: 334 KAGLVNPVLVRLDAETKVS-ENLEMLFLSSKNADREANLLYILQEVIRIPLATSEQLLKL 392
           +  L NP+ + +D E K++   L+  ++  +  ++   L  +L ++         Q++  
Sbjct: 263 RRFLQNPLEIFVDDEAKLTLHGLQQYYIKLEEREKNRKLAQLLDDL------EFNQVIIF 316

Query: 393 QKSTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMPAANELPSEKATILFVPTRHHVEYIS 452
            KST                                ANEL                   +
Sbjct: 317 VKSTNR------------------------------ANEL-------------------T 327

Query: 453 QLLRDCGYLISYIYGTLDQHARKNQLYNFRAGLTSILVVTDVAARGVDIPMLANVINYTL 512
           +LL    +    ++G + Q  R  +   F+     I V TDV  RG+DI  +   INY L
Sbjct: 328 KLLNASNFPAITVHGHMKQEERIARYKAFKDFEKRICVSTDVFGRGIDIERINLAINYDL 387

Query: 513 PGSSKIFVHRVGRTARAGNKGWAYSIVA 540
                 ++HRVGR  R G KG A S VA
Sbjct: 388 TSEPDQYLHRVGRAGRFGTKGLAISFVA 415

>KAFR0B04480 Chr2 complement(929008..930315) [1308 bp, 435 aa] {ON}
           Anc_5.69 YHR169W
          Length = 435

 Score =  134 bits (338), Expect = 6e-33,   Method: Compositional matrix adjust.
 Identities = 77/195 (39%), Positives = 106/195 (54%), Gaps = 8/195 (4%)

Query: 141 SFPSFGLSKIVLNNIKRKGFRQPTPIQRKTIPLILQSRDIVGMARTGSGKTAAFILPMVE 200
           SF   GLSK +L++++     QPT IQ   IP IL+ RD +G A+TGSGKT  F  PM+ 
Sbjct: 6   SFKQLGLSKWLLDSLRAMKITQPTTIQSHCIPEILKGRDCIGGAKTGSGKTITFAAPMLA 65

Query: 201 KLKSHSGKIGARAVILSPSRELAMQTFNVFKDFARGTELRSVLLTGGDSLEEQFSMMMSN 260
           +        G   V+L+P+RELAMQ    F        +R  L+ GG+S+  Q   +   
Sbjct: 66  RWSEDP--CGMFGVVLTPTRELAMQIAEQFTALGSSMNIRVALIVGGESIVNQAIELQRK 123

Query: 261 PDVIIATPGRFLHLKVEMNLD----LKSVEYVVFDEADRLFEMGFQEQLNELLASLP--T 314
           P  IIATPGR  H  +    D    LK  +Y+V DEAD L    F + L+  + +LP   
Sbjct: 124 PHFIIATPGRLAHHILNSGEDTVGGLKRAKYLVLDEADFLLNDTFAKDLSTCIGALPDKN 183

Query: 315 TRQTLLFSATLPNSL 329
            RQTLLF+AT+ + +
Sbjct: 184 ARQTLLFTATITDQV 198

 Score = 83.2 bits (204), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 39/102 (38%), Positives = 58/102 (56%)

Query: 438 TILFVPTRHHVEYISQLLRDCGYLISYIYGTLDQHARKNQLYNFRAGLTSILVVTDVAAR 497
            I+FV      E + + L+     ++ ++  + Q  R N L+ FRA    IL+ TDVA+R
Sbjct: 260 VIIFVNRTATAEVLRKTLKHLDLRVASLHSQMSQQERTNSLHRFRANAARILIATDVASR 319

Query: 498 GVDIPMLANVINYTLPGSSKIFVHRVGRTARAGNKGWAYSIV 539
           G+DIP +  V+NY +P     ++HR GRTARAG  G A S +
Sbjct: 320 GLDIPTVELVVNYDIPSDPDTYIHRSGRTARAGKSGDAISFI 361

>TDEL0G00650 Chr7 (132659..134116) [1458 bp, 485 aa] {ON} Anc_5.40
           YMR290C
          Length = 485

 Score =  135 bits (340), Expect = 7e-33,   Method: Compositional matrix adjust.
 Identities = 85/264 (32%), Positives = 146/264 (55%), Gaps = 27/264 (10%)

