Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Smik_3.541.52ON1032103248400.0
YCL024W (KCC4)1.52ON1037103934750.0
Skud_3.391.52ON1017103433490.0
Suva_3.1901.52ON1024104231190.0
Suva_2.6871.52ON1128114419690.0
KLLA0C01650g1.52ON1112113818560.0
KAFR0D041001.52ON1117113418530.0
CAGL0K05709g1.52ON110336814540.0
YDR507C (GIN4)1.52ON114236914430.0
Smik_4.7891.52ON113636914390.0
NCAS0B086001.52ON111735814351e-180
Skud_4.7831.52ON113536114311e-180
TBLA0A071501.52ON139144514401e-178
NDAI0A006601.52ON102236114111e-178
TDEL0C064901.52ON115336914121e-176
Kpol_2002.461.52ON112337014091e-176
KLTH0F01672g1.52ON116436414041e-175
TPHA0E036401.52ON113739413941e-174
KNAG0F002901.52ON112535713931e-174
ZYRO0F17402g1.52ON118937313721e-170
AFR696C1.52ON114235313671e-170
Ecym_10581.52ON116435313651e-169
SAKL0C01716g1.52ON121537613631e-169
KLTH0D05566g2.479ON11283649981e-117
Kwal_26.77882.479ON12673649971e-116
Ecym_73922.479ON143435510021e-115
SAKL0E02860g2.479ON13773589981e-115
KLLA0F13552g2.479ON12673739891e-114
ABL034W2.479ON14253589941e-114
KAFR0D032002.479ON14483849671e-111
YKL101W (HSL1)2.479ON15184049671e-110
Skud_11.1262.479ON15184049631e-110
Suva_11.1232.479ON15263929581e-109
Smik_11.1392.479ON15343929581e-109
KNAG0A065402.479ON14323849511e-108
Kpol_431.92.479ON15523989531e-108
NCAS0A057702.479ON14613879461e-108
TBLA0I011502.479ON17453899471e-107
ZYRO0G03366g2.479ON16163999411e-106
TDEL0A025502.479ON13693999311e-106
CAGL0K08514g2.479ON14893959331e-106
TPHA0G032002.479ON15344298641e-96
NDAI0D027502.479ON15152988137e-90
CAGL0M08910g5.611ON6122696383e-71
Kpol_495.145.611ON6242696361e-70
TPHA0C004705.611ON6312696342e-70
YDR477W (SNF1)5.611ON6332696333e-70
Smik_4.7545.611ON6322696315e-70
Skud_4.7515.611ON6342696316e-70
Suva_2.6515.611ON6332696307e-70
KLLA0A03806g5.611ON6023256252e-69
NCAS0A080805.611ON6232696244e-69
TBLA0E033605.611ON6542696257e-69
KLTH0G05698g5.611ON5972696207e-69
KAFR0C058605.611ON6442636221e-68
TDEL0A047805.611ON6212696201e-68
Kpol_1018.655.611ON6012636173e-68
NDAI0H009405.611ON6852696204e-68
AEL230W5.611ON6082696155e-68
Kwal_47.182335.611ON5982696145e-68
SAKL0G06952g5.611ON5992696147e-68
TPHA0D028405.611ON6342696131e-67
ZYRO0A05544g5.611ON6312696087e-67
KNAG0B032305.611ON6412636062e-66
Ecym_55885.611ON6132696042e-66
Kwal_33.132251.52ON9641766212e-66
Kwal_33.13222singletonOFF1481205448e-64
CAGL0M02519g8.654ON7563015097e-53
CAGL0M11396g8.279ON11922905161e-52
KNAG0J015908.654ON8053115081e-52
TPHA0G017108.654ON8052854966e-51
SAKL0H07084g8.654ON9192874987e-51
Kpol_1072.298.654ON8932804961e-50
TDEL0A060008.654ON7902784931e-50
KAFR0A037308.654ON7882884921e-50
TPHA0J008208.279ON12182884963e-50
NDAI0E023208.654ON9322884915e-50
NCAS0C015908.654ON8642914887e-50
NDAI0B020708.279ON12583334938e-50
Kpol_1012.68.654ON6282864799e-50
NDAI0J012508.279ON11763094911e-49
Skud_4.3838.279ON10652834901e-49
AGR058W8.279ON10713104901e-49
Smik_15.4178.654ON8062864841e-49
NCAS0B037408.279ON10492884882e-49
ZYRO0F06842g8.654ON8432794843e-49
NCAS0B050908.279ON12102914883e-49
SAKL0H16632g8.279ON10622884873e-49
CAGL0M02299g8.668ON8932794843e-49
Smik_4.3678.279ON10662834873e-49
Suva_8.2848.654ON8083164814e-49
Suva_10.1808.279ON11592884856e-49
Suva_16.1698.654ON8582914816e-49
NDAI0E012908.654ON7292894768e-49
Smik_6.3398.654ON8652884808e-49
KAFR0H025408.654ON8173274799e-49
Ecym_42918.279ON11452924839e-49
Kpol_1066.468.279ON12252964841e-48
Suva_2.2838.279ON10892834821e-48
KAFR0B028008.279ON10952864812e-48
YPL141C (FRK1)8.654ON8652914782e-48
TBLA0C046008.279ON13152864812e-48
YDR122W (KIN1)8.279ON10642834793e-48
Skud_12.1648.279ON11602884793e-48
CAGL0J03872g8.654ON6612844684e-48
KLLA0F19536g8.279ON11042904784e-48
KNAG0G021108.279ON11923034785e-48
Skud_15.3998.654ON8073184726e-48
TBLA0C017508.654ON9812894749e-48
YLR096W (KIN2)8.279ON11472884751e-47
Skud_16.1408.654ON8652884701e-47
Smik_12.1558.279ON11622884732e-47
YOR233W (KIN4)8.654ON8002864672e-47
Kwal_26.87098.654ON8292844682e-47
TDEL0F040608.279ON11262864713e-47
KLTH0D10714g8.654ON8722844683e-47
KLTH0G13288g8.279ON11422884713e-47
SAKL0H06754g8.668ON8842724683e-47
TPHA0D011408.654ON6222994584e-47
NCAS0B014708.654ON7272844616e-47
Ecym_83398.654ON9202814667e-47
ZYRO0F07194g8.668ON9382894641e-46
KLLA0F11319g8.668ON8432874621e-46
NCAS0C016708.668ON8962744612e-46
KNAG0A030408.654ON6443684532e-46
CAGL0B01925g8.279ON9442914594e-46
KNAG0J016708.668ON10092764605e-46
ACR119W8.654ON9312814561e-45
ZYRO0D06776g8.279ON12042854581e-45
NDAI0E023908.668ON8832854551e-45
TBLA0B039708.654ON12082774562e-45
Kwal_26.87518.668ON8482754486e-45
KNAG0D010906.222ON3722734241e-44
Kpol_1072.198.668ON8962744471e-44
KNAG0H031408.279ON9362974472e-44
KLTH0D11044g8.668ON8492774424e-44
TDEL0A061408.668ON8612764381e-43
TBLA0B038608.668ON9882794392e-43
KLLA0D07348g8.654ON9092814345e-43
TPHA0G016308.668ON8712714336e-43
Ecym_24058.668ON8552794327e-43
Suva_16.1608.668ON9182934338e-43
YPL150W8.668ON9012914302e-42
Skud_16.1328.668ON9242914274e-42
SAKL0D07656g1.374ON4322674084e-42
NDAI0G053001.374ON4372694077e-42
ACR133C8.668ON8512764238e-42
Smik_6.3478.668ON9172914249e-42
CAGL0M02233g8.676ON7672924164e-41
Kpol_1065.36.222ON3762713974e-41
CAGL0E05720g6.222ON3582723964e-41
TPHA0E028206.222ON3842583959e-41
KLTH0D11242g8.676ON7952864121e-40
TPHA0O011201.374ON4292703952e-40
CAGL0L07326g2.352ON5063163984e-40
KAFR0H025108.668ON8793434095e-40
SAKL0H06534g8.676ON8042904085e-40
TBLA0A020506.222ON4342693918e-40
Kwal_26.87968.676ON7962864051e-39
Smik_4.1352.352ON5133063942e-39
Kwal_56.237178.279ON8581884033e-39
Skud_6.891.374ON4462713883e-39
TBLA0A020306.214ON4032713843e-39
Kwal_56.240916.222ON3812583825e-39
YFR014C (CMK1)1.374ON4462713865e-39
Skud_13.1546.31ON7052693976e-39
YMR001C (CDC5)6.31ON7052953976e-39
KLTH0C10912g6.31ON6972673967e-39
KLTH0H11396g1.374ON4372723847e-39
NCAS0A088801.374ON4222693838e-39
Smik_6.3508.676ON8222813988e-39
CAGL0F04741g1.374ON4422693849e-39
YPL209C (IPL1)6.222ON3672683789e-39
NCAS0D021006.31ON7262073951e-38
Skud_15.1441.374ON4492973841e-38
Suva_15.1551.374ON4522693841e-38
Suva_13.1636.31ON7052663941e-38
KAFR0K003306.214ON3732713781e-38
Suva_11.561.182ON3982863791e-38
YDL101C (DUN1)2.352ON5133063861e-38
Smik_7.3191.374ON4462713822e-38
KNAG0J017008.676ON8202803962e-38
Skud_16.706.222ON3672683772e-38
ZYRO0E07018g6.222ON3672583772e-38
Smik_15.1531.374ON4422693812e-38
KAFR0H024308.676ON7842773942e-38
Skud_10.501.182ON3972853782e-38
Smik_13.1596.31ON7052693922e-38
KNAG0I014801.374ON4402733802e-38
Suva_4.1452.352ON5143033842e-38
TDEL0E053106.222ON3742623753e-38
ACL006W6.31ON7082663913e-38
KLLA0C06138g6.31ON7082593913e-38
YJL164C (TPK1)1.182ON3972853764e-38
KLLA0B02332g6.222ON3612693734e-38
KLLA0B07205g1.182ON4552863804e-38
Kwal_0.961.374ON4272643784e-38
Smik_6.4146.222ON3672683744e-38
YPL153C (RAD53)8.676ON8212813924e-38
ACR142W8.676ON8372813924e-38
TDEL0B063201.374ON4442813785e-38
Ecym_30356.31ON7402693905e-38
Suva_6.781.374ON4452713785e-38
Ecym_21946.222ON3662773735e-38
Skud_11.581.182ON3952863755e-38
YOL016C (CMK2)1.374ON4472693785e-38
Kwal_56.224766.31ON6972673895e-38
YPL203W (TPK2)6.214ON3802723736e-38
Skud_16.766.214ON3822723737e-38
NCAS0B044906.222ON3492563707e-38
Smik_10.661.182ON3972853747e-38
Skud_16.1298.676ON8272813917e-38
Suva_16.1578.676ON8322813908e-38
Smik_6.4086.214ON3812723729e-38
KAFR0K002806.222ON3602573719e-38
NDAI0F016006.222ON4122583741e-37
KLLA0F11143g8.676ON8132743891e-37
Skud_4.1542.352ON5133063791e-37
NDAI0E021108.676ON9032863901e-37
SAKL0A04246g6.222ON4002573721e-37
TPHA0F024306.31ON7982643881e-37
Suva_6.2451.182ON3942693721e-37
KNAG0E008506.31ON7112683861e-37
ZYRO0G08844g6.214ON3622713691e-37
TBLA0B004906.31ON7873123872e-37
YKL166C (TPK3)1.182ON3982863712e-37
Smik_11.621.182ON3972863712e-37
KLTH0H04180g6.214ON3532663682e-37
SAKL0E01584g6.31ON6952693842e-37
Kpol_1072.168.676ON7952773862e-37
KLTH0F04840g1.182ON3812683692e-37
CAGL0G09020g6.214ON3612663673e-37
Suva_16.1046.214ON3832723683e-37
KAFR0G026906.31ON7132643833e-37
KAFR0I020101.374ON4322753714e-37
Kpol_1037.206.31ON7042683824e-37
Kpol_1033.506.214ON3842553665e-37
TPHA0G016008.676ON8452903845e-37
AAR009W1.374ON4532653706e-37
Kpol_1004.192.352ON4942933726e-37
TDEL0D053203.92ON10573113856e-37
Kwal_33.138461.182ON3752503648e-37
KAFR0C044801.374ON4352693688e-37
Kpol_1069.131.374ON4272993679e-37
KNAG0C024401.182ON4012553651e-36
Kwal_56.240596.214ON3532663621e-36
NDAI0C026806.31ON7502613791e-36
KAFR0B054108.279ON5393293721e-36
NCAS0D006301.374ON4272923661e-36
SAKL0C05368g1.182ON4182663651e-36
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Smik_3.54
         (1032 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Smik_3.54 Chr3 (80309..83407) [3099 bp, 1032 aa] {ON} YCL024W (R...  1868   0.0  
YCL024W Chr3 (79162..82275) [3114 bp, 1037 aa] {ON}  KCC4Protein...  1343   0.0  
Skud_3.39 Chr3 (66201..69254) [3054 bp, 1017 aa] {ON} YCL024W (R...  1294   0.0  
Suva_3.190 Chr3 (288639..288813,288870..291766) [3072 bp, 1024 a...  1206   0.0  
Suva_2.687 Chr2 complement(1215095..1218481) [3387 bp, 1128 aa] ...   763   0.0  
KLLA0C01650g Chr3 (128119..131457) [3339 bp, 1112 aa] {ON} simil...   719   0.0  
KAFR0D04100 Chr4 complement(809681..813034) [3354 bp, 1117 aa] {...   718   0.0  
CAGL0K05709g Chr11 complement(556732..560043) [3312 bp, 1103 aa]...   564   0.0  
YDR507C Chr4 complement(1462358..1465786) [3429 bp, 1142 aa] {ON...   560   0.0  
Smik_4.789 Chr4 complement(1385209..1388619) [3411 bp, 1136 aa] ...   558   0.0  
NCAS0B08600 Chr2 (1649375..1652728) [3354 bp, 1117 aa] {ON} Anc_...   557   e-180
Skud_4.783 Chr4 complement(1382552..1385959) [3408 bp, 1135 aa] ...   555   e-180
TBLA0A07150 Chr1 (1776160..1780335) [4176 bp, 1391 aa] {ON} Anc_...   559   e-178
NDAI0A00660 Chr1 (121773..124841) [3069 bp, 1022 aa] {ON} Anc_1.52    548   e-178
TDEL0C06490 Chr3 complement(1191461..1194922) [3462 bp, 1153 aa]...   548   e-176
Kpol_2002.46 s2002 (95107..98478) [3372 bp, 1123 aa] {ON} (95107...   547   e-176
KLTH0F01672g Chr6 (127277..130771) [3495 bp, 1164 aa] {ON} simil...   545   e-175
TPHA0E03640 Chr5 complement(769962..773375) [3414 bp, 1137 aa] {...   541   e-174
KNAG0F00290 Chr6 (31750..35127) [3378 bp, 1125 aa] {ON} Anc_1.52...   541   e-174
ZYRO0F17402g Chr6 complement(1445685..1449254) [3570 bp, 1189 aa...   533   e-170
AFR696C Chr6 complement(1722130..1725558) [3429 bp, 1142 aa] {ON...   531   e-170
Ecym_1058 Chr1 (105835..109329) [3495 bp, 1164 aa] {ON} similar ...   530   e-169
SAKL0C01716g Chr3 (143880..147527) [3648 bp, 1215 aa] {ON} simil...   529   e-169
KLTH0D05566g Chr4 (498055..501441) [3387 bp, 1128 aa] {ON} weakl...   389   e-117
Kwal_26.7788 s26 (511530..515333) [3804 bp, 1267 aa] {ON} YKL101...   388   e-116
Ecym_7392 Chr7 complement(803240..807544) [4305 bp, 1434 aa] {ON...   390   e-115
SAKL0E02860g Chr5 complement(228726..232859) [4134 bp, 1377 aa] ...   389   e-115
KLLA0F13552g Chr6 complement(1252906..1256709) [3804 bp, 1267 aa...   385   e-114
ABL034W Chr2 (333432..337709) [4278 bp, 1425 aa] {ON} Syntenic h...   387   e-114
KAFR0D03200 Chr4 (628993..633339) [4347 bp, 1448 aa] {ON} Anc_2....   377   e-111
YKL101W Chr11 (248920..253476) [4557 bp, 1518 aa] {ON}  HSL1Nim1...   377   e-110
Skud_11.126 Chr11 (235011..239567) [4557 bp, 1518 aa] {ON} YKL10...   375   e-110
Suva_11.123 Chr11 (235064..239644) [4581 bp, 1526 aa] {ON} YKL10...   373   e-109
Smik_11.139 Chr11 (235511..240115) [4605 bp, 1534 aa] {ON} YKL10...   373   e-109
KNAG0A06540 Chr1 (1002435..1006733) [4299 bp, 1432 aa] {ON} Anc_...   370   e-108
Kpol_431.9 s431 complement(22310..26968) [4659 bp, 1552 aa] {ON}...   371   e-108
NCAS0A05770 Chr1 (1132854..1137239) [4386 bp, 1461 aa] {ON} Anc_...   369   e-108
TBLA0I01150 Chr9 complement(235187..240424) [5238 bp, 1745 aa] {...   369   e-107
ZYRO0G03366g Chr7 (261014..265864) [4851 bp, 1616 aa] {ON} simil...   367   e-106
TDEL0A02550 Chr1 (457841..461950) [4110 bp, 1369 aa] {ON} Anc_2....   363   e-106
CAGL0K08514g Chr11 complement(854143..858612) [4470 bp, 1489 aa]...   363   e-106
TPHA0G03200 Chr7 (683296..687900) [4605 bp, 1534 aa] {ON} Anc_2....   337   1e-96
NDAI0D02750 Chr4 (639802..644349) [4548 bp, 1515 aa] {ON} Anc_2....   317   7e-90
CAGL0M08910g Chr13 complement(887703..889541) [1839 bp, 612 aa] ...   250   3e-71
Kpol_495.14 s495 (33810..35684) [1875 bp, 624 aa] {ON} (33810..3...   249   1e-70
TPHA0C00470 Chr3 (81482..83377) [1896 bp, 631 aa] {ON} Anc_5.611...   248   2e-70
YDR477W Chr4 (1412373..1414274) [1902 bp, 633 aa] {ON}  SNF1AMP-...   248   3e-70
Smik_4.754 Chr4 (1333667..1335565) [1899 bp, 632 aa] {ON} YDR477...   247   5e-70
Skud_4.751 Chr4 (1332135..1334039) [1905 bp, 634 aa] {ON} YDR477...   247   6e-70
Suva_2.651 Chr2 (1164264..1166165) [1902 bp, 633 aa] {ON} YDR477...   247   7e-70
KLLA0A03806g Chr1 complement(338807..340615) [1809 bp, 602 aa] {...   245   2e-69
NCAS0A08080 Chr1 complement(1594221..1596092) [1872 bp, 623 aa] ...   244   4e-69
TBLA0E03360 Chr5 complement(838512..840476) [1965 bp, 654 aa] {O...   245   7e-69
KLTH0G05698g Chr7 (453530..455323) [1794 bp, 597 aa] {ON} simila...   243   7e-69
KAFR0C05860 Chr3 (1160586..1162520) [1935 bp, 644 aa] {ON} Anc_5...   244   1e-68
TDEL0A04780 Chr1 (842715..844580) [1866 bp, 621 aa] {ON} Anc_5.6...   243   1e-68
Kpol_1018.65 s1018 (189779..191584) [1806 bp, 601 aa] {ON} (1897...   242   3e-68
NDAI0H00940 Chr8 complement(209645..211702) [2058 bp, 685 aa] {O...   243   4e-68
AEL230W Chr5 (198401..200227) [1827 bp, 608 aa] {ON} Syntenic ho...   241   5e-68
Kwal_47.18233 s47 complement(743846..745642) [1797 bp, 598 aa] {...   241   5e-68
SAKL0G06952g Chr7 (570584..572383) [1800 bp, 599 aa] {ON} simila...   241   7e-68
TPHA0D02840 Chr4 (591733..593637) [1905 bp, 634 aa] {ON}              240   1e-67
ZYRO0A05544g Chr1 (450809..452704) [1896 bp, 631 aa] {ON} highly...   238   7e-67
KNAG0B03230 Chr2 complement(625072..626997) [1926 bp, 641 aa] {O...   238   2e-66
Ecym_5588 Chr5 complement(1205102..1206943) [1842 bp, 613 aa] {O...   237   2e-66
Kwal_33.13225 s33 (127676..130570) [2895 bp, 964 aa] {ON} YFR016...   243   2e-66
Kwal_33.13222 s33 (127342..127788) [447 bp, 148 aa] {OFF} YDR507...   214   8e-64
CAGL0M02519g Chr13 complement(290723..292993) [2271 bp, 756 aa] ...   200   7e-53
CAGL0M11396g Chr13 (1122109..1125687) [3579 bp, 1192 aa] {ON} si...   203   1e-52
KNAG0J01590 Chr10 (292565..294982) [2418 bp, 805 aa] {ON} Anc_8....   200   1e-52
TPHA0G01710 Chr7 complement(350452..352869) [2418 bp, 805 aa] {O...   195   6e-51
SAKL0H07084g Chr8 complement(619288..622047) [2760 bp, 919 aa] {...   196   7e-51
Kpol_1072.29 s1072 complement(61987..64668) [2682 bp, 893 aa] {O...   195   1e-50
TDEL0A06000 Chr1 (1053427..1055799) [2373 bp, 790 aa] {ON} Anc_8...   194   1e-50
KAFR0A03730 Chr1 (761946..764312) [2367 bp, 788 aa] {ON} Anc_8.6...   194   1e-50
TPHA0J00820 Chr10 (193408..197064) [3657 bp, 1218 aa] {ON} Anc_8...   195   3e-50
NDAI0E02320 Chr5 (480203..483001) [2799 bp, 932 aa] {ON}              193   5e-50
NCAS0C01590 Chr3 (293327..295921) [2595 bp, 864 aa] {ON} Anc_8.654    192   7e-50
NDAI0B02070 Chr2 (514024..517800) [3777 bp, 1258 aa] {ON}             194   8e-50
Kpol_1012.6 s1012 (11581..13467) [1887 bp, 628 aa] {ON} (11581.....   189   9e-50
NDAI0J01250 Chr10 complement(291314..294844) [3531 bp, 1176 aa] ...   193   1e-49
Skud_4.383 Chr4 (666354..669551) [3198 bp, 1065 aa] {ON} YDR122W...   193   1e-49
AGR058W Chr7 (823626..826841) [3216 bp, 1071 aa] {ON} Syntenic h...   193   1e-49
Smik_15.417 Chr15 (725513..727933) [2421 bp, 806 aa] {ON} YOR233...   191   1e-49
NCAS0B03740 Chr2 complement(668231..671380) [3150 bp, 1049 aa] {...   192   2e-49
ZYRO0F06842g Chr6 (561269..563800) [2532 bp, 843 aa] {ON} simila...   191   3e-49
NCAS0B05090 Chr2 (946126..949758) [3633 bp, 1210 aa] {ON}             192   3e-49
SAKL0H16632g Chr8 complement(1461613..1464801) [3189 bp, 1062 aa...   192   3e-49
CAGL0M02299g Chr13 (273725..276406) [2682 bp, 893 aa] {ON} simil...   191   3e-49
Smik_4.367 Chr4 (655941..659141) [3201 bp, 1066 aa] {ON} YDR122W...   192   3e-49
Suva_8.284 Chr8 (514891..517317) [2427 bp, 808 aa] {ON} YOR233W ...   189   4e-49
Suva_10.180 Chr10 (337364..340843) [3480 bp, 1159 aa] {ON} YLR09...   191   6e-49
Suva_16.169 Chr16 complement(292738..295314) [2577 bp, 858 aa] {...   189   6e-49
NDAI0E01290 Chr5 complement(255593..257782) [2190 bp, 729 aa] {O...   187   8e-49
Smik_6.339 Chr6 (538177..540774) [2598 bp, 865 aa] {ON} YPL141C ...   189   8e-49
KAFR0H02540 Chr8 complement(483399..485852) [2454 bp, 817 aa] {O...   189   9e-49
Ecym_4291 Chr4 complement(620549..623986) [3438 bp, 1145 aa] {ON...   190   9e-49
Kpol_1066.46 s1066 (82874..86551) [3678 bp, 1225 aa] {ON} (82874...   191   1e-48
Suva_2.283 Chr2 (489490..492759) [3270 bp, 1089 aa] {ON} YDR122W...   190   1e-48
KAFR0B02800 Chr2 (571295..574582) [3288 bp, 1095 aa] {ON} Anc_8....   189   2e-48
YPL141C Chr16 complement(283464..286061) [2598 bp, 865 aa] {ON} ...   188   2e-48
TBLA0C04600 Chr3 (1112043..1115990) [3948 bp, 1315 aa] {ON} Anc_...   189   2e-48
YDR122W Chr4 (694700..697894) [3195 bp, 1064 aa] {ON}  KIN1Serin...   189   3e-48
Skud_12.164 Chr12 (315700..319182) [3483 bp, 1160 aa] {ON} YLR09...   189   3e-48
CAGL0J03872g Chr10 (368472..370457) [1986 bp, 661 aa] {ON} simil...   184   4e-48
KLLA0F19536g Chr6 (1808263..1811577) [3315 bp, 1104 aa] {ON} sim...   188   4e-48
KNAG0G02110 Chr7 (477260..480838) [3579 bp, 1192 aa] {ON} Anc_8....   188   5e-48
Skud_15.399 Chr15 (714789..717212) [2424 bp, 807 aa] {ON} YOR233...   186   6e-48
TBLA0C01750 Chr3 (412762..415707) [2946 bp, 981 aa] {ON} Anc_8.6...   187   9e-48
YLR096W Chr12 (332590..336033) [3444 bp, 1147 aa] {ON}  KIN2Seri...   187   1e-47
Skud_16.140 Chr16 complement(255090..257687) [2598 bp, 865 aa] {...   185   1e-47
Smik_12.155 Chr12 (312480..315968) [3489 bp, 1162 aa] {ON} YLR09...   186   2e-47
YOR233W Chr15 (775846..778248) [2403 bp, 800 aa] {ON}  KIN4Serin...   184   2e-47
Kwal_26.8709 s26 (907885..910374) [2490 bp, 829 aa] {ON} YPL141C...   184   2e-47
TDEL0F04060 Chr6 (749896..753276) [3381 bp, 1126 aa] {ON} Anc_8....   186   3e-47
KLTH0D10714g Chr4 (880389..883007) [2619 bp, 872 aa] {ON} simila...   184   3e-47
KLTH0G13288g Chr7 complement(1139058..1142486) [3429 bp, 1142 aa...   186   3e-47
SAKL0H06754g Chr8 (594995..597649) [2655 bp, 884 aa] {ON} simila...   184   3e-47
TPHA0D01140 Chr4 (238656..240524) [1869 bp, 622 aa] {ON} Anc_8.6...   181   4e-47
NCAS0B01470 Chr2 (241003..243186) [2184 bp, 727 aa] {ON} Anc_8.654    182   6e-47
Ecym_8339 Chr8 (684113..686875) [2763 bp, 920 aa] {ON} similar t...   184   7e-47
ZYRO0F07194g Chr6 complement(581438..584254) [2817 bp, 938 aa] {...   183   1e-46
KLLA0F11319g Chr6 (1042436..1044967) [2532 bp, 843 aa] {ON} simi...   182   1e-46
NCAS0C01670 Chr3 complement(306682..309372) [2691 bp, 896 aa] {O...   182   2e-46
KNAG0A03040 Chr1 complement(372150..374084) [1935 bp, 644 aa] {O...   179   2e-46
CAGL0B01925g Chr2 (176316..179150) [2835 bp, 944 aa] {ON} simila...   181   4e-46
KNAG0J01670 Chr10 complement(304021..307050) [3030 bp, 1009 aa] ...   181   5e-46
ACR119W Chr3 (560761..563556) [2796 bp, 931 aa] {ON} Syntenic ho...   180   1e-45
ZYRO0D06776g Chr4 complement(583027..586641) [3615 bp, 1204 aa] ...   181   1e-45
NDAI0E02390 Chr5 complement(496256..498907) [2652 bp, 883 aa] {O...   179   1e-45
TBLA0B03970 Chr2 complement(904167..907793) [3627 bp, 1208 aa] {...   180   2e-45
Kwal_26.8751 s26 complement(928853..931399) [2547 bp, 848 aa] {O...   177   6e-45
KNAG0D01090 Chr4 complement(183319..184437) [1119 bp, 372 aa] {O...   167   1e-44
Kpol_1072.19 s1072 (44906..47596) [2691 bp, 896 aa] {ON} (44906....   176   1e-44
KNAG0H03140 Chr8 complement(589553..592363) [2811 bp, 936 aa] {O...   176   2e-44
KLTH0D11044g Chr4 complement(901388..903937) [2550 bp, 849 aa] {...   174   4e-44
TDEL0A06140 Chr1 complement(1074016..1076601) [2586 bp, 861 aa] ...   173   1e-43
TBLA0B03860 Chr2 (887855..890821) [2967 bp, 988 aa] {ON} Anc_8.6...   173   2e-43
KLLA0D07348g Chr4 (626999..629728) [2730 bp, 909 aa] {ON} simila...   171   5e-43
TPHA0G01630 Chr7 (336511..339126) [2616 bp, 871 aa] {ON} Anc_8.6...   171   6e-43
Ecym_2405 Chr2 (788655..791222) [2568 bp, 855 aa] {ON} similar t...   171   7e-43
Suva_16.160 Chr16 (277393..280149) [2757 bp, 918 aa] {ON} YPL150...   171   8e-43
YPL150W Chr16 (268188..270893) [2706 bp, 901 aa] {ON} Protein ki...   170   2e-42
Skud_16.132 Chr16 (239797..242571) [2775 bp, 924 aa] {ON} YPL150...   169   4e-42
SAKL0D07656g Chr4 complement(627469..628767) [1299 bp, 432 aa] {...   161   4e-42
NDAI0G05300 Chr7 (1289208..1290521) [1314 bp, 437 aa] {ON} Anc_1...   161   7e-42
ACR133C Chr3 complement(581468..584023) [2556 bp, 851 aa] {ON} S...   167   8e-42
Smik_6.347 Chr6 complement(553316..556069) [2754 bp, 917 aa] {ON...   167   9e-42
CAGL0M02233g Chr13 complement(267332..269635) [2304 bp, 767 aa] ...   164   4e-41
Kpol_1065.3 s1065 complement(4445..5575) [1131 bp, 376 aa] {ON} ...   157   4e-41
CAGL0E05720g Chr5 (569265..570341) [1077 bp, 358 aa] {ON} simila...   157   4e-41
TPHA0E02820 Chr5 complement(589816..590970) [1155 bp, 384 aa] {O...   156   9e-41
KLTH0D11242g Chr4 (918232..920619) [2388 bp, 795 aa] {ON} simila...   163   1e-40
TPHA0O01120 Chr15 complement(217462..218751) [1290 bp, 429 aa] {...   156   2e-40
CAGL0L07326g Chr12 (810529..812049) [1521 bp, 506 aa] {ON} simil...   157   4e-40
KAFR0H02510 Chr8 complement(476574..479213) [2640 bp, 879 aa] {O...   162   5e-40
SAKL0H06534g Chr8 complement(575439..577853) [2415 bp, 804 aa] {...   161   5e-40
TBLA0A02050 Chr1 (495735..497039) [1305 bp, 434 aa] {ON}              155   8e-40
Kwal_26.8796 s26 (946406..948796) [2391 bp, 796 aa] {ON} YPL153C...   160   1e-39
Smik_4.135 Chr4 complement(256861..258402) [1542 bp, 513 aa] {ON...   156   2e-39
Kwal_56.23717 s56 complement(674222..676798) [2577 bp, 858 aa] {...   159   3e-39
Skud_6.89 Chr6 (166257..167594) [1338 bp, 446 aa] {ON} YFR014C (...   154   3e-39
TBLA0A02030 Chr1 complement(491365..492576) [1212 bp, 403 aa] {O...   152   3e-39
Kwal_56.24091 s56 (845680..846825) [1146 bp, 381 aa] {ON} YPL209...   151   5e-39
YFR014C Chr6 complement(172537..173877) [1341 bp, 446 aa] {ON}  ...   153   5e-39
Skud_13.154 Chr13 complement(255263..257380) [2118 bp, 705 aa] {...   157   6e-39
YMR001C Chr13 complement(269019..271136) [2118 bp, 705 aa] {ON} ...   157   6e-39
KLTH0C10912g Chr3 (898372..900465) [2094 bp, 697 aa] {ON} highly...   157   7e-39
KLTH0H11396g Chr8 complement(973355..974668) [1314 bp, 437 aa] {...   152   7e-39
NCAS0A08880 Chr1 (1756271..1757539) [1269 bp, 422 aa] {ON} Anc_1...   152   8e-39
Smik_6.350 Chr6 (559997..562465) [2469 bp, 822 aa] {ON} YPL153C ...   157   8e-39
CAGL0F04741g Chr6 (478256..479584) [1329 bp, 442 aa] {ON} simila...   152   9e-39
YPL209C Chr16 complement(156490..157593) [1104 bp, 367 aa] {ON} ...   150   9e-39
NCAS0D02100 Chr4 (385878..388058) [2181 bp, 726 aa] {ON} Anc_6.31     156   1e-38
Skud_15.144 Chr15 complement(254620..255969) [1350 bp, 449 aa] {...   152   1e-38
Suva_15.155 Chr15 complement(267680..269038) [1359 bp, 452 aa] {...   152   1e-38
Suva_13.163 Chr13 complement(259136..261253) [2118 bp, 705 aa] {...   156   1e-38
KAFR0K00330 Chr11 (74162..75283) [1122 bp, 373 aa] {ON} Anc_6.21...   150   1e-38
Suva_11.56 Chr11 complement(119479..120675) [1197 bp, 398 aa] {O...   150   1e-38
YDL101C Chr4 complement(280307..281848) [1542 bp, 513 aa] {ON}  ...   153   1e-38
Smik_7.319 Chr7 complement(534132..535472) [1341 bp, 446 aa] {ON...   151   2e-38
KNAG0J01700 Chr10 (309962..312424) [2463 bp, 820 aa] {ON}             157   2e-38
Skud_16.70 Chr16 complement(129918..131021) [1104 bp, 367 aa] {O...   149   2e-38
ZYRO0E07018g Chr5 (531316..532419) [1104 bp, 367 aa] {ON} simila...   149   2e-38
Smik_15.153 Chr15 complement(261920..263248) [1329 bp, 442 aa] {...   151   2e-38
KAFR0H02430 Chr8 complement(464446..466800) [2355 bp, 784 aa] {O...   156   2e-38
Skud_10.50 Chr10 complement(84697..85890) [1194 bp, 397 aa] {ON}...   150   2e-38
Smik_13.159 Chr13 complement(260249..262366) [2118 bp, 705 aa] {...   155   2e-38
KNAG0I01480 Chr9 (287733..289055) [1323 bp, 440 aa] {ON} Anc_1.3...   150   2e-38
Suva_4.145 Chr4 complement(268826..270370) [1545 bp, 514 aa] {ON...   152   2e-38
TDEL0E05310 Chr5 (972769..973893) [1125 bp, 374 aa] {ON} Anc_6.2...   149   3e-38
ACL006W Chr3 (344395..346521) [2127 bp, 708 aa] {ON} Syntenic ho...   155   3e-38
KLLA0C06138g Chr3 (540409..542535) [2127 bp, 708 aa] {ON} simila...   155   3e-38
YJL164C Chr10 complement(109966..111159) [1194 bp, 397 aa] {ON} ...   149   4e-38
KLLA0B02332g Chr2 complement(206863..207948) [1086 bp, 361 aa] {...   148   4e-38
KLLA0B07205g Chr2 complement(624606..625973) [1368 bp, 455 aa] {...   150   4e-38
Kwal_0.96 s0 complement(46082..47365) [1284 bp, 427 aa] {ON} YOL...   150   4e-38
Smik_6.414 Chr6 (666806..667909) [1104 bp, 367 aa] {ON} YPL209C ...   148   4e-38
YPL153C Chr16 complement(261727..264192) [2466 bp, 821 aa] {ON} ...   155   4e-38
ACR142W Chr3 (597519..600032) [2514 bp, 837 aa] {ON} Syntenic ho...   155   4e-38
TDEL0B06320 Chr2 (1118534..1119868) [1335 bp, 444 aa] {ON} Anc_1...   150   5e-38
Ecym_3035 Chr3 complement(70391..72613) [2223 bp, 740 aa] {ON} s...   154   5e-38
Suva_6.78 Chr6 (135988..137325) [1338 bp, 445 aa] {ON} YFR014C (...   150   5e-38
Ecym_2194 Chr2 complement(381633..382733) [1101 bp, 366 aa] {ON}...   148   5e-38
Skud_11.58 Chr11 complement(120855..122042) [1188 bp, 395 aa] {O...   149   5e-38
YOL016C Chr15 complement(294777..296120) [1344 bp, 447 aa] {ON} ...   150   5e-38
Kwal_56.22476 s56 complement(145039..147132) [2094 bp, 697 aa] {...   154   5e-38
YPL203W Chr16 (166256..167398) [1143 bp, 380 aa] {ON}  TPK2cAMP-...   148   6e-38
Skud_16.76 Chr16 (139571..140719) [1149 bp, 382 aa] {ON} YPL203W...   148   7e-38
NCAS0B04490 Chr2 (814474..815523) [1050 bp, 349 aa] {ON} Anc_8.141    147   7e-38
Smik_10.66 Chr10 complement(108043..109236) [1194 bp, 397 aa] {O...   148   7e-38
Skud_16.129 Chr16 complement(233341..235824) [2484 bp, 827 aa] {...   155   7e-38
Suva_16.157 Chr16 complement(270891..273389) [2499 bp, 832 aa] {...   154   8e-38
Smik_6.408 Chr6 complement(657018..658163) [1146 bp, 381 aa] {ON...   147   9e-38
KAFR0K00280 Chr11 complement(64906..65988) [1083 bp, 360 aa] {ON...   147   9e-38
NDAI0F01600 Chr6 complement(392424..393662) [1239 bp, 412 aa] {O...   148   1e-37
KLLA0F11143g Chr6 complement(1026129..1028570) [2442 bp, 813 aa]...   154   1e-37
Skud_4.154 Chr4 complement(275783..277324) [1542 bp, 513 aa] {ON...   150   1e-37
NDAI0E02110 Chr5 complement(430989..433700) [2712 bp, 903 aa] {O...   154   1e-37
SAKL0A04246g Chr1 complement(396019..397221) [1203 bp, 400 aa] {...   147   1e-37
TPHA0F02430 Chr6 complement(535865..538261) [2397 bp, 798 aa] {O...   154   1e-37
Suva_6.245 Chr6 (438131..439315) [1185 bp, 394 aa] {ON} YJL164C ...   147   1e-37
KNAG0E00850 Chr5 complement(158992..161127) [2136 bp, 711 aa] {O...   153   1e-37
ZYRO0G08844g Chr7 complement(711678..712766) [1089 bp, 362 aa] {...   146   1e-37
TBLA0B00490 Chr2 complement(94755..97118) [2364 bp, 787 aa] {ON}...   153   2e-37
YKL166C Chr11 complement(134509..135705) [1197 bp, 398 aa] {ON} ...   147   2e-37
Smik_11.62 Chr11 complement(120153..121346) [1194 bp, 397 aa] {O...   147   2e-37
KLTH0H04180g Chr8 (381111..382172) [1062 bp, 353 aa] {ON} highly...   146   2e-37
SAKL0E01584g Chr5 complement(121830..123917) [2088 bp, 695 aa] {...   152   2e-37
Kpol_1072.16 s1072 complement(37585..39972) [2388 bp, 795 aa] {O...   153   2e-37
KLTH0F04840g Chr6 complement(427194..428339) [1146 bp, 381 aa] {...   146   2e-37
CAGL0G09020g Chr7 (860266..861351) [1086 bp, 361 aa] {ON} highly...   145   3e-37
Suva_16.104 Chr16 (176201..177352) [1152 bp, 383 aa] {ON} YPL203...   146   3e-37
KAFR0G02690 Chr7 complement(555573..557714) [2142 bp, 713 aa] {O...   152   3e-37
KAFR0I02010 Chr9 complement(411589..412887) [1299 bp, 432 aa] {O...   147   4e-37
Kpol_1037.20 s1037 (41658..43772) [2115 bp, 704 aa] {ON} (41658....   151   4e-37
Kpol_1033.50 s1033 complement(126043..127197) [1155 bp, 384 aa] ...   145   5e-37
TPHA0G01600 Chr7 complement(329313..331850) [2538 bp, 845 aa] {O...   152   5e-37
AAR009W Chr1 (358947..360308) [1362 bp, 453 aa] {ON} Syntenic ho...   147   6e-37
Kpol_1004.19 s1004 (36090..36101,36217..37689) [1485 bp, 494 aa]...   147   6e-37
TDEL0D05320 Chr4 complement(965082..968255) [3174 bp, 1057 aa] {...   152   6e-37
Kwal_33.13846 s33 complement(419630..420757) [1128 bp, 375 aa] {...   144   8e-37
KAFR0C04480 Chr3 (894906..896213) [1308 bp, 435 aa] {ON} Anc_1.3...   146   8e-37
Kpol_1069.13 s1069 complement(27223..28506) [1284 bp, 427 aa] {O...   145   9e-37
KNAG0C02440 Chr3 complement(475652..476857) [1206 bp, 401 aa] {O...   145   1e-36
Kwal_56.24059 s56 complement(829673..830734) [1062 bp, 353 aa] {...   144   1e-36
NDAI0C02680 Chr3 complement(621951..624203) [2253 bp, 750 aa] {O...   150   1e-36
KAFR0B05410 Chr2 complement(1111152..1112771) [1620 bp, 539 aa] ...   147   1e-36
NCAS0D00630 Chr4 complement(107310..108593) [1284 bp, 427 aa] {O...   145   1e-36
SAKL0C05368g Chr3 complement(510576..511832) [1257 bp, 418 aa] {...   145   1e-36
AFL101C Chr6 complement(249144..250247) [1104 bp, 367 aa] {ON} S...   143   2e-36
SAKL0A04466g Chr1 (413816..414937) [1122 bp, 373 aa] {ON} highly...   143   2e-36
TBLA0B03840 Chr2 complement(881914..884490) [2577 bp, 858 aa] {O...   150   2e-36
NCAS0C01370 Chr3 complement(250693..253092) [2400 bp, 799 aa] {O...   150   2e-36
CAGL0K10604g Chr11 complement(1030055..1031395) [1341 bp, 446 aa...   145   2e-36
KNAG0C01060 Chr3 complement(205965..207374) [1410 bp, 469 aa] {O...   145   3e-36
TDEL0E05220 Chr5 complement(957515..958597) [1083 bp, 360 aa] {O...   142   3e-36
Suva_16.97 Chr16 complement(165977..167083) [1107 bp, 368 aa] {O...   143   3e-36
KLLA0F23155g Chr6 (2157146..2158429) [1284 bp, 427 aa] {ON} simi...   144   3e-36
NDAI0A00960 Chr1 complement(197205..198431) [1227 bp, 408 aa] {O...   144   3e-36
KNAG0D01140 Chr4 (192308..193495) [1188 bp, 395 aa] {ON}              143   3e-36
TBLA0D05010 Chr4 complement(1234934..1236238) [1305 bp, 434 aa] ...   144   3e-36
ZYRO0E05588g Chr5 (430271..431686) [1416 bp, 471 aa] {ON} simila...   145   4e-36
TDEL0A06220 Chr1 (1088622..1091006) [2385 bp, 794 aa] {ON} Anc_8...   149   5e-36
TDEL0C03710 Chr3 (653934..655169) [1236 bp, 411 aa] {ON} Anc_1.1...   143   5e-36
KLTH0H03982g Chr8 complement(363432..364628) [1197 bp, 398 aa] {...   143   5e-36
SAKL0E05984g Chr5 complement(485895..487391,487462..487482) [151...   145   6e-36
NDAI0H03520 Chr8 (860096..861472) [1377 bp, 458 aa] {ON}              144   7e-36
CAGL0J11638g Chr10 complement(1130744..1132984) [2241 bp, 746 aa...   148   8e-36
KAFR0K02450 Chr11 (504087..504131,504190..505680) [1536 bp, 511 ...   144   9e-36
ZYRO0C07480g Chr3 (565426..567750) [2325 bp, 774 aa] {ON} highly...   147   1e-35
NCAS0I02840 Chr9 (528136..529344) [1209 bp, 402 aa] {ON} Anc_1.2...   142   1e-35
Ecym_1275 Chr1 complement(560481..561836) [1356 bp, 451 aa] {ON}...   143   1e-35
KAFR0F01800 Chr6 complement(350480..351754) [1275 bp, 424 aa] {O...   142   1e-35
Kpol_1023.26 s1023 (51805..54024) [2220 bp, 739 aa] {ON} (51805....   147   1e-35
KLLA0E01585g Chr5 (149305..149370,149488..150960) [1539 bp, 512 ...   144   1e-35
KLLA0D03190g Chr4 (267933..269051) [1119 bp, 372 aa] {ON} highly...   141   1e-35
Ecym_2397 Chr2 complement(771343..773961) [2619 bp, 872 aa] {ON}...   147   1e-35
NDAI0F01650 Chr6 (403635..404738) [1104 bp, 367 aa] {ON} Anc_6.214    140   2e-35
KAFR0C04280 Chr3 (848308..849912) [1605 bp, 534 aa] {ON} Anc_1.3...   144   2e-35
NCAS0A01100 Chr1 (218400..219464) [1065 bp, 354 aa] {ON}              140   2e-35
TPHA0J00420 Chr10 complement(96445..98568) [2124 bp, 707 aa] {ON...   146   2e-35
NCAS0B08280 Chr2 (1579804..1581033) [1230 bp, 409 aa] {ON} Anc_1...   141   2e-35
TBLA0B08250 Chr2 complement(1968879..1972922) [4044 bp, 1347 aa]...   147   3e-35
CAGL0M08404g Chr13 complement(836791..838179) [1389 bp, 462 aa] ...   142   3e-35
AFL090W Chr6 (274336..275376) [1041 bp, 346 aa] {ON} Syntenic ho...   139   3e-35
Ecym_2203 Chr2 (401590..402648) [1059 bp, 352 aa] {ON} similar t...   139   3e-35
ZYRO0F07370g Chr6 (595931..598219) [2289 bp, 762 aa] {ON} simila...   145   4e-35
NCAS0B05910 Chr2 (1120092..1121645) [1554 bp, 517 aa] {ON} Anc_2...   142   7e-35
Kwal_56.22693 s56 complement(239982..242936) [2955 bp, 984 aa] {...   145   9e-35
TBLA0C05830 Chr3 complement(1408930..1410210) [1281 bp, 426 aa] ...   140   1e-34
TPHA0E02840 Chr5 (594381..595589) [1209 bp, 402 aa] {ON} Anc_6.2...   139   1e-34
KAFR0G00480 Chr7 complement(131066..132268) [1203 bp, 400 aa] {O...   139   1e-34
Kpol_2002.75 s2002 complement(168123..169394) [1272 bp, 423 aa] ...   139   1e-34
KNAG0C01820 Chr3 (355604..357376) [1773 bp, 590 aa] {ON}              142   1e-34
KLLA0C12485g Chr3 (1060167..1062944) [2778 bp, 925 aa] {ON} simi...   144   1e-34
TDEL0G04380 Chr7 (792278..794446) [2169 bp, 722 aa] {ON} Anc_6.3...   143   2e-34
TDEL0G02820 Chr7 complement(543911..545377,545450..545476) [1494...   140   3e-34
ZYRO0G18502g Chr7 (1528075..1529265) [1191 bp, 396 aa] {ON} simi...   137   3e-34
NCAS0C04940 Chr3 (1006185..1009535) [3351 bp, 1116 aa] {ON} Anc_...   144   3e-34
TPHA0C04570 Chr3 (985491..987071) [1581 bp, 526 aa] {ON} Anc_2.3...   140   4e-34
CAGL0I09504g Chr9 (909589..911175) [1587 bp, 528 aa] {ON} simila...   139   5e-34
NDAI0B00210 Chr2 (27983..29185) [1203 bp, 400 aa] {ON} Anc_1.182      136   8e-34
ZYRO0A07546g Chr1 complement(619278..620747,620833..620847) [148...   137   1e-33
KNAG0C02080 Chr3 complement(404332..405588) [1257 bp, 418 aa] {O...   136   2e-33
TBLA0B07330 Chr2 complement(1745229..1746821,1746990..1747013) [...   138   2e-33
AFL188C Chr6 complement(88793..90211) [1419 bp, 472 aa] {ON} Syn...   137   2e-33
KLTH0C09548g Chr3 (792218..795199) [2982 bp, 993 aa] {ON} simila...   140   3e-33
Ecym_5624 Chr5 (1256658..1258022) [1365 bp, 454 aa] {ON} similar...   135   4e-33
NDAI0B04700 Chr2 complement(1164332..1165918) [1587 bp, 528 aa] ...   137   5e-33
Kwal_47.17263 s47 complement(321115..324498) [3384 bp, 1127 aa] ...   139   8e-33
KNAG0A05670 Chr1 complement(847460..849016) [1557 bp, 518 aa] {O...   135   1e-32
Suva_7.83 Chr7 complement(159329..161038) [1710 bp, 569 aa] {ON}...   136   1e-32
Smik_14.377 Chr14 (666338..669025) [2688 bp, 895 aa] {ON} YNR047...   139   1e-32
NDAI0G03470 Chr7 complement(829975..832455) [2481 bp, 826 aa] {O...   138   1e-32
AEL115C Chr5 complement(405062..406222) [1161 bp, 386 aa] {ON} S...   132   1e-32
Ecym_8095 Chr8 (205952..207106) [1155 bp, 384 aa] {ON} similar t...   132   2e-32
TPHA0P01050 Chr16 complement(212259..215624) [3366 bp, 1121 aa] ...   138   2e-32
NDAI0G04290 Chr7 complement(1030530..1033871) [3342 bp, 1113 aa]...   138   2e-32
KNAG0K00680 Chr11 (120919..124206) [3288 bp, 1095 aa] {ON} Anc_3...   138   2e-32
KAFR0D01220 Chr4 (246927..250094) [3168 bp, 1055 aa] {ON} Anc_7....   137   3e-32
Smik_7.93 Chr7 complement(158441..160132) [1692 bp, 563 aa] {ON}...   134   4e-32