Query: 119 EEDDVNEYFSTNNLEKQKHKKGSFPSFGLSKIVLNNIKRKGFRQPTPIQRKTIPLILQSR 178
           E DDV E FS  NL               S   +  +++ GF   TP+Q +TIP +L  R
Sbjct: 15  ENDDVVEEFSGLNL---------------SDATMKAVEKMGFSSMTPVQARTIPPLLAGR 59

Query: 179 DIVGMARTGSGKTAAFILPMVEKLKSHSGKI----GARAVILSPSRELAMQTFNVFKDFA 234
           D++G A+TGSGKT AF++P +E+L  HS K     G   ++++P+RELA+Q F V ++  
Sbjct: 60  DVLGAAKTGSGKTLAFLIPAIERL--HSLKFKPRNGTGVIVITPTRELALQIFGVARELM 117

Query: 235 RGTELRSVLLTGGDSLEEQFSMMMSNPDVIIATPGRFL-HLKVEMNLDLKSVEYVVFDEA 293
                   ++ GG +  ++   +    +++IATPGR L HL+       K+++ +V DEA
Sbjct: 118 EFHSQTYGIVIGGANRRQEADKLAKGVNMLIATPGRLLDHLQNTKGFVFKNLKALVIDEA 177

Query: 294 DRLFEMGFQEQLNELLASLPT-TRQTLLFSATLPNSLVDFVKAGL-VNPVLVRLDAE--T 349
           DR+ E+GF++++ +++  LP   RQ++LFSAT    + D  +  L   P+ + + +E   
Sbjct: 178 DRILEIGFEDEMRQIIKILPNDDRQSMLFSATQTTKVEDLARISLRPGPLFINVVSEKDN 237

Query: 350 KVSENLEMLFLSSKNADREANLLY 373
             ++ LE  ++   ++D+   LL+
Sbjct: 238 STADGLEQGYVVC-DSDKRFLLLF 260

 Score = 72.8 bits (177), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 38/105 (36%), Positives = 60/105 (57%), Gaps = 1/105 (0%)

Query: 435 EKATILFVPTRHHVEYISQLLRDCGYLISYIYGTLDQHARKNQLYNFRAGLTSILVVTDV 494
           +K  I+F+ + + V+Y ++LL      +  ++G   Q  R N  + F      IL+ TDV
Sbjct: 268 KKKVIVFLSSCNSVKYYAELLNYIDLPVLELHGKQKQQKRTNTFFEFCNAERGILICTDV 327

Query: 495 AARGVDIPMLANVINYTLPGSSKIFVHRVGRTARAGNKGWAYSIV 539
           AARG+DIP +  +I +  P   + ++HRVGRTAR G KG   S++
Sbjct: 328 AARGLDIPAVDWIIQFDPPDDPRDYIHRVGRTAR-GTKGKGKSLM 371

>NCAS0F02200 Chr6 (438960..440486) [1527 bp, 508 aa] {ON} Anc_5.40
          Length = 508

 Score =  135 bits (341), Expect = 8e-33,   Method: Compositional matrix adjust.
 Identities = 80/241 (33%), Positives = 140/241 (58%), Gaps = 12/241 (4%)

Query: 142 FPSFGLSKIVLNNIKRKGFRQPTPIQRKTIPLILQSRDIVGMARTGSGKTAAFILPMVEK 201
           F    LS   L  I++ GF   TP+Q +TIP ++  RD++G A+TGSGKT AF++P +E 
Sbjct: 46  FQDLTLSPPTLKAIEKMGFTTLTPVQARTIPPLMAGRDVLGAAKTGSGKTLAFLIPAIEL 105

Query: 202 LKSHSGKI----GARAVILSPSRELAMQTFNVFKDFARGTELRSVLLTGGDSLEEQFSMM 257
           L  HS K     G   ++++P+RELA+Q F V ++          ++ GG +  ++   +
Sbjct: 106 L--HSLKFKPRNGTGIIVITPTRELALQIFGVARELMEFHSQTFGIVIGGANRRQEADKL 163

Query: 258 MSNPDVIIATPGRFL-HLKVEMNLDLKSVEYVVFDEADRLFEMGFQEQLNELLASLPTT- 315
           M   +++IATPGR L HL+       K+++ ++ DEADR+ E+GF++++ +++  LP   
Sbjct: 164 MKGVNMLIATPGRLLDHLQNTKGFVFKNLKALIIDEADRILEIGFEDEMKQIIKILPNED 223