TPHA0O01400 Chr15 complement(277678..279258) [1581 bp, 526 aa] {...   134   5e-32
YNR047W Chr14 (708523..711204) [2682 bp, 893 aa] {ON}  FPK1Ser/T...   136   5e-32
Smik_4.767 Chr4 complement(1353354..1355630) [2277 bp, 758 aa] {...   136   5e-32
CAGL0C03509g Chr3 complement(350846..353533) [2688 bp, 895 aa] {...   136   5e-32
NDAI0B03190 Chr2 complement(815759..817309) [1551 bp, 516 aa] {O...   133   7e-32
Suva_15.65 Chr15 (102271..105513) [3243 bp, 1080 aa] {ON} YOL100...   136   7e-32
ZYRO0B06512g Chr2 complement(521075..524410) [3336 bp, 1111 aa] ...   135   1e-31
Kpol_1054.2 s1054 complement(4365..7655) [3291 bp, 1096 aa] {ON}...   135   1e-31
NCAS0C04120 Chr3 complement(840008..842755) [2748 bp, 915 aa] {O...   135   1e-31
NCAS0B07380 Chr2 complement(1396315..1397898) [1584 bp, 527 aa] ...   132   1e-31
Suva_2.666 Chr2 complement(1183839..1186133) [2295 bp, 764 aa] {...   134   1e-31
Kpol_183.1 s183 (158..2257) [2100 bp, 699 aa] {ON} (158..2257) [...   134   1e-31
Kwal_23.6458 s23 (1592349..1594955) [2607 bp, 868 aa] {ON} YNR04...   135   1e-31
Suva_14.402 Chr14 (690198..692915) [2718 bp, 905 aa] {ON} YNR047...   135   1e-31
TPHA0M02080 Chr13 (426966..429635) [2670 bp, 889 aa] {ON} Anc_6....   135   1e-31
Skud_3.165 Chr3 (258916..261066) [2151 bp, 716 aa] {ON} YCR091W ...   134   2e-31
YOL100W Chr15 (129237..132482) [3246 bp, 1081 aa] {ON}  PKH2Seri...   135   2e-31
TDEL0A07860 Chr1 (1365985..1368498) [2514 bp, 837 aa] {ON} Anc_6...   134   2e-31
SAKL0D06534g Chr4 complement(538606..540091,540155..540237) [156...   132   2e-31
TPHA0E03300 Chr5 (703575..704912) [1338 bp, 445 aa] {ON} Anc_1.1...   130   2e-31
Kpol_1018.54 s1018 (163688..166192) [2505 bp, 834 aa] {ON} (1636...   134   3e-31
CAGL0G04609g Chr7 complement(437162..440059) [2898 bp, 965 aa] {...   134   3e-31
NDAI0H02470 Chr8 complement(597707..601942) [4236 bp, 1411 aa] {...   135   3e-31
YDR490C Chr4 complement(1431968..1434268) [2301 bp, 766 aa] {ON}...   133   3e-31
Skud_14.379 Chr14 (677081..679774) [2694 bp, 897 aa] {ON} YNR047...   134   3e-31
KNAG0D00210 Chr4 complement(22721..25222) [2502 bp, 833 aa] {ON}...   133   4e-31
TBLA0C00720 Chr3 (149299..151149) [1851 bp, 616 aa] {ON} Anc_1.4...   132   4e-31
KLTH0A07458g Chr1 (620459..623080) [2622 bp, 873 aa] {ON} simila...   134   4e-31
Skud_7.92 Chr7 complement(169006..170697) [1692 bp, 563 aa] {ON}...   131   4e-31
KLTH0F09988g Chr6 complement(868693..869931) [1239 bp, 412 aa] {...   129   4e-31
Skud_4.764 Chr4 complement(1351725..1353995) [2271 bp, 756 aa] {...   133   4e-31
KLTH0E06776g Chr5 complement(622147..625575) [3429 bp, 1142 aa] ...   134   4e-31
CAGL0I07513g Chr9 (722045..725275) [3231 bp, 1076 aa] {ON} simil...   134   5e-31
Smik_3.173 Chr3 complement(242285..246307) [4023 bp, 1340 aa] {O...   134   5e-31
Smik_2.417 Chr2 (735214..736797) [1584 bp, 527 aa] {ON} YBR274W ...   130   6e-31
Skud_15.54 Chr15 (88576..91824) [3249 bp, 1082 aa] {ON} YOL100W ...   133   6e-31
TPHA0B03850 Chr2 (909219..910841) [1623 bp, 540 aa] {ON} Anc_1.4...   130   6e-31
KAFR0J02620 Chr10 complement(502187..504265) [2079 bp, 692 aa] {...   132   6e-31
NDAI0K02390 Chr11 (537260..539920) [2661 bp, 886 aa] {ON} Anc_6....   133   7e-31
Kwal_0.155 s0 (84856..86619) [1764 bp, 587 aa] {ON} YLR248W (RCK...   130   7e-31
NCAS0F01580 Chr6 complement(313801..317949) [4149 bp, 1382 aa] {...   133   8e-31
Kpol_1028.16 s1028 complement(45186..47825) [2640 bp, 879 aa] {O...   132   9e-31
Smik_15.57 Chr15 (92331..95576) [3246 bp, 1081 aa] {ON} YOL100W ...   132   1e-30
ZYRO0A03894g Chr1 (307915..309273) [1359 bp, 452 aa] {ON} simila...   128   1e-30
Skud_2.406 Chr2 (718522..720105) [1584 bp, 527 aa] {ON} YBR274W ...   129   1e-30
TPHA0H02630 Chr8 complement(614048..618151) [4104 bp, 1367 aa] {...   132   1e-30
KAFR0F03970 Chr6 (777047..778201) [1155 bp, 384 aa] {ON} Anc_4.1...   126   1e-30
CAGL0K07458g Chr11 complement(737165..739279) [2115 bp, 704 aa] ...   131   2e-30
YBR274W Chr2 (749594..751177) [1584 bp, 527 aa] {ON}  CHK1Serine...   129   2e-30
ZYRO0B09196g Chr2 complement(721019..722569) [1551 bp, 516 aa] {...   129   2e-30
YGL158W Chr7 (207033..208571) [1539 bp, 512 aa] {ON}  RCK1Protei...   129   2e-30
Kwal_23.3590 s23 complement(353755..355254) [1500 bp, 499 aa] {O...   128   2e-30
Skud_3.146 Chr3 complement(227229..231233) [4005 bp, 1334 aa] {O...   132   2e-30
Ecym_3586 Chr3 complement(1112070..1115303) [3234 bp, 1077 aa] {...   132   2e-30
TPHA0D02740 Chr4 (566279..568819) [2541 bp, 846 aa] {ON} Anc_5.5...   131   2e-30
KLLA0D09328g Chr4 complement(788565..791705) [3141 bp, 1046 aa] ...   131   2e-30
KLLA0F07623g Chr6 (720246..723935) [3690 bp, 1229 aa] {ON} simil...   131   2e-30
NCAS0A05570 Chr1 (1093653..1096409) [2757 bp, 918 aa] {ON} Anc_6...   130   3e-30
AER264C Chr5 complement(1120017..1124468) [4452 bp, 1483 aa] {ON...   131   4e-30
YCR091W Chr3 (274404..276566) [2163 bp, 720 aa] {ON}  KIN82Putat...   130   4e-30
KLLA0C17160g Chr3 (1498959..1501454) [2496 bp, 831 aa] {ON} simi...   130   4e-30
Smik_3.189 Chr3 (273885..276044) [2160 bp, 719 aa] {ON} YCR091W ...   129   4e-30
KAFR0C04780 Chr3 (948771..951131) [2361 bp, 786 aa] {ON} Anc_6.3...   130   5e-30
KAFR0C01440 Chr3 complement(295468..298755) [3288 bp, 1095 aa] {...   130   5e-30
SAKL0H24706g Chr8 (2145552..2149100) [3549 bp, 1182 aa] {ON} sim...   130   5e-30
YKL126W Chr11 (205707..207749) [2043 bp, 680 aa] {ON}  YPK1Serin...   129   7e-30
SAKL0C09174g Chr3 complement(833618..836833) [3216 bp, 1071 aa] ...   130   8e-30
Kwal_26.7154 s26 (237387..241028) [3642 bp, 1213 aa] {ON} YOL045...   130   8e-30
AFR335C Chr6 complement(1046756..1049857) [3102 bp, 1033 aa] {ON...   129   9e-30
Skud_11.103 Chr11 (192587..194629) [2043 bp, 680 aa] {ON} YMR104...   128   9e-30
Ecym_6040 Chr6 complement(77854..80544) [2691 bp, 896 aa] {ON} s...   129   1e-29
KLLA0C00979g Chr3 (73295..74746) [1452 bp, 483 aa] {ON} similar ...   126   1e-29
Skud_1.44 Chr1 (95573..99643) [4071 bp, 1356 aa] {ON} YAL017W (R...   129   1e-29
NCAS0C04100 Chr3 (834997..837714) [2718 bp, 905 aa] {ON} Anc_8.141    129   1e-29
SAKL0A00484g Chr1 complement(57938..60544) [2607 bp, 868 aa] {ON...   129   1e-29
Smik_11.113 Chr11 (191688..193730) [2043 bp, 680 aa] {ON} YMR104...   128   1e-29
KAFR0I02440 Chr9 complement(493668..495128) [1461 bp, 486 aa] {O...   125   2e-29
KLLA0C18568g Chr3 (1639958..1642282) [2325 bp, 774 aa] {ON} simi...   128   2e-29
TDEL0D02040 Chr4 (395555..397138) [1584 bp, 527 aa] {ON} Anc_1.3...   126   2e-29
Kpol_541.49 s541 complement(156530..159514) [2985 bp, 994 aa] {O...   128   2e-29
YCR073C Chr3 complement(242588..246583) [3996 bp, 1331 aa] {ON} ...   129   2e-29
Suva_4.535 Chr4 (921278..922861) [1584 bp, 527 aa] {ON} YBR274W ...   125   2e-29
SAKL0D08294g Chr4 (692455..693966) [1512 bp, 503 aa] {ON} some s...   125   2e-29
TPHA0B00240 Chr2 complement(44468..46525) [2058 bp, 685 aa] {ON}...   127   2e-29
NDAI0K01370 Chr11 (313672..315714) [2043 bp, 680 aa] {ON}             127   2e-29
NDAI0G03450 Chr7 (822716..825562) [2847 bp, 948 aa] {ON} Anc_8.141    128   3e-29
Suva_11.99 Chr11 (192143..194197) [2055 bp, 684 aa] {ON} YMR104C...   127   3e-29
KAFR0E01040 Chr5 complement(214744..216252) [1509 bp, 502 aa] {O...   125   3e-29
TBLA0C01320 Chr3 complement(289223..290626) [1404 bp, 467 aa] {O...   124   3e-29
TBLA0D02230 Chr4 (557816..561280) [3465 bp, 1154 aa] {ON} Anc_8....   128   3e-29
ZYRO0D17468g Chr4 (1439376..1441958) [2583 bp, 860 aa] {ON} weak...   127   3e-29
YGL179C Chr7 complement(163409..165091) [1683 bp, 560 aa] {ON}  ...   125   3e-29
YAL017W Chr1 (120225..124295) [4071 bp, 1356 aa] {ON}  PSK1One o...   128   3e-29
KLLA0E03587g Chr5 complement(323764..325707) [1944 bp, 647 aa] {...   126   4e-29
NDAI0I00250 Chr9 (42174..44867) [2694 bp, 897 aa] {ON} Anc_3.177...   127   4e-29
TDEL0D03950 Chr4 (720229..721710) [1482 bp, 493 aa] {ON} Anc_3.2...   124   5e-29
TBLA0A04720 Chr1 (1168895..1172683) [3789 bp, 1262 aa] {ON} Anc_...   127   5e-29
KLTH0H10318g Chr8 complement(888661..890128,890228..890316) [155...   124   5e-29
Suva_7.106 Chr7 (202969..204540) [1572 bp, 523 aa] {ON} YGL158W ...   124   5e-29
TDEL0H03640 Chr8 complement(600211..603924) [3714 bp, 1237 aa] {...   127   6e-29
SAKL0H24750g Chr8 complement(2152673..2155420) [2748 bp, 915 aa]...   127   6e-29
CAGL0C05005g Chr3 complement(467626..470856) [3231 bp, 1076 aa] ...   127   6e-29
KAFR0A05090 Chr1 (1011918..1013924) [2007 bp, 668 aa] {ON}            125   6e-29
Kwal_47.17252 s47 (318148..320766) [2619 bp, 872 aa] {ON} YGL180...   126   7e-29
TBLA0E02290 Chr5 complement(563483..567385) [3903 bp, 1300 aa] {...   127   7e-29
NCAS0D04710 Chr4 complement(901442..903856) [2415 bp, 804 aa] {O...   125   1e-28
KNAG0J01290 Chr10 complement(230493..232019) [1527 bp, 508 aa] {...   123   1e-28
SAKL0E03608g Chr5 complement(291806..294007) [2202 bp, 733 aa] {...   125   1e-28
TPHA0G02910 Chr7 (624676..626727) [2052 bp, 683 aa] {ON} Anc_2.4...   124   1e-28
NDAI0H02340 Chr8 complement(568767..570887) [2121 bp, 706 aa] {O...   124   2e-28
NCAS0A10290 Chr1 complement(2051582..2053111) [1530 bp, 509 aa] ...   122   2e-28
KLTH0E06754g Chr5 (619163..621784) [2622 bp, 873 aa] {ON} simila...   125   2e-28
NCAS0A05370 Chr1 complement(1061671..1066197) [4527 bp, 1508 aa]...   125   2e-28
TPHA0O01030 Chr15 complement(191875..193890) [2016 bp, 671 aa] {...   124   2e-28
CAGL0F00913g Chr6 (97023..100643) [3621 bp, 1206 aa] {ON} simila...   125   2e-28
ZYRO0A05214g Chr1 complement(418443..421268) [2826 bp, 941 aa] {...   125   2e-28
TDEL0F00930 Chr6 complement(160181..163573) [3393 bp, 1130 aa] {...   125   2e-28
KNAG0D04810 Chr4 (867817..872139) [4323 bp, 1440 aa] {ON} Anc_7....   125   2e-28
KLLA0C08525g Chr3 (744554..749209) [4656 bp, 1551 aa] {ON} simil...   125   2e-28
Kpol_1035.17 s1035 complement(39908..41503) [1596 bp, 531 aa] {O...   122   2e-28
NCAS0A04360 Chr1 (880768..882822) [2055 bp, 684 aa] {ON} Anc_2.446    124   2e-28
ZYRO0G02530g Chr7 (194463..196577) [2115 bp, 704 aa] {ON} highly...   124   2e-28
KAFR0B02140 Chr2 (417972..420662) [2691 bp, 896 aa] {ON} Anc_8.1...   124   2e-28
SAKL0B09856g Chr2 complement(830531..834355) [3825 bp, 1274 aa] ...   125   3e-28
KLLA0B12716g Chr2 (1109939..1112089) [2151 bp, 716 aa] {ON} simi...   124   3e-28
KAFR0C00930 Chr3 complement(186877..189687) [2811 bp, 936 aa] {O...   124   3e-28
Smik_1.50 Chr1 (103132..107205) [4074 bp, 1357 aa] {ON} YAL017W ...   125   3e-28
Kpol_1018.162 s1018 (414868..416904) [2037 bp, 678 aa] {ON} (414...   123   3e-28
KAFR0K00700 Chr11 complement(153981..158126) [4146 bp, 1381 aa] ...   124   4e-28
CAGL0L06006g Chr12 complement(672704..675532) [2829 bp, 942 aa] ...   124   4e-28
Kpol_1033.55 s1033 (138831..140555,140557..140895) [2064 bp, 687...   123   4e-28
Suva_1.50 Chr1 (96474..100556) [4083 bp, 1360 aa] {ON} YAL017W (...   124   5e-28
Ecym_6307 Chr6 (578677..580227) [1551 bp, 516 aa] {ON} similar t...   121   5e-28
Kwal_56.22788 s56 complement(281404..282951) [1548 bp, 515 aa] {...   121   5e-28
Kwal_23.6325 s23 complement(1533223..1537851) [4629 bp, 1542 aa]...   124   5e-28
TBLA0B02310 Chr2 (539362..541821) [2460 bp, 819 aa] {ON} Anc_3.9...   123   6e-28
KLTH0D04818g Chr4 (439491..441566) [2076 bp, 691 aa] {ON} simila...   122   6e-28
TPHA0L00500 Chr12 (83710..86589) [2880 bp, 959 aa] {ON} Anc_7.86...   123   6e-28
SAKL0A01254g Chr1 (119884..124560) [4677 bp, 1558 aa] {ON} simil...   124   7e-28
Kwal_26.7635 s26 (451306..453381) [2076 bp, 691 aa] {ON} YKL126W...   122   8e-28
CAGL0B04301g Chr2 (420544..422172) [1629 bp, 542 aa] {ON} simila...   120   9e-28
TBLA0F00240 Chr6 complement(45510..49256) [3747 bp, 1248 aa] {ON...   123   9e-28
CAGL0K03399g Chr11 complement(311316..313427) [2112 bp, 703 aa] ...   122   1e-27
AFR377C Chr6 complement(1116589..1118769) [2181 bp, 726 aa] {ON}...   122   1e-27
KAFR0C03010 Chr3 (598970..601342) [2373 bp, 790 aa] {ON} Anc_8.1...   122   1e-27
TPHA0G02480 Chr7 (509815..511860) [2046 bp, 681 aa] {ON} Anc_2.4...   121   1e-27
KNAG0E01390 Chr5 (275055..276776) [1722 bp, 573 aa] {ON} Anc_1.4...   120   1e-27
TDEL0B05820 Chr2 complement(1031136..1032863) [1728 bp, 575 aa] ...   120   1e-27
Kwal_17.2687 s17 complement(6084..7172) [1089 bp, 362 aa] {ON} Y...   117   1e-27
KAFR0D03020 Chr4 (596365..598398) [2034 bp, 677 aa] {ON} Anc_2.4...   121   1e-27
ZYRO0D05500g Chr4 (473262..477050) [3789 bp, 1262 aa] {ON} weakl...   122   1e-27
YMR104C Chr13 complement(473420..475453) [2034 bp, 677 aa] {ON} ...   121   2e-27
CAGL0K02167g Chr11 complement(192297..195785) [3489 bp, 1162 aa]...   122   2e-27
Smik_7.115 Chr7 (201140..202663) [1524 bp, 507 aa] {ON} YGL158W ...   119   2e-27
Ecym_2499 Chr2 complement(976395..981020) [4626 bp, 1541 aa] {ON...   122   2e-27
Ecym_8399 Chr8 (821221..824766) [3546 bp, 1181 aa] {ON} similar ...   122   2e-27
ACL053C Chr3 complement(273163..276708) [3546 bp, 1181 aa] {ON} ...   122   2e-27
TBLA0I01370 Chr9 complement(294202..296526) [2325 bp, 774 aa] {O...   121   2e-27
CAGL0H06259g Chr8 (615045..619055) [4011 bp, 1336 aa] {ON} simil...   122   2e-27
TBLA0E02790 Chr5 complement(693136..695562) [2427 bp, 808 aa] {O...   121   2e-27
ABL028W Chr2 (345953..348121) [2169 bp, 722 aa] {ON} Syntenic ho...   121   2e-27
TDEL0B06160 Chr2 complement(1086672..1088327) [1656 bp, 551 aa] ...   120   2e-27
KNAG0I02670 Chr9 complement(524008..526734) [2727 bp, 908 aa] {O...   122   2e-27
KLLA0F24618g Chr6 complement(2288943..2290613) [1671 bp, 556 aa]...   120   2e-27
KLTH0H08316g Chr8 (730027..731094) [1068 bp, 355 aa] {ON} simila...   116   2e-27
NCAS0C03690 Chr3 (741930..744881) [2952 bp, 983 aa] {ON}              122   2e-27
Smik_13.290 Chr13 complement(457921..459951) [2031 bp, 676 aa] {...   121   2e-27
ZYRO0G19074g Chr7 complement(1580648..1583413) [2766 bp, 921 aa]...   121   2e-27
TDEL0E01820 Chr5 complement(348423..349403) [981 bp, 326 aa] {ON...   115   2e-27
TPHA0H02390 Chr8 (561244..563436) [2193 bp, 730 aa] {ON} Anc_6.3...   120   3e-27
TDEL0B04700 Chr2 (834336..836996) [2661 bp, 886 aa] {ON} Anc_8.1...   121   3e-27
KLTH0D02486g Chr4 (247566..251237) [3672 bp, 1223 aa] {ON} simil...   122   3e-27
Skud_7.114 Chr7 (211645..213153) [1509 bp, 502 aa] {ON} YGL158W ...   119   3e-27
ADR167W Chr4 (994581..997202) [2622 bp, 873 aa] {ON} Syntenic ho...   121   3e-27
NCAS0A02180 Chr1 (410419..411489) [1071 bp, 356 aa] {ON} Anc_4.192    116   3e-27
TDEL0D04460 Chr4 complement(813075..815816) [2742 bp, 913 aa] {O...   121   3e-27
TPHA0A04170 Chr1 (937692..939233) [1542 bp, 513 aa] {ON} Anc_3.2...   119   4e-27
TDEL0A07560 Chr1 complement(1316498..1321225) [4728 bp, 1575 aa]...   121   4e-27
AEL083W Chr5 (470964..472574) [1611 bp, 536 aa] {ON} Syntenic ho...   119   4e-27
TBLA0I02400 Chr9 complement(548975..554167) [5193 bp, 1730 aa] {...   121   4e-27
NCAS0A08770 Chr1 complement(1733181..1734890) [1710 bp, 569 aa] ...   119   4e-27
KLTH0A06776g Chr1 complement(562932..567503) [4572 bp, 1523 aa] ...   121   4e-27
Ecym_2640 Chr2 complement(1232617..1236594) [3978 bp, 1325 aa] {...   121   5e-27
KLTH0H11858g Chr8 (1013677..1015374) [1698 bp, 565 aa] {ON} some...   119   5e-27
KLTH0C08932g Chr3 (749308..750867) [1560 bp, 519 aa] {ON} simila...   118   5e-27
Kpol_1037.6 s1037 (12601..15534) [2934 bp, 977 aa] {ON} (12601.....   120   5e-27
YOL045W Chr15 (243497..246802) [3306 bp, 1101 aa] {ON}  PSK2One ...   120   6e-27
Suva_3.110 Chr3 complement(160016..164146) [4131 bp, 1376 aa] {O...   120   6e-27
ACR281C Chr3 complement(864528..868307) [3780 bp, 1259 aa] {ON} ...   120   6e-27
KNAG0A06290 Chr1 (958438..960516) [2079 bp, 692 aa] {ON} Anc_2.4...   119   6e-27
Suva_15.124 Chr15 (215781..219101) [3321 bp, 1106 aa] {ON} YOL04...   120   6e-27
NDAI0K02100 Chr11 complement(469575..472304) [2730 bp, 909 aa] {...   120   6e-27
NCAS0A05050 Chr1 complement(1002107..1004788) [2682 bp, 893 aa] ...   120   6e-27
Kpol_1040.20 s1040 (57057..60950) [3894 bp, 1297 aa] {ON} (57057...   120   7e-27
Suva_13.281 Chr13 complement(455094..457136) [2043 bp, 680 aa] {...   119   7e-27
YGL180W Chr7 (160065..162758) [2694 bp, 897 aa] {ON}  ATG1Protei...   120   8e-27
NDAI0D04110 Chr4 (966439..967560) [1122 bp, 373 aa] {ON} Anc_4.192    115   8e-27
CAGL0B03509g Chr2 complement(349638..351431) [1794 bp, 597 aa] {...   118   9e-27
Skud_15.112 Chr15 (202308..205613) [3306 bp, 1101 aa] {ON} YOL04...   120   1e-26
ZYRO0E05170g Chr5 complement(390866..392593) [1728 bp, 575 aa] {...   118   1e-26
KLLA0F12188g Chr6 (1122745..1124385) [1641 bp, 546 aa] {ON} some...   117   1e-26
Kpol_1028.40 s1028 (95617..100392) [4776 bp, 1591 aa] {ON} (9561...   120   1e-26
AAL029W Chr1 (289989..291593) [1605 bp, 534 aa] {ON} Syntenic ho...   117   1e-26
KNAG0D00390 Chr4 (53459..58429) [4971 bp, 1656 aa] {ON} Anc_6.34...   120   1e-26
NDAI0A08560 Chr1 complement(1969778..1973731) [3954 bp, 1317 aa]...   120   1e-26
Ecym_2744 Chr2 complement(1442759..1444465) [1707 bp, 568 aa] {O...   117   1e-26
TPHA0C00160 Chr3 complement(17339..19603) [2265 bp, 754 aa] {ON}...   119   1e-26
Skud_13.262 Chr13 complement(448758..450791) [2034 bp, 677 aa] {...   118   1e-26
KAFR0I02100 Chr9 (431876..433258) [1383 bp, 460 aa] {ON} Anc_1.3...   116   1e-26
TPHA0M01840 Chr13 complement(380953..385818) [4866 bp, 1621 aa] ...   119   2e-26
Kpol_1007.17 s1007 (32671..32687,32861..33767) [924 bp, 307 aa] ...   112   2e-26
ZYRO0G19052g Chr7 (1576638..1580033) [3396 bp, 1131 aa] {ON} sim...   119   2e-26
Suva_14.385 Chr14 complement(661987..666732) [4746 bp, 1581 aa] ...   119   2e-26
TDEL0A02220 Chr1 (402496..404565) [2070 bp, 689 aa] {ON} Anc_2.4...   118   2e-26
Kpol_1050.13 s1050 (34788..36578) [1791 bp, 596 aa] {ON} (34788....   117   2e-26
Ecym_3547 Chr3 complement(1034494..1036107) [1614 bp, 537 aa] {O...   116   2e-26
KLLA0F01276g Chr6 complement(120001..121560) [1560 bp, 519 aa] {...   116   2e-26
KNAG0I01360 Chr9 complement(262712..264556) [1845 bp, 614 aa] {O...   117   2e-26
Smik_15.122 Chr15 (209665..212970) [3306 bp, 1101 aa] {ON} YOL04...   119   2e-26
TBLA0B01630 Chr2 (360963..364850) [3888 bp, 1295 aa] {ON} Anc_3....   119   3e-26
Kpol_1014.8 s1014 (13007..14368) [1362 bp, 453 aa] {ON} (13007.....   115   3e-26
KLTH0D01386g Chr4 (129448..130053,130132..130974) [1449 bp, 482 ...   115   3e-26
TBLA0D04420 Chr4 complement(1097314..1099356) [2043 bp, 680 aa] ...   117   3e-26
NDAI0H03460 Chr8 complement(836849..838726) [1878 bp, 625 aa] {O...   117   3e-26
ZYRO0C06776g Chr3 complement(508813..511485) [2673 bp, 890 aa] {...   118   3e-26
Kpol_487.14 s487 complement(56520..58394) [1875 bp, 624 aa] {ON}...   117   3e-26
NCAS0F01460 Chr6 complement(290441..292465) [2025 bp, 674 aa] {O...   117   3e-26
Suva_7.82 Chr7 (156049..158751) [2703 bp, 900 aa] {ON} YGL180W (...   118   3e-26
KNAG0C06060 Chr3 (1183766..1186654) [2889 bp, 962 aa] {ON} Anc_5...   118   3e-26
KLTH0D06006g Chr4 complement(532589..535453) [2865 bp, 954 aa] {...   118   3e-26
KNAG0M00190 Chr13 complement(25224..27602) [2379 bp, 792 aa] {ON...   117   3e-26
ZYRO0A06446g Chr1 complement(513126..515957) [2832 bp, 943 aa] {...   118   3e-26
Suva_2.642 Chr2 (1147428..1148865,1149541..1150805) [2703 bp, 90...   117   3e-26
SAKL0H11638g Chr8 complement(994049..994946,995016..995032) [915...   111   4e-26
ACL054W Chr3 (269703..272621) [2919 bp, 972 aa] {ON} Syntenic ho...   117   4e-26
CAGL0F00649g Chr6 (71961..73505) [1545 bp, 514 aa] {ON} similar ...   115   4e-26
Suva_15.411 Chr15 (716095..718542) [2448 bp, 815 aa] {ON} YHR205...   117   5e-26
NCAS0A12350 Chr1 complement(2446237..2447236,2447319..2448559) [...   117   5e-26
Smik_8.295 Chr8 (484074..486548) [2475 bp, 824 aa] {ON} YHR205W ...   117   5e-26
YHR205W Chr8 (509363..511837) [2475 bp, 824 aa] {ON}  SCH9AGC fa...   117   5e-26
YNR031C Chr14 complement(680694..685433) [4740 bp, 1579 aa] {ON}...   118   5e-26
AGL242C Chr7 complement(246896..247790,247838..247854) [912 bp, ...   111   5e-26
TBLA0A10690 Chr1 (2642723..2645632) [2910 bp, 969 aa] {ON} Anc_4...   117   6e-26
Skud_7.91 Chr7 (165681..168374) [2694 bp, 897 aa] {ON} YGL180W (...   117   6e-26
TBLA0I01800 Chr9 complement(401728..403617) [1890 bp, 629 aa] {O...   116   6e-26
NDAI0G05190 Chr7 complement(1258638..1260452) [1815 bp, 604 aa] ...   115   7e-26
NDAI0I00340 Chr9 (65047..70557) [5511 bp, 1836 aa] {ON} Anc_6.341     117   7e-26
NCAS0B04580 Chr2 (831695..835255) [3561 bp, 1186 aa] {ON} Anc_8....   117   7e-26
NCAS0A08610 Chr1 complement(1700839..1702704) [1866 bp, 621 aa] ...   115   7e-26
Smik_7.92 Chr7 (155049..157742) [2694 bp, 897 aa] {ON} YGL180W (...   117   7e-26
Kpol_1044.3 s1044 (4910..5845,5849..7711) [2799 bp, 932 aa] {ON}...   117   7e-26
KAFR0B06980 Chr2 (1452754..1455081) [2328 bp, 775 aa] {ON} Anc_4...   116   8e-26
Skud_14.362 Chr14 complement(648801..653540) [4740 bp, 1579 aa] ...   117   8e-26
NCAS0A06440 Chr1 (1270771..1273020) [2250 bp, 749 aa] {ON} Anc_4...   116   9e-26
Kwal_26.7861 s26 complement(544126..546993) [2868 bp, 955 aa] {O...   116   1e-25
Skud_8.272 Chr8 (478199..480706) [2508 bp, 835 aa] {ON} YHR205W ...   116   1e-25
KAFR0C05130 Chr3 (1018035..1019402) [1368 bp, 455 aa] {ON} Anc_7...   113   1e-25
ACL104C Chr3 complement(157357..160200) [2844 bp, 947 aa] {ON} S...   116   1e-25
NDAI0A03870 Chr1 (867910..870597) [2688 bp, 895 aa] {ON} Anc_2.496    116   1e-25
Kpol_265.1 s265 (4826..7099) [2274 bp, 757 aa] {ON} (4826..7099)...   115   1e-25
Kwal_47.16761 s47 (100315..102549) [2235 bp, 744 aa] {ON} YHR205...   115   1e-25
Smik_3.94 Chr3 (128344..130155) [1812 bp, 603 aa] {ON} YCR008W (...   115   1e-25
TPHA0H00410 Chr8 (79426..82197) [2772 bp, 923 aa] {ON} Anc_8.141...   116   1e-25
KLTH0D17204g Chr4 complement(1426818..1429085) [2268 bp, 755 aa]...   115   1e-25
NDAI0C01700 Chr3 complement(367077..370139) [3063 bp, 1020 aa] {...   116   1e-25
Kpol_1037.52 s1037 complement(128841..130379) [1539 bp, 512 aa] ...   114   1e-25
SAKL0G01848g Chr7 (154547..157204) [2658 bp, 885 aa] {ON} weakly...   115   1e-25
NCAS0J00960 Chr10 (157010..159121) [2112 bp, 703 aa] {ON}             115   2e-25
KNAG0F02900 Chr6 (549477..551426) [1950 bp, 649 aa] {ON}              115   2e-25
Suva_3.33 Chr3 (42176..44020) [1845 bp, 614 aa] {ON} YCR008W (REAL)   114   2e-25
SAKL0B12364g Chr2 (1060853..1063021) [2169 bp, 722 aa] {ON} high...   115   2e-25
SAKL0G06402g Chr7 (535632..537986) [2355 bp, 784 aa] {ON} simila...   115   2e-25
TBLA0I01310 Chr9 (279407..281245) [1839 bp, 612 aa] {ON} Anc_2.4...   114   2e-25
TBLA0C02940 Chr3 complement(706091..711022) [4932 bp, 1643 aa] {...   116   2e-25
SAKL0D09240g Chr4 (764130..765761) [1632 bp, 543 aa] {ON} some s...   114   2e-25
Ecym_6344 Chr6 complement(664647..668840) [4194 bp, 1397 aa] {ON...   115   2e-25
Skud_5.249 Chr5 complement(400867..404310) [3444 bp, 1147 aa] {O...   115   2e-25
Ecym_6136 Chr6 complement(248721..250187) [1467 bp, 488 aa] {ON}...   113   2e-25
KLTH0H12650g Chr8 (1072961..1074592) [1632 bp, 543 aa] {ON} simi...   113   2e-25
ADL389W Chr4 (27641..29776) [2136 bp, 711 aa] {ON} Syntenic homo...   114   2e-25
KAFR0C04590 Chr3 complement(917915..922321) [4407 bp, 1468 aa] {...   115   2e-25
KAFR0D03100 Chr4 complement(610106..611635) [1530 bp, 509 aa] {O...   113   2e-25
KLLA0C04191g Chr3 (384198..386591) [2394 bp, 797 aa] {ON} weakly...   115   2e-25
TDEL0E01710 Chr5 complement(330667..332706) [2040 bp, 679 aa] {O...   114   3e-25
YCR008W Chr3 (128470..130281) [1812 bp, 603 aa] {ON}  SAT4Ser/Th...   114   3e-25
TDEL0A04580 Chr1 (816247..818331) [2085 bp, 694 aa] {ON} Anc_5.5...   114   3e-25
TPHA0C01780 Chr3 complement(407048..407965) [918 bp, 305 aa] {ON...   108   3e-25
KNAG0E00360 Chr5 (54187..55563) [1377 bp, 458 aa] {ON}                112   3e-25
ZYRO0E04246g Chr5 complement(322215..324035) [1821 bp, 606 aa] {...   113   3e-25
KAFR0F04340 Chr6 (848844..853628) [4785 bp, 1594 aa] {ON} Anc_6....   115   3e-25
KNAG0L00520 Chr12 (79786..80892) [1107 bp, 368 aa] {ON} Anc_7.86...   110   3e-25
Kwal_27.9763 s27 (54483..57089) [2607 bp, 868 aa] {ON} YAR019C (...   114   3e-25
CAGL0L12474g Chr12 complement(1347340..1348248) [909 bp, 302 aa]...   108   4e-25
Skud_4.742 Chr4 (1315170..1317881) [2712 bp, 903 aa] {ON} YDR466...   114   4e-25
TBLA0D02240 Chr4 complement(561856..566547) [4692 bp, 1563 aa] {...   115   4e-25
KLTH0G12738g Chr7 complement(1085500..1086804) [1305 bp, 434 aa]...   111   4e-25
NDAI0D03420 Chr4 (806856..809261) [2406 bp, 801 aa] {ON} Anc_4.384    114   4e-25
Suva_16.286 Chr16 complement(495354..496254,496351..496367) [918...   108   4e-25
NDAI0G05060 Chr7 complement(1227369..1229495) [2127 bp, 708 aa] ...   114   5e-25
Ecym_8400 Chr8 complement(825315..828515) [3201 bp, 1066 aa] {ON...   114   5e-25
KNAG0A02310 Chr1 complement(216545..217453) [909 bp, 302 aa] {ON...   108   5e-25
Smik_14.360 Chr14 complement(638655..643406) [4752 bp, 1583 aa] ...   114   5e-25
TPHA0G03290 Chr7 (702953..705874) [2922 bp, 973 aa] {ON} Anc_2.4...   114   5e-25
NCAS0A07990 Chr1 complement(1578473..1581346) [2874 bp, 957 aa] ...   114   5e-25
YDR466W Chr4 (1395121..1397817) [2697 bp, 898 aa] {ON}  PKH3Prot...   114   6e-25
Ecym_7473 Chr7 (963826..966045) [2220 bp, 739 aa] {ON} similar t...   113   6e-25
Skud_16.251 Chr16 complement(457106..458006,458108..458124) [918...   108   6e-25
KLLA0F14190g Chr6 (1311121..1315137) [4017 bp, 1338 aa] {ON} uni...   114   6e-25
TPHA0H00420 Chr8 complement(82575..85691) [3117 bp, 1038 aa] {ON...   114   6e-25
NCAS0A09470 Chr1 complement(1883183..1887730) [4548 bp, 1515 aa]...   114   6e-25
KLLA0C04213g Chr3 (386815..387999) [1185 bp, 394 aa] {ON} simila...   110   7e-25
KLLA0E11947g Chr5 complement(1060048..1061892) [1845 bp, 614 aa]...   112   8e-25
TBLA0E04970 Chr5 (1272310..1273944) [1635 bp, 544 aa] {ON} Anc_4...   112   8e-25
AEL185C Chr5 complement(291129..292676) [1548 bp, 515 aa] {ON} S...   111   8e-25
Kpol_463.8 s463 complement(18696..23039) [4344 bp, 1447 aa] {ON}...   114   8e-25
YPL031C Chr16 complement(492018..492918,493021..493037) [918 bp,...   107   8e-25
KAFR0H01530 Chr8 complement(283589..284509) [921 bp, 306 aa] {ON...   107   9e-25
Kwal_0.307 s0 (145676..147145) [1470 bp, 490 aa] {OFF} YCR008W (...   111   9e-25
Kwal_YGOB_0.307 s0 (145676..147175) [1500 bp, 500 aa] {ON} ANNOT...   111   9e-25
Skud_3.73 Chr3 (110742..112556) [1815 bp, 604 aa] {ON} YCR008W (...   112   9e-25
KNAG0G01250 Chr7 complement(280791..283364) [2574 bp, 857 aa] {O...   113   9e-25
AFR092W Chr6 (595092..599363) [4272 bp, 1423 aa] {ON} Syntenic h...   114   9e-25
Kpol_1000.14 s1000 complement(36018..38015) [1998 bp, 665 aa] {O...   112   9e-25
KLLA0B13607g Chr2 (1191592..1194561) [2970 bp, 989 aa] {ON} simi...   113   9e-25
TDEL0D00330 Chr4 complement(55638..57872) [2235 bp, 744 aa] {ON}...   112   9e-25
AER195C Chr5 complement(1005431..1006945) [1515 bp, 504 aa] {ON}...   111   1e-24
Ecym_4523 Chr4 (1039929..1042070) [2142 bp, 713 aa] {ON} similar...   112   1e-24
ADR300C Chr4 complement(1222344..1225016) [2673 bp, 890 aa] {ON}...   113   1e-24
KLTH0E16126g Chr5 complement(1427208..1429814) [2607 bp, 868 aa]...   113   1e-24
KLTH0G17512g Chr7 complement(1518329..1519426) [1098 bp, 365 aa]...   108   1e-24
CAGL0F09075g Chr6 (894761..897001) [2241 bp, 746 aa] {ON} simila...   112   1e-24
NCAS0D04600 Chr4 (875553..880604) [5052 bp, 1683 aa] {ON} Anc_6....   113   1e-24
KLTH0G05214g Chr7 (423793..425754) [1962 bp, 653 aa] {ON} weakly...   112   1e-24
Smik_4.745 Chr4 (1316457..1319201) [2745 bp, 914 aa] {ON} YDR466...   112   1e-24
AGR334W Chr7 (1355098..1356693) [1596 bp, 531 aa] {ON} Syntenic ...   111   1e-24
ZYRO0G00506g Chr7 complement(38488..40854) [2367 bp, 788 aa] {ON...   112   1e-24
Ecym_6301 Chr6 complement(566248..567324) [1077 bp, 358 aa] {ON}...   108   1e-24
TDEL0B01540 Chr2 complement(272561..273458,273562..273578) [915 ...   107   1e-24
KLLA0B03586g Chr2 complement(326871..329075) [2205 bp, 734 aa] {...   112   1e-24
Smik_12.321 Chr12 (579087..580919) [1833 bp, 610 aa] {ON} YLR248...   111   2e-24
ZYRO0D08184g Chr4 (706856..711601) [4746 bp, 1581 aa] {ON} simil...   113   2e-24
KLTH0E11220g Chr5 (1005953..1005969,1006040..1006931) [909 bp, 3...   107   2e-24
ADR379C Chr4 complement(1386598..1388076) [1479 bp, 492 aa] {ON}...   110   2e-24
KNAG0I02830 Chr9 (549811..554358) [4548 bp, 1515 aa] {ON} Anc_1....   113   2e-24
Kwal_14.1273 s14 complement(259953..261200) [1248 bp, 415 aa] {O...   109   2e-24
TPHA0H01630 Chr8 (371333..374443) [3111 bp, 1036 aa] {ON} Anc_5....   112   2e-24
KLLA0D11990g Chr4 complement(1022895..1023792,1023928..1023944) ...   107   2e-24
KLLA0C14278g Chr3 (1240990..1242615) [1626 bp, 541 aa] {ON} simi...   110   2e-24
TBLA0F02350 Chr6 complement(578797..580467) [1671 bp, 556 aa] {O...   110   2e-24
ZYRO0D04752g Chr4 complement(397364..398215,398290..398907) [147...   110   2e-24
YJL095W Chr10 (247255..251691) [4437 bp, 1478 aa] {ON}  BCK1Mito...   112   2e-24
TPHA0O00670 Chr15 (125331..127088) [1758 bp, 585 aa] {ON} Anc_1....   110   2e-24
CAGL0M10153g Chr13 complement(1010688..1013291) [2604 bp, 867 aa...   112   2e-24
CAGL0L07810g Chr12 complement(859653..861443) [1791 bp, 596 aa] ...   110   2e-24
Kwal_56.23841 s56 (732202..733500) [1299 bp, 432 aa] {ON} YLR113...   108   2e-24
NDAI0G03030 Chr7 (704910..708269) [3360 bp, 1119 aa] {ON}             112   2e-24
TPHA0B01520 Chr2 complement(336164..339616) [3453 bp, 1150 aa] {...   112   2e-24
KAFR0A01760 Chr1 complement(363462..366119) [2658 bp, 885 aa] {O...   112   2e-24
ZYRO0G15290g Chr7 complement(1237119..1241582) [4464 bp, 1487 aa...   112   3e-24
Kwal_14.2497 s14 complement(784224..785480) [1257 bp, 418 aa] {O...   108   3e-24
KLLA0E06447g Chr5 complement(577669..581154) [3486 bp, 1161 aa] ...   112   3e-24
Suva_5.250 Chr5 (392904..396323) [3420 bp, 1139 aa] {ON} YER129W...   112   3e-24
ZYRO0F08074g Chr6 (654009..654025,654107..655004) [915 bp, 304 a...   105   3e-24
TPHA0I00920 Chr9 (204753..209057) [4305 bp, 1434 aa] {ON} Anc_1....   112   3e-24
NDAI0G05470 Chr7 (1340175..1344842) [4668 bp, 1555 aa] {ON} Anc_...   112   4e-24
Kpol_1055.24 s1055 complement(57430..60243) [2814 bp, 937 aa] {O...   111   4e-24
CAGL0K04301g Chr11 (405248..406315) [1068 bp, 355 aa] {ON} simil...   107   4e-24
KNAG0D02140 Chr4 complement(362745..365357) [2613 bp, 870 aa] {O...   111   4e-24
KAFR0K02490 Chr11 (515669..518356) [2688 bp, 895 aa] {ON} Anc_5....   111   4e-24
TPHA0H00760 Chr8 complement(152442..155384) [2943 bp, 980 aa] {O...   111   4e-24
KAFR0A01420 Chr1 (276454..280650) [4197 bp, 1398 aa] {ON} Anc_1....   111   5e-24
Ecym_2531 Chr2 (1034031..1034047,1034135..1035023) [906 bp, 301 ...   105   5e-24
Kpol_1041.9 s1041 (27806..29059) [1254 bp, 417 aa] {ON} (27806.....   107   5e-24
TDEL0H04100 Chr8 complement(706443..707306,707369..707974) [1470...   108   5e-24
KAFR0D04950 Chr4 (971956..974982) [3027 bp, 1008 aa] {ON} Anc_5....   111   5e-24
CAGL0K02673g Chr11 complement(241338..244085) [2748 bp, 915 aa] ...   110   5e-24
Sklu_YGOB_Anc_2.496 Chr5 (185447..187306) [1860 bp, 619 aa] {ON}...   110   5e-24
CAGL0K06479g Chr11 (637125..640100) [2976 bp, 991 aa] {ON} some ...   110   6e-24
NDAI0A07190 Chr1 (1636773..1638380) [1608 bp, 535 aa] {ON} Anc_3...   109   6e-24
NDAI0B02500 Chr2 (625206..629036) [3831 bp, 1276 aa] {ON} Anc_8....   111   6e-24
KAFR0A06190 Chr1 complement(1251546..1253690) [2145 bp, 714 aa] ...   110   6e-24
NDAI0K01480 Chr11 complement(337108..338706) [1599 bp, 532 aa] {...   108   6e-24
TBLA0A03570 Chr1 (892930..895857) [2928 bp, 975 aa] {ON} Anc_5.4...   110   7e-24
YLR248W Chr12 (634252..636084) [1833 bp, 610 aa] {ON}  RCK2Prote...   109   7e-24
NCAS0C02470 Chr3 complement(460460..461378,461483..461499) [936 ...   105   7e-24
SAKL0C08844g Chr3 (811712..813307) [1596 bp, 531 aa] {ON} simila...   108   8e-24
NDAI0B02900 Chr2 complement(737651..738709) [1059 bp, 352 aa] {O...   105   8e-24
Suva_2.157 Chr2 complement(275484..277064) [1581 bp, 526 aa] {ON...   108   8e-24
ZYRO0B01166g Chr2 complement(97168..100059) [2892 bp, 963 aa] {O...   110   8e-24
Ecym_4773 Chr4 complement(1504949..1506541) [1593 bp, 530 aa] {O...   108   9e-24
KLLA0E17073g Chr5 complement(1515721..1518279) [2559 bp, 852 aa]...   110   9e-24
CAGL0M11748g Chr13 (1168856..1170199) [1344 bp, 447 aa] {ON} hig...   107   1e-23
TDEL0C02110 Chr3 (364853..366340) [1488 bp, 495 aa] {ON} Anc_7.3...   108   1e-23
Suva_8.47 Chr8 complement(91615..94557) [2943 bp, 980 aa] {ON} Y...   110   1e-23
Kwal_55.20326 s55 complement(351010..353262) [2253 bp, 750 aa] {...   109   1e-23
ZYRO0F13310g Chr6 (1092612..1096322) [3711 bp, 1236 aa] {ON} som...   110   1e-23
TDEL0E02180 Chr5 complement(408232..411195) [2964 bp, 987 aa] {O...   110   1e-23
TDEL0D01400 Chr4 (269367..273656) [4290 bp, 1429 aa] {ON} Anc_1....   110   1e-23
NDAI0H01020 Chr8 complement(225366..228566) [3201 bp, 1066 aa] {...   110   1e-23
Suva_10.202 Chr10 (380079..381386) [1308 bp, 435 aa] {ON} YLR113...   107   1e-23
Skud_10.119 Chr10 (215299..219744) [4446 bp, 1481 aa] {ON} YJL09...   110   1e-23
Skud_12.181 Chr12 (354407..355702) [1296 bp, 431 aa] {ON} YLR113...   106   1e-23
TDEL0C03050 Chr3 (545862..549299) [3438 bp, 1145 aa] {ON} Anc_7....   109   1e-23
Smik_12.173 Chr12 (351727..353034) [1308 bp, 435 aa] {ON} YLR113...   106   1e-23
KLTH0D03454g Chr4 (327039..331340) [4302 bp, 1433 aa] {ON} simil...   110   1e-23
TBLA0H01330 Chr8 complement(297718..299163) [1446 bp, 481 aa] {O...   107   1e-23
KLTH0G18194g Chr7 (1570885..1572132) [1248 bp, 415 aa] {ON} weak...   106   1e-23
Suva_6.169 Chr6 complement(300200..304654) [4455 bp, 1484 aa] {O...   110   1e-23
Smik_8.42 Chr8 complement(74075..76894) [2820 bp, 939 aa] {ON} Y...   109   2e-23
Ecym_2434 Chr2 complement(843308..846676) [3369 bp, 1122 aa] {ON...   109   2e-23
KNAG0B05350 Chr2 complement(1034166..1036676) [2511 bp, 836 aa] ...   108   2e-23
NCAS0B05560 Chr2 complement(1050313..1051371) [1059 bp, 352 aa] ...   105   2e-23
Skud_8.39 Chr8 complement(76730..79501) [2772 bp, 923 aa] {ON} Y...   109   2e-23
NCAS0I00470 Chr9 (74336..77584) [3249 bp, 1082 aa] {ON} Anc_7.86      109   2e-23
CAGL0I05390g Chr9 complement(508677..510041) [1365 bp, 454 aa] {...   106   2e-23
KAFR0G01080 Chr7 complement(243965..247417) [3453 bp, 1150 aa] {...   109   2e-23
KLLA0F20053g Chr6 (1867209..1868543) [1335 bp, 444 aa] {ON} high...   106   2e-23
SAKL0E03344g Chr5 (272024..273754) [1731 bp, 576 aa] {ON} simila...   107   2e-23
Suva_10.345 Chr10 (601536..603365) [1830 bp, 609 aa] {ON} YLR248...   107   2e-23
AEL284C Chr5 complement(106480..107919) [1440 bp, 479 aa] {ON} S...   106   2e-23
AFR019W Chr6 (471481..472560) [1080 bp, 359 aa] {ON} Syntenic ho...   104   2e-23
ZYRO0D06182g Chr4 complement(529121..530416) [1296 bp, 431 aa] {...   105   2e-23
CAGL0L11550g Chr12 (1232015..1235233) [3219 bp, 1072 aa] {ON} si...   108   2e-23
NCAS0E02230 Chr5 (429499..430176,430250..431104) [1533 bp, 510 a...   107   2e-23
TBLA0I00280 Chr9 (42870..46820) [3951 bp, 1316 aa] {ON} Anc_2.49...   109   3e-23
Kpol_520.17 s520 complement(37953..41447) [3495 bp, 1164 aa] {ON...   108   3e-23
ZYRO0C13156g Chr3 complement(1041022..1042068) [1047 bp, 348 aa]...   104   3e-23
Suva_4.223 Chr4 complement(395869..397719) [1851 bp, 616 aa] {ON...   107   3e-23
KNAG0A06750 Chr1 (1053919..1056294) [2376 bp, 791 aa] {ON} Anc_2...   108   3e-23
Kpol_1031.10 s1031 (25064..28447) [3384 bp, 1127 aa] {ON} (25064...   108   3e-23
KNAG0G01430 Chr7 complement(322758..323822) [1065 bp, 354 aa] {O...   104   3e-23
CAGL0L03520g Chr12 complement(403100..407443) [4344 bp, 1447 aa]...   108   3e-23
YHL007C Chr8 complement(95118..97937) [2820 bp, 939 aa] {ON}  ST...   108   3e-23
CAGL0B02739g Chr2 complement(262590..264620) [2031 bp, 676 aa] {...   107   3e-23
KNAG0C04310 Chr3 complement(842994..846503) [3510 bp, 1169 aa] {...   108   3e-23
Suva_15.297 Chr15 (518854..520850,520945..522172) [3225 bp, 1074...   108   4e-23
Skud_4.146 Chr4 (263181..263196,263281..264173) [909 bp, 302 aa]...   102   4e-23
Ecym_2457 Chr2 (888054..890165) [2112 bp, 703 aa] {ON} similar t...   107   4e-23
ACR191C Chr3 complement(680398..683847) [3450 bp, 1149 aa] {ON} ...   108   4e-23
YER129W Chr5 (417281..420709) [3429 bp, 1142 aa] {ON}  SAK1Upstr...   108   4e-23
Kpol_1042.20 s1042 (45090..47261) [2172 bp, 723 aa] {ON} (45090....   107   4e-23
Kwal_55.21545 s55 complement(882294..884891) [2598 bp, 865 aa] {...   107   4e-23
Ecym_5505 Chr5 (1027605..1030616) [3012 bp, 1003 aa] {ON} simila...   108   4e-23
Kpol_541.48 s541 (152877..153692,153695..156046) [3168 bp, 1055 ...   108   4e-23
NCAS0H01940 Chr8 (374913..377960) [3048 bp, 1015 aa] {ON} Anc_5....   108   5e-23
YHR102W Chr8 (316572..319814) [3243 bp, 1080 aa] {ON}  KIC1Prote...   108   5e-23
CAGL0J06072g Chr10 complement(574501..576822) [2322 bp, 773 aa] ...   107   5e-23
Skud_12.329 Chr12 (580813..582645) [1833 bp, 610 aa] {ON} YLR248...   107   5e-23
KLLA0B13112g Chr2 complement(1146006..1148198) [2193 bp, 730 aa]...   107   5e-23
Kwal_14.1416 s14 (315842..316939) [1098 bp, 365 aa] {ON} YGR040W...   103   5e-23
YKL116C Chr11 complement(221344..222900) [1557 bp, 518 aa] {ON} ...   105   6e-23
Smik_5.275 Chr5 (426176..429601) [3426 bp, 1141 aa] {ON} YER129W...   107   6e-23
NCAS0D00710 Chr4 (122875..124737) [1863 bp, 620 aa] {ON}              106   6e-23
KAFR0C02840 Chr3 (559821..560873) [1053 bp, 350 aa] {ON} Anc_8.1...   103   6e-23
ABL055C Chr2 complement(295495..297105) [1611 bp, 536 aa] {ON} S...   105   6e-23
Ecym_6196 Chr6 (364576..365652) [1077 bp, 358 aa] {ON} similar t...   103   6e-23
NCAS0E03010 Chr5 (599358..602810) [3453 bp, 1150 aa] {ON} Anc_7....   107   7e-23
Kwal_33.13112 s33 (76807..78324) [1518 bp, 505 aa] {ON} YDR523C ...   105   7e-23
KNAG0B01780 Chr2 (326438..331180) [4743 bp, 1580 aa] {ON} Anc_1....   107   7e-23
KLTH0E04334g Chr5 complement(391495..393723) [2229 bp, 742 aa] {...   107   7e-23
TBLA0I00910 Chr9 complement(170526..173945) [3420 bp, 1139 aa] {...   107   7e-23
SAKL0F13618g Chr6 (1085967..1089494) [3528 bp, 1175 aa] {ON} sim...   107   7e-23
TDEL0F00840 Chr6 (144884..146875) [1992 bp, 663 aa] {ON} Anc_2.9...   106   7e-23
NCAS0B06000 Chr2 complement(1134919..1135808,1135909..1135957) [...   102   8e-23
NCAS0B08300 Chr2 (1582859..1584796) [1938 bp, 645 aa] {ON} Anc_1...   106   8e-23
TPHA0C04650 Chr3 complement(1006190..1007119) [930 bp, 309 aa] {...   102   8e-23
SAKL0H16038g Chr8 complement(1401627..1402931) [1305 bp, 434 aa]...   104   8e-23
Smik_4.128 Chr4 (244339..244354,244439..245331) [909 bp, 302 aa]...   102   8e-23
Skud_11.113 Chr11 complement(207796..209355) [1560 bp, 519 aa] {...   105   9e-23
TBLA0B08520 Chr2 complement(2038517..2041321) [2805 bp, 934 aa] ...   107   9e-23
Skud_8.163 Chr8 (290415..293645) [3231 bp, 1076 aa] {ON} YHR102W...   107   9e-23
Kpol_543.55 s543 (126256..127533) [1278 bp, 425 aa] {ON} (126256...   104   9e-23
ACL191C Chr3 complement(26475..27572) [1098 bp, 365 aa] {ON} Syn...   103   1e-22
KLLA0E21693g Chr5 complement(1936438..1939488) [3051 bp, 1016 aa...   107   1e-22
NDAI0E04610 Chr5 (1042690..1046154) [3465 bp, 1154 aa] {ON} Anc_...   107   1e-22
TBLA0A08290 Chr1 complement(2039328..2041376) [2049 bp, 682 aa] ...   106   1e-22
CAGL0K11550g Chr11 (1118971..1120587) [1617 bp, 538 aa] {ON} sim...   105   1e-22
Smik_11.125 Chr11 complement(208208..209764) [1557 bp, 518 aa] {...   105   1e-22
KNAG0K01240 Chr11 (243154..246096) [2943 bp, 980 aa] {ON} Anc_3....   106   1e-22
Ecym_4652 Chr4 (1272725..1276156) [3432 bp, 1143 aa] {ON} simila...   106   1e-22
ABL011C Chr2 complement(378257..380362) [2106 bp, 701 aa] {ON} S...   105   1e-22
Smik_10.147 Chr10 (239101..243537) [4437 bp, 1478 aa] {ON} YJL09...   107   1e-22
Smik_8.180 Chr8 (292993..296214) [3222 bp, 1073 aa] {ON} YHR102W...   106   1e-22
SAKL0C07722g Chr3 (717419..720157) [2739 bp, 912 aa] {ON} simila...   106   1e-22
ZYRO0B07854g Chr2 complement(613992..616007) [2016 bp, 671 aa] {...   105   1e-22
Suva_8.405 Chr8 complement(730738..732348) [1611 bp, 536 aa] {ON...   104   1e-22
KNAG0B04320 Chr2 complement(821265..824348) [3084 bp, 1027 aa] {...   106   1e-22
KNAG0A05580 Chr1 (830643..831560) [918 bp, 305 aa] {ON} Anc_2.33...   101   1e-22
KAFR0D03390 Chr4 (667896..670292) [2397 bp, 798 aa] {ON} Anc_2.4...   105   2e-22
ZYRO0C02288g Chr3 complement(181604..184327) [2724 bp, 907 aa] {...   106   2e-22
Skud_4.97 Chr4 (168099..169670) [1572 bp, 523 aa] {ON} YDL159W (...   104   2e-22
YDL108W Chr4 (267698..267725,267807..268699) [921 bp, 306 aa] {O...   100   2e-22
Ecym_4266 Chr4 complement(564935..566329) [1395 bp, 464 aa] {ON}...   103   2e-22
YDL025C Chr4 complement(405344..407206) [1863 bp, 620 aa] {ON}  ...   105   2e-22
SAKL0B05082g Chr2 (436707..438896) [2190 bp, 729 aa] {ON} simila...   105   2e-22
KLTH0F00946g Chr6 (73412..74950) [1539 bp, 512 aa] {ON} similar ...   103   2e-22
KNAG0I00590 Chr9 (100275..102068) [1794 bp, 597 aa] {ON}              104   2e-22
CAGL0J04290g Chr10 complement(403542..404615) [1074 bp, 357 aa] ...   102   2e-22
NCAS0A14050 Chr1 complement(2763082..2764551) [1470 bp, 489 aa] ...   103   2e-22
Skud_2.141 Chr2 complement(264097..265677) [1581 bp, 526 aa] {ON...   103   2e-22
Kwal_27.10581 s27 complement(403249..406713) [3465 bp, 1154 aa] ...   105   2e-22
NDAI0E03170 Chr5 complement(677441..678392,678524..678543) [972 ...   100   2e-22
Suva_2.11 Chr2 complement(17473..18858) [1386 bp, 461 aa] {ON} Y...   103   3e-22
Suva_11.108 Chr11 complement(207520..209070) [1551 bp, 516 aa] {...   103   3e-22
AGR048C Chr7 complement(807464..808825) [1362 bp, 453 aa] {ON} S...   103   3e-22
Suva_2.105 Chr2 (186428..187489) [1062 bp, 353 aa] {ON} YBL016W ...   101   3e-22
SAKL0G08250g Chr7 (703212..705707) [2496 bp, 831 aa] {ON} simila...   105   3e-22
KLLA0E14785g Chr5 complement(1323743..1324675) [933 bp, 310 aa] ...   100   3e-22
KLTH0C05478g Chr3 complement(471760..475254) [3495 bp, 1164 aa] ...   105   3e-22
Kpol_530.41 s530 (94710..96326) [1617 bp, 538 aa] {ON} (94710..9...   103   3e-22
YGR052W Chr7 (593596..594705) [1110 bp, 369 aa] {ON}  FMP48Putat...   101   4e-22
YLR113W Chr12 (371620..372927) [1308 bp, 435 aa] {ON}  HOG1Mitog...   102   4e-22
Smik_6.136 Chr6 (219577..220686) [1110 bp, 369 aa] {ON} YGR052W ...   101   4e-22
Skud_2.4 Chr2 complement(4805..8260) [3456 bp, 1151 aa] {ON} YBL...   105   4e-22
YBL105C Chr2 complement(14241..17696) [3456 bp, 1151 aa] {ON}  P...   105   4e-22
Kwal_47.18307 s47 complement(776521..778386) [1866 bp, 621 aa] {...   103   5e-22
CAGL0D02244g Chr4 complement(229504..230967) [1464 bp, 487 aa] {...   102   5e-22
Kpol_1002.111 s1002 (277615..278664) [1050 bp, 349 aa] {ON} (277...   100   5e-22
Skud_4.225 Chr4 complement(400160..401992) [1833 bp, 610 aa] {ON...   103   5e-22
Smik_2.13 Chr2 complement(14021..17473) [3453 bp, 1150 aa] {ON} ...   104   5e-22
Smik_2.14 Chr2 complement(14021..17473) [3453 bp, 1150 aa] {ON} ...   104   5e-22
NCAS0C02510 Chr3 complement(468113..469390) [1278 bp, 425 aa] {O...   101   5e-22
KLTH0D05082g Chr4 complement(457124..458680) [1557 bp, 518 aa] {...   102   6e-22
KAFR0A08360 Chr1 complement(1677561..1680050) [2490 bp, 829 aa] ...   104   6e-22
Kpol_1031.67 s1031 (174170..175663) [1494 bp, 497 aa] {ON} (1741...   102   6e-22
TPHA0F02870 Chr6 complement(636574..638259) [1686 bp, 561 aa] {O...   103   7e-22
KNAG0G01240 Chr7 (277868..280597) [2730 bp, 909 aa] {ON} Anc_8.1...   104   7e-22
Skud_15.519 Chr15 complement(932720..934216) [1497 bp, 498 aa] {...   102   7e-22
Smik_4.209 Chr4 complement(385530..386995,387230..387623) [1860 ...   103   7e-22
Kwal_26.7355 s26 (326867..331207) [4341 bp, 1446 aa] {ON} YJL095...   104   7e-22
Smik_2.101 Chr2 (186008..187069) [1062 bp, 353 aa] {ON} YBL016W ...   100   7e-22
TBLA0F00820 Chr6 (209607..211844) [2238 bp, 745 aa] {ON} Anc_3.1...   103   7e-22
SAKL0D05522g Chr4 (437018..441442) [4425 bp, 1474 aa] {ON} simil...   104   7e-22
KLLA0A02497g Chr1 (218592..219680) [1089 bp, 362 aa] {ON} highly...   100   8e-22
KNAG0G02300 Chr7 (528489..529748) [1260 bp, 419 aa] {ON} Anc_8.3...   101   8e-22
KAFR0B04630 Chr2 (964764..966302) [1539 bp, 512 aa] {ON} Anc_1.3...   102   8e-22
NCAS0C03380 Chr3 complement(664012..665310) [1299 bp, 432 aa] {O...   101   9e-22
ZYRO0D10252g Chr4 (860458..863109) [2652 bp, 883 aa] {ON} simila...   103   9e-22
CAGL0M09361g Chr13 complement(928484..931918) [3435 bp, 1144 aa]...   103   9e-22
Smik_4.79 Chr4 (149246..150796) [1551 bp, 516 aa] {ON} YDL159W (...   102   9e-22
YLR362W Chr12 (849866..852019) [2154 bp, 717 aa] {ON}  STE11Sign...   103   9e-22
KNAG0B05880 Chr2 (1155395..1157695) [2301 bp, 766 aa] {ON} Anc_4...   103   9e-22
Ecym_6145 Chr6 complement(266766..267863) [1098 bp, 365 aa] {ON}...   100   9e-22
TPHA0L01240 Chr12 (263357..264814) [1458 bp, 485 aa] {ON} Anc_8....   102   9e-22
TPHA0D03940 Chr4 (825250..826989) [1740 bp, 579 aa] {ON} Anc_3.4...   102   1e-21
Kwal_23.5290 s23 complement(1095011..1097470) [2460 bp, 819 aa] ...   103   1e-21
Skud_2.90 Chr2 (176138..177199) [1062 bp, 353 aa] {ON} YBL016W (...   100   1e-21
TPHA0C02880 Chr3 (623723..624778) [1056 bp, 351 aa] {ON} Anc_8.1...   100   1e-21
KAFR0C03020 Chr3 complement(601565..603121) [1557 bp, 518 aa] {O...   102   1e-21
NDAI0G02700 Chr7 complement(618268..619611) [1344 bp, 447 aa] {O...   101   1e-21
TPHA0P01270 Chr16 complement(254480..257137) [2658 bp, 885 aa] {...   103   1e-21
Kwal_26.7682 s26 complement(470565..472121) [1557 bp, 518 aa] {O...   102   1e-21
SAKL0C12386g Chr3 complement(1108341..1110923) [2583 bp, 860 aa]...   103   1e-21
YBL016W Chr2 (192451..193512) [1062 bp, 353 aa] {ON}  FUS3Mitoge...    99   1e-21
TPHA0G02990 Chr7 complement(640488..642098) [1611 bp, 536 aa] {O...   102   1e-21
Ecym_8004 Chr8 complement(5273..7957) [2685 bp, 894 aa] {ON} sim...   103   1e-21
ADR058C Chr4 complement(810939..811826) [888 bp, 295 aa] {ON} Sy...    98   1e-21
Smik_14.34 Chr14 (53272..55788) [2517 bp, 838 aa] {ON} YNL298W (...   103   1e-21
Smik_15.535 Chr15 complement(940569..942050) [1482 bp, 493 aa] {...   101   1e-21
NDAI0J01990 Chr10 (491491..493758) [2268 bp, 755 aa] {ON} Anc_4....   102   2e-21
NCAS0E01150 Chr5 complement(217594..219315) [1722 bp, 573 aa] {O...   102   2e-21
TDEL0G02620 Chr7 (501589..501613,501677..502566) [915 bp, 304 aa...    98   2e-21
TDEL0G00630 Chr7 complement(128151..129764) [1614 bp, 537 aa] {O...   101   2e-21
Smik_16.204 Chr16 complement(369272..370021) [750 bp, 249 aa] {O...    97   2e-21
Ecym_6425 Chr6 (825834..828095) [2262 bp, 753 aa] {ON} similar t...   102   2e-21
TBLA0H01660 Chr8 complement(377521..380511) [2991 bp, 996 aa] {O...   102   2e-21
Suva_14.42 Chr14 (65645..68239) [2595 bp, 864 aa] {ON} YNL298W (...   102   2e-21
CAGL0H10318g Chr8 complement(1006299..1007222) [924 bp, 307 aa] ...    98   2e-21
NCAS0A04440 Chr1 complement(895181..896935) [1755 bp, 584 aa] {O...   101   2e-21
Kwal_27.11803 s27 (952938..953678) [741 bp, 246 aa] {ON} YPL031C...    96   2e-21
NCAS0F02190 Chr6 complement(435844..437706) [1863 bp, 620 aa] {O...   101   2e-21
KLTH0B07106g Chr2 (571005..573260) [2256 bp, 751 aa] {ON} simila...   102   2e-21
KLLA0D08415g Chr4 (714473..716797) [2325 bp, 774 aa] {ON} simila...   102   2e-21
TDEL0A02720 Chr1 complement(491618..494365) [2748 bp, 915 aa] {O...   102   2e-21
SAKL0B11044g Chr2 complement(962142..962940,963019..963086,96315...   100   2e-21
Suva_4.87 Chr4 (160236..161810) [1575 bp, 524 aa] {ON} YDL159W (...   101   2e-21
Kwal_55.20189 s55 (288918..291356) [2439 bp, 812 aa] {ON} YHR082...   102   2e-21
KLTH0F16676g Chr6 complement(1351362..1353998) [2637 bp, 878 aa]...   102   2e-21
TPHA0B01010 Chr2 complement(229538..231634) [2097 bp, 698 aa] {O...   102   2e-21
KLTH0A01320g Chr1 (118671..121115) [2445 bp, 814 aa] {ON} simila...   102   2e-21
NCAS0A09960 Chr1 complement(1993554..1995926) [2373 bp, 790 aa] ...   102   2e-21
TPHA0N00370 Chr14 (68298..69650) [1353 bp, 450 aa] {ON} Anc_7.41...   100   2e-21
SAKL0E04950g Chr5 (401903..402994) [1092 bp, 363 aa] {ON} highly...    99   3e-21
KAFR0E01580 Chr5 (318991..320280) [1290 bp, 429 aa] {ON} Anc_5.2...   100   3e-21
NDAI0C05340 Chr3 (1236394..1237296) [903 bp, 300 aa] {ON}              97   3e-21
KAFR0A06790 Chr1 complement(1371892..1372806) [915 bp, 304 aa] {...    97   3e-21
Ecym_4647 Chr4 (1261859..1263511) [1653 bp, 550 aa] {ON} similar...   100   3e-21
KAFR0A03710 Chr1 (758918..760399) [1482 bp, 493 aa] {ON} Anc_8.6...   100   3e-21
Ecym_3371 Chr3 (706573..706597,706675..707570) [921 bp, 306 aa] ...    97   3e-21
Suva_6.26 Chr6 complement(42811..48072) [5262 bp, 1753 aa] {ON} ...   102   3e-21
YFL033C Chr6 complement(69115..74427) [5313 bp, 1770 aa] {ON}  R...   102   3e-21
Kpol_1033.63 s1033 complement(158652..160205) [1554 bp, 517 aa] ...   100   3e-21
Smik_10.65 Chr10 complement(104987..107545) [2559 bp, 852 aa] {O...   101   3e-21
Ecym_7414 Chr7 (848665..850440) [1776 bp, 591 aa] {ON} similar t...   100   3e-21
Ecym_1030 Chr1 (56043..57365) [1323 bp, 440 aa] {ON} similar to ...   100   4e-21
TDEL0B04490 Chr2 (792559..793629) [1071 bp, 356 aa] {ON} Anc_8.1...    98   4e-21
YNL298W Chr14 (68915..71443) [2529 bp, 842 aa] {ON}  CLA4Cdc42p-...   101   4e-21
Smik_11.60 Chr11 complement(116793..118970) [2178 bp, 725 aa] {O...   101   4e-21
Skud_1.72 Chr1 (141337..144261) [2925 bp, 974 aa] {ON} YAR019C (...   101   4e-21
CAGL0M03729g Chr13 complement(420316..422901) [2586 bp, 861 aa] ...   101   4e-21
Kpol_534.14 s534 (34465..34591,34724..35616) [1020 bp, 339 aa] {...    98   4e-21
Smik_6.46 Chr6 complement(84451..89733) [5283 bp, 1760 aa] {ON} ...   102   4e-21
CAGL0H07535g Chr8 (736241..737137) [897 bp, 298 aa] {ON} highly ...    97   5e-21
YDL159W Chr4 (172481..174028) [1548 bp, 515 aa] {ON}  STE7Signal...   100   5e-21
Skud_6.38 Chr6 complement(72416..77692) [5277 bp, 1758 aa] {ON} ...   102   5e-21
TPHA0A01630 Chr1 complement(328040..329347) [1308 bp, 435 aa] {O...    99   5e-21
TPHA0H01500 Chr8 complement(336652..339639) [2988 bp, 995 aa] {O...   101   5e-21
TBLA0A01630 Chr1 complement(385348..386386,386496..386512) [1056...    97   5e-21
Skud_14.40 Chr14 (62496..65006) [2511 bp, 836 aa] {ON} YNL298W (...   101   5e-21
YBR028C Chr2 complement(294425..296002) [1578 bp, 525 aa] {ON}  ...   100   6e-21
NCAS0A11530 Chr1 (2281835..2283223) [1389 bp, 462 aa] {ON} Anc_3...    99   6e-21
TBLA0A08430 Chr1 complement(2075682..2076773) [1092 bp, 363 aa] ...    97   6e-21
Ecym_5251 Chr5 (522785..525466) [2682 bp, 893 aa] {ON} similar t...   100   7e-21
SAKL0H11748g Chr8 complement(1002207..1003541) [1335 bp, 444 aa]...    99   8e-21
KLLA0E10539g Chr5 (929989..931104) [1116 bp, 371 aa] {ON} highly...    97   8e-21
ZYRO0G02816g Chr7 complement(213421..214980) [1560 bp, 519 aa] {...    99   8e-21
KLTH0D04356g Chr4 (405904..405987,406076..407401) [1410 bp, 469 ...    99   8e-21
KAFR0B02980 Chr2 (623470..624804) [1335 bp, 444 aa] {ON} Anc_8.3...    99   9e-21
SAKL0H19668g Chr8 (1736301..1737674) [1374 bp, 457 aa] {ON} high...    99   9e-21
Suva_11.65 Chr11 complement(134606..136120) [1515 bp, 504 aa] {O...    99   9e-21
Smik_2.146 Chr2 complement(275270..276850) [1581 bp, 526 aa] {ON...    99   9e-21
Kpol_1018.137 s1018 complement(366178..367914) [1737 bp, 578 aa]...    99   9e-21
Suva_16.439 Chr16 (755102..756796) [1695 bp, 564 aa] {ON} YPR111...    99   9e-21
Kwal_33.14434 s33 complement(672031..674310) [2280 bp, 759 aa] {...   100   1e-20
KNAG0K01710 Chr11 (360438..361931) [1494 bp, 497 aa] {ON} Anc_3....    99   1e-20
ZYRO0C12408g Chr3 (979857..981593) [1737 bp, 578 aa] {ON} highly...    99   1e-20
TDEL0D04560 Chr4 (835822..837885) [2064 bp, 687 aa] {ON} Anc_3.1...   100   1e-20
YOR351C Chr15 complement(995018..996511) [1494 bp, 497 aa] {ON} ...    99   1e-20
KNAG0A06390 Chr1 complement(974644..976254) [1611 bp, 536 aa] {O...    99   1e-20
CAGL0K01661g Chr11 complement(147781..149229) [1449 bp, 482 aa] ...    99   1e-20
Kwal_26.7552 s26 (416444..417829) [1386 bp, 461 aa] {ON} YKL139W...    98   1e-20
Kpol_1066.45 s1066 complement(76786..79428) [2643 bp, 880 aa] {O...   100   1e-20
ZYRO0F11418g Chr6 complement(936573..938117) [1545 bp, 514 aa] {...    99   1e-20
Ecym_2566 Chr2 (1105239..1106126) [888 bp, 295 aa] {ON} similar ...    96   1e-20
Smik_12.450 Chr12 (788896..791106) [2211 bp, 736 aa] {ON} YLR362...   100   1e-20
KLTH0E03652g Chr5 (330227..332671) [2445 bp, 814 aa] {ON} simila...   100   1e-20
KLTH0E16104g Chr5 complement(1425822..1427042) [1221 bp, 406 aa]...    97   1e-20
SAKL0H01364g Chr8 complement(143450..145141) [1692 bp, 563 aa] {...    99   1e-20
ADL283W Chr4 (205173..205197,205250..206145) [921 bp, 306 aa] {O...    96   1e-20
TDEL0F04290 Chr6 (801456..802739) [1284 bp, 427 aa] {ON} Anc_8.3...    97   1e-20
KNAG0F00170 Chr6 (13778..15409) [1632 bp, 543 aa] {ON} Anc_1.24 ...    99   1e-20
KLTH0F04730g Chr6 complement(417013..419133) [2121 bp, 706 aa] {...    99   2e-20
Skud_16.398 Chr16 (712145..713827) [1683 bp, 560 aa] {ON} YPR111...    99   2e-20
CAGL0B04147g Chr2 (402798..404498) [1701 bp, 566 aa] {ON} highly...    99   2e-20
TBLA0F00860 Chr6 (219628..222570) [2943 bp, 980 aa] {ON} Anc_3.1...   100   2e-20
TBLA0B00770 Chr2 complement(168444..170519) [2076 bp, 691 aa] {O...    99   2e-20
TDEL0A02010 Chr1 (365325..366782) [1458 bp, 485 aa] {ON} Anc_2.4...    98   2e-20
Ecym_3525 Chr3 (993328..995784) [2457 bp, 818 aa] {ON} similar t...    99   2e-20
YDL214C Chr4 complement(74446..76545) [2100 bp, 699 aa] {ON}  PR...    99   2e-20
KLTH0B09042g Chr2 (736520..738112) [1593 bp, 530 aa] {ON} simila...    98   2e-20
SAKL0F11110g Chr6 (868447..869832) [1386 bp, 461 aa] {ON} simila...    97   2e-20
Smik_6.338 Chr6 (535192..536727) [1536 bp, 511 aa] {ON} YPL140C ...    98   2e-20
KNAG0D04040 Chr4 (730581..731897) [1317 bp, 438 aa] {ON} Anc_4.1...    97   2e-20
Skud_11.67 Chr11 complement(135815..137341) [1527 bp, 508 aa] {O...    98   2e-20
NDAI0B03310 Chr2 complement(844616..845557) [942 bp, 313 aa] {ON...    95   2e-20
Skud_13.465 Chr13 (826172..827929) [1758 bp, 585 aa] {ON} YMR291...    98   2e-20
TBLA0B09590 Chr2 (2272405..2273328) [924 bp, 307 aa] {ON} Anc_2....    95   3e-20
Skud_7.350 Chr7 (580913..582022) [1110 bp, 369 aa] {ON} YGR052W ...    96   3e-20
TDEL0E00690 Chr5 (144269..146770) [2502 bp, 833 aa] {ON} Anc_3.6...    99   3e-20
ACR196C Chr3 complement(692321..693913) [1593 bp, 530 aa] {ON} S...    98   3e-20
YPR111W Chr16 (747306..749000) [1695 bp, 564 aa] {ON}  DBF20Ser/...    98   3e-20
NCAS0D00400 Chr4 complement(61545..63716) [2172 bp, 723 aa] {ON}...    99   3e-20
NCAS0B02350 Chr2 complement(394128..395018) [891 bp, 296 aa] {ON...    94   3e-20
ADR174C Chr4 complement(1008796..1010811) [2016 bp, 671 aa] {ON}...    98   3e-20
KAFR0E03030 Chr5 (606567..607457) [891 bp, 296 aa] {ON} Anc_8.51...    94   3e-20
ABR014W Chr2 (417708..420623) [2916 bp, 971 aa] {ON} Syntenic ho...    99   3e-20
Skud_16.141 Chr16 complement(259166..260707) [1542 bp, 513 aa] {...    97   3e-20
TDEL0A02330 Chr1 complement(420205..421662) [1458 bp, 485 aa] {O...    97   3e-20
TDEL0E02510 Chr5 (486415..489156) [2742 bp, 913 aa] {ON} Anc_5.3...    99   3e-20
Kwal_27.11919 s27 (1003201..1003827) [627 bp, 209 aa] {OFF} YBR1...    92   3e-20
Smik_16.354 Chr16 (625456..627150) [1695 bp, 564 aa] {ON} YPR111...    98   3e-20
Kwal_26.8703 s26 (905007..906341) [1335 bp, 444 aa] {ON} YOR231W...    97   3e-20
TPHA0O01620 Chr15 (321912..324359) [2448 bp, 815 aa] {ON} Anc_2....    99   4e-20
Smik_11.97 Chr11 (168854..170491) [1638 bp, 545 aa] {ON} YKL139W...    97   4e-20
Suva_4.411 Chr4 (729465..730361) [897 bp, 298 aa] {ON} YBR160W (...    94   4e-20
Kwal_27.10004 s27 complement(156153..158360) [2208 bp, 735 aa] {...    98   4e-20
Suva_7.334 Chr7 (568847..569956) [1110 bp, 369 aa] {ON} YGR052W ...    96   4e-20
Smik_6.178 Chr6 (291601..293322) [1722 bp, 573 aa] {ON} YGR092W ...    97   4e-20
Smik_2.300 Chr2 (546211..547107) [897 bp, 298 aa] {ON} YBR160W (...    94   4e-20
TDEL0F03120 Chr6 (570471..572192) [1722 bp, 573 aa] {ON} Anc_3.4...    97   4e-20
AFR724C Chr6 complement(1770338..1771660) [1323 bp, 440 aa] {ON}...    96   4e-20
YDL028C Chr4 complement(400997..403291) [2295 bp, 764 aa] {ON}  ...    98   4e-20
Suva_14.158 Chr14 complement(289281..291650) [2370 bp, 789 aa] {...    98   4e-20
Smik_4.207 Chr4 complement(381159..383456) [2298 bp, 765 aa] {ON...    98   4e-20
ZYRO0A07062g Chr1 (576600..576615,576675..577561) [903 bp, 300 a...    94   4e-20
Ecym_2357 Chr2 (700079..701914) [1836 bp, 611 aa] {ON} similar t...    97   5e-20
YBR160W Chr2 (560078..560974) [897 bp, 298 aa] {ON}  CDC28Cataly...    94   5e-20
YPL140C Chr16 complement(287514..289034) [1521 bp, 506 aa] {ON} ...    97   5e-20
NCAS0I02060 Chr9 (386630..388573) [1944 bp, 647 aa] {ON} Anc_3.1...    98   5e-20
AEL205W Chr5 (246871..249252) [2382 bp, 793 aa] {ON} Syntenic ho...    98   5e-20
Suva_7.375 Chr7 (643870..645591) [1722 bp, 573 aa] {ON} YGR092W ...    97   5e-20
NDAI0A06130 Chr1 complement(1391744..1394203) [2460 bp, 819 aa] ...    98   5e-20
KLLA0A07403g Chr1 (661261..663900) [2640 bp, 879 aa] {ON} simila...    98   5e-20
Skud_10.49 Chr10 complement(81651..84206) [2556 bp, 851 aa] {ON}...    98   6e-20
AER232C Chr5 complement(1066272..1067981) [1710 bp, 569 aa] {ON}...    97   6e-20
Skud_12.447 Chr12 (790003..792210) [2208 bp, 735 aa] {ON} YLR362...    97   6e-20
ZYRO0A02772g Chr1 complement(223226..224473) [1248 bp, 415 aa] {...    96   6e-20
TBLA0A01660 Chr1 complement(391368..392828) [1461 bp, 486 aa] {O...    96   6e-20
Suva_10.464 Chr10 (809505..811721) [2217 bp, 738 aa] {ON} YLR362...    97   6e-20
Suva_6.246 Chr6 (439815..442373) [2559 bp, 852 aa] {ON} YJL165C ...    97   7e-20
SAKL0E12958g Chr5 (1066434..1068653) [2220 bp, 739 aa] {ON} simi...    97   7e-20
YKL139W Chr11 (182958..184544) [1587 bp, 528 aa] {ON}  CTK1Catal...    96   7e-20
KAFR0B01510 Chr2 complement(284425..286092) [1668 bp, 555 aa] {O...    97   8e-20
TPHA0D01770 Chr4 (365255..370279) [5025 bp, 1674 aa] {ON} Anc_5....    98   8e-20
KNAG0A03060 Chr1 complement(375640..377142) [1503 bp, 500 aa] {O...    96   8e-20
Skud_11.88 Chr11 (169115..170659) [1545 bp, 514 aa] {ON} YKL139W...    96   8e-20
SAKL0B04488g Chr2 (395136..396242) [1107 bp, 368 aa] {ON} highly...    94   9e-20
SAKL0F06094g Chr6 (457709..459442) [1734 bp, 577 aa] {ON} unipro...    96   9e-20
KLLA0D14905g Chr4 (1256065..1257768) [1704 bp, 567 aa] {ON} simi...    96   9e-20
TBLA0F01550 Chr6 complement(385184..386716) [1533 bp, 510 aa] {O...    96   9e-20
TBLA0A08810 Chr1 (2161249..2162304) [1056 bp, 351 aa] {ON} Anc_8...    94   1e-19
YGR092W Chr7 (668189..669907) [1719 bp, 572 aa] {ON}  DBF2Ser/Th...    96   1e-19
Kpol_1045.46 s1045 complement(106567..108372) [1806 bp, 601 aa] ...    96   1e-19
Smik_1.79 Chr1 complement(149839..152763) [2925 bp, 974 aa] {ON}...    97   1e-19
KLTH0E11924g Chr5 (1059134..1060030) [897 bp, 298 aa] {ON} highl...    93   1e-19
Suva_11.86 Chr11 (169096..170685) [1590 bp, 529 aa] {ON} YKL139W...    96   1e-19
KLLA0A02717g Chr1 (245082..246380) [1299 bp, 432 aa] {ON} weakly...    95   1e-19
ZYRO0B04796g Chr2 (385611..387683) [2073 bp, 690 aa] {ON} simila...    97   1e-19
Skud_2.287 Chr2 (527443..528339) [897 bp, 298 aa] {ON} YBR160W (...    92   1e-19
KLLA0A06820g Chr1 complement(615686..618004) [2319 bp, 772 aa] {...    97   1e-19
KNAG0E03200 Chr5 complement(641437..646020) [4584 bp, 1527 aa] {...    97   1e-19
AER223C Chr5 complement(1044971..1047679) [2709 bp, 902 aa] {ON}...    97   1e-19
Kwal_YGOB_27.11919 s27 (1003201..1003830,1004866..1005135) [900 ...    92   1e-19
KLLA0C16577g Chr3 complement(1451181..1452695) [1515 bp, 504 aa]...    96   1e-19
YKL168C Chr11 complement(131288..133462) [2175 bp, 724 aa] {ON} ...    96   1e-19
KLLA0B09790g Chr2 complement(855327..856214) [888 bp, 295 aa] {O...    92   1e-19
KLTH0G06974g Chr7 (556626..558125) [1500 bp, 499 aa] {ON} highly...    96   1e-19
KAFR0G00460 Chr7 complement(128077..130023) [1947 bp, 648 aa] {O...    96   1e-19
CAGL0G05720g Chr7 complement(547617..549833) [2217 bp, 738 aa] {...    96   1e-19
ZYRO0A08448g Chr1 complement(677122..678225) [1104 bp, 367 aa] {...    94   1e-19
TPHA0F03520 Chr6 (755480..757756) [2277 bp, 758 aa] {ON} Anc_1.5...    96   1e-19
NDAI0E01690 Chr5 (335849..337051) [1203 bp, 400 aa] {ON} Anc_2.391     94   2e-19
KLTH0F09504g Chr6 (824743..824770,824831..825729) [927 bp, 308 a...    92   2e-19
TDEL0B01590 Chr2 complement(280143..281573) [1431 bp, 476 aa] {O...    95   2e-19
ZYRO0F12122g Chr6 complement(984069..985910) [1842 bp, 613 aa] {...    96   2e-19
TDEL0A05980 Chr1 (1049221..1050771) [1551 bp, 516 aa] {ON} Anc_8...    95   2e-19
Smik_13.338 Chr13 (528578..529690) [1113 bp, 370 aa] {ON} YMR139...    94   2e-19
YAR019C Chr1 complement(172211..175135) [2925 bp, 974 aa] {ON}  ...    97   2e-19
ZYRO0A12826g Chr1 (1014651..1015751) [1101 bp, 366 aa] {ON} high...    93   2e-19
YJL165C Chr10 complement(106894..109461) [2568 bp, 855 aa] {ON} ...    96   2e-19
TBLA0C02310 Chr3 complement(546887..548596) [1710 bp, 569 aa] {O...    96   2e-19
Skud_8.143 Chr8 complement(242422..245535) [3114 bp, 1037 aa] {O...    96   2e-19
NDAI0E01310 Chr5 complement(260484..262094) [1611 bp, 536 aa] {O...    95   2e-19
Skud_15.397 Chr15 (711559..713082) [1524 bp, 507 aa] {ON} YOR231...    95   2e-19
SAKL0D06666g Chr4 (551260..552522) [1263 bp, 420 aa] {ON} some s...    94   2e-19
KNAG0K02370 Chr11 complement(475088..477739) [2652 bp, 883 aa] {...    96   2e-19
Skud_11.56 Chr11 complement(117617..119776) [2160 bp, 719 aa] {O...    96   2e-19
NDAI0A00940 Chr1 complement(193710..195800) [2091 bp, 696 aa] {O...    96   2e-19
KNAG0B01130 Chr2 complement(208528..210279) [1752 bp, 583 aa] {O...    95   2e-19
KLLA0B11902g Chr2 (1041657..1043144) [1488 bp, 495 aa] {ON} unip...    94   3e-19
NCAS0C01580 Chr3 (291554..292873) [1320 bp, 439 aa] {ON} Anc_8.652     94   3e-19
Kwal_YGOB_23.3471 s23 (305207..305234,305298..306196) [927 bp, 3...    92   3e-19
Kwal_27.9773 s27 (57252..58472) [1221 bp, 406 aa] {ON} YAR018C (...    93   3e-19
Ecym_6044 Chr6 complement(84500..85756) [1257 bp, 418 aa] {ON} s...    94   3e-19
SAKL0E04092g Chr5 complement(326532..327901,327970..327982) [138...    94   3e-19
TBLA0G03450 Chr7 (913497..919415) [5919 bp, 1972 aa] {ON} Anc_8....    96   3e-19
Ecym_6056 Chr6 complement(107449..108888) [1440 bp, 479 aa] {ON}...    94   3e-19
NDAI0C01850 Chr3 (407978..411712) [3735 bp, 1244 aa] {ON}              96   3e-19
Kwal_23.3992 s23 complement(515493..517208) [1716 bp, 571 aa] {O...    94   4e-19
Kwal_27.11777 s27 (942591..943985) [1395 bp, 464 aa] {ON} YPL026...    94   4e-19
Suva_16.170 Chr16 complement(296877..298406) [1530 bp, 509 aa] {...    94   4e-19
CAGL0C02893g Chr3 complement(286017..287966) [1950 bp, 649 aa] {...    95   4e-19
Kpol_1018.148 s1018 (393064..394413) [1350 bp, 449 aa] {ON} (393...    94   4e-19
Smik_13.507 Chr13 (835298..837058) [1761 bp, 586 aa] {ON} YMR291...    94   4e-19
NDAI0A06620 Chr1 complement(1510218..1512461) [2244 bp, 747 aa] ...    95   4e-19
ADR253W Chr4 (1141941..1143083) [1143 bp, 380 aa] {ON} Syntenic ...    92   4e-19
KLTH0C02662g Chr3 complement(240347..242674) [2328 bp, 775 aa] {...    95   4e-19
SAKL0C00946g Chr3 (84995..86689) [1695 bp, 564 aa] {ON} similar ...    94   4e-19
CAGL0K04169g Chr11 (384567..385763) [1197 bp, 398 aa] {ON} simil...    93   4e-19
SAKL0H10758g Chr8 complement(930403..931302) [900 bp, 299 aa] {O...    91   4e-19
KLLA0F01408g Chr6 (135424..136302) [879 bp, 292 aa] {ON} conserv...    91   4e-19
Smik_4.494 Chr4 (900954..902321) [1368 bp, 455 aa] {ON} YDR247W ...    93   4e-19
KLTH0G06468g Chr7 complement(513119..518251) [5133 bp, 1710 aa] ...    96   4e-19
Kpol_513.7 s513 (14160..15050) [891 bp, 296 aa] {ON} (14160..150...    91   5e-19
Smik_15.415 Chr15 (722292..723815) [1524 bp, 507 aa] {ON} YOR231...    94   5e-19
KNAG0A03900 Chr1 complement(520500..521390) [891 bp, 296 aa] {ON...    91   5e-19
Ecym_1508 Chr1 (1045857..1050941) [5085 bp, 1694 aa] {ON} simila...    95   5e-19
Ecym_4448 Chr4 complement(917136..918872) [1737 bp, 578 aa] {ON}...    94   5e-19
TBLA0B03990 Chr2 complement(910314..912455) [2142 bp, 713 aa] {O...    94   5e-19
ZYRO0B04906g Chr2 (395546..398089) [2544 bp, 847 aa] {ON} simila...    95   6e-19
KLLA0E12145g Chr5 (1080245..1081612) [1368 bp, 455 aa] {ON} simi...    93   6e-19
CAGL0L06820g Chr12 (769035..770135) [1101 bp, 366 aa] {ON} highl...    92   6e-19
Kpol_1044.26 s1044 complement(60216..62666) [2451 bp, 816 aa] {O...    94   6e-19
SAKL0H07128g Chr8 complement(623681..625141) [1461 bp, 486 aa] {...    93   6e-19
YOR231W Chr15 (772601..774127) [1527 bp, 508 aa] {ON}  MKK1Mitog...    93   6e-19
Suva_8.282 Chr8 (511665..513185) [1521 bp, 506 aa] {ON} YOR231W ...    93   6e-19
Kpol_499.3 s499 complement(6075..7199) [1125 bp, 374 aa] {ON} co...    92   6e-19
KAFR0F00380 Chr6 complement(91358..92800) [1443 bp, 480 aa] {ON}...    93   6e-19
TBLA0B09740 Chr2 (2312062..2314815) [2754 bp, 917 aa] {ON} Anc_2...    94   6e-19
Skud_7.391 Chr7 (652479..654200) [1722 bp, 573 aa] {ON} YGR092W ...    94   6e-19
ZYRO0D07502g Chr4 complement(652782..654320) [1539 bp, 512 aa] {...    93   7e-19
Kpol_2001.30 s2001 (87817..90093) [2277 bp, 758 aa] {ON} (87817....    94   7e-19
Suva_4.138 Chr4 (256421..257197) [777 bp, 258 aa] {ON} YDL108W (...    89   7e-19
Suva_4.221 Chr4 complement(391492..393789) [2298 bp, 765 aa] {ON...    94   7e-19
KLLA0C07535g Chr3 (658746..660620) [1875 bp, 624 aa] {ON} some s...    94   7e-19
KLTH0F12012g Chr6 complement(1013169..1014881) [1713 bp, 570 aa]...    94   7e-19
KNAG0C01020 Chr3 (200271..202595) [2325 bp, 774 aa] {ON} Anc_1.1...    94   8e-19
NDAI0E03760 Chr5 (817014..818765) [1752 bp, 583 aa] {ON} Anc_7.41      94   8e-19
Suva_15.275 Chr15 complement(470782..473862) [3081 bp, 1026 aa] ...    94   8e-19
TDEL0B01250 Chr2 complement(228145..229038) [894 bp, 297 aa] {ON...    90   8e-19
NCAS0I02080 Chr9 (390551..392875) [2325 bp, 774 aa] {ON} Anc_3.162     94   8e-19
SAKL0G10978g Chr7 (929164..930729) [1566 bp, 521 aa] {ON} highly...    93   9e-19
KLLA0F23507g Chr6 complement(2198603..2200066) [1464 bp, 487 aa]...    93   9e-19
SAKL0C05280g Chr3 complement(502205..504490) [2286 bp, 761 aa] {...    94   9e-19
NCAS0B01450 Chr2 (237824..239341) [1518 bp, 505 aa] {ON} Anc_8.652     93   9e-19
KNAG0C02430 Chr3 complement(472213..474804) [2592 bp, 863 aa] {O...    94   9e-19
YMR291W Chr13 (852630..854390) [1761 bp, 586 aa] {ON}  TDA1Prote...    93   9e-19
Ecym_5252 Chr5 (525687..526976) [1290 bp, 429 aa] {ON} similar t...    92   1e-18
NDAI0G01280 Chr7 complement(281834..283573) [1740 bp, 579 aa] {O...    93   1e-18
KLTH0D10670g Chr4 (877472..878806) [1335 bp, 444 aa] {ON} some s...    92   1e-18
TPHA0G02090 Chr7 complement(429178..430527) [1350 bp, 449 aa] {O...    92   1e-18
YHR082C Chr8 complement(268459..271548) [3090 bp, 1029 aa] {ON} ...    94   1e-18
TDEL0D02650 Chr4 complement(505536..506636) [1101 bp, 366 aa] {O...    91   1e-18
CAGL0I06248g Chr9 (600351..602792) [2442 bp, 813 aa] {ON} simila...    94   1e-18
KAFR0F03900 Chr6 (763094..764203) [1110 bp, 369 aa] {ON} Anc_4.1...    91   1e-18
TPHA0G01450 Chr7 (297855..299861) [2007 bp, 668 aa] {ON}               93   1e-18
Suva_8.316 Chr8 complement(561812..563914) [2103 bp, 700 aa] {ON...    93   1e-18
Suva_11.54 Chr11 complement(116221..118401) [2181 bp, 726 aa] {O...    93   1e-18
Kpol_1072.31 s1072 complement(67104..68684) [1581 bp, 526 aa] {O...    92   1e-18
TPHA0A02770 Chr1 complement(597703..600129) [2427 bp, 808 aa] {O...    94   1e-18
KAFR0A07560 Chr1 (1525225..1527504) [2280 bp, 759 aa] {ON} Anc_2...    93   1e-18
TDEL0C03740 Chr3 (658468..660702) [2235 bp, 744 aa] {ON} Anc_1.1...    93   1e-18
CAGL0H01199g Chr8 (110610..115556) [4947 bp, 1648 aa] {ON} highl...    94   1e-18
CAGL0J11308g Chr10 (1099969..1102155) [2187 bp, 728 aa] {ON} sim...    93   1e-18
Kwal_23.5576 s23 complement(1223517..1225031) [1515 bp, 504 aa] ...    92   1e-18
TBLA0H03440 Chr8 (840759..841643) [885 bp, 294 aa] {ON} Anc_8.51...    89   1e-18
KAFR0K01540 Chr11 (320997..322706) [1710 bp, 569 aa] {ON} Anc_3....    92   1e-18
CAGL0K11275g Chr11 (1094626..1096203) [1578 bp, 525 aa] {ON} sim...    92   2e-18
CAGL0K12562g Chr11 (1235695..1240743) [5049 bp, 1682 aa] {ON} si...    94   2e-18
SAKL0E06534g Chr5 complement(533369..534267,534334..534358) [924...    89   2e-18
ADR033W Chr4 (764716..766449) [1734 bp, 577 aa] {ON} Syntenic ho...    92   2e-18
SAKL0H05588g Chr8 (502752..504602) [1851 bp, 616 aa] {ON} simila...    92   2e-18
ZYRO0F03014g Chr6 complement(255189..260003) [4815 bp, 1604 aa] ...    94   2e-18
ZYRO0G20306g Chr7 complement(1675578..1677227) [1650 bp, 549 aa]...    92   2e-18
TBLA0C03140 Chr3 (759258..760763) [1506 bp, 501 aa] {ON} Anc_5.2...    92   2e-18
NCAS0A04220 Chr1 (855791..857353) [1563 bp, 520 aa] {ON} Anc_2.425     92   2e-18
YOR267C Chr15 complement(822588..824867) [2280 bp, 759 aa] {ON} ...    93   2e-18
Suva_13.319 Chr13 (525309..526421) [1113 bp, 370 aa] {ON} YMR139...    90   2e-18
KNAG0B04460 Chr2 (856495..859461) [2967 bp, 988 aa] {ON} Anc_5.3...    93   2e-18
TBLA0B03590 Chr2 (834488..837022) [2535 bp, 844 aa] {ON} Anc_8.7...    93   2e-18
NDAI0H00610 Chr8 complement(141913..143022) [1110 bp, 369 aa] {O...    90   2e-18
Smik_8.160 Chr8 complement(245207..248323) [3117 bp, 1038 aa] {O...    93   2e-18
ACR218W Chr3 (731433..736142) [4710 bp, 1569 aa] {ON} Syntenic h...    93   2e-18
Suva_13.481 Chr13 (834531..836279) [1749 bp, 582 aa] {ON} YMR291...    92   2e-18
Smik_15.449 Chr15 complement(772245..774437) [2193 bp, 730 aa] {...    92   3e-18
KAFR0F02710 Chr6 (528336..529493) [1158 bp, 385 aa] {ON} Anc_2.3...    90   3e-18
KAFR0D04800 Chr4 complement(942369..944690) [2322 bp, 773 aa] {O...    92   3e-18
Suva_4.33 Chr4 complement(63334..65427) [2094 bp, 697 aa] {ON} Y...    92   3e-18
TPHA0L01470 Chr12 (303604..304497) [894 bp, 297 aa] {ON} Anc_8.5...    89   3e-18
KNAG0G02780 Chr7 complement(615058..617202) [2145 bp, 714 aa] {O...    92   3e-18
KAFR0I01570 Chr9 (330982..332574) [1593 bp, 530 aa] {ON} Anc_2.5...    91   3e-18
Skud_4.223 Chr4 complement(395836..398145) [2310 bp, 769 aa] {ON...    92   3e-18
KAFR0B03170 Chr2 complement(656163..658025) [1863 bp, 620 aa] {O...    92   3e-18