Query: 316 RQTLLFSATLPNSLVDFVKAGL-VNPVLVRLDAE--TKVSENLEMLFLSSKNADREANLL 372
           RQ++LFSAT    + D  +  L   P+ + + +E  T  ++ LE  ++   ++D+   LL
Sbjct: 224 RQSMLFSATQTTKVEDLARISLRKGPLFINVASEDNTSTADGLEQGYVVC-DSDKRFLLL 282

Query: 373 Y 373
           +
Sbjct: 283 F 283

 Score = 72.0 bits (175), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 37/105 (35%), Positives = 60/105 (57%), Gaps = 1/105 (0%)

Query: 435 EKATILFVPTRHHVEYISQLLRDCGYLISYIYGTLDQHARKNQLYNFRAGLTSILVVTDV 494
           +K  I+F+ + + V+Y ++LL      +  ++G   Q  R N  + F      IL+ TDV
Sbjct: 291 KKKIIVFLSSCNSVKYYAELLNYIDLPVLELHGKQKQQKRTNTFFEFCNADRGILICTDV 350

Query: 495 AARGVDIPMLANVINYTLPGSSKIFVHRVGRTARAGNKGWAYSIV 539
           AARG+DIP +  ++ +  P   + ++HRVGRTAR G KG   S++
Sbjct: 351 AARGLDIPAVDWIVQFDPPDDPRDYIHRVGRTAR-GTKGKGKSLM 394

>AGR333C Chr7 complement(1353154..1354668) [1515 bp, 504 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YMR290C
           (HAS1)
          Length = 504

 Score =  135 bits (341), Expect = 8e-33,   Method: Compositional matrix adjust.
 Identities = 81/241 (33%), Positives = 139/241 (57%), Gaps = 12/241 (4%)

Query: 142 FPSFGLSKIVLNNIKRKGFRQPTPIQRKTIPLILQSRDIVGMARTGSGKTAAFILPMVEK 201
           F    LS   L  I + GF + T +Q +TIP ++  RD++G A+TGSGKT AF+LP +E 
Sbjct: 41  FDELNLSSQTLKAIGKMGFTKMTQVQARTIPPLMAGRDVLGAAKTGSGKTLAFLLPAIEM 100

Query: 202 LKSHSGKI----GARAVILSPSRELAMQTFNVFKDFARGTELRSVLLTGGDSLEEQFSMM 257
           L  HS K     G   ++++P+RELA+Q F V ++          ++ GG +  ++   +
Sbjct: 101 L--HSLKFKPRNGTGVIVITPTRELALQIFGVARELMEFHSQTFGIVIGGANRRQEAEKL 158

Query: 258 MSNPDVIIATPGRFL-HLKVEMNLDLKSVEYVVFDEADRLFEMGFQEQLNELLASLPTT- 315
               +++IATPGR L HL+       K+++ +V DEADR+ E+GF++++ +++  LP   
Sbjct: 159 AKGVNLLIATPGRLLDHLQNTKGFVFKNLKALVIDEADRILEIGFEDEMKQIIKILPNED 218

Query: 316 RQTLLFSATLPNSLVDFVKAGL-VNPVLVRLDA--ETKVSENLEMLFLSSKNADREANLL 372
           RQ++LFSAT    + D  +  L   P+ + +D+  ET  ++ LE  ++   ++D+   LL
Sbjct: 219 RQSMLFSATQTTKVEDLARISLRPGPLFINVDSEKETSTADGLEQGYVVC-DSDKRFLLL 277

Query: 373 Y 373
           +
Sbjct: 278 F 278

 Score = 71.6 bits (174), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 38/104 (36%), Positives = 59/104 (56%), Gaps = 1/104 (0%)

Query: 436 KATILFVPTRHHVEYISQLLRDCGYLISYIYGTLDQHARKNQLYNFRAGLTSILVVTDVA 495
           K  I+F+ + + V+Y ++LL      +  ++G   Q  R N  + F      ILV TDVA
Sbjct: 287 KKIIVFLSSCNSVKYYAELLNYIDLPVLELHGKQKQQKRTNTFFEFCNAERGILVCTDVA 346

Query: 496 ARGVDIPMLANVINYTLPGSSKIFVHRVGRTARAGNKGWAYSIV 539
           ARG+DIP +  +I +  P   + ++HRVGRTA+ G KG   S++
Sbjct: 347 ARGLDIPAVDWIIQFDPPDDPRDYIHRVGRTAK-GTKGKGKSLM 389

>Suva_12.48 Chr12 (66743..69055) [2313 bp, 770 aa] {ON} YJL033W
           (REAL)
          Length = 770

 Score =  138 bits (347), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 74/201 (36%), Positives = 121/201 (60%), Gaps = 4/201 (1%)

Query: 142 FPSFGLSKIVLNNIKRKGFRQPTPIQRKTIPLILQSRDIVGMARTGSGKTAAFILPMVEK 201
           F    +S+  L  ++   F + T IQ  +IP+ LQ  DI+  A+TGSGKT AF++P++E+
Sbjct: 43  FKDLPISEPTLKGLRESSFMKLTEIQADSIPVSLQGHDILAAAKTGSGKTLAFLIPVIER 102

Query: 202 L--KSHSGKIGARAVILSPSRELAMQTFNVFKDFARGTELRSVLLTGGDSLEEQFSMMMS 259
           L  +  +   G  A+I+SP+RELAMQ + V       T   + L+ GG  ++ +   + S
Sbjct: 103 LYREKWTEFDGLGALIISPTRELAMQIYEVLTKIGSHTSFSAGLVIGGKDVKFELERI-S 161

Query: 260 NPDVIIATPGRFL-HLKVEMNLDLKSVEYVVFDEADRLFEMGFQEQLNELLASLPTTRQT 318
             +++I TPGR L HL   + L+  +++ +V DEADR  +MGF++ L+ ++++L  +RQT
Sbjct: 162 RINILIGTPGRILQHLDQAVGLNTSNLQMLVLDEADRCLDMGFKKTLDAIVSNLSPSRQT 221

Query: 319 LLFSATLPNSLVDFVKAGLVN 339
           LLFSAT   S+ D  +  L +
Sbjct: 222 LLFSATQSQSVADLARLSLTD 242

 Score = 65.5 bits (158), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 32/97 (32%), Positives = 47/97 (48%), Gaps = 2/97 (2%)

Query: 439 ILFVPTRHHVEYISQLLRDC--GYLISYIYGTLDQHARKNQLYNFRAGLTSILVVTDVAA 496
           I+F+ +   V ++ +  R    G  + +++G   Q AR   L  F       L  TDV A
Sbjct: 295 IVFLSSSKQVHFVYETFRKMQPGISLMHLHGRQKQRARTETLDKFNRAQQVCLFATDVVA 354

Query: 497 RGVDIPMLANVINYTLPGSSKIFVHRVGRTARAGNKG 533
           RG+D P +  V+    P     ++HRVGR AR G KG
Sbjct: 355 RGIDFPAVEWVVQIDCPEDVDTYIHRVGRCARYGKKG 391

>Skud_8.233 Chr8 (413556..414869) [1314 bp, 437 aa] {ON} YHR169W
           (REAL)
          Length = 437

 Score =  134 bits (337), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 78/198 (39%), Positives = 106/198 (53%), Gaps = 8/198 (4%)

Query: 138 KKGSFPSFGLSKIVLNNIKRKGFRQPTPIQRKTIPLILQSRDIVGMARTGSGKTAAFILP 197
           K   F S GLSK +  ++K     QPT IQ+  IP IL+ RD +G A+TGSGKT AF  P
Sbjct: 6   KTTDFKSLGLSKWLTESLKAMKITQPTAIQKACIPKILEGRDCIGGAKTGSGKTIAFAGP 65

Query: 198 MVEKLKSHSGKIGARAVILSPSRELAMQTFNVFKDFARGTELRSVLLTGGDSLEEQFSMM 257
           M+ K        G   V+L+P+RELAMQ    F        +R  ++ GG+S+ +Q   +
Sbjct: 66  MLTKWSEDP--CGMFGVVLTPTRELAMQIAEQFTALGSSMNIRVSVVVGGESIIQQALAL 123

Query: 258 MSNPDVIIATPGRFLHLKVEMNLD----LKSVEYVVFDEADRLFEMGFQEQLNELLASLP 313
              P  IIATPGR  H  +    D    L   +Y+V DEAD L    F + L   + +LP
Sbjct: 124 QRKPHFIIATPGRLAHHIMSSGEDTVGGLMRAKYLVLDEADILLTSTFADHLATCIGALP 183

Query: 314 T--TRQTLLFSATLPNSL 329
               RQTLLF+AT+ + +
Sbjct: 184 AKDKRQTLLFTATITDQV 201

 Score = 87.4 bits (215), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 41/104 (39%), Positives = 60/104 (57%)