ZYRO0F08778g Chr6 (702733..703626) [894 bp, 297 aa] {ON} highly ...    88   3e-18
KNAG0A02350 Chr1 complement(223757..225022) [1266 bp, 421 aa] {O...    90   3e-18
NDAI0D04050 Chr4 (952438..953538) [1101 bp, 366 aa] {ON} Anc_4.184     89   3e-18
TDEL0G03220 Chr7 complement(600259..601350) [1092 bp, 363 aa] {O...    89   3e-18
Smik_8.97 Chr8 complement(148421..149857) [1437 bp, 478 aa] {ON}...    91   3e-18
Kpol_365.3 s365 complement(2204..4177,4180..4206,4209..4874) [26...    92   3e-18
Kwal_47.17868 s47 (587449..588546) [1098 bp, 365 aa] {ON} YMR139...    89   3e-18
Suva_16.291 Chr16 complement(504006..505433) [1428 bp, 475 aa] {...    91   3e-18
YMR139W Chr13 (546125..547237) [1113 bp, 370 aa] {ON}  RIM11Prot...    89   4e-18
TBLA0A07460 Chr1 (1848207..1849757) [1551 bp, 516 aa] {ON} Anc_1...    91   4e-18
KLTH0E09658g Chr5 (869857..870957) [1101 bp, 366 aa] {ON} highly...    89   4e-18
TBLA0H01820 Chr8 (429920..433417) [3498 bp, 1165 aa] {ON} Anc_5....    92   4e-18
Kwal_23.3471 s23 (305414..306196) [783 bp, 260 aa] {OFF} YDL108W...    87   4e-18
AAL083W Chr1 (196774..201870) [5097 bp, 1698 aa] {ON} Syntenic h...    92   4e-18
NCAS0C01110 Chr3 (207664..209664) [2001 bp, 666 aa] {ON} Anc_8.716     91   4e-18
NDAI0K01150 Chr11 complement(264377..266527) [2151 bp, 716 aa] {...    92   4e-18
KNAG0A05920 Chr1 complement(883522..884742) [1221 bp, 406 aa] {O...    90   4e-18
Skud_15.432 Chr15 complement(761490..763601) [2112 bp, 703 aa] {...    92   4e-18
SAKL0B01210g Chr2 complement(109892..114658) [4767 bp, 1588 aa] ...    92   4e-18
SAKL0C07458g Chr3 complement(687452..689395) [1944 bp, 647 aa] {...    91   4e-18
AER222C Chr5 complement(1043479..1044750) [1272 bp, 423 aa] {ON}...    90   5e-18
CAGL0G03047g Chr7 (282299..283918) [1620 bp, 539 aa] {ON} highly...    91   5e-18
TDEL0D04450 Chr4 complement(811665..812924) [1260 bp, 419 aa] {O...    90   5e-18
ADR313W Chr4 (1255930..1257666) [1737 bp, 578 aa] {ON} Syntenic ...    91   6e-18
NCAS0A00280 Chr1 (40406..42013) [1608 bp, 535 aa] {ON} Anc_1.24        91   6e-18
YOL113W Chr15 (104326..106293) [1968 bp, 655 aa] {ON}  SKM1Membe...    91   6e-18
Skud_8.86 Chr8 complement(149508..150953) [1446 bp, 481 aa] {ON}...    90   6e-18
NDAI0A06630 Chr1 complement(1514165..1515943) [1779 bp, 592 aa] ...    91   6e-18
Kwal_33.14167 s33 (554863..557379) [2517 bp, 838 aa] {ON} YDL028...    91   6e-18
CAGL0J00539g Chr10 (47095..48561) [1467 bp, 488 aa] {ON} highly ...    90   6e-18
NCAS0A04010 Chr1 complement(809163..810299) [1137 bp, 378 aa] {O...    89   7e-18
KAFR0F02220 Chr6 (432967..435210) [2244 bp, 747 aa] {ON} Anc_3.1...    91   7e-18
Kwal_33.14192 s33 complement(563582..565315) [1734 bp, 577 aa] {...    91   7e-18
NCAS0B02530 Chr2 complement(422882..424207) [1326 bp, 441 aa] {O...    89   7e-18
Kpol_1037.7 s1037 (15938..17182) [1245 bp, 414 aa] {ON} (15938.....    89   7e-18
YHR030C Chr8 complement(168890..170344) [1455 bp, 484 aa] {ON}  ...    90   7e-18
KAFR0C03520 Chr3 (715667..720019) [4353 bp, 1450 aa] {ON} Anc_8....    91   8e-18
AEL118C Chr5 complement(399738..401789) [2052 bp, 683 aa] {ON} S...    91   8e-18
NCAS0I02850 Chr9 (529637..532042) [2406 bp, 801 aa] {ON} Anc_1.180     91   8e-18
TBLA0C06820 Chr3 (1645811..1647508) [1698 bp, 565 aa] {ON} Anc_5...    90   8e-18
ZYRO0F06798g Chr6 (558198..559676) [1479 bp, 492 aa] {ON} simila...    90   8e-18
Suva_7.325 Chr7 (550760..551866) [1107 bp, 368 aa] {ON} YGR040W ...    88   9e-18
Suva_15.216 Chr15 complement(376197..377624) [1428 bp, 475 aa] {...    89   9e-18
Kpol_1055.25 s1055 complement(62930..67933) [5004 bp, 1667 aa] {...    91   9e-18
Skud_13.300 Chr13 (519521..520633) [1113 bp, 370 aa] {ON} YMR139...    88   9e-18
Suva_15.46 Chr15 (81948..83909) [1962 bp, 653 aa] {ON} YOL113W (...    90   9e-18
Ecym_1313 Chr1 complement(633556..634455) [900 bp, 299 aa] {ON} ...    87   1e-17
Skud_7.337 Chr7 (562750..563856) [1107 bp, 368 aa] {ON} YGR040W ...    88   1e-17
Smik_4.157 Chr4 complement(289446..290605,290830..291250) [1581 ...    90   1e-17
YKL048C Chr11 complement(347214..349136) [1923 bp, 640 aa] {ON} ...    90   1e-17
TPHA0B02440 Chr2 (560189..561592) [1404 bp, 467 aa] {ON} Anc_5.2...    89   1e-17
TPHA0J00630 Chr10 (139476..140600) [1125 bp, 374 aa] {ON} Anc_4....    88   1e-17
CAGL0H09152g Chr8 complement(895722..898055) [2334 bp, 777 aa] {...    90   1e-17
TDEL0E03520 Chr5 (657779..659251) [1473 bp, 490 aa] {ON} Anc_5.2...    89   1e-17
Kwal_23.5668 s23 (1263868..1268937) [5070 bp, 1689 aa] {ON} YDR2...    91   1e-17
YDL079C Chr4 complement(312951..314044,314337..314748) [1506 bp,...    89   1e-17
Kpol_185.2 s185 complement(1614..3704) [2091 bp, 696 aa] {ON} co...    90   1e-17
CAGL0F03311g Chr6 complement(327599..330736) [3138 bp, 1045 aa] ...    91   1e-17
TPHA0D00360 Chr4 complement(55596..60206) [4611 bp, 1536 aa] {ON...    91   1e-17
Smik_15.39 Chr15 (72332..74314) [1983 bp, 660 aa] {ON} YOL113W (...    90   1e-17
SAKL0D12628g Chr4 (1048973..1051429) [2457 bp, 818 aa] {ON} weak...    90   1e-17
KAFR0A04070 Chr1 complement(817388..819325) [1938 bp, 645 aa] {O...    90   1e-17
KLTH0E11110g Chr5 (997486..998847) [1362 bp, 453 aa] {ON} simila...    89   1e-17
Skud_4.39 Chr4 complement(70857..72947) [2091 bp, 696 aa] {ON} Y...    90   2e-17
NDAI0B00220 Chr2 (29825..32470) [2646 bp, 881 aa] {ON} Anc_1.180       90   2e-17
SAKL0B11308g Chr2 complement(984543..986369) [1827 bp, 608 aa] {...    89   2e-17
TDEL0A06610 Chr1 complement(1151052..1152824) [1773 bp, 590 aa] ...    89   2e-17
TDEL0D04600 Chr4 (843530..845917) [2388 bp, 795 aa] {ON} Anc_3.1...    90   2e-17
YDR283C Chr4 complement(1025070..1030049) [4980 bp, 1659 aa] {ON...    90   2e-17
KLTH0D08712g Chr4 complement(728072..729886) [1815 bp, 604 aa] {...    89   2e-17
KAFR0E01490 Chr5 (298209..303167) [4959 bp, 1652 aa] {ON} Anc_5....    90   2e-17
KNAG0K01250 Chr11 (246241..247467) [1227 bp, 408 aa] {ON} Anc_3....    88   2e-17
TDEL0C00590 Chr3 complement(94223..99031) [4809 bp, 1602 aa] {ON...    90   2e-17
NCAS0H01780 Chr8 complement(341549..344773) [3225 bp, 1074 aa] {...    90   2e-17
Kwal_33.13831 s33 complement(413256..415358) [2103 bp, 700 aa] {...    89   2e-17
NDAI0F03390 Chr6 (816047..818380) [2334 bp, 777 aa] {ON}               89   2e-17
KAFR0D04500 Chr4 (887515..889989) [2475 bp, 824 aa] {ON} Anc_1.5...    89   2e-17
NDAI0A04760 Chr1 complement(1088637..1090103) [1467 bp, 488 aa] ...    88   2e-17
Smik_4.803 Chr4 complement(1408345..1409817) [1473 bp, 490 aa] {...    88   2e-17
KLLA0D07304g Chr4 (623352..624749) [1398 bp, 465 aa] {ON} some s...    88   2e-17
Kpol_1072.1 s1072 (686..2683) [1998 bp, 665 aa] {ON} (686..2683)...    89   2e-17
TBLA0D02070 Chr4 complement(522456..523958) [1503 bp, 500 aa] {O...    88   2e-17
CAGL0M13541g Chr13 (1333846..1335714) [1869 bp, 622 aa] {ON} sim...    89   2e-17
NDAI0C04000 Chr3 (907842..912812) [4971 bp, 1656 aa] {ON} Anc_5....    90   2e-17
ADR163W Chr4 (989728..991008) [1281 bp, 426 aa] {ON} Syntenic ho...    88   2e-17
KAFR0B00920 Chr2 (170792..172300) [1509 bp, 502 aa] {ON} Anc_7.3...    88   3e-17
KLTH0G18612g Chr7 (1604066..1608640) [4575 bp, 1524 aa] {ON} sim...    90   3e-17
NDAI0C03610 Chr3 (829317..831476) [2160 bp, 719 aa] {ON} Anc_5.38      89   3e-17
KLTH0F06578g Chr6 complement(568519..570309) [1791 bp, 596 aa] {...    89   3e-17
SAKL0C12870g Chr3 (1145051..1146142) [1092 bp, 363 aa] {ON} high...    87   3e-17
KAFR0C00920 Chr3 complement(185475..186674) [1200 bp, 399 aa] {O...    87   3e-17
KAFR0E01810 Chr5 complement(372094..373524) [1431 bp, 476 aa] {O...    88   3e-17
Kpol_1041.29 s1041 (73725..74876) [1152 bp, 383 aa] {ON} (73725....    87   3e-17
Kpol_529.18 s529 (52782..55118) [2337 bp, 778 aa] {ON} (52782..5...    89   3e-17
Skud_16.256 Chr16 complement(465728..467362) [1635 bp, 544 aa] {...    88   3e-17
YGR040W Chr7 (575398..576504) [1107 bp, 368 aa] {ON}  KSS1Mitoge...    87   3e-17
NCAS0F02520 Chr6 (495799..500631) [4833 bp, 1610 aa] {ON} Anc_5....    89   3e-17
NDAI0F04520 Chr6 complement(1098426..1099895) [1470 bp, 489 aa] ...    88   3e-17
YDR247W Chr4 (956013..957398) [1386 bp, 461 aa] {ON}  VHS1Cytopl...    87   3e-17
TDEL0B06900 Chr2 complement(1220590..1222257) [1668 bp, 555 aa] ...    88   3e-17
Suva_2.449 Chr2 complement(789612..794603) [4992 bp, 1663 aa] {O...    89   4e-17
KLLA0C03938g Chr3 complement(358851..360632) [1782 bp, 593 aa] {...    88   4e-17
Suva_2.703 Chr2 complement(1238496..1239953) [1458 bp, 485 aa] {...    87   4e-17
Smik_4.532 Chr4 complement(956572..961554) [4983 bp, 1660 aa] {O...    89   4e-17
KLTH0F06468g Chr6 (559256..561769) [2514 bp, 837 aa] {ON} simila...    89   4e-17
SAKL0C07348g Chr3 (677348..679933) [2586 bp, 861 aa] {ON} some s...    89   4e-17
NDAI0A01970 Chr1 (440268..442184) [1917 bp, 638 aa] {ON} Anc_7.335     88   4e-17
Ecym_8098 Chr8 (210698..212857) [2160 bp, 719 aa] {ON} similar t...    89   4e-17
NCAS0B00420 Chr2 complement(54562..56718) [2157 bp, 718 aa] {ON}...    88   4e-17
NDAI0C03900 Chr3 complement(883841..885310) [1470 bp, 489 aa] {O...    87   4e-17
YDR523C Chr4 complement(1485566..1487038) [1473 bp, 490 aa] {ON}...    87   4e-17
CAGL0J03828g Chr10 (365325..366728) [1404 bp, 467 aa] {ON} simil...    87   4e-17
Kwal_55.21709 s55 (948619..949641) [1023 bp, 340 aa] {ON} YOR061...    86   4e-17
Suva_11.178 Chr11 complement(330253..332184) [1932 bp, 643 aa] {...    88   5e-17
TDEL0C06780 Chr3 complement(1236767..1238173) [1407 bp, 468 aa] ...    87   5e-17
CAGL0K01617g Chr11 complement(143308..145632) [2325 bp, 774 aa] ...    88   5e-17
NDAI0D01620 Chr4 (386654..388132) [1479 bp, 492 aa] {ON} Anc_5.274     87   5e-17
Smik_14.147 Chr14 complement(272373..274742) [2370 bp, 789 aa] {...    88   5e-17
YNL183C Chr14 complement(293137..295509) [2373 bp, 790 aa] {ON} ...    88   5e-17
KLTH0D12166g Chr4 complement(987310..989061) [1752 bp, 583 aa] {...    88   5e-17
Ecym_7361 Chr7 complement(753862..755313) [1452 bp, 483 aa] {ON}...    87   5e-17
ZYRO0G18546g Chr7 (1530693..1533050) [2358 bp, 785 aa] {ON} simi...    88   5e-17
NCAS0A02120 Chr1 (401097..402230) [1134 bp, 377 aa] {ON} Anc_4.184     86   5e-17
ZYRO0G16082g Chr7 complement(1320266..1321714) [1449 bp, 482 aa]...    87   5e-17
Klac_YGOB_Anc_8.34 Chr6 (836287..839007,839010..841004) [4716 bp...    89   5e-17
TPHA0H00750 Chr8 complement(150811..152043) [1233 bp, 410 aa] {O...    86   5e-17
Kpol_489.20 s489 complement(59150..60178) [1029 bp, 342 aa] {ON}...    85   6e-17
Kwal_55.22001 s55 (1069907..1070998) [1092 bp, 363 aa] {ON} YNL3...    86   6e-17
Skud_4.797 Chr4 complement(1405618..1407075) [1458 bp, 485 aa] {...    87   6e-17
Kwal_14.1159 s14 complement(219896..224461) [4566 bp, 1521 aa] {...    89   6e-17
NCAS0A06680 Chr1 (1320265..1321704) [1440 bp, 479 aa] {ON} Anc_5...    87   6e-17
Smik_16.209 Chr16 complement(377965..379425) [1461 bp, 486 aa] {...    87   6e-17
Smik_6.125 Chr6 (201071..202177) [1107 bp, 368 aa] {ON} YGR040W ...    86   6e-17
Kwal_26.8347 s26 complement(748254..750032) [1779 bp, 592 aa] {O...    87   6e-17
KNAG0K01740 Chr11 (364195..366492) [2298 bp, 765 aa] {ON} Anc_3....    88   6e-17
TDEL0E03300 Chr5 complement(621448..626409) [4962 bp, 1653 aa] {...    89   7e-17
ADR317C Chr4 complement(1263080..1265539) [2460 bp, 819 aa] {ON}...    88   7e-17
YPL026C Chr16 complement(500675..502183) [1509 bp, 502 aa] {ON} ...    87   7e-17
KNAG0D03980 Chr4 (721049..722170) [1122 bp, 373 aa] {ON} Anc_4.1...    86   7e-17
TPHA0M00300 Chr13 (59377..61701) [2325 bp, 774 aa] {ON} Anc_3.16...    88   7e-17
Kpol_1035.40 s1035 (101912..102910,102960..102968,103011..106556...    88   7e-17
CAGL0M10829g Chr13 complement(1076233..1081236) [5004 bp, 1667 a...    88   8e-17
Suva_1.86 Chr1 complement(150761..153685) [2925 bp, 974 aa] {ON}...    88   8e-17
Smik_11.200 Chr11 complement(333676..335592) [1917 bp, 638 aa] {...    87   8e-17
Skud_15.228 Chr15 (403382..404401) [1020 bp, 339 aa] {ON} YOR061...    85   8e-17
CAGL0J04972g Chr10 (475587..476606) [1020 bp, 339 aa] {ON} some ...    85   9e-17
KAFR0H01570 Chr8 complement(290698..291897) [1200 bp, 399 aa] {O...    86   9e-17
KLLA0C10802g Chr3 complement(926916..931934) [5019 bp, 1672 aa] ...    88   9e-17
Ecym_8337 Chr8 (679844..681460) [1617 bp, 538 aa] {ON} similar t...    87   1e-16
Skud_14.151 Chr14 complement(284115..286490) [2376 bp, 791 aa] {...    87   1e-16
NCAS0C03770 Chr3 complement(761101..765897) [4797 bp, 1598 aa] {...    87   1e-16
CAGL0D02002g Chr4 (207419..209080) [1662 bp, 553 aa] {ON} simila...    86   1e-16
KLLA0C03828g Chr3 (349187..351568) [2382 bp, 793 aa] {ON} simila...    87   1e-16
KAFR0D02900 Chr4 (575853..577313) [1461 bp, 486 aa] {ON} Anc_7.5...    86   1e-16
Skud_4.546 Chr4 complement(967636..972618) [4983 bp, 1660 aa] {O...    87   1e-16
ABL143C Chr2 complement(128215..130392) [2178 bp, 725 aa] {ON} S...    87   1e-16
TPHA0G00730 Chr7 (139442..141364) [1923 bp, 640 aa] {ON} Anc_8.7...    86   2e-16
YOR061W Chr15 (441534..442553) [1020 bp, 339 aa] {ON}  CKA2Alpha...    84   2e-16
Kpol_2002.24 s2002 (48405..49868) [1464 bp, 487 aa] {ON} (48405....    86   2e-16
NCAS0A09750 Chr1 (1940202..1942370) [2169 bp, 722 aa] {ON}             87   2e-16
KLTH0F18942g Chr6 (1535941..1537032) [1092 bp, 363 aa] {ON} high...    84   2e-16
Ecym_5236 Chr5 (486270..488864) [2595 bp, 864 aa] {ON} similar t...    87   2e-16
Suva_8.111 Chr8 (204414..205433) [1020 bp, 339 aa] {ON} YOR061W ...    84   2e-16
TDEL0A01120 Chr1 complement(189217..191466) [2250 bp, 749 aa] {O...    86   2e-16
Kpol_513.17 s513 (49097..50824) [1728 bp, 575 aa] {ON} (49097..5...    86   2e-16
TBLA0C05800 Chr3 complement(1402262..1405207) [2946 bp, 981 aa] ...    87   2e-16
NCAS0A12200 Chr1 (2417539..2419782) [2244 bp, 747 aa] {ON} Anc_1...    86   2e-16
SAKL0C07744g Chr3 (720519..721799) [1281 bp, 426 aa] {ON} simila...    85   2e-16
NDAI0A04040 Chr1 complement(907696..910041) [2346 bp, 781 aa] {O...    86   2e-16
Ecym_5241 Chr5 complement(495748..497586) [1839 bp, 612 aa] {ON}...    86   2e-16
KLLA0A09713g Chr1 (851952..853625) [1674 bp, 557 aa] {ON} simila...    86   2e-16
Skud_14.309 Chr14 complement(566344..568263) [1920 bp, 639 aa] {...    86   2e-16
NDAI0G03110 Chr7 complement(725984..731107) [5124 bp, 1707 aa] {...    86   3e-16
TBLA0G00820 Chr7 complement(191559..192833) [1275 bp, 424 aa] {O...    84   3e-16
Suva_4.168 Chr4 complement(302527..303654) [1128 bp, 375 aa] {ON...    84   3e-16
ACR117W Chr3 (557738..559312) [1575 bp, 524 aa] {ON} Syntenic ho...    85   3e-16
Smik_1.78 Chr1 complement(147996..149303) [1308 bp, 435 aa] {ON}...    84   3e-16
CAGL0I03498g Chr9 (297344..298699) [1356 bp, 451 aa] {ON} simila...    84   3e-16
KNAG0F03410 Chr6 (640115..645094) [4980 bp, 1659 aa] {ON}              86   3e-16
ZYRO0C09768g Chr3 (740592..742925) [2334 bp, 777 aa] {ON} simila...    86   3e-16
KLLA0D12100g Chr4 complement(1031728..1033161) [1434 bp, 477 aa]...    85   3e-16
TPHA0L02180 Chr12 (453556..455538) [1983 bp, 660 aa] {ON} Anc_5....    86   3e-16
Suva_1.84 Chr1 complement(148430..149737) [1308 bp, 435 aa] {ON}...    84   3e-16
Skud_15.39 Chr15 (69445..71412) [1968 bp, 655 aa] {ON} YOL113W (...    86   3e-16
KAFR0F01790 Chr6 complement(347491..349884) [2394 bp, 797 aa] {O...    86   3e-16
Skud_4.176 Chr4 complement(308461..309594) [1134 bp, 377 aa] {ON...    84   3e-16
Suva_14.32 Chr14 complement(52757..53884) [1128 bp, 375 aa] {ON}...    84   4e-16
KAFR0E02850 Chr5 (575512..576786) [1275 bp, 424 aa] {ON} Anc_8.4...    84   4e-16
Kwal_26.8941 s26 complement(1014543..1016528) [1986 bp, 661 aa] ...    85   4e-16
Skud_4.509 Chr4 (910551..911945) [1395 bp, 464 aa] {ON} YDR247W ...    84   4e-16
YKL161C Chr11 complement(149386..150687) [1302 bp, 433 aa] {ON} ...    84   4e-16
KLLA0F26983g Chr6 (2489326..2490729) [1404 bp, 467 aa] {ON} some...    84   4e-16
TBLA0A10420 Chr1 (2562614..2564092) [1479 bp, 492 aa] {ON} Anc_5...    84   5e-16
Kpol_1067.14 s1067 (29413..31050) [1638 bp, 545 aa] {ON} (29413....    84   5e-16
KLTH0H01584g Chr8 (143065..144453) [1389 bp, 462 aa] {ON} simila...    84   5e-16
KNAG0F01240 Chr6 complement(223003..225591) [2589 bp, 862 aa] {O...    85   5e-16
NDAI0C05160 Chr3 (1199533..1201026) [1494 bp, 497 aa] {ON} Anc_8...    84   5e-16
KNAG0J01950 Chr10 complement(352815..354317) [1503 bp, 500 aa] {...    84   5e-16
NCAS0C04540 Chr3 complement(929920..931056) [1137 bp, 378 aa] {O...    83   6e-16
KLLA0E07437g Chr5 complement(672690..673787) [1098 bp, 365 aa] {...    83   6e-16
KNAG0M01450 Chr13 (254622..256061) [1440 bp, 479 aa] {ON}              84   6e-16
NDAI0E00960 Chr5 (195116..197251) [2136 bp, 711 aa] {ON} Anc_8.716     85   6e-16
KAFR0G00440 Chr7 (124896..127328) [2433 bp, 810 aa] {ON} Anc_1.1...    85   6e-16
TBLA0A07770 Chr1 complement(1916632..1917939) [1308 bp, 435 aa] ...    83   7e-16
CAGL0M13167g Chr13 complement(1293074..1294906) [1833 bp, 610 aa...    84   7e-16
Kwal_23.4276 s23 complement(648061..649626) [1566 bp, 521 aa] {O...    84   7e-16
TPHA0P00640 Chr16 (132185..133963) [1779 bp, 592 aa] {ON} Anc_3....    84   7e-16
Kpol_1032.10 s1032 (24479..26854) [2376 bp, 791 aa] {ON} (24479....    84   8e-16
Suva_3.129 Chr3 (193311..194282) [972 bp, 323 aa] {ON} YCR091W (...    82   8e-16
TBLA0G01910 Chr7 complement(500551..502596) [2046 bp, 681 aa] {O...    84   8e-16
Suva_6.208 Chr6 (369853..371880) [2028 bp, 675 aa] {ON} YJL128C ...    84   8e-16
TBLA0B01990 Chr2 complement(458264..461623) [3360 bp, 1119 aa] {...    85   8e-16
KNAG0A06140 Chr1 (931737..933437) [1701 bp, 566 aa] {ON} Anc_2.4...    84   9e-16
NCAS0G03810 Chr7 complement(703842..705827) [1986 bp, 661 aa] {O...    84   9e-16
KAFR0H03330 Chr8 complement(635910..637019) [1110 bp, 369 aa] {O...    82   9e-16
ZYRO0F01034g Chr6 (80328..82826) [2499 bp, 832 aa] {ON} similar ...    84   1e-15
ZYRO0F18062g Chr6 complement(1494752..1496167) [1416 bp, 471 aa]...    83   1e-15
CAGL0E01683g Chr5 complement(166821..167948) [1128 bp, 375 aa] {...    82   1e-15
AEL179W Chr5 (302948..303817) [870 bp, 289 aa] {ON} NOHBY510; No...    80   1e-15
KNAG0A04080 Chr1 complement(551409..552635) [1227 bp, 408 aa] {O...    82   1e-15
TPHA0G01730 Chr7 complement(355001..356779) [1779 bp, 592 aa] {O...    84   1e-15
CAGL0F03707g Chr6 complement(359839..361665) [1827 bp, 608 aa] {...    84   1e-15
TPHA0A05460 Chr1 (1233608..1235170) [1563 bp, 520 aa] {ON} Anc_5...    83   1e-15
YNL020C Chr14 complement(595623..597539) [1917 bp, 638 aa] {ON} ...    84   1e-15
ZYRO0A05192g Chr1 complement(416951..418198) [1248 bp, 415 aa] {...    82   1e-15
AFR205C Chr6 complement(805580..806953) [1374 bp, 457 aa] {ON} S...    82   1e-15
Smik_15.241 Chr15 (407598..408617) [1020 bp, 339 aa] {ON} YOR061...    81   1e-15
KAFR0C01720 Chr3 (351078..352208) [1131 bp, 376 aa] {ON} Anc_3.4...    82   1e-15
SAKL0E07722g Chr5 complement(625066..627441) [2376 bp, 791 aa] {...    84   1e-15
Skud_1.73 Chr1 (144821..146128) [1308 bp, 435 aa] {ON} YAR018C (...    82   1e-15
YAR018C Chr1 complement(170396..171703) [1308 bp, 435 aa] {ON}  ...    82   2e-15
KLLA0E15313g Chr5 (1362851..1365025) [2175 bp, 724 aa] {ON} simi...    83   2e-15
TPHA0E03850 Chr5 complement(810694..812142) [1449 bp, 482 aa] {O...    82   2e-15
KLLA0F17006g Chr6 complement(1561859..1563106) [1248 bp, 415 aa]...    82   2e-15
Ecym_4056 Chr4 complement(119406..120428) [1023 bp, 340 aa] {ON}...    81   2e-15
NDAI0E03210 Chr5 complement(686073..687317) [1245 bp, 414 aa] {O...    82   2e-15
NDAI0G06150 Chr7 (1519393..1521780) [2388 bp, 795 aa] {ON} Anc_1...    83   2e-15
KNAG0H02020 Chr8 complement(357248..359026) [1779 bp, 592 aa] {O...    82   2e-15
TBLA0D02730 Chr4 complement(674994..676427) [1434 bp, 477 aa] {O...    82   2e-15
KNAG0A01330 Chr1 complement(34784..35977) [1194 bp, 397 aa] {ON}...    81   2e-15
NCAS0C05490 Chr3 (1114733..1115755) [1023 bp, 340 aa] {ON} Anc_5...    80   2e-15
Smik_4.25 Chr4 complement(52454..54547) [2094 bp, 697 aa] {ON} Y...    82   3e-15
ZYRO0G16632g Chr7 (1360854..1365827) [4974 bp, 1657 aa] {ON} hig...    83   3e-15
ZYRO0D03344g Chr4 complement(278347..280326) [1980 bp, 659 aa] {...    82   3e-15
AFR372W Chr6 (1109169..1111493) [2325 bp, 774 aa] {ON} Syntenic ...    82   3e-15
Suva_12.148 Chr12 (223571..225982) [2412 bp, 804 aa] {ON} YJR059...    82   3e-15
SAKL0G10384g Chr7 complement(883824..888848) [5025 bp, 1674 aa] ...    83   3e-15
ZYRO0G04488g Chr7 complement(360635..362545) [1911 bp, 636 aa] {...    82   3e-15
CAGL0I04422g Chr9 (394159..395427) [1269 bp, 422 aa] {ON} some s...    81   3e-15
Ecym_6092 Chr6 (178965..180299) [1335 bp, 444 aa] {ON} similar t...    81   3e-15
TBLA0C03180 Chr3 complement(770462..775468) [5007 bp, 1668 aa] {...    83   4e-15
Kpol_1065.6 s1065 (12266..12916,12918..13280,13332..13340,13394....    81   4e-15
Kwal_56.24584 s56 complement(1063271..1064578) [1308 bp, 435 aa]...    81   4e-15
YJL128C Chr10 complement(178097..180103) [2007 bp, 668 aa] {ON} ...    82   4e-15
KNAG0L01860 Chr12 (336795..337817) [1023 bp, 340 aa] {ON} Anc_5....    80   4e-15
TPHA0O01080 Chr15 complement(205407..207653) [2247 bp, 748 aa] {...    82   4e-15
SAKL0C06666g Chr3 complement(628448..630367) [1920 bp, 639 aa] {...    82   4e-15
NCAS0G01820 Chr7 complement(323288..325690) [2403 bp, 800 aa] {O...    82   4e-15
KNAG0C01040 Chr3 complement(203429..204976) [1548 bp, 515 aa] {O...    81   4e-15
Skud_11.181 Chr11 complement(326935..328845) [1911 bp, 636 aa] {...    82   5e-15
TDEL0A00600 Chr1 complement(101753..102877) [1125 bp, 374 aa] {O...    80   5e-15
Skud_10.283 Chr10 (503324..505765) [2442 bp, 813 aa] {ON} YJR059...    82   5e-15
TDEL0B02610 Chr2 complement(470263..471282) [1020 bp, 339 aa] {O...    79   5e-15
KAFR0G01200 Chr7 (273238..274761) [1524 bp, 507 aa] {ON} Anc_1.2...    81   6e-15
YJR059W Chr10 (545787..548243) [2457 bp, 818 aa] {ON}  PTK2Putat...    82   6e-15
ADR204W Chr4 (1062593..1063612) [1020 bp, 339 aa] {ON} Syntenic ...    79   7e-15
Skud_10.87 Chr10 complement(153140..155164) [2025 bp, 674 aa] {O...    81   7e-15
Kpol_1064.31 s1064 complement(52651..54350) [1700 bp, 566.666666...    81   7e-15
TPHA0P01380 Chr16 (278259..279380) [1122 bp, 373 aa] {ON} Anc_3....    79   8e-15
Kpol_YGOB_1064.31 s1064 complement(52620..54350) [1731 bp, 577 a...    81   8e-15
KLLA0D07810g Chr4 complement(669095..671251) [2157 bp, 718 aa] {...    81   8e-15
CAGL0M08360g Chr13 complement(833220..835520) [2301 bp, 766 aa] ...    81   8e-15
NDAI0D01450 Chr4 (339780..341948) [2169 bp, 722 aa] {ON} Anc_1.507     81   9e-15
CAGL0L05632g Chr12 (612478..614511) [2034 bp, 677 aa] {ON} simil...    81   9e-15
CAGL0I08349g Chr9 complement(813998..816001) [2004 bp, 667 aa] {...    81   9e-15
KAFR0K01310 Chr11 (270172..271191) [1020 bp, 339 aa] {ON} Anc_5....    79   9e-15
CAGL0H01639g Chr8 (158967..160532) [1566 bp, 521 aa] {ON} simila...    80   1e-14
NDAI0G00640 Chr7 (139655..141520) [1866 bp, 621 aa] {ON} Anc_2.284     80   1e-14
CAGL0G02035g Chr7 (179911..180930) [1020 bp, 339 aa] {ON} highly...    78   1e-14
CAGL0H01837g Chr8 complement(176352..178736) [2385 bp, 794 aa] {...    80   1e-14
Kwal_55.21900 s55 complement(1027253..1029130) [1878 bp, 625 aa]...    80   1e-14
Smik_10.106 Chr10 complement(175752..177776) [2025 bp, 674 aa] {...    80   1e-14
TBLA0D00220 Chr4 (52218..54500) [2283 bp, 760 aa] {ON} Anc_2.96 ...    80   1e-14
Ecym_2042 Chr2 complement(67312..68397) [1086 bp, 361 aa] {ON} s...    78   2e-14
NCAS0D01230 Chr4 complement(225213..226661) [1449 bp, 482 aa] {O...    79   2e-14
Skud_14.32 Chr14 complement(49930..51057) [1128 bp, 375 aa] {ON}...    78   2e-14
NDAI0H03740 Chr8 (912611..915373) [2763 bp, 920 aa] {ON} Anc_2.71      80   2e-14
Suva_2.413 Chr2 (735541..736923) [1383 bp, 460 aa] {ON} YDR247W ...    79   2e-14
Kpol_448.13 s448 (25051..27063) [2013 bp, 670 aa] {ON} (25051..2...    80   2e-14
KNAG0J02660 Chr10 (495011..497425) [2415 bp, 804 aa] {ON} Anc_1....    80   2e-14
Kpol_1033.1 s1033 complement(1..828) [828 bp, 276 aa] {ON} compl...    77   2e-14
KNAG0B00260 Chr2 complement(36240..38477) [2238 bp, 745 aa] {ON}...    80   2e-14
Kpol_1039.33 s1039 complement(102096..104201) [2106 bp, 701 aa] ...    80   2e-14
YNL307C Chr14 complement(56446..57573) [1128 bp, 375 aa] {ON}  M...    78   2e-14
Smik_14.24 Chr14 complement(40883..42010) [1128 bp, 375 aa] {ON}...    78   2e-14
Smik_14.311 Chr14 complement(558013..559926) [1914 bp, 637 aa] {...    79   2e-14
TBLA0A09370 Chr1 complement(2310412..2311443) [1032 bp, 343 aa] ...    77   2e-14
TDEL0H01070 Chr8 complement(192834..194624) [1791 bp, 596 aa] {O...    79   2e-14
Ecym_6400 Chr6 complement(779716..781983) [2268 bp, 755 aa] {ON}...    80   2e-14
Kwal_33.14554 s33 (717776..719920) [2145 bp, 714 aa] {ON} YNL161...    79   2e-14
AFR035W Chr6 (498529..500688) [2160 bp, 719 aa] {ON} Syntenic ho...    79   2e-14
Suva_14.178 Chr14 (328862..331195) [2334 bp, 777 aa] {ON} YNL161...    79   2e-14
TBLA0D05640 Chr4 (1380616..1383066) [2451 bp, 816 aa] {ON} Anc_1...    79   3e-14
TPHA0G02800 Chr7 (597211..598722) [1512 bp, 503 aa] {ON} Anc_2.4...    79   3e-14
TBLA0D03740 Chr4 complement(926538..929057) [2520 bp, 839 aa] {O...    79   3e-14
KLTH0F17490g Chr6 (1413752..1414774) [1023 bp, 340 aa] {ON} high...    77   3e-14
KLTH0B06424g Chr2 complement(518184..520328) [2145 bp, 714 aa] {...    79   3e-14
SAKL0G00990g Chr7 complement(89700..90824) [1125 bp, 374 aa] {ON...    77   3e-14
TBLA0J00990 Chr10 (224999..227335) [2337 bp, 778 aa] {ON} Anc_1....    79   3e-14
Smik_14.167 Chr14 (311655..312284,312591..314228) [2268 bp, 755 ...    79   3e-14
YNL161W Chr14 (332597..334867) [2271 bp, 756 aa] {ON}  CBK1Serin...    79   3e-14
NDAI0F03200 Chr6 complement(770618..772924) [2307 bp, 768 aa] {O...    79   3e-14
NDAI0F00560 Chr6 complement(128674..129717) [1044 bp, 347 aa] {O...    77   4e-14
Smik_10.349 Chr10 (534756..537209) [2454 bp, 817 aa] {ON} YJR059...    79   4e-14
TPHA0H01300 Chr8 (293254..294282) [1029 bp, 342 aa] {ON} Anc_5.6...    77   4e-14
Suva_16.491 Chr16 complement(848824..850794) [1971 bp, 656 aa] {...    79   4e-14
ZYRO0G05214g Chr7 (420482..422980) [2499 bp, 832 aa] {ON} some s...    79   4e-14
NDAI0G03920 Chr7 complement(934765..935889) [1125 bp, 374 aa] {O...    77   4e-14
KAFR0A07370 Chr1 complement(1487868..1490012) [2145 bp, 714 aa] ...    79   4e-14
Kpol_1031.32 s1031 (76827..78821) [1995 bp, 664 aa] {ON} (76827....    79   4e-14
TPHA0B01150 Chr2 complement(259998..262070) [2073 bp, 690 aa] {O...    79   5e-14
SAKL0E12342g Chr5 complement(1021369..1023795) [2427 bp, 808 aa]...    79   5e-14
ZYRO0B16038g Chr2 (1300484..1301515) [1032 bp, 343 aa] {ON} high...    77   5e-14
KNAG0F01440 Chr6 (261403..263685) [2283 bp, 760 aa] {ON}               79   5e-14
Skud_14.172 Chr14 (323327..325564) [2238 bp, 745 aa] {ON} YNL161...    79   5e-14
KLLA0F16467g Chr6 (1519800..1520822) [1023 bp, 340 aa] {ON} high...    76   5e-14
KAFR0B00520 Chr2 (105553..107502) [1950 bp, 649 aa] {ON} Anc_4.1...    78   5e-14
NCAS0G03420 Chr7 (628644..630668) [2025 bp, 674 aa] {ON} Anc_1.507     78   6e-14
KAFR0F02190 Chr6 (428623..430095) [1473 bp, 490 aa] {ON} Anc_3.1...    77   6e-14
Ecym_3160 Chr3 complement(304537..306957) [2421 bp, 806 aa] {ON}...    78   6e-14
Ecym_2650 Chr2 complement(1257641..1260325) [2685 bp, 894 aa] {O...    79   6e-14
KAFR0A00840 Chr1 complement(151896..152894) [999 bp, 332 aa] {ON...    76   7e-14
SAKL0F15510g Chr6 complement(1251475..1253373) [1899 bp, 632 aa]...    78   7e-14
TBLA0D01200 Chr4 (303528..305198) [1671 bp, 556 aa] {ON} Anc_8.7...    77   7e-14
ZYRO0C02772g Chr3 (216325..217464) [1140 bp, 379 aa] {ON} highly...    77   7e-14
KAFR0E00330 Chr5 complement(74619..76574) [1956 bp, 651 aa] {ON}...    78   7e-14
TPHA0I03100 Chr9 complement(681645..683666) [2022 bp, 673 aa] {O...    78   8e-14
TPHA0F02150 Chr6 complement(475516..477768) [2253 bp, 750 aa] {O...    78   8e-14
KLLA0E08405g Chr5 complement(756205..758538) [2334 bp, 777 aa] {...    78   8e-14
TDEL0F00530 Chr6 complement(88187..90517) [2331 bp, 776 aa] {ON}...    78   8e-14
AFL217C Chr6 complement(30765..32840) [2076 bp, 691 aa] {ON} Syn...    77   9e-14
NCAS0G02070 Chr7 (372747..374960) [2214 bp, 737 aa] {ON} Anc_2.96      77   9e-14
TPHA0A04030 Chr1 (901665..904829) [3165 bp, 1054 aa] {ON} Anc_3....    78   9e-14
NCAS0B06260 Chr2 complement(1180650..1182821) [2172 bp, 723 aa] ...    77   1e-13
SAKL0B04752g Chr2 (416940..418259) [1320 bp, 439 aa] {ON} weakly...    76   1e-13
ABR088C Chr2 complement(546325..547920) [1596 bp, 531 aa] {ON} S...    77   1e-13
KNAG0J00820 Chr10 complement(137927..141202) [3276 bp, 1091 aa] ...    78   1e-13
Ecym_4364 Chr4 (772870..773997) [1128 bp, 375 aa] {ON} similar t...    76   1e-13
KLLA0E04247g Chr5 (382874..383995) [1122 bp, 373 aa] {ON} simila...    75   1e-13
TBLA0B06940 Chr2 (1639189..1643520) [4332 bp, 1443 aa] {ON} Anc_...    77   1e-13
TBLA0E02590 Chr5 complement(651679..654864) [3186 bp, 1061 aa] {...    77   1e-13
KAFR0G01810 Chr7 (386620..389130) [2511 bp, 836 aa] {ON} Anc_1.2...    77   2e-13
TDEL0G02150 Chr7 (422718..424703) [1986 bp, 661 aa] {ON} Anc_2.2...    76   2e-13
Kpol_161.2 s161 complement(3125..4246) [1122 bp, 373 aa] {ON} co...    75   2e-13
Ecym_3323 Chr3 (618386..620632) [2247 bp, 748 aa] {ON} similar t...    76   2e-13
TPHA0C01810 Chr3 complement(413495..414790) [1296 bp, 431 aa] {O...    75   2e-13
Skud_9.134 Chr9 complement(256610..257728) [1119 bp, 372 aa] {ON...    75   2e-13
Smik_2.191 Chr2 complement(338792..342118) [3327 bp, 1108 aa] {O...    77   3e-13
KAFR0C00430 Chr3 complement(88561..91410) [2850 bp, 949 aa] {ON}...    76   3e-13
KNAG0C03830 Chr3 (751393..752877) [1485 bp, 494 aa] {ON} Anc_7.3...    75   3e-13
KAFR0A01040 Chr1 complement(197612..200350) [2739 bp, 912 aa] {O...    76   3e-13
KLTH0G10318g Chr7 (872129..874501) [2373 bp, 790 aa] {ON} simila...    76   3e-13
NCAS0H03070 Chr8 complement(590494..592440) [1947 bp, 648 aa] {O...    76   3e-13
NCAS0E01560 Chr5 (294095..295345) [1251 bp, 416 aa] {ON}               75   3e-13
NCAS0C03560 Chr3 complement(710551..712476) [1926 bp, 641 aa] {O...    75   3e-13
KAFR0H01460 Chr8 complement(269957..271705) [1749 bp, 582 aa] {O...    75   4e-13
Suva_14.327 Chr14 complement(578572..580470) [1899 bp, 632 aa] {...    75   4e-13
Suva_9.104 Chr9 (178011..180428) [2418 bp, 805 aa] {ON} YIL095W ...    76   4e-13
TBLA0B08650 Chr2 (2065061..2066308) [1248 bp, 415 aa] {ON} Anc_3...    75   4e-13
TPHA0L01350 Chr12 (282034..283884) [1851 bp, 616 aa] {ON}              75   4e-13
NCAS0G00490 Chr7 complement(83953..84996) [1044 bp, 347 aa] {ON}...    74   4e-13
ADL217W Chr4 (321491..323743) [2253 bp, 750 aa] {ON} Syntenic ho...    75   4e-13
YKL198C Chr11 complement(68232..70220) [1989 bp, 662 aa] {ON}  P...    75   5e-13
ADL168C Chr4 complement(398517..399605) [1089 bp, 362 aa] {ON} S...    74   5e-13
ABR177C Chr2 complement(735829..738090) [2262 bp, 753 aa] {ON} S...    75   5e-13
CAGL0K11990g Chr11 complement(1156224..1159199) [2976 bp, 991 aa...    75   5e-13
NCAS0C02390 Chr3 complement(446642..448468) [1827 bp, 608 aa] {O...    75   6e-13
KNAG0F03730 Chr6 complement(697517..699586) [2070 bp, 689 aa] {O...    75   6e-13
NDAI0J00420 Chr10 (73312..75606) [2295 bp, 764 aa] {ON} Anc_7.515      75   7e-13
YIL095W Chr9 (183937..186369) [2433 bp, 810 aa] {ON}  PRK1Protei...    75   7e-13
Smik_16.420 Chr16 complement(725685..727658) [1974 bp, 657 aa] {...    75   7e-13
Ecym_7206 Chr7 complement(423402..425576) [2175 bp, 724 aa] {ON}...    75   7e-13
SAKL0F07854g Chr6 (600324..601442) [1119 bp, 372 aa] {ON} highly...    73   7e-13
YPR161C Chr16 complement(864449..866422) [1974 bp, 657 aa] {ON} ...    74   8e-13
YIL035C Chr9 complement(287790..288908) [1119 bp, 372 aa] {ON}  ...    73   8e-13
Skud_11.20 Chr11 complement(51603..53558) [1956 bp, 651 aa] {ON}...    74   8e-13
TPHA0D01540 Chr4 complement(316471..318594) [2124 bp, 707 aa] {O...    74   9e-13
TPHA0C03380 Chr3 (740939..743032) [2094 bp, 697 aa] {ON} Anc_2.2...    74   9e-13
TPHA0B02780 Chr2 complement(633307..634449) [1143 bp, 380 aa] {O...    73   9e-13
TPHA0M01120 Chr13 complement(223548..225914) [2367 bp, 788 aa] {...    74   1e-12
NCAS0A10590 Chr1 complement(2108142..2111429) [3288 bp, 1095 aa]...    74   1e-12
ZYRO0C12078g Chr3 (946320..948647) [2328 bp, 775 aa] {ON} simila...    74   1e-12
YBR059C Chr2 complement(356861..360187) [3327 bp, 1108 aa] {ON} ...    74   1e-12
NCAS0F02410 Chr6 complement(476683..478071) [1389 bp, 462 aa] {O...    73   1e-12
Kpol_1031.76 s1031 (193193..194923) [1731 bp, 576 aa] {ON} (1931...    74   1e-12
KLTH0F18458g Chr6 complement(1491777..1493663) [1887 bp, 628 aa]...    74   1e-12
Smik_11.24 Chr11 complement(52600..54522) [1923 bp, 640 aa] {ON}...    74   1e-12
Skud_16.460 Chr16 complement(807116..809077) [1962 bp, 653 aa] {...    74   1e-12
NDAI0A05700 Chr1 (1288604..1292077) [3474 bp, 1157 aa] {ON} Anc_...    74   2e-12
KNAG0H00560 Chr8 (89502..91268) [1767 bp, 588 aa] {ON} Anc_2.597...    73   2e-12
Kwal_47.18098 s47 (685497..686621) [1125 bp, 374 aa] {ON} YIL035...    72   2e-12
TDEL0F02980 Chr6 (539327..541549) [2223 bp, 740 aa] {ON} Anc_1.1...    73   2e-12
KNAG0H02860 Chr8 (531728..532843) [1116 bp, 371 aa] {ON}               72   2e-12
Ecym_5209 Chr5 complement(445530..448133) [2604 bp, 867 aa] {ON}...    74   2e-12
Kwal_27.11542 s27 complement(841389..843764) [2376 bp, 791 aa] {...    73   2e-12
Kpol_1013.52 s1013 (123332..125881) [2550 bp, 849 aa] {ON} (1233...    73   2e-12
NDAI0E03080 Chr5 complement(653882..655798) [1917 bp, 638 aa] {O...    73   3e-12
TBLA0A01580 Chr1 complement(367370..369976) [2607 bp, 868 aa] {O...    73   3e-12
ZYRO0D01584g Chr4 (124739..126688) [1950 bp, 649 aa] {ON} some s...    73   3e-12
KAFR0A02560 Chr1 complement(532248..533351) [1104 bp, 367 aa] {O...    71   3e-12
Suva_11.24 Chr11 complement(52742..52930,52961..54523) [1752 bp,...    72   3e-12
Smik_16.296 Chr16 (542962..544128) [1167 bp, 388 aa] {ON} YPR054...    72   3e-12
TPHA0E02270 Chr5 (471696..472916) [1221 bp, 406 aa] {ON} Anc_5.2...    72   3e-12
KNAG0G00280 Chr7 complement(43196..45262) [2067 bp, 688 aa] {ON}...    72   4e-12
KLLA0F18612g Chr6 (1711131..1713575) [2445 bp, 814 aa] {ON} some...    72   4e-12
TBLA0H00370 Chr8 (71216..73393) [2178 bp, 725 aa] {ON} Anc_2.425...    72   4e-12
Kpol_1063.4 s1063 complement(10790..11932) [1143 bp, 380 aa] {ON...    71   5e-12
KNAG0C02250 Chr3 complement(444156..446639) [2484 bp, 827 aa] {O...    72   5e-12
Kwal_33.13825 s33 (409772..412477) [2706 bp, 901 aa] {ON} YKL171...    72   5e-12
CAGL0J03432g Chr10 (330031..331899) [1869 bp, 622 aa] {ON} simil...    72   5e-12
TBLA0I01930 Chr9 complement(436511..440596) [4086 bp, 1361 aa] {...    72   5e-12
TPHA0B03130 Chr2 complement(719624..721372) [1749 bp, 582 aa] {O...    72   5e-12
Kpol_1060.53 s1060 complement(126120..128330) [2211 bp, 736 aa] ...    72   5e-12
ADL102C Chr4 complement(503667..504785) [1119 bp, 372 aa] {ON} S...    70   6e-12
Suva_4.297 Chr4 complement(523650..526973) [3324 bp, 1107 aa] {O...    72   6e-12
Smik_9.84 Chr9 (162983..165409) [2427 bp, 808 aa] {ON} YIL095W (...    72   6e-12
Kwal_27.10945 s27 (565717..568524) [2808 bp, 935 aa] {ON} YBR059...    72   6e-12
NDAI0B03560 Chr2 complement(892839..895109) [2271 bp, 756 aa] {O...    72   6e-12
KLLA0B11946g Chr2 complement(1048033..1049352) [1320 bp, 439 aa]...    71   7e-12
CAGL0H10208g Chr8 complement(996853..999936) [3084 bp, 1027 aa] ...    72   7e-12
TDEL0H00560 Chr8 (94614..96500) [1887 bp, 628 aa] {ON} Anc_7.515...    71   8e-12
Suva_16.382 Chr16 (673009..674205) [1197 bp, 398 aa] {ON} YPR054...    70   8e-12
YKL171W Chr11 (127475..130261) [2787 bp, 928 aa] {ON}  NNK1Prote...    72   8e-12
Kpol_1056.20 s1056 complement(44529..46724) [2196 bp, 731 aa] {O...    71   9e-12
Kpol_1052.22 s1052 (72364..75669) [3306 bp, 1101 aa] {ON} (72364...    71   9e-12
Suva_11.52 Chr11 (112355..115156) [2802 bp, 933 aa] {ON} YKL171W...    71   1e-11
Smik_15.25 Chr15 complement(46541..47668) [1128 bp, 375 aa] {ON}...    70   1e-11
Skud_11.54 Chr11 (113775..116570) [2796 bp, 931 aa] {ON} YKL171W...    71   1e-11
Ecym_8164 Chr8 (342672..346076) [3405 bp, 1134 aa] {ON} similar ...    71   1e-11
TPHA0N01450 Chr14 complement(318088..320340) [2253 bp, 750 aa] {...    71   1e-11
KLTH0A03542g Chr1 (306667..307803) [1137 bp, 378 aa] {ON} highly...    69   1e-11
Kwal_33.13681 s33 complement(350547..352694) [2148 bp, 715 aa] {...    70   1e-11
KLTH0C07260g Chr3 (626334..629039) [2706 bp, 901 aa] {ON} simila...    71   1e-11
TPHA0A02630 Chr1 complement(562516..565164) [2649 bp, 882 aa] {O...    71   1e-11
Skud_2.179 Chr2 complement(325193..328465) [3273 bp, 1090 aa] {O...    71   1e-11
TDEL0B01470 Chr2 complement(257397..259169) [1773 bp, 590 aa] {O...    70   1e-11
Suva_9.165 Chr9 complement(276469..277587) [1119 bp, 372 aa] {ON...    69   2e-11
KLTH0F05918g Chr6 complement(525566..527254) [1689 bp, 562 aa] {...    70   2e-11
KLLA0D10527g Chr4 (892955..894892) [1938 bp, 645 aa] {ON} simila...    70   2e-11
KLLA0B06501g Chr2 complement(576636..579089) [2454 bp, 817 aa] {...    70   2e-11
NDAI0G01760 Chr7 (384420..385700) [1281 bp, 426 aa] {ON}               69   2e-11
KLTH0E11396g Chr5 (1018348..1020069) [1722 bp, 573 aa] {ON} simi...    70   2e-11
ZYRO0F08272g Chr6 (668685..670508) [1824 bp, 607 aa] {ON} simila...    70   2e-11
KAFR0J01370 Chr10 complement(250424..252766) [2343 bp, 780 aa] {...    70   2e-11
ZYRO0D16170g Chr4 (1348849..1349982) [1134 bp, 377 aa] {ON} high...    69   3e-11
CAGL0M08316g Chr13 (829069..831963) [2895 bp, 964 aa] {ON} weakl...    70   3e-11
CAGL0L12650g Chr12 (1360085..1361788) [1704 bp, 567 aa] {ON} sim...    69   3e-11
Kpol_2001.31 s2001 complement(90402..93110) [2709 bp, 902 aa] {O...    70   3e-11
Ecym_2540 Chr2 (1048071..1049792) [1722 bp, 573 aa] {ON} similar...    69   3e-11
KNAG0H01220 Chr8 (209884..212625) [2742 bp, 913 aa] {ON} Anc_3.2...    69   3e-11
Smik_9.156 Chr9 complement(261998..263116) [1119 bp, 372 aa] {ON...    68   4e-11
KNAG0A02220 Chr1 complement(198240..199979) [1740 bp, 579 aa] {O...    69   4e-11
AGR027C Chr7 complement(763303..766188) [2886 bp, 961 aa] {ON} S...    69   4e-11
Kpol_209.1 s209 (1823..5734) [3912 bp, 1303 aa] {ON} (1823..5734...    69   4e-11
ADL315C Chr4 complement(146096..147400) [1305 bp, 434 aa] {ON} S...    68   4e-11
SAKL0D03234g Chr4 (262365..264941) [2577 bp, 858 aa] {ON} some s...    69   4e-11
CAGL0G02607g Chr7 complement(240244..242310) [2067 bp, 688 aa] {...    69   4e-11
Skud_16.239 Chr16 complement(438063..439727) [1665 bp, 554 aa] {...    69   5e-11
YPL042C Chr16 complement(473040..474707) [1668 bp, 555 aa] {ON} ...    69   5e-11
TBLA0J01200 Chr10 (271800..275420) [3621 bp, 1206 aa] {ON} Anc_1...    69   5e-11
KLTH0F03916g Chr6 complement(348177..350282) [2106 bp, 701 aa] {...    69   5e-11
Smik_11.58 Chr11 (112932..115715) [2784 bp, 927 aa] {ON} YKL171W...    69   5e-11
Ecym_8100 Chr8 complement(214001..216547) [2547 bp, 848 aa] {ON}...    69   5e-11
KLTH0E07128g Chr5 complement(657986..660064) [2079 bp, 692 aa] {...    69   5e-11
SAKL0H24288g Chr8 (2099353..2101317) [1965 bp, 654 aa] {ON} simi...    69   5e-11
Smik_16.193 Chr16 complement(350311..351978) [1668 bp, 555 aa] {...    68   5e-11
Ecym_2302 Chr2 (587299..588951) [1653 bp, 550 aa] {ON} similar t...    68   6e-11
NDAI0A02720 Chr1 complement(612346..613455) [1110 bp, 369 aa] {O...    67   6e-11
Kwal_47.17345 s47 complement(364905..367004) [2100 bp, 699 aa] {...    68   7e-11
Kwal_27.11830 s27 (964584..966311) [1728 bp, 575 aa] {ON} YPL042...    68   7e-11
TPHA0H01470 Chr8 complement(329451..333578) [4128 bp, 1375 aa] {...    69   8e-11
Kwal_55.20221 s55 (304482..308006) [3525 bp, 1174 aa] {ON} YHR07...    69   8e-11
ZYRO0G18590g Chr7 complement(1533974..1536202) [2229 bp, 742 aa]...    68   8e-11
YPR054W Chr16 (666280..667446) [1167 bp, 388 aa] {ON}  SMK1Middl...    67   8e-11
NCAS0A13320 Chr1 (2622149..2623258) [1110 bp, 369 aa] {ON}             67   8e-11
TBLA0J00250 Chr10 (42058..44457) [2400 bp, 799 aa] {ON} Anc_7.51...    68   9e-11
NDAI0B00400 Chr2 (74403..76643) [2241 bp, 746 aa] {ON} Anc_1.149       68   9e-11
TDEL0H02380 Chr8 complement(399810..400931) [1122 bp, 373 aa] {O...    67   9e-11
YOL128C Chr15 complement(78352..79479) [1128 bp, 375 aa] {ON}  Y...    67   9e-11
Suva_16.274 Chr16 complement(476249..477916) [1668 bp, 555 aa] {...    68   9e-11
KNAG0B04500 Chr2 (865766..869089) [3324 bp, 1107 aa] {ON} Anc_5....    68   9e-11
Kpol_251.4 s251 (5802..8318) [2517 bp, 838 aa] {ON} (5802..8318)...    68   9e-11
CAGL0I05192g Chr9 complement(493635..494756) [1122 bp, 373 aa] {...    67   9e-11
KLLA0D11814g Chr4 complement(1007240..1009021) [1782 bp, 593 aa]...    68   1e-10
TPHA0K02030 Chr11 (432238..434505) [2268 bp, 755 aa] {ON} Anc_4....    68   1e-10
TBLA0E02460 Chr5 (620609..621745) [1137 bp, 378 aa] {ON} Anc_7.2...    67   1e-10
ZYRO0E06864g Chr5 complement(516731..520078) [3348 bp, 1115 aa] ...    68   1e-10
TBLA0A03220 Chr1 complement(765108..768590) [3483 bp, 1160 aa] {...    68   1e-10
TBLA0B05930 Chr2 (1400163..1402316) [2154 bp, 717 aa] {ON} Anc_2...    68   1e-10
KLTH0F04686g Chr6 (413669..416209) [2541 bp, 846 aa] {ON} weakly...    68   1e-10
NCAS0A06000 Chr1 (1184842..1187133) [2292 bp, 763 aa] {ON} Anc_4...    68   1e-10
AEL120W Chr5 (396394..398715) [2322 bp, 773 aa] {ON} Syntenic ho...    67   1e-10
KLLA0D13266g Chr4 complement(1137750..1141208) [3459 bp, 1152 aa...    67   1e-10
KNAG0D02790 Chr4 (507235..508848) [1614 bp, 537 aa] {ON} Anc_5.3...    67   1e-10
Kpol_1003.35 s1003 (89266..91407) [2142 bp, 713 aa] {ON} (89266....    67   2e-10
NCAS0I03020 Chr9 (555481..557853) [2373 bp, 790 aa] {ON} Anc_1.149     67   2e-10
Skud_10.30 Chr10 complement(51698..54124) [2427 bp, 808 aa] {ON}...    67   2e-10
SAKL0H11352g Chr8 complement(975064..976857) [1794 bp, 597 aa] {...    67   2e-10
NCAS0A15040 Chr1 complement(2962030..2964036) [2007 bp, 668 aa] ...    67   2e-10
Ecym_3488 Chr3 complement(915087..916400) [1314 bp, 437 aa] {ON}...    66   2e-10
ADL043C Chr4 complement(612088..614109) [2022 bp, 673 aa] {ON} S...    67   2e-10
Skud_16.340 Chr16 (631100..632266) [1167 bp, 388 aa] {ON} YPR054...    66   2e-10
Kpol_2001.46 s2001 (127016..129376) [2361 bp, 786 aa] {ON} (1270...    67   2e-10
Smik_8.156 Chr8 complement(234928..238269) [3342 bp, 1113 aa] {O...    67   2e-10
Suva_6.268 Chr6 (470348..472519) [2172 bp, 723 aa] {ON} YJL187C ...    67   2e-10
KLLA0B07579g Chr2 (659591..661759) [2169 bp, 722 aa] {ON} simila...    67   2e-10
KAFR0H01040 Chr8 complement(189604..190860) [1257 bp, 418 aa] {O...    66   2e-10
KAFR0F01630 Chr6 complement(323802..326057) [2256 bp, 751 aa] {O...    66   3e-10
CAGL0D06600g Chr4 (626571..628748) [2178 bp, 725 aa] {ON} simila...    66   3e-10
KAFR0F02730 Chr6 (537477..539309) [1833 bp, 610 aa] {ON} Anc_4.4...    66   3e-10
CAGL0F03245g Chr6 complement(316924..320034) [3111 bp, 1036 aa] ...    66   3e-10
NDAI0H02930 Chr8 (715278..716846) [1569 bp, 522 aa] {ON} Anc_2.391     66   3e-10
YJL187C Chr10 complement(76803..79262) [2460 bp, 819 aa] {ON}  S...    66   3e-10
Kwal_27.12559 s27 (1273349..1274593) [1245 bp, 414 aa] {ON} YPR0...    65   3e-10
Suva_15.271 Chr15 complement(460466..463813) [3348 bp, 1115 aa] ...    66   3e-10
KNAG0C02600 Chr3 complement(504486..507134) [2649 bp, 882 aa] {O...    66   3e-10
Suva_15.32 Chr15 complement(56314..57447) [1134 bp, 377 aa] {ON}...    65   4e-10
TDEL0D03520 Chr4 (647828..650977) [3150 bp, 1049 aa] {ON} Anc_3....    66   4e-10
YHR079C Chr8 complement(258244..261591) [3348 bp, 1115 aa] {ON} ...    66   4e-10
TBLA0B10030 Chr2 (2399979..2402123) [2145 bp, 714 aa] {ON} Anc_4...    65   4e-10
ZYRO0B00638g Chr2 (42738..44930) [2193 bp, 730 aa] {ON} similar ...    65   4e-10
Kwal_33.14081 s33 complement(519343..521085) [1743 bp, 580 aa] {...    65   4e-10
NDAI0E01960 Chr5 (397897..399717) [1821 bp, 606 aa] {ON} Anc_2.425     65   5e-10
Kpol_1035.34 s1035 (79914..80978) [1065 bp, 354 aa] {ON} (79914....    64   6e-10
KLLA0F08877g Chr6 (825217..826182) [966 bp, 321 aa] {ON} uniprot...    64   6e-10
Kpol_376.5 s376 (6334..7767) [1434 bp, 477 aa] {ON} (6334..7767)...    65   7e-10
NCAS0B08320 Chr2 complement(1585766..1588471) [2706 bp, 901 aa] ...    65   8e-10
ZYRO0G20570g Chr7 (1695518..1697305) [1788 bp, 595 aa] {ON} simi...    65   8e-10
KLLA0F02838g Chr6 (264329..266596) [2268 bp, 755 aa] {ON} simila...    65   9e-10
NCAS0A11020 Chr1 (2193556..2194869) [1314 bp, 437 aa] {ON} Anc_3...    64   9e-10
NDAI0G05790 Chr7 complement(1433294..1435252) [1959 bp, 652 aa] ...    64   9e-10
KAFR0F01940 Chr6 complement(379908..382283) [2376 bp, 791 aa] {O...    64   1e-09
TBLA0B09215 Chr2 complement(2180179..2181375) [1197 bp, 398 aa] ...    64   1e-09
KLLA0F01507g Chr6 (144356..145774) [1419 bp, 472 aa] {ON} some s...    64   1e-09
KLTH0D03080g Chr4 (295808..297730) [1923 bp, 640 aa] {ON} simila...    64   1e-09
SAKL0D05104g Chr4 (402641..404692) [2052 bp, 683 aa] {ON} simila...    64   2e-09
Skud_9.78 Chr9 (160531..162960) [2430 bp, 809 aa] {ON} YIL095W (...    64   2e-09
NDAI0C00570 Chr3 (108274..110547) [2274 bp, 757 aa] {ON}               64   2e-09
SAKL0C06248g Chr3 complement(577990..580185) [2196 bp, 731 aa] {...    64   2e-09
ACR249C Chr3 complement(797020..798951) [1932 bp, 643 aa] {ON} S...    64   2e-09
TBLA0H02950 Chr8 complement(721123..723906) [2784 bp, 927 aa] {O...    64   2e-09
Kpol_1027.1 s1027 (1..2088) [2088 bp, 695 aa] {ON} (1..2088) [20...    63   2e-09
TBLA0B06510 Chr2 (1536156..1538489) [2334 bp, 777 aa] {ON} Anc_1...    64   2e-09
KNAG0I03000 Chr9 (596789..598840) [2052 bp, 683 aa] {ON} Anc_4.4...    63   2e-09
CAGL0K00693g Chr11 complement(75466..78096) [2631 bp, 876 aa] {O...    63   2e-09
NDAI0G03150 Chr7 complement(741321..742463) [1143 bp, 380 aa] {O...    62   3e-09
AEL173W Chr5 (313261..314856) [1596 bp, 531 aa] {ON} Syntenic ho...    63   3e-09
SAKL0C04576g Chr3 complement(444365..446611) [2247 bp, 748 aa] {...    63   3e-09
TDEL0C03760 Chr3 complement(661391..663895) [2505 bp, 834 aa] {O...    63   3e-09
NCAS0I02680 Chr9 (498371..500752) [2382 bp, 793 aa] {ON}               63   3e-09
Ecym_8129 Chr8 (269437..271626) [2190 bp, 729 aa] {ON} similar t...    63   3e-09
Kwal_26.7276 s26 (293129..295069) [1941 bp, 646 aa] {ON} YJL106W...    63   3e-09
TPHA0A04570 Chr1 (1038551..1040674) [2124 bp, 707 aa] {ON} Anc_1...    63   3e-09
CAGL0I05896g Chr9 (560169..562505) [2337 bp, 778 aa] {ON} some s...    63   3e-09
Kpol_2001.10 s2001 (30724..33018) [2295 bp, 764 aa] {ON} (30724....    63   3e-09
Ecym_8380 Chr8 (772519..774573) [2055 bp, 684 aa] {ON} similar t...    63   4e-09
Ecym_6359 Chr6 complement(699564..702176) [2613 bp, 870 aa] {ON}...    63   4e-09
NDAI0D02970 Chr4 (701299..704058) [2760 bp, 919 aa] {ON} Anc_4.4...    63   4e-09
AGL249C Chr7 complement(234347..236092) [1746 bp, 581 aa] {ON} S...    62   4e-09
TDEL0F01550 Chr6 (282677..284839) [2163 bp, 720 aa] {ON} Anc_4.4...    63   4e-09
Smik_10.45 Chr10 complement(74813..77278) [2466 bp, 821 aa] {ON}...    63   4e-09
ZYRO0F03190g Chr6 complement(270262..271371) [1110 bp, 369 aa] {...    61   5e-09
KLTH0E03828g Chr5 (345775..349131) [3357 bp, 1118 aa] {ON} simil...    63   5e-09
KLLA0A05819g Chr1 (541545..543659) [2115 bp, 704 aa] {ON} simila...    62   5e-09
Skud_8.139 Chr8 complement(232178..235534) [3357 bp, 1118 aa] {O...    62   5e-09
TDEL0H00890 Chr8 complement(146908..149088) [2181 bp, 726 aa] {O...    62   6e-09
Kpol_1066.19 s1066 (31013..32806) [1794 bp, 597 aa] {OFF} (31013...    62   6e-09
Kpol_YGOB_1066.19 s1066 (30983..32806) [1824 bp, 607 aa] {ON} AN...    62   6e-09
Skud_10.73 Chr10 complement(123049..125436) [2388 bp, 795 aa] {O...    62   6e-09
AFR076W Chr6 (564252..566714) [2463 bp, 820 aa] {ON} Syntenic ho...    62   8e-09
TBLA0B08810 Chr2 (2094401..2095375) [975 bp, 324 aa] {ON} Anc_2....    60   8e-09
NDAI0G06240 Chr7 (1546580..1549282) [2703 bp, 900 aa] {ON} Anc_1...    62   8e-09
CAGL0D01694g Chr4 complement(176981..178279) [1299 bp, 432 aa] {...    61   9e-09
AEL149C Chr5 complement(348350..350533) [2184 bp, 727 aa] {ON} S...    62   9e-09
Smik_10.91 Chr10 complement(145745..148153) [2409 bp, 802 aa] {O...    62   9e-09
ADR293C Chr4 complement(1207021..1210425) [3405 bp, 1134 aa] {ON...    62   9e-09
TBLA0J01000 Chr10 complement(227869..231072) [3204 bp, 1067 aa] ...    62   1e-08
SAKL0B07304g Chr2 (625541..627007) [1467 bp, 488 aa] {ON} simila...    61   1e-08
TPHA0M01500 Chr13 (317999..319291) [1293 bp, 430 aa] {ON} Anc_3....    60   1e-08
YJL141C Chr10 complement(147967..150390) [2424 bp, 807 aa] {ON} ...    61   1e-08
KAFR0D04760 Chr4 complement(932849..936205) [3357 bp, 1118 aa] {...    61   1e-08
TDEL0D01220 Chr4 complement(228529..230451) [1923 bp, 640 aa] {O...    61   1e-08
TPHA0A02760 Chr1 (594482..597502) [3021 bp, 1006 aa] {ON} Anc_1....    61   1e-08
ZYRO0C15862g Chr3 (1239992..1241305) [1314 bp, 437 aa] {ON} simi...    60   2e-08
Skud_16.42 Chr16 complement(75193..76287) [1095 bp, 364 aa] {ON}...    60   2e-08
KLLA0F22297g Chr6 complement(2083448..2085547) [2100 bp, 699 aa]...    60   2e-08
Ecym_1502 Chr1 (1030765..1031838) [1074 bp, 357 aa] {ON} similar...    59   2e-08
Suva_10.55 Chr10 complement(110943..113177) [2235 bp, 744 aa] {O...    60   2e-08
Smik_12.44 Chr12 complement(92046..94262) [2217 bp, 738 aa] {ON}...    60   2e-08
TDEL0C04800 Chr3 (866157..867467) [1311 bp, 436 aa] {ON} Anc_3.3...    60   2e-08
KLTH0H10582g Chr8 (914695..916440) [1746 bp, 581 aa] {ON} weakly...    60   2e-08
SAKL0D06820g Chr4 (566145..567938) [1794 bp, 597 aa] {ON} simila...    60   2e-08
KAFR0C03480 Chr3 (708186..709277) [1092 bp, 363 aa] {ON} Anc_8.4...    59   2e-08
Skud_12.48 Chr12 complement(97218..99422) [2205 bp, 734 aa] {ON}...    60   2e-08
SAKL0C05236g Chr3 (498347..501385) [3039 bp, 1012 aa] {ON} simil...    60   3e-08
NCAS0H01740 Chr8 complement(331436..335284) [3849 bp, 1282 aa] {...    60   3e-08
YLL019C Chr12 complement(105686..107899) [2214 bp, 737 aa] {ON} ...    60   3e-08
TBLA0D05770 Chr4 (1424960..1427671) [2712 bp, 903 aa] {ON} Anc_1...    60   3e-08
KLTH0F05522g Chr6 complement(477035..478975) [1941 bp, 646 aa] {...    59   3e-08
Skud_15.25 Chr15 complement(43728..44864) [1137 bp, 378 aa] {ON}...    59   3e-08
KLLA0A06776g Chr1 (612115..614517) [2403 bp, 800 aa] {ON} simila...    59   4e-08
TBLA0A02240 Chr1 (539297..540538) [1242 bp, 413 aa] {ON} Anc_6.2...    59   4e-08
ZYRO0A01848g Chr1 (152134..154248) [2115 bp, 704 aa] {ON} simila...    59   4e-08
KNAG0H00790 Chr8 complement(124926..126131) [1206 bp, 401 aa] {O...    59   4e-08
CAGL0K12496g Chr11 (1219220..1220302) [1083 bp, 360 aa] {ON} sim...    58   4e-08
TDEL0D01930 Chr4 complement(373906..375753) [1848 bp, 615 aa] {O...    59   5e-08
KNAG0B01670 Chr2 (307587..309860) [2274 bp, 757 aa] {ON} Anc_1.2...    59   5e-08
TBLA0D05210 Chr4 (1279846..1282323) [2478 bp, 825 aa] {ON} Anc_1...    59   5e-08
YJL057C Chr10 complement(328118..330121) [2004 bp, 667 aa] {ON} ...    59   6e-08
Ecym_6294 Chr6 complement(551351..552982) [1632 bp, 543 aa] {ON}...    58   7e-08
TDEL0E02600 Chr5 (501545..504934) [3390 bp, 1129 aa] {ON} Anc_5....    59   9e-08
TBLA0A06670 Chr1 complement(1630701..1632023) [1323 bp, 440 aa] ...    58   9e-08
Suva_6.221 Chr6 (399862..400920,400924..402096) [2232 bp, 743 aa...    58   1e-07
Smik_10.183 Chr10 complement(319743..321746) [2004 bp, 667 aa] {...    58   1e-07
Kwal_33.13984 s33 complement(471429..473378) [1950 bp, 649 aa] {...    58   1e-07
Kpol_1051.42 s1051 (98030..99379,99382..100212) [2181 bp, 726 aa...    58   1e-07
Suva_6.133 Chr6 (221952..223955) [2004 bp, 667 aa] {ON} YJL057C ...    57   1e-07
AFL143C Chr6 complement(164241..165326) [1086 bp, 361 aa] {ON} S...    57   1e-07
NCAS0A09570 Chr1 complement(1907017..1909200) [2184 bp, 727 aa] ...    57   2e-07
TBLA0D02510 Chr4 complement(626101..627234) [1134 bp, 377 aa] {O...    57   2e-07
KAFR0F01150 Chr6 complement(218711..219811) [1101 bp, 366 aa] {O...    57   2e-07
ZYRO0D10472g Chr4 (876899..880357) [3459 bp, 1152 aa] {ON} simil...    57   2e-07
KNAG0E03260 Chr5 complement(654134..655246) [1113 bp, 370 aa] {O...    56   2e-07
KNAG0A05430 Chr1 complement(800787..803153) [2367 bp, 788 aa] {O...    57   2e-07
Kwal_14.2554 s14 (811455..813233) [1779 bp, 592 aa] {ON} YJL057C...    57   2e-07
TPHA0I00820 Chr9 (177222..179651) [2430 bp, 809 aa] {ON} Anc_1.2...    57   3e-07
AFR150C Chr6 complement(707303..708352) [1050 bp, 349 aa] {ON} S...    55   3e-07
NDAI0A05280 Chr1 complement(1191032..1192342) [1311 bp, 436 aa] ...    56   3e-07
KLTH0E15004g Chr5 (1328930..1330165) [1236 bp, 411 aa] {ON} simi...    56   3e-07
CAGL0H08437g Chr8 complement(825191..829423) [4233 bp, 1410 aa] ...    57   3e-07
ZYRO0D02970g Chr4 complement(231363..233669) [2307 bp, 768 aa] {...    56   4e-07
TPHA0D00430 Chr4 complement(73651..74730) [1080 bp, 359 aa] {ON}...    55   4e-07
NCAS0A09170 Chr1 (1813960..1815846) [1887 bp, 628 aa] {ON} Anc_1...    56   4e-07
SAKL0G08448g Chr7 (718250..721717) [3468 bp, 1155 aa] {ON} simil...    56   4e-07
NDAI0C01890 Chr3 (419452..423777) [4326 bp, 1441 aa] {ON} Anc_5....    56   4e-07
Smik_10.132 Chr10 (212933..214873) [1941 bp, 646 aa] {ON} YJL106...    56   5e-07
Smik_6.441 Chr6 (721619..722713) [1095 bp, 364 aa] {ON} YPL236C ...    55   5e-07
CAGL0G04455g Chr7 (426386..428641) [2256 bp, 751 aa] {ON} simila...    56   5e-07
Suva_6.182 Chr6 complement(328699..330642) [1944 bp, 647 aa] {ON...    55   6e-07
YJL106W Chr10 (221390..223327) [1938 bp, 645 aa] {ON}  IME2Serin...    55   6e-07
Skud_10.153 Chr10 (288733..290742) [2010 bp, 669 aa] {ON} YJL057...    55   6e-07
NCAS0C03810 Chr3 complement(772530..773660) [1131 bp, 376 aa] {O...    55   6e-07
Suva_6.222 Chr6 (400975..402096) [1122 bp, 373 aa] {ON} YJL141C ...    54   9e-07
YPL236C Chr16 complement(101608..102702) [1095 bp, 364 aa] {ON} ...    54   9e-07
TDEL0C00660 Chr3 complement(107849..108952) [1104 bp, 367 aa] {O...    54   9e-07
YFL029C Chr6 complement(78055..79161) [1107 bp, 368 aa] {ON}  CA...    54   9e-07
Kpol_463.19 s463 complement(53246..55561) [2316 bp, 771 aa] {ON}...    55   9e-07
Skud_10.107 Chr10 (189314..191254) [1941 bp, 646 aa] {ON} YJL106...    55   1e-06
Suva_16.70 Chr16 complement(110631..111725) [1095 bp, 364 aa] {O...    54   1e-06
CAGL0J05082g Chr10 (483782..485743) [1962 bp, 653 aa] {ON} simil...    54   2e-06
Kpol_1002.21 s1002 complement(62702..63895) [1194 bp, 397 aa] {O...    54   2e-06
KAFR0A01340 Chr1 (259300..261171) [1872 bp, 623 aa] {ON} Anc_1.2...    54   2e-06
NDAI0A00920 Chr1 (189693..192521) [2829 bp, 942 aa] {ON} Anc_1.1...    54   2e-06
Kwal_33.15381 s33 complement(1080902..1083868) [2967 bp, 988 aa]...    54   2e-06
TPHA0I02660 Chr9 (582108..584219) [2112 bp, 703 aa] {ON} Anc_1.3...    53   4e-06
NDAI0G05370 Chr7 (1313015..1315555) [2541 bp, 846 aa] {ON} Anc_1...    53   5e-06
KLTH0B02178g Chr2 (171582..174551) [2970 bp, 989 aa] {ON} simila...    52   6e-06
ZYRO0G17094g Chr7 complement(1404552..1406804) [2253 bp, 750 aa]...    52   6e-06
CAGL0H00979g Chr8 complement(94328..95527) [1200 bp, 399 aa] {ON...    51   9e-06
Skud_13.385 Chr13 complement(672612..674966) [2355 bp, 784 aa] {...    52   9e-06
KNAG0B05340 Chr2 complement(1031600..1033588) [1989 bp, 662 aa] ...    51   1e-05
NDAI0F01340 Chr6 complement(327928..329148) [1221 bp, 406 aa] {O...    50   1e-05
Suva_13.399 Chr13 complement(679223..681388) [2166 bp, 721 aa] {...    51   1e-05
ZYRO0A06182g Chr1 (493846..496062) [2217 bp, 738 aa] {ON} simila...    51   1e-05
KNAG0A07560 Chr1 (1186540..1187550) [1011 bp, 336 aa] {ON} Anc_3...    50   2e-05
TPHA0H01880 Chr8 (441140..442402) [1263 bp, 420 aa] {ON} Anc_6.2...    50   2e-05
Ecym_3487 Chr3 complement(910575..914810) [4236 bp, 1411 aa] {ON...    51   2e-05
YMR216C Chr13 complement(698811..701039) [2229 bp, 742 aa] {ON} ...    51   2e-05
TDEL0B03770 Chr2 (676581..678575) [1995 bp, 664 aa] {ON} Anc_8.7...    50   2e-05
TDEL0A06750 Chr1 (1179818..1180936) [1119 bp, 372 aa] {ON} Anc_6...    50   2e-05
Kpol_1064.42 s1064 complement(78573..80207) [1635 bp, 544 aa] {O...    50   3e-05
Smik_13.424 Chr13 complement(682907..685177) [2271 bp, 756 aa] {...    50   3e-05
KAFR0A01740 Chr1 complement(356086..358035) [1950 bp, 649 aa] {O...    50   3e-05
TBLA0A02040 Chr1 complement(493305..495056) [1752 bp, 583 aa] {O...    50   3e-05
SAKL0B01474g Chr2 complement(145734..146777) [1044 bp, 347 aa] {...    49   4e-05
KLTH0G18282g Chr7 complement(1576512..1577558) [1047 bp, 348 aa]...    49   4e-05
Suva_6.29 Chr6 complement(51588..52691) [1104 bp, 367 aa] {ON} Y...    49   5e-05
Skud_6.41 Chr6 complement(81310..82416) [1107 bp, 368 aa] {ON} Y...    49   5e-05
Ecym_2153 Chr2 complement(287697..288788) [1092 bp, 363 aa] {ON}...    49   6e-05
TBLA0D01110 Chr4 (283160..285640) [2481 bp, 826 aa] {ON} Anc_8.7...    49   6e-05
Kwal_56.24274 s56 (932404..933444) [1041 bp, 346 aa] {ON} YPL236...    48   6e-05
Smik_6.49 Chr6 complement(93305..94408) [1104 bp, 367 aa] {ON} Y...    48   6e-05
NCAS0G01210 Chr7 complement(215860..216963) [1104 bp, 367 aa] {O...    48   7e-05
Kpol_413.7 s413 complement(18363..20267) [1905 bp, 634 aa] {ON} ...    49   8e-05
KAFR0F02310 Chr6 (452380..453912) [1533 bp, 510 aa] {ON} Anc_3.1...    48   9e-05
CAGL0F03905g Chr6 complement(377962..380088) [2127 bp, 708 aa] {...    49   9e-05
TPHA0J02370 Chr10 complement(523628..525016) [1389 bp, 462 aa] {...    48   1e-04
Kwal_14.1249 s14 (252877..253911) [1035 bp, 344 aa] {ON} YFL029C...    47   1e-04
NCAS0I01210 Chr9 complement(218242..222582) [4341 bp, 1446 aa] {...    48   1e-04
TPHA0G01380 Chr7 (279600..281579) [1980 bp, 659 aa] {ON} Anc_8.7...    48   1e-04
KLLA0B11924g Chr2 complement(1043344..1047582) [4239 bp, 1412 aa...    48   2e-04
ZYRO0E07876g Chr5 (616134..617243) [1110 bp, 369 aa] {ON} simila...    47   2e-04
CAGL0H03245g Chr8 (303335..305686) [2352 bp, 783 aa] {ON} simila...    47   2e-04
TBLA0F01730 Chr6 complement(431961..433004) [1044 bp, 347 aa] {O...    47   2e-04
SAKL0C07876g Chr3 (732534..733970) [1437 bp, 478 aa] {ON} simila...    47   2e-04
KLLA0F22605g Chr6 complement(2109034..2111913) [2880 bp, 959 aa]...    47   2e-04
AER216C Chr5 complement(1032840..1034348) [1509 bp, 502 aa] {ON}...    47   2e-04
CAGL0K01815g Chr11 (162973..164487) [1515 bp, 504 aa] {ON} simil...    47   2e-04
Ecym_8210 Chr8 (431406..434297) [2892 bp, 963 aa] {ON} similar t...    47   2e-04
NDAI0K01030 Chr11 (239418..241712) [2295 bp, 764 aa] {ON} Anc_8....    47   3e-04
TDEL0D04390 Chr4 complement(799835..801340) [1506 bp, 501 aa] {O...    47   3e-04
TPHA0A03700 Chr1 complement(808996..813273) [4278 bp, 1425 aa] {...    47   3e-04
TBLA0B06620 Chr2 complement(1556378..1559671) [3294 bp, 1097 aa]...    47   3e-04
Ecym_5258 Chr5 (536868..538376) [1509 bp, 502 aa] {ON} similar t...    47   3e-04
Kpol_538.20 s538 (39404..42382) [2979 bp, 992 aa] {ON} (39404..4...    47   3e-04
SAKL0H05214g Chr8 (468419..470185) [1767 bp, 588 aa] {ON} simila...    47   3e-04
KNAG0K01660 Chr11 complement(345808..347331) [1524 bp, 507 aa] {...    46   4e-04
AER348C Chr5 complement(1275897..1277774) [1878 bp, 625 aa] {ON}...    46   4e-04
KLTH0H03080g Chr8 complement(274038..275078) [1041 bp, 346 aa] {...    46   4e-04
NDAI0D02140 Chr4 complement(496708..499785) [3078 bp, 1025 aa] {...    46   4e-04
NCAS0C01030 Chr3 (192001..194043) [2043 bp, 680 aa] {ON} Anc_8.732     46   4e-04
ZYRO0A05060g Chr1 complement(405402..406886) [1485 bp, 494 aa] {...    46   5e-04
KNAG0J02520 Chr10 (472464..476795) [4332 bp, 1443 aa] {ON} Anc_3...    46   6e-04
Kpol_1010.68 s1010 complement(168093..169595) [1503 bp, 500 aa] ...    45   6e-04
Suva_7.258 Chr7 (445704..447911) [2208 bp, 735 aa] {ON} YGL021W ...    46   6e-04
AGR315C Chr7 complement(1319993..1322872) [2880 bp, 959 aa] {ON}...    45   7e-04
KNAG0J02030 Chr10 complement(368141..370327) [2187 bp, 728 aa] {...    45   8e-04
Kwal_27.12562 s27 (1274883..1279139) [4257 bp, 1418 aa] {ON} YBR...    45   0.001
NDAI0F01640 Chr6 (401323..403086) [1764 bp, 587 aa] {ON} Anc_6.215     45   0.001
Kwal_26.6921 s26 (123345..123875) [531 bp, 176 aa] {OFF} YOR351C...    43   0.001
KAFR0C02290 Chr3 complement(449963..451204) [1242 bp, 413 aa] {O...    44   0.001
NCAS0I01870 Chr9 (345214..346866) [1653 bp, 550 aa] {ON} Anc_3.1...    45   0.001
KLTH0D12518g Chr4 complement(1023214..1024992) [1779 bp, 592 aa]...    45   0.001
TPHA0A04330 Chr1 (974713..976218) [1506 bp, 501 aa] {ON} Anc_3.1...    44   0.001
NCAS0A01090 Chr1 (216576..218042) [1467 bp, 488 aa] {ON} Anc_6.215     44   0.001
SAKL0A03344g Chr1 complement(305149..306243) [1095 bp, 364 aa] {...    44   0.001
KAFR0K00880 Chr11 (188439..191069) [2631 bp, 876 aa] {ON} Anc_5....    45   0.001
Kwal_26.9032 s26 complement(1047382..1049157) [1776 bp, 591 aa] ...    44   0.002
NDAI0A07790 Chr1 (1790683..1795206) [4524 bp, 1507 aa] {ON} Anc_...    44   0.002
TPHA0G00610 Chr7 (114519..116138) [1620 bp, 539 aa] {ON} Anc_8.7...    44   0.002
KLTH0E15972g Chr5 complement(1414595..1416016) [1422 bp, 473 aa]...    44   0.002
NCAS0A07080 Chr1 complement(1400590..1403607) [3018 bp, 1005 aa]...    44   0.002
CAGL0G01716g Chr7 complement(155248..156390) [1143 bp, 380 aa] {...    43   0.002
Ecym_6239 Chr6 complement(445704..447791) [2088 bp, 695 aa] {ON}...    44   0.003
ZYRO0G08866g Chr7 complement(713156..714661) [1506 bp, 501 aa] {...    44   0.003
Kpol_1033.51 s1033 complement(127843..129165) [1323 bp, 440 aa] ...    43   0.003
KLLA0C04345g Chr3 (397899..399326) [1428 bp, 475 aa] {ON} simila...    43   0.003
TBLA0B01650 Chr2 (370837..372306) [1470 bp, 489 aa] {ON} Anc_3.1...    43   0.003
TPHA0E02830 Chr5 (591805..593364) [1560 bp, 519 aa] {ON} Anc_6.2...    43   0.003
ZYRO0G12232g Chr7 (964508..967591) [3084 bp, 1027 aa] {ON} simil...    43   0.004
Skud_7.266 Chr7 (458004..460217) [2214 bp, 737 aa] {ON} YGL021W ...    43   0.004
KLLA0C07216g Chr3 (626227..628278) [2052 bp, 683 aa] {ON} simila...    43   0.004
KLTH0E15026g Chr5 (1331171..1335730) [4560 bp, 1519 aa] {ON} sim...    43   0.004
Kpol_1065.32 s1065 complement(65735..70255) [4521 bp, 1506 aa] {...    43   0.004
Suva_4.232 Chr4 (417104..418627) [1524 bp, 507 aa] {ON} YDL017W ...    43   0.004
KNAG0D00830 Chr4 complement(130823..131986) [1164 bp, 387 aa] {O...    42   0.004
CAGL0I08899g Chr9 complement(863906..866701) [2796 bp, 931 aa] {...    43   0.004
Smik_4.218 Chr4 (406174..407697) [1524 bp, 507 aa] {ON} YDL017W ...    43   0.005
NDAI0B04530 Chr2 complement(1128472..1130094) [1623 bp, 540 aa] ...    43   0.005
NCAS0D03820 Chr4 complement(708820..710241) [1422 bp, 473 aa] {O...    42   0.005
YGL021W Chr7 (454785..457067) [2283 bp, 760 aa] {ON}  ALK1Protei...    43   0.005
KAFR0K00320 Chr11 (72569..73942) [1374 bp, 457 aa] {ON} Anc_6.21...    42   0.005
SAKL0G13882g Chr7 complement(1191656..1194604) [2949 bp, 982 aa]...    43   0.006
TDEL0E04680 Chr5 complement(875878..878862) [2985 bp, 994 aa] {O...    43   0.006
Kpol_1002.61 s1002 complement(167383..169851) [2469 bp, 822 aa] ...    42   0.006
SAKL0H10340g Chr8 complement(883790..886009) [2220 bp, 739 aa] {...    42   0.006
KLTH0D02970g Chr4 complement(284533..285945) [1413 bp, 470 aa] {...    42   0.006
ZYRO0F09174g Chr6 complement(744109..745638) [1530 bp, 509 aa] {...    42   0.006
Smik_7.269 Chr7 (446854..449094) [2241 bp, 746 aa] {ON} YGL021W ...    42   0.006
Suva_16.102 Chr16 (173734..175209) [1476 bp, 491 aa] {ON} YPL204...    42   0.007
TDEL0E05230 Chr5 complement(958851..960323) [1473 bp, 490 aa] {O...    42   0.007
YDL017W Chr4 (424209..425732) [1524 bp, 507 aa] {ON}  CDC7DDK (D...    42   0.007
SAKL0B07326g Chr2 (627224..631477) [4254 bp, 1417 aa] {ON} simil...    42   0.007
TPHA0I01240 Chr9 (283537..285210) [1674 bp, 557 aa] {ON} Anc_2.1...    42   0.007
Ecym_2202 Chr2 (399184..400629) [1446 bp, 481 aa] {ON} similar t...    42   0.007
Smik_6.409 Chr6 complement(658629..660119) [1491 bp, 496 aa] {ON...    42   0.008
SAKL0A04444g Chr1 (412103..413527) [1425 bp, 474 aa] {ON} highly...    42   0.009
KNAG0D01130 Chr4 (190658..191947) [1290 bp, 429 aa] {ON} Anc_6.2...    42   0.010
CAGL0H03553g Chr8 complement(328668..330155) [1488 bp, 495 aa] {...    42   0.010
YPL204W Chr16 (164276..165760) [1485 bp, 494 aa] {ON}  HRR25Prot...    42   0.011
NDAI0F03150 Chr6 complement(757283..758923) [1641 bp, 546 aa] {O...    42   0.011
Kwal_56.24064 s56 complement(831165..832592) [1428 bp, 475 aa] {...    42   0.011
NDAI0A06470 Chr1 (1470263..1472083) [1821 bp, 606 aa] {ON} Anc_3...    42   0.011
TPHA0J02290 Chr10 (508389..510779) [2391 bp, 796 aa] {ON} Anc_6....    42   0.012
Skud_16.75 Chr16 (137624..139108) [1485 bp, 494 aa] {ON} YPL204W...    41   0.012
NCAS0B07200 Chr2 complement(1363351..1364940) [1590 bp, 529 aa] ...    41   0.012
KLTH0H04158g Chr8 (378344..379798) [1455 bp, 484 aa] {ON} simila...    41   0.012
Suva_15.332 Chr15 complement(575263..575547,575959..576084,57614...    41   0.013
KNAG0F01490 Chr6 (270931..272604) [1674 bp, 557 aa] {ON} Anc_2.1...    41   0.013
Skud_8.196 Chr8 complement(346056..346463,346494..347684) [1599 ...    41   0.015
Skud_4.237 Chr4 (418979..420502) [1524 bp, 507 aa] {ON} YDL017W ...    41   0.016
YHR135C Chr8 complement(372694..374310) [1617 bp, 538 aa] {ON}  ...    41   0.017
NDAI0I01070 Chr9 (259836..261278) [1443 bp, 480 aa] {ON} Anc_6.215     40   0.020
CAGL0G06138g Chr7 complement(585585..587204) [1620 bp, 539 aa] {...    40   0.021
Kwal_56.23723 s56 complement(676986..677432) [447 bp, 149 aa] {O...    39   0.022
YBR097W Chr2 (436951..441315) [4365 bp, 1454 aa] {ON}  VPS15Myri...    41   0.022
KLLA0D03168g Chr4 (265761..267278) [1518 bp, 505 aa] {ON} simila...    40   0.023
Smik_2.239 Chr2 (421843..426207) [4365 bp, 1454 aa] {ON} YBR097W...    40   0.029
AFR040W Chr6 (505602..507245) [1644 bp, 547 aa] {ON} Syntenic ho...    40   0.033
Kwal_27.9804 s27 (69307..70728) [1422 bp, 473 aa] {ON} YDL017W (...    40   0.035
AFL091W Chr6 (272431..273867) [1437 bp, 478 aa] {ON} Syntenic ho...    40   0.035
CAGL0J05940g Chr10 (562687..564147) [1461 bp, 486 aa] {ON} simil...    40   0.043
KNAG0E03740 Chr5 complement(738877..741528) [2652 bp, 883 aa] {O...    40   0.044
KAFR0A07320 Chr1 complement(1478564..1480033) [1470 bp, 489 aa] ...    40   0.044
Kpol_1002.53 s1002 (150289..151668) [1380 bp, 459 aa] {ON} (1502...    39   0.046
Ecym_2618 Chr2 (1196140..1197453) [1314 bp, 437 aa] {ON} similar...    39   0.049
AEL330C Chr5 complement(27521..28105) [585 bp, 194 aa] {ON} Synt...    38   0.055
Kwal_26.7237 s26 complement(276089..277318) [1230 bp, 409 aa] {O...    39   0.055
NCAS0G02120 Chr7 (381894..383465) [1572 bp, 523 aa] {ON} Anc_2.105     39   0.056
Skud_14.179 Chr14 complement(334239..335924) [1686 bp, 561 aa] {...    39   0.059
YPR106W Chr16 (740061..741392) [1332 bp, 443 aa] {ON}  ISR1Predi...    39   0.061
TBLA0A06660 Chr1 complement(1626147..1630400) [4254 bp, 1417 aa]...    39   0.063
Smik_14.174 Chr14 complement(323054..324709) [1656 bp, 551 aa] {...    39   0.063
Smik_8.216 Chr8 complement(349478..351145) [1668 bp, 555 aa] {ON...    39   0.068
KAFR0D04250 Chr4 (837888..839207) [1320 bp, 439 aa] {ON} Anc_3.4...    39   0.069
TBLA0B05310 Chr2 complement(1251914..1253494) [1581 bp, 526 aa] ...    39   0.070
Suva_4.344 Chr4 (606007..610371) [4365 bp, 1454 aa] {ON} YBR097W...    39   0.072
Suva_14.185 Chr14 complement(340104..341789) [1686 bp, 561 aa] {...    39   0.076
Skud_2.225 Chr2 (405095..409459) [4365 bp, 1454 aa] {ON} YBR097W...    39   0.077
YNL154C Chr14 complement(343636..345276) [1641 bp, 546 aa] {ON} ...    39   0.078
Kpol_1027.20 s1027 complement(43412..44974) [1563 bp, 520 aa] {O...    39   0.078
YGL083W Chr7 (353058..355472) [2415 bp, 804 aa] {ON}  SCY1Putati...    39   0.079
Suva_7.481 Chr7 complement(829537..832644) [3108 bp, 1035 aa] {O...    39   0.11 
KAFR0G01670 Chr7 (363200..367459) [4260 bp, 1419 aa] {ON} Anc_3....    39   0.12 
Suva_16.433 Chr16 (747883..749205) [1323 bp, 440 aa] {ON} YPR106...    38   0.15 
YGR188C Chr7 complement(872044..875109) [3066 bp, 1021 aa] {ON} ...    38   0.16 
KNAG0F01980 Chr6 (379013..380368) [1356 bp, 451 aa] {ON} Anc_6.2...    38   0.16 
KAFR0B03270 Chr2 complement(677477..679231) [1755 bp, 584 aa] {O...    37   0.19 
ZYRO0G08316g Chr7 (677123..679465) [2343 bp, 780 aa] {ON} simila...    37   0.23 
SAKL0E12100g Chr5 complement(1004036..1005622) [1587 bp, 528 aa]...    37   0.24 
KLLA0D11044g Chr4 complement(942458..944068) [1611 bp, 536 aa] {...    37   0.25 
TBLA0B05130 Chr2 complement(1207884..1210484) [2601 bp, 866 aa] ...    37   0.27 
Skud_7.518 Chr7 complement(847291..850359) [3069 bp, 1022 aa] {O...    37   0.28 
TBLA0D00250 Chr4 (61918..63618) [1701 bp, 566 aa] {ON} Anc_2.105...    37   0.32 
KNAG0H03710 Chr8 complement(687550..689184) [1635 bp, 544 aa] {O...    37   0.38 
Smik_6.306 Chr6 complement(480942..484031) [3090 bp, 1029 aa] {O...    37   0.44 
TDEL0F00910 Chr6 (157379..159070) [1692 bp, 563 aa] {ON} Anc_2.1...    36   0.44 
TPHA0J03180 Chr10 complement(691886..694882) [2997 bp, 998 aa] {...    36   0.51 
SAKL0B09350g Chr2 (793524..794798) [1275 bp, 424 aa] {ON} weakly...    36   0.55 
ZYRO0G05412g Chr7 (435657..437408) [1752 bp, 583 aa] {ON} simila...    36   0.59 
Skud_16.391 Chr16 (704392..705723) [1332 bp, 443 aa] {ON} YPR106...    36   0.60 
KLTH0B06204g Chr2 complement(502282..503778) [1497 bp, 498 aa] {...    35   0.89 
AEL065C Chr5 complement(511520..514597) [3078 bp, 1025 aa] {ON} ...    35   1.2  
Kwal_33.14596 s33 (735962..737464) [1503 bp, 500 aa] {ON} YNL154...    35   1.3  
SAKL0A05038g Chr1 complement(458190..460628) [2439 bp, 812 aa] {...    35   1.3  
KAFR0F00520 Chr6 (111106..112659) [1554 bp, 517 aa] {ON} Anc_2.1...    34   2.1  
TDEL0C04810 Chr3 (867670..871932) [4263 bp, 1420 aa] {ON} Anc_3....    34   3.1  
TBLA0G02780 Chr7 (730835..732529) [1695 bp, 564 aa] {ON} Anc_8.1...    33   3.3  
Smik_16.346 Chr16 (617471..618802) [1332 bp, 443 aa] {ON} YPR106...    33   3.4  
ZYRO0G11550g Chr7 complement(915944..918787) [2844 bp, 947 aa] {...    33   3.9  
SAKL0G14542g Chr7 (1253864..1256701) [2838 bp, 945 aa] {ON} high...    33   4.9  
SAKL0D00396g Chr4 (33694..33709,33774..34258) [501 bp, 166 aa] {...    31   7.5  
ZYRO0C15884g Chr3 (1241605..1245873) [4269 bp, 1422 aa] {ON} sim...    32   9.1  