Query: 436 KATILFVPTRHHVEYISQLLRDCGYLISYIYGTLDQHARKNQLYNFRAGLTSILVVTDVA 495
           K  I+FV      E + + L+     ++ ++  + Q  R N L+ FRA    +L+ TDVA
Sbjct: 261 KTAIIFVNRTMTAEILRRTLKQLEVRVASLHSQMPQQERTNSLHRFRANAARVLIATDVA 320

Query: 496 ARGVDIPMLANVINYTLPGSSKIFVHRVGRTARAGNKGWAYSIV 539
           +RG+DIP +  V+NY +P    +F+HR GRTARAG  G A S V
Sbjct: 321 SRGLDIPTVELVVNYDIPSDPDVFIHRSGRTARAGRNGDAISFV 364

>Kpol_513.15 s513 complement(41334..42839) [1506 bp, 501 aa] {ON}
           complement(41334..42839) [1506 nt, 502 aa]
          Length = 501

 Score =  135 bits (340), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 80/242 (33%), Positives = 140/242 (57%), Gaps = 12/242 (4%)

Query: 141 SFPSFGLSKIVLNNIKRKGFRQPTPIQRKTIPLILQSRDIVGMARTGSGKTAAFILPMVE 200
           +F    LS   L  I++ GF   TP+Q +TIP +L  RD++G A+TGSGKT AF++P +E
Sbjct: 38  NFKDLKLSDPTLKAIEKMGFTSMTPVQARTIPPLLAGRDVLGAAKTGSGKTLAFLIPAIE 97

Query: 201 KLKSHSGKI----GARAVILSPSRELAMQTFNVFKDFARGTELRSVLLTGGDSLEEQFSM 256
            L  HS K     G   ++++P+RELA+Q F V ++          ++ GG +  ++   
Sbjct: 98  ML--HSLKFKPRNGTGVIVITPTRELALQIFGVVRELMEFHSQTFGIVIGGANRRQEAEK 155

Query: 257 MMSNPDVIIATPGRFL-HLKVEMNLDLKSVEYVVFDEADRLFEMGFQEQLNELLASLPTT 315
           ++   ++++ATPGR L HL+       K+++ +V DEADR+ E+GF++++ +++  LP  
Sbjct: 156 LIKGVNMLVATPGRLLDHLQNTKGFVFKNLKALVIDEADRILEIGFEDEMKQIIKILPNE 215

Query: 316 -RQTLLFSATLPNSLVDFVKAGL-VNPVLVRLDAE--TKVSENLEMLFLSSKNADREANL 371
            RQ++LFSAT    + D  +  L   P+ + +  E  T  ++ LE  ++  + +D+   L
Sbjct: 216 DRQSMLFSATQTTKVEDLARISLRKGPLFINVVTERDTSTADGLEQGYVVCE-SDKRFLL 274

Query: 372 LY 373
           L+
Sbjct: 275 LF 276

 Score = 72.4 bits (176), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 39/105 (37%), Positives = 59/105 (56%), Gaps = 1/105 (0%)

Query: 435 EKATILFVPTRHHVEYISQLLRDCGYLISYIYGTLDQHARKNQLYNFRAGLTSILVVTDV 494
           +K  I+F+ + + V Y ++LL      +  ++G   Q  R N  + F      ILV TDV
Sbjct: 284 KKKIIVFLSSCNSVRYYAELLNYIDLPVLELHGKQKQQKRTNTFFEFCNAERGILVCTDV 343

Query: 495 AARGVDIPMLANVINYTLPGSSKIFVHRVGRTARAGNKGWAYSIV 539
           AARG+DIP +  +I +  P   + ++HRVGRTAR G KG   S++
Sbjct: 344 AARGLDIPAVDWIIQFDPPDDPRDYIHRVGRTAR-GTKGKGKSLM 387

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.315    0.131    0.364 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 92,901,516
Number of extensions: 3958915
Number of successful extensions: 14391
Number of sequences better than 10.0: 638
Number of HSP's gapped: 13576
Number of HSP's successfully gapped: 1137
Length of query: 998
Length of database: 53,481,399
Length adjustment: 120
Effective length of query: 878
Effective length of database: 39,721,479
Effective search space: 34875458562
Effective search space used: 34875458562
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 71 (32.0 bits)