>Smik_3.54 Chr3 (80309..83407) [3099 bp, 1032 aa] {ON} YCL024W (REAL)
          Length = 1032

 Score = 1868 bits (4840), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 939/1032 (90%), Positives = 939/1032 (90%)

Query: 1    MAVANMETYRITKPLNIIGPWKLGETLGFGSTGKVQLARHERTGQKTAVKVIPKSIFKSE 60
            MAVANMETYRITKPLNIIGPWKLGETLGFGSTGKVQLARHERTGQKTAVKVIPKSIFKSE
Sbjct: 1    MAVANMETYRITKPLNIIGPWKLGETLGFGSTGKVQLARHERTGQKTAVKVIPKSIFKSE 60

Query: 61   GSHGNNDSVLPFNIEREIVIMKLLSHPNVLSLYDVWETDNNLYLILEYAEKGELFNLLVD 120
            GSHGNNDSVLPFNIEREIVIMKLLSHPNVLSLYDVWETDNNLYLILEYAEKGELFNLLVD
Sbjct: 61   GSHGNNDSVLPFNIEREIVIMKLLSHPNVLSLYDVWETDNNLYLILEYAEKGELFNLLVD 120

Query: 121  RGPLPEREAIKCFKQIIIAISYCHALGIVHRDLKPENLLLDNSYNIKIADFGMAALQTDA 180
            RGPLPEREAIKCFKQIIIAISYCHALGIVHRDLKPENLLLDNSYNIKIADFGMAALQTDA
Sbjct: 121  RGPLPEREAIKCFKQIIIAISYCHALGIVHRDLKPENLLLDNSYNIKIADFGMAALQTDA 180

Query: 181  GMLETSCGSPHYAAPEIVSGLPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRDLLLK 240
            GMLETSCGSPHYAAPEIVSGLPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRDLLLK
Sbjct: 181  GMLETSCGSPHYAAPEIVSGLPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRDLLLK 240

Query: 241  VQKGQFEMPNNAEISGDAQDLIRRILVVDPTQRIKIRDILSHPLLKKYQTIKDSKSIKDL 300
            VQKGQFEMPNNAEISGDAQDLIRRILVVDPTQRIKIRDILSHPLLKKYQTIKDSKSIKDL
Sbjct: 241  VQKGQFEMPNNAEISGDAQDLIRRILVVDPTQRIKIRDILSHPLLKKYQTIKDSKSIKDL 300

Query: 301  PRENTYLYPLADADNHTSVTIDDSILQNLVILWHGRPAEEIMKKLQDNGTNTEKTLYALL 360
            PRENTYLYPLADADNHTSVTIDDSILQNLVILWHGRPAEEIMKKLQDNGTNTEKTLYALL
Sbjct: 301  PRENTYLYPLADADNHTSVTIDDSILQNLVILWHGRPAEEIMKKLQDNGTNTEKTLYALL 360

Query: 361  YRFKLESMKETNKRSRSKINXXXXXXXXXXXXXXXXXAFNHQSLDSAPRKHASRGHSKNF 420
            YRFKLESMKETNKRSRSKIN                 AFNHQSLDSAPRKHASRGHSKNF
Sbjct: 361  YRFKLESMKETNKRSRSKINKTKKSKRVSTLSSSSSSAFNHQSLDSAPRKHASRGHSKNF 420

Query: 421  PXXXXXXXXXXXXXXTDCSPIPLRSSKRISISSAVPGNTLQVPDXXXXXXXXXXXXXXXX 480
            P              TDCSPIPLRSSKRISISSAVPGNTLQVPD                
Sbjct: 421  PSSRKRSSFILSSNSTDCSPIPLRSSKRISISSAVPGNTLQVPDSSLKLKRNSKRSSKRL 480

Query: 481  XYMPNLGRGXXXXXXXXXXXXXIXXXXXXXXXXXTKRTSSNFATLIDEIFEPEKFELAKR 540
             YMPNLGRG             I           TKRTSSNFATLIDEIFEPEKFELAKR
Sbjct: 481  SYMPNLGRGSLTTNLLSNYTNLIDDDDWEYIDKDTKRTSSNFATLIDEIFEPEKFELAKR 540

Query: 541  EKAELQKKVQEAKRQVSKNAPISDEKDVGFEVSDGMRELKKINNKVSSPLMNYEFSQKEL 600
            EKAELQKKVQEAKRQVSKNAPISDEKDVGFEVSDGMRELKKINNKVSSPLMNYEFSQKEL
Sbjct: 541  EKAELQKKVQEAKRQVSKNAPISDEKDVGFEVSDGMRELKKINNKVSSPLMNYEFSQKEL 600

Query: 601  LQDIDTLLTNRYQLSSYTRPISRLDPGLTPVTGAIPHSIKEKTALLQDTEMKIIETIRKS 660
            LQDIDTLLTNRYQLSSYTRPISRLDPGLTPVTGAIPHSIKEKTALLQDTEMKIIETIRKS
Sbjct: 601  LQDIDTLLTNRYQLSSYTRPISRLDPGLTPVTGAIPHSIKEKTALLQDTEMKIIETIRKS 660

Query: 661  EFLGSLLNVREGISQDNNQLASIEVSPKISTTPLMYNDQVEIRKISDVEVPHFTRKSKHF 720
            EFLGSLLNVREGISQDNNQLASIEVSPKISTTPLMYNDQVEIRKISDVEVPHFTRKSKHF
Sbjct: 661  EFLGSLLNVREGISQDNNQLASIEVSPKISTTPLMYNDQVEIRKISDVEVPHFTRKSKHF 720

Query: 721  TTANNRRSVLSLYSLKESLEDLNQISKNEEPDSPPQGSTDNASKSELVDVIEEVTEXXXX 780
            TTANNRRSVLSLYSLKESLEDLNQISKNEEPDSPPQGSTDNASKSELVDVIEEVTE    
Sbjct: 721  TTANNRRSVLSLYSLKESLEDLNQISKNEEPDSPPQGSTDNASKSELVDVIEEVTEQKNS 780

Query: 781  XXXXXXXXXXXXXXXXXILYDVPECVDSPQGYDINDAHSTQSPASKSTEPKPVVKLPSLS 840
                             ILYDVPECVDSPQGYDINDAHSTQSPASKSTEPKPVVKLPSLS
Sbjct: 781  QHDQDDSNDSNGMNNNNILYDVPECVDSPQGYDINDAHSTQSPASKSTEPKPVVKLPSLS 840

Query: 841  SFQRKNASGLGIYQRESSRESLPSVTINISESDKTTENEAQKEIKHDKSDTILSNHDGKA 900
            SFQRKNASGLGIYQRESSRESLPSVTINISESDKTTENEAQKEIKHDKSDTILSNHDGKA
Sbjct: 841  SFQRKNASGLGIYQRESSRESLPSVTINISESDKTTENEAQKEIKHDKSDTILSNHDGKA 900

Query: 901  DSYKGDISNIVRESSHGSFLKKLSKGKILELDVRAKISEKRLYEGLHKLLEGWKQYGLKN 960
            DSYKGDISNIVRESSHGSFLKKLSKGKILELDVRAKISEKRLYEGLHKLLEGWKQYGLKN
Sbjct: 901  DSYKGDISNIVRESSHGSFLKKLSKGKILELDVRAKISEKRLYEGLHKLLEGWKQYGLKN 960

Query: 961  LGINTADMIISGKLVNDGILSLRSTLFEIVILPNGSGRSLIKFNKKTGSTKTLTKFATEI 1020
            LGINTADMIISGKLVNDGILSLRSTLFEIVILPNGSGRSLIKFNKKTGSTKTLTKFATEI
Sbjct: 961  LGINTADMIISGKLVNDGILSLRSTLFEIVILPNGSGRSLIKFNKKTGSTKTLTKFATEI 1020

Query: 1021 QIILQKEGVLDE 1032
            QIILQKEGVLDE
Sbjct: 1021 QIILQKEGVLDE 1032

>YCL024W Chr3 (79162..82275) [3114 bp, 1037 aa] {ON}  KCC4Protein
            kinase of the bud neck involved in the septin checkpoint,
            associates with septin proteins, negatively regulates
            Swe1p by phosphorylation, shows structural homology to
            bud neck kinases Gin4p and Hsl1p
          Length = 1037

 Score = 1343 bits (3475), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 705/1039 (67%), Positives = 800/1039 (76%), Gaps = 9/1039 (0%)

Query: 1    MAVANMETYRITKPLNIIGPWKLGETLGFGSTGKVQLARHERTGQKTAVKVIPKSIFKSE 60
            M VAN ET+   KP + IGPWKLGETLGFGSTGKVQLA+HERTG +TAVKVI KSIF + 
Sbjct: 1    MTVANTETHSAAKPSSTIGPWKLGETLGFGSTGKVQLAQHERTGHRTAVKVISKSIFNNN 60

Query: 61   GSHGNNDSVLPFNIEREIVIMKLLSHPNVLSLYDVWETDNNLYLILEYAEKGELFNLLVD 120
            G+H N+DSVLP+NIEREIVIMKLLSHPNVLSLYDVWET+NNLYLILEYAEKGELFNLLVD
Sbjct: 61   GNHSNDDSVLPYNIEREIVIMKLLSHPNVLSLYDVWETNNNLYLILEYAEKGELFNLLVD 120

Query: 121  RGPLPEREAIKCFKQIIIAISYCHALGIVHRDLKPENLLLDNSYNIKIADFGMAALQTDA 180
             GPLPEREAI CF+QIII ISYCHALGIVHRDLKPENLLLD+ YNIKIADFGMAALQTDA
Sbjct: 121  HGPLPEREAINCFRQIIIGISYCHALGIVHRDLKPENLLLDSFYNIKIADFGMAALQTDA 180

Query: 181  GMLETSCGSPHYAAPEIVSGLPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRDLLLK 240
             +LETSCGSPHYAAPEIVSGLPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRDLLLK
Sbjct: 181  DLLETSCGSPHYAAPEIVSGLPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRDLLLK 240

Query: 241  VQKGQFEMPNNAEISGDAQDLIRRILVVDPTQRIKIRDILSHPLLKKYQTIKDSKSIKDL 300
            VQKGQFEMPN+ EIS DAQDLI +ILVVDP QRIKIRDILSHPLLKKYQTIKDSKSIKDL
Sbjct: 241  VQKGQFEMPNDTEISRDAQDLIGKILVVDPRQRIKIRDILSHPLLKKYQTIKDSKSIKDL 300

Query: 301  PRENTYLYPLADADNHTSVTIDDSILQNLVILWHGRPAEEIMKKLQDNGTNTEKTLYALL 360
            PRENTYLYPLAD++NHTS +IDDSILQNLV+LWHGR A++I+ KL++NGTN EK LYALL
Sbjct: 301  PRENTYLYPLADSNNHTSASIDDSILQNLVVLWHGRHADDIVSKLKENGTNKEKILYALL 360

Query: 361  YRFKLESMKETNKRSRSKINXXXXXXXXXXXXXXXXXAFNHQSLDSAPRKHASRGHSKNF 420
            YRFKL+S++ +NK++R+KI                    N++S+ S PR+  S+ HS+ F
Sbjct: 361  YRFKLDSVRGSNKKNRNKIKKTKKNKRSSTLSSSSSLLLNNRSIQSTPRRRTSKRHSREF 420

Query: 421  PXXXXXXXXXXXXXXTDCSPIPLRSSKRISISSAVPGNTLQVPDXXXX--XXXXXXXXXX 478
                           TD SPIPLRSSKRI+  +    NT   P                 
Sbjct: 421  SSSRKRSSFLLSSNPTDSSPIPLRSSKRITHINVASANTQATPSGVPNPHKRNSKKRSSK 480

Query: 479  XXXYMPNLGRGXXXXXXXXXXXXXIXXXXXXXXXXXTKRTSSNFATLIDEIFEPEKFELA 538
               YMPN  R              I            KRTSSNFATLIDEIFEPEKFELA
Sbjct: 481  RLSYMPNTKRSSLTSKSLSNFTNLIDDDDWEYIEKDAKRTSSNFATLIDEIFEPEKFELA 540

Query: 539  KREKAELQKKVQEAKRQVSKNAPISDEKDVGFEVSDGMRELKKINNKVSSPLMNYEFSQK 598
            KREKAELQ+KVQEAKRQ S NA   +E + G EVSDGM+ELKKIN+KVSSPL+NYEFSQ+
Sbjct: 541  KREKAELQRKVQEAKRQ-SVNAQKINEDEFGSEVSDGMKELKKINDKVSSPLINYEFSQQ 599

Query: 599  ELLQDIDTLLTNRYQLSSYTRPISRLDPGLTPVTGAIPHSIKEKTALLQDTEMKIIETIR 658
            ELLQDIDTLLTNRYQLSSYTRPISRLDPGLTPVT  +P+++KEKTALLQDTE KIIETIR
Sbjct: 600  ELLQDIDTLLTNRYQLSSYTRPISRLDPGLTPVTETLPNNLKEKTALLQDTEKKIIETIR 659

Query: 659  KSEFLGSLLNVREGISQDNNQLASIEVSPKISTTPLMYNDQVEIRKISDVEVPHFTRKSK 718
            +S+FLGSLLNVR G+S   ++LA IE SP +STTPL+YND++E R+ISDVEVPHFTRKSK
Sbjct: 660  RSKFLGSLLNVRGGLSPGKSELAPIEESPIVSTTPLIYNDRMEPRRISDVEVPHFTRKSK 719

Query: 719  HFTTANNRRSVLSLYSLKESLEDLNQISKNEEPDSPPQGSTDNASKSELVDVIEEVTEXX 778
            HFTTANNRRSVLSLY+ K+S++DLN+    E+PD PPQGSTDN S+SE  ++ E +T+  
Sbjct: 720  HFTTANNRRSVLSLYA-KDSIKDLNEFLIKEDPDLPPQGSTDNESRSEDPEIAESITDSR 778

Query: 779  XXXXXXXXXXXXXXXXXXXILYDVPECVDSPQGYDINDAHSTQSPASKSTEPKPVVKLPS 838
                               IL D P+ V   Q YD+ D +  QSP SKS EP  VVKLPS
Sbjct: 779  NIQYDEDDSKDGDNVNNDNILSDFPQGVGISQEYDMKDKNPNQSPISKSAEPTLVVKLPS 838

Query: 839  LSSFQRKNASGLGIYQRESSRESLPSVTINISESDKTTENEAQKEIKHDKSDTILSNHDG 898
            LSSFQ KNASGLG+YQRE S+ +LPS+T N S   +  E+ A+K  + +K    LS+ D 
Sbjct: 839  LSSFQGKNASGLGLYQREPSKVTLPSLTSNNSSVGENIEDGAEKGTESEKIAASLSDDDL 898

Query: 899  KADSYKGDISNI-----VRESSHGSFLKKLSKGKILELDVRAKISEKRLYEGLHKLLEGW 953
            K D+ K D   +     V++  +   LKK SKGKILEL++ AKI EKRLYEGLHKLLEGW
Sbjct: 899  KEDNDKKDNDTVNAPTTVKKPPNSVLLKKFSKGKILELEIHAKIPEKRLYEGLHKLLEGW 958

Query: 954  KQYGLKNLGINTADMIISGKLVNDGILSLRSTLFEIVILPNGSGRSLIKFNKKTGSTKTL 1013
            KQYGLKNL  N  +MII+GKLVND IL LRSTLFEI++LPNG GRSLIKFNKKTGSTKTL
Sbjct: 959  KQYGLKNLVFNITNMIITGKLVNDSILFLRSTLFEIMVLPNGDGRSLIKFNKKTGSTKTL 1018

Query: 1014 TKFATEIQIILQKEGVLDE 1032
            TK ATEIQIILQKEGVLD+
Sbjct: 1019 TKLATEIQIILQKEGVLDK 1037

>Skud_3.39 Chr3 (66201..69254) [3054 bp, 1017 aa] {ON} YCL024W (REAL)
          Length = 1017

 Score = 1294 bits (3349), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 669/1034 (64%), Positives = 775/1034 (74%), Gaps = 19/1034 (1%)

Query: 1    MAVANMETYRITKPLNIIGPWKLGETLGFGSTGKVQLARHERTGQKTAVKVIPKSIFKSE 60
            M VAN ET    K  + IGPWKLGETLG GS GKV+LA+HE T  KTAVK+I KSIF +E
Sbjct: 1    MTVANTETQTAAKSSSTIGPWKLGETLGVGSAGKVRLAQHEGTAHKTAVKIISKSIFNTE 60

Query: 61   GSHGNNDSVLPFNIEREIVIMKLLSHPNVLSLYDVWETDNNLYLILEYAEKGELFNLLVD 120
            G++GN+ SVLP+NIEREIVIMKLLSHPNVL LYDVWET+NNLYLILEYAEKGELFNLLVD
Sbjct: 61   GNYGNHGSVLPYNIEREIVIMKLLSHPNVLGLYDVWETNNNLYLILEYAEKGELFNLLVD 120

Query: 121  RGPLPEREAIKCFKQIIIAISYCHALGIVHRDLKPENLLLDNSYNIKIADFGMAALQTDA 180
            RG LPEREA+KCF+QIIIA+SYCHALGIVHRDLKPENLLLD+ YNIK+ADFGMAALQTDA
Sbjct: 121  RGALPEREAMKCFRQIIIAVSYCHALGIVHRDLKPENLLLDSDYNIKVADFGMAALQTDA 180

Query: 181  GMLETSCGSPHYAAPEIVSGLPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRDLLLK 240
             +LETSCGSPHYAAPEIVSGLPYEGF+SDVWSCGVILFALLTGRLPFDEENGN+R LLLK
Sbjct: 181  ALLETSCGSPHYAAPEIVSGLPYEGFSSDVWSCGVILFALLTGRLPFDEENGNIRTLLLK 240

Query: 241  VQKGQFEMPNNAEISGDAQDLIRRILVVDPTQRIKIRDILSHPLLKKYQTIKDSKSIKDL 300
            VQ+GQFEMP++ EIS DAQDLI +ILVVDP QRIKIRDILSHPLLK+YQTIKDSKSIKDL
Sbjct: 241  VQRGQFEMPDDTEISKDAQDLISKILVVDPAQRIKIRDILSHPLLKRYQTIKDSKSIKDL 300

Query: 301  PRENTYLYPLADADNHTSVTIDDSILQNLVILWHGRPAEEIMKKLQDNGTNTEKTLYALL 360
            PRE+TYLYPLADA       IDDSILQNLV+LWHGR A+EI  KL+ +GTNTEKTLYALL
Sbjct: 301  PREDTYLYPLADA----GAAIDDSILQNLVVLWHGRHADEIKAKLKASGTNTEKTLYALL 356

Query: 361  YRFKLESMKETNKRSRSKINXXXXXXXXXXXXXXXXXAFNHQSLDSAPRKHASRGHSKNF 420
            YRFKLESM+E+NKR R K                       ++L+S PRK  S+ HS NF
Sbjct: 357  YRFKLESMRESNKRRRHKTKKTKNRKFSTSSSL-----VKGRNLESTPRKRTSKTHSNNF 411

Query: 421  PXXXXXXXXXXXXXXTDCSPIPLRSSKRISISSAVPGNTLQVPDXXXXX-XXXXXXXXXX 479
                            + SPIPLR+SK IS+ +A  G +  VP                 
Sbjct: 412  SSGKKRSSFILSPNSINSSPIPLRNSKGISLRNATSGGSPVVPVILLNSFKRNSKLSSKR 471

Query: 480  XXYMPNLGRGXXXXXXXXXXXXXIXXXXXXXXXXXTKRTSSNFATLIDEIFEPEKFELAK 539
              YMPNL  G             I           TKRTSSNFATLIDEIFEPE+FELAK
Sbjct: 472  SSYMPNLKSGSVTSRLLSNYNKLIDEDDWECIEKDTKRTSSNFATLIDEIFEPEEFELAK 531

Query: 540  REKAELQKKVQEAKRQVSKNAPISDEKDVGFEVSDGMRELKKINNKVSSPLMNYEFSQKE 599
            REK ELQ+KV+ +K        +SD      E +DGM+ELK+IN KVSSPL+NYEFSQ+E
Sbjct: 532  REKVELQRKVRGSK--------MSDNIGDRSEFTDGMKELKRINAKVSSPLINYEFSQQE 583

Query: 600  LLQDIDTLLTNRYQLSSYTRPISRLDPGLTPVTGAIPHSIKEKTALLQDTEMKIIETIRK 659
            LLQDIDTLLTNRYQLS+YTRPIS+LDPGL P  G  PH IKE+TAL++DTE+KIIETI +
Sbjct: 584  LLQDIDTLLTNRYQLSAYTRPISKLDPGLMPAAGTTPHDIKEQTALIRDTEVKIIETIHR 643

Query: 660  SEFLGSLLNVREGISQDNNQLASIEVSPKISTTPLMYNDQVEIRKISDVEVPHFTRKSKH 719
            S+FLGSLLNVREG+S+D+++LA IE S  ISTTPL+Y+D+ E+RKISDVEVPHFTRKS+H
Sbjct: 644  SKFLGSLLNVREGMSKDDDELAPIEESSIISTTPLIYDDRTEVRKISDVEVPHFTRKSRH 703

Query: 720  FTTANNRRSVLSLYSLKESLEDLNQISKNEEPDSPPQGSTDNASKSELVDVIEEVTEXXX 779
            FT A+NRRSVLSLYS ++S +DL+QISKNE  DSP Q S D+ S S+ V   E +     
Sbjct: 704  FTAASNRRSVLSLYSSRDSFKDLSQISKNEYSDSPSQRSVDDTSSSKKVGHTESLASVAE 763

Query: 780  XXXXXXXXXXXXXXXXXXILYDVPECVDSPQGYDINDAHSTQSPASKSTEPKPVVKLPSL 839
                              +LYDVPE VD PQ    +D  S+ S  S S EP PVV+LPSL
Sbjct: 764  HIDDDSYNDHNSGMNSDNVLYDVPEGVDLPQEVKNSDEQSSCSLVSSSLEPTPVVELPSL 823

Query: 840  SSFQRKNASGLGIYQRESSRESLPSVTINISESDKTTENEAQKEIKHDKSDTILSNHDGK 899
            SSFQ KNASGLGIYQRE S+ SLP+ TI+ S++ +  E E +KE+KHD   T L + + K
Sbjct: 824  SSFQGKNASGLGIYQREPSKVSLPTATIDTSDAVENRETEVKKELKHDSIATNLPDDNVK 883

Query: 900  A-DSYKGDISNIVRESSHGSFLKKLSKGKILELDVRAKISEKRLYEGLHKLLEGWKQYGL 958
              ++   +  + +++SS+ S LK +SKGKILEL++ AKI  KRL+EGLHKLLEGWKQYGL
Sbjct: 884  ENNNATAEAPSRIKKSSNVSILKNISKGKILELEIHAKIPNKRLFEGLHKLLEGWKQYGL 943

Query: 959  KNLGINTADMIISGKLVNDGILSLRSTLFEIVILPNGSGRSLIKFNKKTGSTKTLTKFAT 1018
            K LG + A MII GKLVND ILSLRSTLFEI++LPNG  RSLIKFNKKTGS+K LTK AT
Sbjct: 944  KKLGFDAAKMIIKGKLVNDSILSLRSTLFEIIVLPNGDDRSLIKFNKKTGSSKVLTKLAT 1003

Query: 1019 EIQIILQKEGVLDE 1032
            EIQIILQKEGVLD+
Sbjct: 1004 EIQIILQKEGVLDK 1017

>Suva_3.190 Chr3 (288639..288813,288870..291766) [3072 bp, 1024 aa]
            {ON} YDR507C (REAL)
          Length = 1024

 Score = 1206 bits (3119), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 653/1042 (62%), Positives = 751/1042 (72%), Gaps = 42/1042 (4%)

Query: 11   ITKPLNIIGPWKLGETLGFGSTGKVQLARHERTGQKTAVKVIPKSIFKSEGSHGNNDSVL 70
            + KP N IGPW+LGETLG GSTG+VQLA+HERTG KTAVKVI K+IF +E   G     L
Sbjct: 3    MAKPSNTIGPWRLGETLGSGSTGRVQLAQHERTGHKTAVKVISKTIFDTEDGGGXXXLAL 62

Query: 71   PFNIEREIVIMKLLSHPNVLSLYDVWETDNNLYLILEYAEKGELFNLLVDRGPLPEREAI 130
            P+NIEREIV+MKLLSHPNVLSLYDVWET+NNLYLILEYAEKGELFNLLVDRGPLPE+EA+
Sbjct: 63   PYNIEREIVVMKLLSHPNVLSLYDVWETNNNLYLILEYAEKGELFNLLVDRGPLPEKEAV 122

Query: 131  KCFKQIIIAISYCHALGIVHRDLKPENLLLDNSYNIKIADFGMAALQTDAGMLETSCGSP 190
            KCF+QIIIAISYCHALGIVHRDLKPENLLLDN YNIKIADFGMAALQTDA +LETSCGSP
Sbjct: 123  KCFRQIIIAISYCHALGIVHRDLKPENLLLDNDYNIKIADFGMAALQTDARLLETSCGSP 182

Query: 191  HYAAPEIVSGLPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRDLLLKVQKGQFEMPN 250
            HYAAPEIVSGLPY GFASDVWSCGVILFALLTGRLPFDE+NGNVRDLLLKVQ+GQFEMP+
Sbjct: 183  HYAAPEIVSGLPYRGFASDVWSCGVILFALLTGRLPFDEDNGNVRDLLLKVQRGQFEMPD 242

Query: 251  NAEISGDAQDLIRRILVVDPTQRIKIRDILSHPLLKKYQTIKDSKSIKDLPRENTYLYPL 310
              EIS DAQ+LI RILVVDPTQR+K RDIL+HPLLKKYQTI+DSKSI++LPRENTYLYPL
Sbjct: 243  ATEISKDAQNLISRILVVDPTQRMKTRDILTHPLLKKYQTIRDSKSIRNLPRENTYLYPL 302

Query: 311  ADADNHTSVTIDDSILQNLVILWHGRPAEEIMKKLQDNGTNTEKTLYALLYRFKLESMKE 370
            ADA NHT+ TID SILQNLV+LWHGRPA+EI+  L+DNGTNTEKTLYALLYRFK    +E
Sbjct: 303  ADAGNHTNATIDGSILQNLVVLWHGRPADEIVANLKDNGTNTEKTLYALLYRFK----QE 358

Query: 371  TNKRSRSKINXXXXXXXXXXXXXXXXXAFNHQSLD-SAPRKHASRGHSKNFPXXXXXXXX 429
             NKRSR KI                  + +H  L  S PR+   +  S NF         
Sbjct: 359  ANKRSRHKIKKTTKKNPPYPSMSILSSSSSHNRLSGSTPRRRTPKRRSMNFSSSKKRSSF 418

Query: 430  XXXXXXTDCSPIPLRSSKRISISSAVPGNTLQVP-DXXXXXXXXXXXXXXXXXYMPNLGR 488
                  ++ SP+P R+SKR S  +    N   VP                   Y+PN+ R
Sbjct: 419  ILASNSSNGSPMPSRNSKRSSFFNTASANVPPVPVKLLNSYKRNSKRSSKRLSYVPNVKR 478

Query: 489  GXXXXXXXXXXXXXIXXXXXXXXXXXTKRTSSNFATLIDEIFEPEKFELAKREKAELQKK 548
            G             I           TKRTSSNFATLIDEIFEPEKFELA+REKAELQ+K
Sbjct: 479  GSLTSKSLSKYTNLIDEDDWEYIEKDTKRTSSNFATLIDEIFEPEKFELARREKAELQRK 538

Query: 549  VQEAKRQVSKNAPISDEKDVGFEVSDGMRELKKINNKVSSPLMNYEFSQKELLQDIDTLL 608
            VQEAKR  S  A ++ E       SD M ELKKINNKVSSPL+NYE+SQ+ELLQDI+TLL
Sbjct: 539  VQEAKRGKSDVAKLNQENGNETGKSDAMEELKKINNKVSSPLINYEYSQQELLQDINTLL 598

Query: 609  TNRYQLSSYTRPISRLDPGLTPVTGAIPHSIKEKTALLQDTEMKIIETIRKSEFLGSLLN 668
            TNR QLS+YTRPIS+LDPGL P    IP+ IKEKT LL DTEMKI+ETIRKS+ L S LN
Sbjct: 599  TNRCQLSAYTRPISKLDPGLMPTPETIPYDIKEKTDLLLDTEMKILETIRKSKILDSSLN 658

Query: 669  VREGISQDNNQLASIEVSPKISTTPLMY-NDQVEIRKISDVEVPHFTRKSKHFTTANNRR 727
            +R+ +S+D ++L S+E SP  STTPL+Y ND  E+ KISD++VPHFTRKSK FT  NNRR
Sbjct: 659  LRKEVSRDADRLPSVEESPIASTTPLVYNNDSKEVCKISDIQVPHFTRKSKCFTPTNNRR 718

Query: 728  SVLSLYSLKESLEDLNQISKNEEPDSPPQGSTDNASKSELVDVIEEVTEXXXXXXXXXXX 787
            SVLSLYS + S + L++I  +++P + P  S  N   SE +D+ E++             
Sbjct: 719  SVLSLYSSRHSFKGLSRILNSKDPSANPY-SHINGPLSEEIDLTEDIANMKNIENNNNNN 777

Query: 788  XXXXXXXXXXILYDVPECVDSPQGYDIND----------AHSTQSPASKSTEPKPVVKLP 837
                       LYDV E     QG D +D          + S QS  S +TEP   VKLP
Sbjct: 778  NR---------LYDVSESAILLQGNDDDDDDDDNENDDGSQSIQSSVSNNTEPTTFVKLP 828

Query: 838  SLSSFQRKNASGLGIYQR--------ESSRESLPSVTINISESDKTTENEAQKEIKHDKS 889
            SLSSFQ KNASGLGIYQR        ESS E LP+VTI I + D+  EN    EI+H+  
Sbjct: 829  SLSSFQEKNASGLGIYQREPSIEPSIESSIEPLPNVTIAIEDVDEDGEN----EIQHENI 884

Query: 890  DTILSNHDGKADSYKGDISNIVRESSHGSFLKKLSKGKILELDVRAKISEKRLYEGLHKL 949
             T LSN + K +    D  + +RE S+ SFLKK SKGKILEL++ AKI  +RL+EGLHKL
Sbjct: 885  TTSLSNDNIKKND---DTKDTIREYSNVSFLKKFSKGKILELEIHAKIPAERLFEGLHKL 941

Query: 950  LEGWKQYGLKNLGINTADMIISGKLVNDGILSLRSTLFEIVILPNGSGRSLIKFNKKTGS 1009
            LEGWKQYGLKNLG +TA+MII+GKLVND ILSLRSTLFEI++LPN   RSLIKFNKKTGS
Sbjct: 942  LEGWKQYGLKNLGFDTANMIITGKLVNDNILSLRSTLFEIIVLPNRDDRSLIKFNKKTGS 1001

Query: 1010 TKTLTKFATEIQIILQKEGVLD 1031
            TKTL K   EIQI+LQKEGVLD
Sbjct: 1002 TKTLKKLGYEIQIVLQKEGVLD 1023

>Suva_2.687 Chr2 complement(1215095..1218481) [3387 bp, 1128 aa] {ON}
            YCL024W (REAL)
          Length = 1128

 Score =  763 bits (1969), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 490/1144 (42%), Positives = 633/1144 (55%), Gaps = 160/1144 (13%)

Query: 16   NIIGPWKLGETLGFGSTGKVQLARHERTGQKTAVKVIPKSIFKSEGSHG------NNDSV 69
            N IGPWKLGETLG GSTGKVQLAR++ TGQ+ AVKVI K++F S    G      N    
Sbjct: 14   NTIGPWKLGETLGLGSTGKVQLARNKSTGQEAAVKVISKAVFNSGNVSGTSIVGSNTPDA 73

Query: 70   LPFNIEREIVIMKLLSHPNVLSLYDVWETDNNLYLILEYAEKGELFNLLVDRGPLPEREA 129
            LP+ IEREI+IMKLL+HPNVL LYDVWET+ +LYL+LEYAEKGELFNLLV+RGPLPE EA
Sbjct: 74   LPYGIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPENEA 133

Query: 130  IKCFKQIIIAISYCHALGIVHRDLKPENLLLDNSYNIKIADFGMAALQTDAGMLETSCGS 189
            I+ F+QIII +SYCHALGIVHRDLKPENLLLD+ YNIKIADFGMAAL+T+  +LETSCGS
Sbjct: 134  IRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEGKLLETSCGS 193

Query: 190  PHYAAPEIVSGLPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRDLLLKVQKGQFEMP 249
            PHYAAPEIVSG+PY+GFASDVWSCGVILFALLTGRLPFDEE+GN+R LLLKVQKG+FE+P
Sbjct: 194  PHYAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRALLLKVQKGEFELP 253

Query: 250  NNAEISGDAQDLIRRILVVDPTQRIKIRDILSHPLLKKYQTIKDSKSIKDLPRENTYLYP 309
            ++ EIS +AQDLI +IL VDP +RIK RDIL HPLL+KY +I+DSKSI+DLPRE+TYL P
Sbjct: 254  SDDEISREAQDLISKILTVDPERRIKARDILKHPLLQKYPSIRDSKSIRDLPREDTYLTP 313

Query: 310  LADADNHTSVTIDDSILQNLVILWHGRPAEEIMKKLQDNGTNTEKTLYALLYRFKLESMK 369
            L+++++    +ID +ILQNLVILWHGR  + I  KLQ+ G N EKTLYALLYRFK ++ K
Sbjct: 314  LSESNS----SIDATILQNLVILWHGRDPDGIRAKLQEPGANAEKTLYALLYRFKCDTQK 369

Query: 370  ETNK----RSRSKINXXX-----------------XXXXXXXXXXXXXXAFNHQSLDSAP 408
            E  K    R R  I                                   +FN  +  SA 
Sbjct: 370  ELIKQQQIRKRQSIGSVSISPPKRTSTTPQRRRNRESIISVSSSRKKPISFNKFTASSAS 429

Query: 409  RKH-----ASRGHSKNFPXXXXXXXXXXXXXXTDCSPIPLRSSKRISISSAVPGNTLQVP 463
              +     +S+  SKNF                  SP P   +KR SI++          
Sbjct: 430  SSNLTTPGSSKRLSKNF-----SSKKKLSTIVNQSSPTPSSRNKRTSIANVDKNQKRASI 484

Query: 464  DXXXXXXXXXXXXXXXXXYMPNLGRGXXXXXXXXXXXXXIXXXXXXXXXXXTKRTSSNFA 523
                               +P++ R                          TKRTSSNFA
Sbjct: 485  FSTTKKNKRASKSTRRMSLIPSMKRESVTTKLMSTYAKLAEDDDWEYIEKETKRTSSNFA 544

Query: 524  TLIDEIFEPEKFELAKREKAELQKKVQEAK--RQVSKNAPISDEKDVGF------EVSDG 575
            TLIDEIFE EK++  ++EK EL++KV+EAK   ++ +     +EK+         E+   
Sbjct: 545  TLIDEIFEYEKYDQIRKEKEELERKVKEAKALEELERRKRKQEEKERARKLLEKEELKRK 604

Query: 576  MRELKK-------------INNK----------VSSPLMNYEFSQKELLQDIDTLLTNRY 612
              ELKK             IN++          +S+P+ N E +   L  DID +L  R 
Sbjct: 605  QEELKKQIDIDISDLEHELINHREEKFEGNIRSISAPMENEENNINHLEADIDNILRRR- 663

Query: 613  QLSSYTRPISRLDPGL---TPVTGAIPHSIKEKTALLQDTEMKIIETIRKSEFLGSLLNV 669
              S  TRP+SRLDPG+   +P+    P   K+       TE KI+ETIR+S+FLGS  N+
Sbjct: 664  NFSLQTRPVSRLDPGIIFSSPIETEDPVEPKKAENERLTTEKKILETIRRSKFLGSSFNI 723

Query: 670  ---------------------REGISQDNNQLASIEVSPK-------------ISTTPLM 695
                                  E I  D+N      V PK              +TT L+
Sbjct: 724  DKELKLSQMEYPGMAAPQRLSEERIVSDSNGKYESLVLPKDAKGVAHLKDNTAPTTTELL 783

Query: 696  YNDQVEIRKISDVEVPHFTRKSKHFTTANNRRSVLSLYSLKESLEDLNQISKNEEPDSPP 755
             N   E+RKISD+ VP FTRKS+HF+ +N R SVLS+YS KES  +L  I KN   D  P
Sbjct: 784  SNG--ELRKISDIRVPQFTRKSRHFSESNKRLSVLSMYSTKESFTNLVDILKNGNLDINP 841

Query: 756  QG-----STDNASKSE-LVDVIEEVTEXXXXXXXXXXXXXXXXXXXXXILYDVPE-CVDS 808
            Q      +  +A  SE L + + E  E                      LYDV + C+  
Sbjct: 842  QQNQRVPTPRSADDSEFLFETVNEEAEYTGNSSNDER------------LYDVGDSCIKD 889

Query: 809  PQGYDINDAH----STQSPASKSTEPKPVVKLPSLSSFQRKNASG-LGIYQRESSRESLP 863
                 +N A     ST    +K+      + LP+L     K+ +G  G  Q +      P
Sbjct: 890  KNTLKLNFADRFNGSTNEKETKN------LHLPTLPPLNGKDEAGKQGEEQEKEDLHEQP 943

Query: 864  SVTINISESDKTTENEAQKEIKHDK---------------SDTILSNHDGKADSYKGDIS 908
             V   I ESD  +  E +++ + D+                 T   N+D +A +   D  
Sbjct: 944  KVKSMIPESDSLSHAEKEQKEREDQQRGGKDLEPPLNKSVQKTREKNNDTQAKNQSTDPK 1003

Query: 909  NIVRESSHGSFLKKL--SKGKILELDVRAKISEKRLYEGLHKLLEGWKQYGLKNLGINTA 966
                 S +GSF +K   S       ++ AK+S K+L+ GL KLL GW QYGLKN+  N  
Sbjct: 1004 PNKNVSGNGSFFRKFSKSSTSEKSTELYAKVSAKQLFNGLEKLLRGWNQYGLKNVKSNPN 1063

Query: 967  DMIISGKLVNDGILSLRSTLFEIVILPNGSGRSLIKFNKKTGSTKTLTKFATEIQIILQK 1026
            ++ ++GKL ++ + SLRSTLFE+ I   G   S+++F K +GS KT+ K   E++ +L K
Sbjct: 1064 NLTLTGKLSSENMFSLRSTLFEVSIYQKGKV-SVVEFKKISGSFKTVKKLVKEVENVLNK 1122

Query: 1027 EGVL 1030
            EGVL
Sbjct: 1123 EGVL 1126

>KLLA0C01650g Chr3 (128119..131457) [3339 bp, 1112 aa] {ON} similar to
            uniprot|Q12263 Saccharomyces cerevisiae YDR507C
          Length = 1112

 Score =  719 bits (1856), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 463/1138 (40%), Positives = 628/1138 (55%), Gaps = 164/1138 (14%)

Query: 16   NIIGPWKLGETLGFGSTGKVQLARHERTGQKTAVKVIPKSIFKSEGSH---GNNDSVLPF 72
            + IGPWKLG TLG GSTGKV +A +E  GQ+ AVK+I KSIF ++GS    GN+  VLP+
Sbjct: 12   DTIGPWKLGSTLGVGSTGKVVMAYNETKGQQAAVKIISKSIFNAQGSTMIGGNDPDVLPY 71

Query: 73   NIEREIVIMKLLSHPNVLSLYDVWETDNNLYLILEYAEKGELFNLLVDRGPLPEREAIKC 132
             IEREI+IMKLL+HPNVL LYDVWET  +LY++LEY EKGELFNLLV+RGPLPE EA++ 
Sbjct: 72   GIEREIIIMKLLNHPNVLRLYDVWETSKDLYMVLEYVEKGELFNLLVERGPLPENEAVRF 131

Query: 133  FKQIIIAISYCHALGIVHRDLKPENLLLDNSYNIKIADFGMAALQTDAGMLETSCGSPHY 192
            F+QIII ISYCHALGIVHRDLKPENLLLD+ +N+K+ADFGMAAL++   +LETSCGSPHY
Sbjct: 132  FRQIIIGISYCHALGIVHRDLKPENLLLDHKFNVKLADFGMAALESKDKLLETSCGSPHY 191

Query: 193  AAPEIVSGLPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRDLLLKVQKGQFEMPNNA 252
            AAPEIVSGLPY GF SDVWSCGVIL+ALLTGRLPFDEE+GN+R+LLLKVQ G+FEMP + 
Sbjct: 192  AAPEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEEDGNIRNLLLKVQSGKFEMPGDD 251

Query: 253  EISGDAQDLIRRILVVDPTQRIKIRDILSHPLLKKYQTIKDSKSIKDLPRENTYLYPLA- 311
            EIS +AQDLI RIL VDP QRIK R+IL HPLL+KY +IKDSKSI++LPRE+TYL PL+ 
Sbjct: 252  EISSEAQDLIARILTVDPEQRIKTREILKHPLLRKYPSIKDSKSIRNLPREDTYLNPLSL 311

Query: 312  DADNHTSVTIDDSILQNLVILWHGRPAEEIMKKLQDNGTNTEKTLYALLYRFK------- 364
            +  N     +D++ILQNLV+LWHGR  E+I+ KL + G N EKT YALL+RFK       
Sbjct: 312  EGGNQ---CVDETILQNLVVLWHGRNKEDIITKLMEPGANLEKTFYALLHRFKHDNYQDQ 368

Query: 365  -------------------LESMKETNKRSRSKINXXXXXXXXXXXXXXXXXAFNHQSLD 405
                               + S+   NK                          + Q L 
Sbjct: 369  LKQQELQKKQSVSSNSLMYVGSLPSPNKSDSPVTTPKKKRTSIIVASSSHKRPVSMQKLS 428

Query: 406  ---SAPRKHASRGH--SKNFPXXXXXXXXXXXXXXTDCSPIPLRSSK--RISISSAVPGN 458
               S+P K+ S G   SK FP                 SP P    +  RI+ S+A P  
Sbjct: 429  SQHSSPVKNGSIGKRLSKTFP----SNKRISQLVSNSSSPTPAAHKRVSRINDSAAPP-- 482

Query: 459  TLQVP-DXXXXXXXXXXXXXXXXXYMPNLGRGXXXXXXXXXXXXXIXXXXXXXXXXXTKR 517
               VP +                  +PN+ RG                         TKR
Sbjct: 483  ---VPKEMLRDYKRQSKRQSKRFSLLPNMKRGSITTKLIATYAKLSEDSEWEYIEKETKR 539

Query: 518  TSSNFATLIDEIFEPEKFELAKREKAELQKKVQ--------------------EAKRQVS 557
            TS +FATL+D+IFE EK+E  ++EK EL++KV                     + + +  
Sbjct: 540  TSQDFATLMDQIFEHEKYEQIRKEKEELERKVNEAREKEEAERKERERIEREEQERLERE 599

Query: 558  KNAPISDEKDVGFEVSDGMRELKK--------------INNK-VSSPLMNYEFSQKE--- 599
            +      +K++  ++ D + +LK                N + VS+P+     + K    
Sbjct: 600  ERKRAERQKELQDQMEDEIAKLKAEYEAVQGSSDERNTANGRSVSAPIETDRTANKRDST 659

Query: 600  --LLQDIDTLLTNRYQLSSYTRPISRLDPGLTPVTGAIPHSIKEKTALLQDTEMKIIETI 657
              +  DI+ L+  R   S  TRP+SRLDPG+      +  ++++  A     E  I+ETI
Sbjct: 660  FGIKNDINELINTR-NFSLQTRPVSRLDPGIIAAESRLSANLEDDQA---SKEKTILETI 715

Query: 658  RKSEFLGSLLNV----------------REGISQDNNQLASIEVS--PK-ISTTPLMYND 698
            R+S+FLGS  N+                +E + + + Q A  EV   PK       + +D
Sbjct: 716  RRSKFLGSQFNLNVELEKAQKDLVSKERQEQLRKYSEQTAKYEVQKLPKNAKAVATLRDD 775

Query: 699  QVEIRKISDVEVPHFTRKSKHFTTANNRRSVLSLYSLKESLEDLNQISKNEE-----PDS 753
            +VE RK+S+V+VP FTR+SKHF+++N R SVLSLYS K S  +L    KN+      P  
Sbjct: 776  EVEPRKLSEVKVPQFTRRSKHFSSSNKRFSVLSLYSTKTSFTNLVDHLKNDNYLEPLPGQ 835

Query: 754  PPQGSTDNASKSE-LVDVIEEVTEXXXXXXXXXXXXXXXXXXXXXILYDVPECVDSPQGY 812
            P   S+  A + E + + +EE+ E                      L++VPE   + +G 
Sbjct: 836  PEYSSSKVAQEPEFMFETVEELDENSK-------------------LFEVPE---TEEGK 873

Query: 813  DINDAHSTQSPASKSTEPKPVVKLPSLSSFQ-------RKNASGLGIYQRESSRESLPSV 865
              + A    + A K +     + LPSL   Q          A GLGIYQ     +  P  
Sbjct: 874  LASAARKESTDARKQSTNDKDINLPSLPPLQVSHDVADENGALGLGIYQPNDQTQK-PHK 932

Query: 866  TI----NISESDKTTENEAQKEI--KHDKSDTILSNHDGKADSYKGDISNIVRESSHGSF 919
            T+    +I E+  +T + ++ E+  K   +D +  N++ +      +I+  V      SF
Sbjct: 933  TMLIDESIDENISSTSDVSRTEVVKKPPLNDVVRKNNNERKPLE--EITPKVENKRKISF 990

Query: 920  LKKLSKGKILEL-------DVRAKISEKRLYEGLHKLLEGWKQYGLKNLGINTADMIISG 972
             +K S+G   +L        ++A +S  ++Y+ L +LL  W  YGLK++  +  D +ISG
Sbjct: 991  FRKFSQGSEKKLGPESFDSQLKAGVSAPKMYKALDRLLNEWTNYGLKHVESSPNDFVISG 1050

Query: 973  KLVNDGILSLRSTLFEIVILPNGSGRSLIKFNKKTGSTKTLTKFATEIQIILQKEGVL 1030
            KL +D ILSLRST F+I +LP     S+I+F KK+GSTKT  +   EI+ IL+KE VL
Sbjct: 1051 KLTSDNILSLRSTGFKITVLPGEGNGSIIQFTKKSGSTKTFNRLVKEIEKILEKEKVL 1108

>KAFR0D04100 Chr4 complement(809681..813034) [3354 bp, 1117 aa] {ON}
            Anc_1.52 YDR507C
          Length = 1117

 Score =  718 bits (1853), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 472/1134 (41%), Positives = 622/1134 (54%), Gaps = 154/1134 (13%)

Query: 18   IGPWKLGETLGFGSTGKVQLARHERTGQKTAVKVIPKSIFKSEGSHGNN---DSVLPFNI 74
            +GPWKLGETLG GSTGKVQLA ++ TG++ A+KVI KS+F +  +  ++      LP+ I
Sbjct: 15   LGPWKLGETLGLGSTGKVQLAHNKTTGKQAAIKVISKSVFNNNSAQSSSLTTPDALPYGI 74

Query: 75   EREIVIMKLLSHPNVLSLYDVWETDNNLYLILEYAEKGELFNLLVDRGPLPEREAIKCFK 134
            EREI+IMKLL+HPNVL LYDVWET++NLY++LEYAEKGELFNLLV++GPL E+EAI+ F+
Sbjct: 75   EREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAEKGELFNLLVEKGPLQEQEAIRFFR 134

Query: 135  QIIIAISYCHALGIVHRDLKPENLLLDNSYNIKIADFGMAALQTDAGMLETSCGSPHYAA 194
            QIII ISYCHALGIVHRDLKPENLLLD+ YNIKIADFGMAAL+T+  +LETSCGSPHYAA
Sbjct: 135  QIIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEDKLLETSCGSPHYAA 194

Query: 195  PEIVSGLPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRDLLLKVQKGQFEMPNNAEI 254
            PEIVSG+PY GFASDVWSCGVILFALLTGRLPFDEE+GN+R+LLLKVQ G+FEMP++ EI
Sbjct: 195  PEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQSGEFEMPSDDEI 254

Query: 255  SGDAQDLIRRILVVDPTQRIKIRDILSHPLLKKYQTIKDSKSIKDLPRENTYLYPLADAD 314
            S +AQDL+ +IL VDP +RI+ RDIL HPLL+KY +IKDSKSI++LPRE+TYL PL+D +
Sbjct: 255  SHEAQDLLAKILTVDPEKRIRARDILKHPLLQKYPSIKDSKSIRNLPREDTYLNPLSDNN 314

Query: 315  NHTSVTIDDSILQNLVILWHGRPAEEIMKKLQDNGTNTEKTLYALLYRFKLESMKETNK- 373
            +    TID +ILQNLV+LWHGR   EI+ KL++ G N EKTLYALL RFK++S KE  K 
Sbjct: 315  S----TIDKTILQNLVVLWHGRDVNEIISKLKEPGANAEKTLYALLDRFKIDSEKENFKN 370

Query: 374  ---RSRSKINXXXXX--XXXXXXXXXXXXAFNHQSLDSAPRKHASRGH------------ 416
               R R  I                      +  S+ S+ +K AS               
Sbjct: 371  EQIRKRQSITSSVSRSPAKKASTPQRRKNRISMISVSSSHKKPASFNRLSSVVHNNLSAS 430

Query: 417  --------SKNFPXXXXXXXXXXXXXXTDCSPIPLRSSKRISISSAVPGNTLQVPDXXXX 468
                    SK F                + SP P   +KR S+ +    + L        
Sbjct: 431  SSTTTTPASKKFSMNKKLSMIADKSNSNNSSPTPAHRNKRTSMINTDRQSIL-------S 483

Query: 469  XXXXXXXXXXXXXYMPNLGRGXXXXXXXXXXXXXIXXXXXXXXXXXTKRTSSNFATLIDE 528
                          M N+ RG                         TKRTSS+FATLIDE
Sbjct: 484  KNKRASRSSKRLSVMANMKRGSITTKLIATYAKLSEDDDWEYIEKETKRTSSDFATLIDE 543

Query: 529  IFEPEKFELAKREKAELQKKVQEAKRQVSKNA---------PISDEKDVGFEVSDGMREL 579
            IFE EK+E  ++EK EL +KV+ AK +  +            +++EK    +     R++
Sbjct: 544  IFEHEKYEQIRKEKEELARKVRLAKEREEEERRRREEEELHKLNEEKKFEAQQLQLQRQM 603

Query: 580  KKINNKVSSPLM------------NYEFSQKELLQDI--DTLLTNRYQLSSYTRPISRLD 625
             +    + + L             NY      L ++   D LL  R   S  TRPISRLD
Sbjct: 604  DEEIENLRADLKGDVEPNQEKNEDNYRSVSVPLSKETVNDNLLRQR-NFSLQTRPISRLD 662

Query: 626  PGL----------TPVTGAIPHSIKEKTALLQDTEMKIIETIRKSEFLGSLLNVREGISQ 675
            PGL           P++   P   K+      DTE  I+ETIR+S+FLGS  ++   +  
Sbjct: 663  PGLFFSEQSPTEEKPISPDEPVPNKK-----LDTEKMILETIRRSKFLGSSFDINRELKA 717

Query: 676  DNNQLASIEVSPKIST--------------TPLMYNDQVEIRKISDVEVPHFTRKSKHFT 721
               ++       K++T              T  + +   E+ KISD+ VP FTRKS+HFT
Sbjct: 718  AEKRVMQPPTVQKLTTENKSSDELPKHAVGTAALNSSTAEVSKISDIRVPQFTRKSRHFT 777

Query: 722  TANNRRSVLSLYSLKESLEDLNQISKNEEPDSPPQGST---DNASKSELVDVIEEVTEXX 778
            T+N R SVLS+YS ++S  +L  I KN E  +     T    +A  SE   + E V E  
Sbjct: 778  TSNRRLSVLSMYSTRQSFSNLVDILKNTEAGTELGQRTPTPHSAGDSEF--IFETVNEEA 835

Query: 779  XXXXXXXXXXXXXXXXXXXILYDVP--ECVDSPQGYDINDAHSTQSPASKSTEPKPVV-- 834
                                LY+V   +  + P G  +N A         STEP   +  
Sbjct: 836  EYTGNSSNDDK---------LYEVADLDAAEKPSGMKLNFADRFNKKEEDSTEPSRDIQN 886

Query: 835  KLPSLSSFQRKNASGLGIYQRESSRESLPSVTINISESDK-----TTENEA-QKEIKHDK 888
            KLP L     K  +GLGIYQ  S  E  P +     + DK     +++NE  +KEIK   
Sbjct: 887  KLPVLPPLDGK--AGLGIYQTSSPIE--PQLLERPVKGDKFMETISSDNEKPEKEIKSMI 942

Query: 889  SDTIL-----------------SNHDGKADSYKGD--ISNIVRESSHG-----SFLKKLS 924
             + ++                   HD +    K    ++   RES        SF +K S
Sbjct: 943  PEAVIEEPKNVSPIEVQKTRKDQEHDKRPVMEKKPEVVAPKQRESDQEKKRSVSFFRKFS 1002

Query: 925  KGKILELDVRAK--------ISEKRLYEGLHKLLEGWKQYGLKNLGINTADMIISGKLVN 976
               I     +A+        I+ +++++GL +LL GW +YGLKN+   ++ M ISGKL +
Sbjct: 1003 GSSISSNKSKAETEKVLVTNIAARQVFDGLRRLLNGWSKYGLKNVRSVSSTMTISGKLSS 1062

Query: 977  DGILSLRSTLFEIVILPNGSGRSLIKFNKKTGSTKTLTKFATEIQIILQKEGVL 1030
            D ILSLRST FEI +  NG   S++   KK+GS+K + +  TEI+ I  KEGVL
Sbjct: 1063 DNILSLRSTNFEIKVTSNGESSSVL-IRKKSGSSKAVLRLTTEIENIFSKEGVL 1115

>CAGL0K05709g Chr11 complement(556732..560043) [3312 bp, 1103 aa]
           {ON} similar to uniprot|Q12263 Saccharomyces cerevisiae
           YDR507c GIN4
          Length = 1103

 Score =  564 bits (1454), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 259/368 (70%), Positives = 319/368 (86%), Gaps = 8/368 (2%)

Query: 16  NIIGPWKLGETLGFGSTGKVQLARHERTGQKTAVKVIPKSIFKSEG---SHGNNDSVLPF 72
           N IGPWKLGETLG GSTGKV LA +E T Q+ AVKVI K++F++     S+G+  + LP+
Sbjct: 15  NQIGPWKLGETLGSGSTGKVLLASNETTKQQAAVKVISKAVFEAMNNSESNGDATNALPY 74

Query: 73  NIEREIVIMKLLSHPNVLSLYDVWETDNNLYLILEYAEKGELFNLLVDRGPLPEREAIKC 132
           NIE+EI+IMKLL+HPNVL L+DVWET+++LYL+LEYAEKGELFN+LV+RGPLPE EA++ 
Sbjct: 75  NIEQEIIIMKLLNHPNVLRLFDVWETNSDLYLVLEYAEKGELFNMLVERGPLPENEAVRA 134

Query: 133 FKQIIIAISYCHALGIVHRDLKPENLLLDNSYNIKIADFGMAALQTDAGMLETSCGSPHY 192
           F+QIII ISYCH+LG+VHRDLKPENLLLDN  NIKIADFGMAAL+++  +LETSCGSPHY
Sbjct: 135 FRQIIIGISYCHSLGVVHRDLKPENLLLDNKLNIKIADFGMAALESEDKLLETSCGSPHY 194

Query: 193 AAPEIVSGLPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRDLLLKVQKGQFEMPNNA 252
           AAPEI+SGLPYEGF+SDVWSCGVILFALLTGRLPFDEE+GN+R+LLLKVQKG+FEMP++ 
Sbjct: 195 AAPEIISGLPYEGFSSDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQKGEFEMPDDD 254

Query: 253 EISGDAQDLIRRILVVDPTQRIKIRDILSHPLLKKYQTIKDSKSIKDLPRENTYLYPLAD 312
           EI+ +AQDL+ R+L VDP++RI IR+IL HPLL+KY +IKDS+SI++LPRE+TYL PLAD
Sbjct: 255 EITKEAQDLLARLLTVDPSKRITIREILKHPLLQKYPSIKDSRSIRNLPREDTYLSPLAD 314

Query: 313 ADNHTSVTIDDSILQNLVILWHGRPAEEIMKKLQDNGTNTEKTLYALLYRFKLESMKETN 372
               T+  IDD+ILQNLVILWHG+ A EI  KL++ G NTEKTLYALLYRFK ++ +E N
Sbjct: 315 ----TNSKIDDAILQNLVILWHGKDAREIAAKLREPGANTEKTLYALLYRFKCDTQREAN 370

Query: 373 K-RSRSKI 379
           + R +SKI
Sbjct: 371 RARRQSKI 378

 Score =  203 bits (517), Expect = 6e-53,   Method: Compositional matrix adjust.
 Identities = 189/592 (31%), Positives = 295/592 (49%), Gaps = 106/592 (17%)

Query: 515  TKRTSSNFATLIDEIFEPEKFELAKREKAELQKKVQEA----------------KRQVSK 558
            TKRTSS+FATLIDEIFE EK+E  ++EKAEL++KV+E                 + ++ +
Sbjct: 540  TKRTSSDFATLIDEIFEYEKYEQIRKEKAELERKVRETKEREERERKERQEKELQERLER 599

Query: 559  NAPISDEKDVGFEVSDGMRELKK--INNK--------VSSPLMNYEFSQKELLQDIDTLL 608
                  ++D+  ++ + +  LKK  + ++        VS PL +     +++ +DID +L
Sbjct: 600  ERIEKQKEDIARQMDEEISNLKKELVGDQDNEDKFRSVSEPLESKSKKIEDIEEDIDGIL 659

Query: 609  TNRYQLSSYTRPISRLDPGLTPVTGA------IPHSIKEKTALLQDTEMKIIETIRKSEF 662
             NR + S  TRP+SRLDPG+  +         +P ++  +  L ++TE KI+ETIR+S+F
Sbjct: 660  RNR-KYSLQTRPVSRLDPGIGFIDKPRQSEQHVPETVNLEPEL-EETEQKILETIRRSKF 717

Query: 663  LGSLLNVR---EGISQDNNQLASIEVSPKISTTPLMYNDQVE---------IRKISDVEV 710
            LGS  +++   E + +       IE        P      VE         +RKISD++V
Sbjct: 718  LGSSFDIKKELENVKRHRQTSQPIEKEMAPPALPETLPKAVEKKNVSMDPSLRKISDIKV 777

Query: 711  PHFTRKSKHFTTANNRRSVLSLYSLKESLEDLNQISKNEEPD------SPPQGSTDNASK 764
            P FTRKS+HF+T+N R SVLS+YS KES  +L  I KN   +      +P   S D++  
Sbjct: 778  PQFTRKSRHFSTSNRRLSVLSMYSTKESYSNLADILKNGPGEKEMIQTAPTPKSADDSD- 836

Query: 765  SELVDVIEEVTEXXXXXXXXXXXXXXXXXXXXXILYDVPECVDSP---QGYDINDAHSTQ 821
             +L D I+E                         LY+V E  ++    +  DI D  +++
Sbjct: 837  -QLFDTIDEADTPASVSREER-------------LYEVAEESENELANKKIDIADLLNSE 882

Query: 822  SPASKSTEPKP-VVKLPSLSSFQRKNASGLGIYQRESSRESLPSVTINISESDKTTENEA 880
                KS E +   +KLP L       ++      +E+  +S   +  N+  S      E+
Sbjct: 883  GSNLKSVEEQEDSMKLPKLPPLFEDGST------KETKEQSKSMIPENMQSS------ES 930

Query: 881  QKEIKHDKSDT------ILSNHDGKADS--YKGDISNIVRESSHG---------SFLKKL 923
            QK+I+ + SD        ++ H   +D    K   +  ++ +S           SFL+KL
Sbjct: 931  QKQIEKNNSDEGGSLNPFMTKHRDVSDKGVTKEKPTVTMKTTSEQVSADKKRNMSFLRKL 990

Query: 924  SKGKILELD-----VRAKISEKRLYEGLHKLLEGWKQYGLKNLGINTADMIISGKLVNDG 978
            SKG     D     +   +S K+L+ GL  LL+GW +YGLK + I++    I+GKL ND 
Sbjct: 991  SKGSSSSKDNVDVTLSTSVSSKQLFSGLVNLLKGWTKYGLKGIAIDSTSQTITGKLANDN 1050

Query: 979  ILSLRSTLFEIVILPNGSGRSLIKFNKKTGSTKTLTKFATEIQIILQKEGVL 1030
            ILS RST F I+I     G S + F K +GS K + + + E++ +L KEGVL
Sbjct: 1051 ILSFRSTAFSILIFSQEKG-SAVTFRKVSGSGKAVRRLSDEVKKVLSKEGVL 1101

>YDR507C Chr4 complement(1462358..1465786) [3429 bp, 1142 aa] {ON}
           GIN4Protein kinase involved in bud growth and assembly
           of the septin ring, proposed to have kinase-dependent
           and kinase-independent activities; undergoes
           autophosphorylation; similar to Kcc4p and Hsl1p
          Length = 1142

 Score =  560 bits (1443), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 262/369 (71%), Positives = 311/369 (84%), Gaps = 10/369 (2%)

Query: 16  NIIGPWKLGETLGFGSTGKVQLARHERTGQKTAVKVIPKSIFKSEGSHGNN------DSV 69
           N IGPWKLGETLG GSTGKVQLAR+  TGQ+ AVKVI K++F +    G +         
Sbjct: 14  NTIGPWKLGETLGLGSTGKVQLARNGSTGQEAAVKVISKAVFNTGNVSGTSIVGSTTPDA 73

Query: 70  LPFNIEREIVIMKLLSHPNVLSLYDVWETDNNLYLILEYAEKGELFNLLVDRGPLPEREA 129
           LP+ IEREI+IMKLL+HPNVL LYDVWET+ +LYL+LEYAEKGELFNLLV+RGPLPE EA
Sbjct: 74  LPYGIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPEHEA 133

Query: 130 IKCFKQIIIAISYCHALGIVHRDLKPENLLLDNSYNIKIADFGMAALQTDAGMLETSCGS 189
           I+ F+QIII +SYCHALGIVHRDLKPENLLLD+ YNIKIADFGMAAL+T+  +LETSCGS
Sbjct: 134 IRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEGKLLETSCGS 193

Query: 190 PHYAAPEIVSGLPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRDLLLKVQKGQFEMP 249
           PHYAAPEIVSG+PY+GFASDVWSCGVILFALLTGRLPFDEE+GN+R LLLKVQKG+FEMP
Sbjct: 194 PHYAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRTLLLKVQKGEFEMP 253

Query: 250 NNAEISGDAQDLIRRILVVDPTQRIKIRDILSHPLLKKYQTIKDSKSIKDLPRENTYLYP 309
           ++ EIS +AQDLIR+IL VDP +RIK RDIL HPLL+KY +I+DSKSI+ LPRE+TYL P
Sbjct: 254 SDDEISREAQDLIRKILTVDPERRIKTRDILKHPLLQKYPSIRDSKSIRGLPREDTYLTP 313

Query: 310 LADADNHTSVTIDDSILQNLVILWHGRPAEEIMKKLQDNGTNTEKTLYALLYRFKLESMK 369
           L+++++    +ID +ILQNLVILWHGR  E I +KL++ G N EKTLYALLYRFK ++ K
Sbjct: 314 LSESNS----SIDATILQNLVILWHGRDPEGIKEKLREPGANAEKTLYALLYRFKCDTQK 369

Query: 370 ETNKRSRSK 378
           E  K+ + K
Sbjct: 370 ELIKQQQVK 378

 Score =  135 bits (341), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 107/298 (35%), Positives = 148/298 (49%), Gaps = 65/298 (21%)

Query: 515 TKRTSSNFATLIDEIFEPEKFELAKREKAELQKKVQEAK--------------------- 553
           TKRTSSNFATLIDEIFE EK+E  ++EK EL++KV+EAK                     
Sbjct: 536 TKRTSSNFATLIDEIFEYEKYEQIRKEKEELERKVREAKAREELERRRRKQEEKERARKL 595

Query: 554 --RQVSKNAPISDEKDVGFEVSDGMRELKKINNK--------VSSPLMNYEFSQKELLQD 603
             ++  K      +K +  ++SD  +EL K   +        +S+P+ N E +   L  D
Sbjct: 596 LEKEDLKRKQEELKKQIEIDISDLEQELSKHKEEKLDGNIRSISAPMENEEKNINHLEVD 655

Query: 604 IDTLLTNRYQLSSYTRPISRLDPGL---TPVTGAIPHSIKEKTALLQDTEMKIIETIRKS 660
           ID +L  R   S  TRP+SRLDPG+   +P     P   K        TE KI+ETIR+S
Sbjct: 656 IDNILRRR-NFSLQTRPVSRLDPGIMFSSPTEEVSPVEPKRTENERLTTEKKILETIRRS 714

Query: 661 EFLGSLLNVREGISQDNNQLASIEVSPKISTTPLMY--NDQVE----------------- 701
           +FLGS  N+ + +     +  SI    ++S   ++   ND  E                 
Sbjct: 715 KFLGSSFNIDKELKLSKMEYPSIIAPQRLSEERVVSDSNDGYESLILPKDGNGVSQLKDS 774

Query: 702 -----------IRKISDVEVPHFTRKSKHFTTANNRRSVLSLYSLKESLEDLNQISKN 748
                      +RKIS++ VP FTRKS+HF+ +N R SVLS+YS KES  +L  I KN
Sbjct: 775 TATTAPVSDGRLRKISEIRVPQFTRKSRHFSESNKRLSVLSMYSTKESFTNLVDILKN 832

>Smik_4.789 Chr4 complement(1385209..1388619) [3411 bp, 1136 aa]
           {ON} YDR507C (REAL)
          Length = 1136

 Score =  558 bits (1439), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 261/369 (70%), Positives = 311/369 (84%), Gaps = 10/369 (2%)

Query: 16  NIIGPWKLGETLGFGSTGKVQLARHERTGQKTAVKVIPKSIFKSEGSHGNN------DSV 69
           N IGPWKLGETLG GSTGKVQLAR++ TGQ+ AVKVI K++F +    G +         
Sbjct: 14  NTIGPWKLGETLGLGSTGKVQLARNKSTGQEAAVKVISKTVFNTGNVSGTSIVGSTTPDA 73

Query: 70  LPFNIEREIVIMKLLSHPNVLSLYDVWETDNNLYLILEYAEKGELFNLLVDRGPLPEREA 129
           LP+ IEREI+IMKLL+HPNVL LYDVWET+ +LYL+LEYAEKGELFNLLV+RGPLPE EA
Sbjct: 74  LPYGIEREIIIMKLLNHPNVLRLYDVWETNADLYLVLEYAEKGELFNLLVERGPLPENEA 133

Query: 130 IKCFKQIIIAISYCHALGIVHRDLKPENLLLDNSYNIKIADFGMAALQTDAGMLETSCGS 189
           I+ F+QIII +SYCHALGIVHRDLKPENLLLD+ YNIKIADFGMAAL+T+  +LETSCGS
Sbjct: 134 IRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEGKLLETSCGS 193

Query: 190 PHYAAPEIVSGLPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRDLLLKVQKGQFEMP 249
           PHYAAPEIVSG+PY+GFASDVWSCGVILFALLTGRLPFDEE+GN+R LLLKVQKG+FE+P
Sbjct: 194 PHYAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRTLLLKVQKGEFELP 253

Query: 250 NNAEISGDAQDLIRRILVVDPTQRIKIRDILSHPLLKKYQTIKDSKSIKDLPRENTYLYP 309
           ++ EIS +AQDLI RIL VDP +RIK RDIL HPLL+KY +IKDSKSI+ LPRE+TYL P
Sbjct: 254 SDDEISREAQDLISRILTVDPERRIKTRDILKHPLLQKYPSIKDSKSIRGLPREDTYLTP 313

Query: 310 LADADNHTSVTIDDSILQNLVILWHGRPAEEIMKKLQDNGTNTEKTLYALLYRFKLESMK 369
           L+++++    +ID +ILQNLVILWHGR  + I +KL++ G N EKTLYALLYRFK ++ K
Sbjct: 314 LSESNS----SIDATILQNLVILWHGRDPDGIKEKLRETGANAEKTLYALLYRFKCDTQK 369

Query: 370 ETNKRSRSK 378
           E  K+ + K
Sbjct: 370 ELVKQQQIK 378

 Score =  135 bits (340), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 110/310 (35%), Positives = 151/310 (48%), Gaps = 67/310 (21%)

Query: 515 TKRTSSNFATLIDEIFEPEKFELAKREKAELQKKVQEAK--------------------- 553
           TKRTSSNFATLIDEIFE EK+E  ++EK EL++KV+EAK                     
Sbjct: 536 TKRTSSNFATLIDEIFEYEKYEQIRKEKEELERKVREAKAREELERRRRRQEEKERTRKL 595

Query: 554 --RQVSKNAPISDEKDVGFEVSDGMRELKKINNK--------VSSPLMNYEFSQKELLQD 603
             ++  K      +K +  ++SD  +EL +   +        +S+P+ N E +   L  D
Sbjct: 596 LEKEELKMKQEELKKQIEMDISDLEQELSRHKEEKPDGNIRSISAPMENEEKNIDHLGTD 655

Query: 604 IDTLLTNRYQLSSYTRPISRLDPGLT---PVTGAIPHSIKEKTALLQDTEMKIIETIRKS 660
           ID +L  R   S  TRP+SRLDPG+    P+    P   K        TE KI+ETIR+S
Sbjct: 656 IDNILRRR-NFSLQTRPVSRLDPGIVFSNPIETVYPVEPKRSENERLTTEKKILETIRRS 714

Query: 661 EFLGSLLNVR---------------------EGISQDNNQLASIEVSPK----------- 688
           +FLGS  N+                      E +  D N      + PK           
Sbjct: 715 KFLGSSFNIEKELKLSKMEYPSVLAPEKLSGERVVSDLNGKYESLILPKDAKGVSQLKDD 774

Query: 689 ISTTPLMYNDQVEIRKISDVEVPHFTRKSKHFTTANNRRSVLSLYSLKESLEDLNQISKN 748
           I++T   +    ++RKIS+V VP FTRKS+HF+ +N R S+LS+YS KES  +L  I KN
Sbjct: 775 ITSTTTEHLSDGKLRKISEVRVPQFTRKSRHFSESNKRLSLLSMYSTKESFTNLVDILKN 834

Query: 749 EEPDSPPQGS 758
              D   Q S
Sbjct: 835 SNLDVNNQQS 844

 Score =  100 bits (248), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 54/121 (44%), Positives = 80/121 (66%), Gaps = 7/121 (5%)

Query: 914  SSHGSFLKKLSKG----KILELDVRAKISEKRLYEGLHKLLEGWKQYGLKNLGINTADMI 969
            + + SF +K SK     K++EL   AK+S ++L+ GL KLL GW Q+GLKN+  +  ++ 
Sbjct: 1017 TGNSSFFRKFSKSSASDKLVEL--YAKVSARQLFNGLEKLLRGWTQFGLKNIKSHPNNLT 1074

Query: 970  ISGKLVNDGILSLRSTLFEIVILPNGSGRSLIKFNKKTGSTKTLTKFATEIQIILQKEGV 1029
            ++GKL ++ I SLRSTLFEI I P G   S+++F K +GS K + K   E++ +L KEGV
Sbjct: 1075 LTGKLSSENIFSLRSTLFEINIYPKGR-MSVVQFKKISGSFKAVKKLVNEVENVLNKEGV 1133

Query: 1030 L 1030
            L
Sbjct: 1134 L 1134

>NCAS0B08600 Chr2 (1649375..1652728) [3354 bp, 1117 aa] {ON}
           Anc_5.591 YDR466W
          Length = 1117

 Score =  557 bits (1435), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 257/358 (71%), Positives = 306/358 (85%), Gaps = 10/358 (2%)

Query: 16  NIIGPWKLGETLGFGSTGKVQLARHERTGQKTAVKVIPKSIFKSEGSH------GNNDSV 69
           + IGPWKLGETLG GSTGKVQLA +E T Q+ A+K+I KSIF ++ +        N    
Sbjct: 17  DTIGPWKLGETLGLGSTGKVQLAFNETTNQQAAIKIISKSIFNTKPNSNETSMVANTPDS 76

Query: 70  LPFNIEREIVIMKLLSHPNVLSLYDVWETDNNLYLILEYAEKGELFNLLVDRGPLPEREA 129
           LP+ IEREI+IMKLL H NVLSLYDVWET++NLY+ILEYAEKGELFNLLV++GPLPE+EA
Sbjct: 77  LPYGIEREIIIMKLLRHANVLSLYDVWETNSNLYMILEYAEKGELFNLLVEKGPLPEKEA 136

Query: 130 IKCFKQIIIAISYCHALGIVHRDLKPENLLLDNSYNIKIADFGMAALQTDAGMLETSCGS 189
           ++ F+QIII ISYCHALGIVHRDLKPENLLLD+ +NIKIADFGMAAL+T+  +LETSCGS
Sbjct: 137 VRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALETEDKLLETSCGS 196

Query: 190 PHYAAPEIVSGLPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRDLLLKVQKGQFEMP 249
           PHYAAPEIVSG+PY GF SDVWSCGVILFALLTGRLPFDEE+GN+R+LLLKVQ GQFEMP
Sbjct: 197 PHYAAPEIVSGIPYHGFESDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMP 256

Query: 250 NNAEISGDAQDLIRRILVVDPTQRIKIRDILSHPLLKKYQTIKDSKSIKDLPRENTYLYP 309
           ++ E+S DAQDLI RIL VDPT+RIK R+IL HPLL+KY +IKDSKSIK+LPRE+TYL+P
Sbjct: 257 DDDEMSRDAQDLISRILTVDPTKRIKTREILKHPLLQKYPSIKDSKSIKNLPREDTYLFP 316

Query: 310 LADADNHTSVTIDDSILQNLVILWHGRPAEEIMKKLQDNGTNTEKTLYALLYRFKLES 367
           L+D ++     ID SILQNLV+LWHGR  E+I  KL+++G N EKT+YALLYRFK+E+
Sbjct: 317 LSDNNS----VIDPSILQNLVVLWHGRDKEQIAAKLKESGANAEKTIYALLYRFKIEA 370

 Score =  203 bits (516), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 196/603 (32%), Positives = 287/603 (47%), Gaps = 133/603 (22%)

Query: 515  TKRTSSNFATLIDEIFEPEKFELAKREKAELQKKVQEAK--------------------R 554
            TKRTSS+FATLIDEIFE EK+E  ++EK EL +KV+EAK                    R
Sbjct: 559  TKRTSSDFATLIDEIFEHEKYEQIRKEKEELARKVREAKEGEARERREQESEKQRKQRER 618

Query: 555  QVSKNAPISDEKDVGFEVS----DGMRELKKIN-----NKVSSPLMNYEFSQKELLQ-DI 604
            +  +   +  +  +  E+S    D   E K          VS+PL   E    E ++ DI
Sbjct: 619  EELERQQLELQNHIDQEISNLKADLANETKGAEPYENPRSVSAPL---ERENPEAIERDI 675

Query: 605  DTLLTNRYQLSSYTRPISRLDPGL----------TPVTGAIPHSIKEKTALLQDTEMKII 654
            + L   R  +S  TRP SRLDPG+           P+   I   I        D E KI+
Sbjct: 676  NDLFARR-NVSLQTRPKSRLDPGILYSAPAETVSNPLLSDIDQEI--------DREKKIL 726

Query: 655  ETIRKSEFLGSLLNVREGISQDNNQLASIEVSPK-----------------ISTTPLMYN 697
            ETIR+S FLGS  N+ + + +   + A  E S K                 I   PL  N
Sbjct: 727  ETIRRSRFLGSSYNINKEL-EFAKKTALAETSKKEKRSKVTSQNIVADKAAIGVIPL--N 783

Query: 698  D-QVEIRKISDVEVPHFTRKSKHFTTANNRRSVLSLYSLKESLEDLNQISKNEEPDSPPQ 756
            D +  +RKIS+++VP FTRKS+HF+ +N R SVLS+YS K+S  +L  I K        +
Sbjct: 784  DTEAGLRKISEIKVPQFTRKSRHFSNSNRRLSVLSMYSTKQSYTNLGDILK--------E 835

Query: 757  GSTDNASKSELVDVIEEVTEXXXXXXXXXXXXXXXXXXXXXILYDVPECVDSPQGYDIND 816
            G  + AS++      +  TE                      LY++ E    P+  D+N 
Sbjct: 836  GGVNLASEANNTTTSKASTEPEFQFESVNEGTANK-------LYELQE---EPEYTDVN- 884

Query: 817  AHSTQSPASKSTEPKPVVKLPSLSSFQRK--NASGLGIYQRESSRESLPSV--------- 865
                     +  +PK  VKLP+L     K   A+GL IYQ  S  +  P+          
Sbjct: 885  --------KEDGKPKKNVKLPTLPPLHEKTNQANGLAIYQSSSDDDKKPTEPQPKSQSMI 936

Query: 866  -----TINISESDKTT-----ENEAQKEIKHDKSDTILSNHDGKADSYKGDISNIVRESS 915
                 +IN S S K T     E++A K+I   K        + K      ++   V +  
Sbjct: 937  PERQDSINNSASVKKTPVVEPESQATKKINKPKQRQPKKEEERKP---LNEMPPNVEKKR 993

Query: 916  HGSFLKKLSKGKIL--------ELDVRAKISEKRLYEGLHKLLEGWKQYGLKNLGINTAD 967
            + SF +K SK   +        + +V   +S  +LY+GL +LL+GW +YGLK++   +  
Sbjct: 994  NVSFFRKFSKSSAVSTLTKNGFDYEVYVNVSAPQLYKGLLRLLQGWSKYGLKDVKSQSNY 1053

Query: 968  MIISGKLVNDGILSLRSTLFEIVILPNGSGRSLIKFNKKTGSTKTLTKFATEIQIILQKE 1027
            M ++GKL ND ILSLRST+FE+++   G  +S++ FNK +GS+KT+ +   EI+ +L++E
Sbjct: 1054 MKLTGKLSNDNILSLRSTVFEMIVESKGK-QSVVGFNKISGSSKTVRRLFVEIEKVLRQE 1112

Query: 1028 GVL 1030
            GVL
Sbjct: 1113 GVL 1115

>Skud_4.783 Chr4 complement(1382552..1385959) [3408 bp, 1135 aa]
           {ON} YDR507C (REAL)
          Length = 1135

 Score =  555 bits (1431), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 257/361 (71%), Positives = 307/361 (85%), Gaps = 10/361 (2%)

Query: 16  NIIGPWKLGETLGFGSTGKVQLARHERTGQKTAVKVIPKSIFKSEGSHGNN------DSV 69
           N IGPWKLGETLG GSTGKVQLAR++ TGQ+ AVKVI K++F +    G +         
Sbjct: 14  NTIGPWKLGETLGLGSTGKVQLARNKSTGQEAAVKVISKAVFNAGNMSGTSIVGSITPDA 73

Query: 70  LPFNIEREIVIMKLLSHPNVLSLYDVWETDNNLYLILEYAEKGELFNLLVDRGPLPEREA 129
           LP+ IEREI+IMKLL+HPNVL LYDVWET+ +LYL+LEYAEKGELFNLLV+RGPLPE EA
Sbjct: 74  LPYGIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLPENEA 133

Query: 130 IKCFKQIIIAISYCHALGIVHRDLKPENLLLDNSYNIKIADFGMAALQTDAGMLETSCGS 189
           I+ F+QIII +SYCHALGIVHRDLKPENLLLD+ YNIKIADFGMAAL+T+  +LETSCGS
Sbjct: 134 IRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEGKLLETSCGS 193

Query: 190 PHYAAPEIVSGLPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRDLLLKVQKGQFEMP 249
           PHYAAPEIVSG+PY+GFASDVWSCGVILFALLTGRLPFDEE+GN+R LLLKVQKGQFE+P
Sbjct: 194 PHYAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRTLLLKVQKGQFELP 253

Query: 250 NNAEISGDAQDLIRRILVVDPTQRIKIRDILSHPLLKKYQTIKDSKSIKDLPRENTYLYP 309
           ++ E+S +AQDLI +IL VDP +RIK RDIL HPLL+KY +I+DSKSI+ LPRE+TYL P
Sbjct: 254 SDDEVSREAQDLICKILTVDPKRRIKARDILKHPLLQKYPSIRDSKSIRGLPREDTYLTP 313

Query: 310 LADADNHTSVTIDDSILQNLVILWHGRPAEEIMKKLQDNGTNTEKTLYALLYRFKLESMK 369
           L+++++    +ID +ILQNLVILWHGR  + I +KL++ G N EKTLYALLYRFK ++ K
Sbjct: 314 LSESNS----SIDATILQNLVILWHGRDPDGIKEKLKEPGANAEKTLYALLYRFKCDTQK 369

Query: 370 E 370
           E
Sbjct: 370 E 370

 Score =  130 bits (327), Expect = 6e-30,   Method: Compositional matrix adjust.
 Identities = 113/310 (36%), Positives = 149/310 (48%), Gaps = 67/310 (21%)

Query: 515 TKRTSSNFATLIDEIFEPEKFELAKREKAELQKKVQEAK------------------RQV 556
           TKRTSSNFATLIDEIFE EK+E  ++EK EL+ KV+EAK                  R+V
Sbjct: 536 TKRTSSNFATLIDEIFEYEKYEKIRKEKKELELKVREAKAREELERRKRKQEEKEHSRKV 595

Query: 557 SKNAPISD-----EKDVGFEVSDGMRELKKINNK--------VSSPLMNYEFSQKELLQD 603
            +   +       +K +  ++SD   EL K   +        +S+P+ + E +   L  D
Sbjct: 596 LEKEELKRKQQELKKQIEIDISDLEHELSKHKEEKPDGNIRSISAPMESEEKNINHLEVD 655

Query: 604 IDTLLTNRYQLSSYTRPISRLDPGL---TPVTGAIPHSIKEKTALLQDTEMKIIETIRKS 660
           ID +L  R   S  TRP+SRLDPG+   +PV        K        TE KI+ETIR+S
Sbjct: 656 IDNILRRR-NFSLQTRPVSRLDPGIMFSSPVEKESAVEPKRTENERLTTEKKILETIRRS 714

Query: 661 EFLGSLLNV---------------------REGISQDNNQLASIEVSPKISTTPLMYNDQ 699
           +FLGS  N+                      E I  D +      V PK +       D 
Sbjct: 715 KFLGSSFNIEKELKLSKMEYPSMVPPQRLSEERIVSDPSDDYGSLVLPKDARGYSQLEDH 774

Query: 700 V-----------EIRKISDVEVPHFTRKSKHFTTANNRRSVLSLYSLKESLEDLNQISKN 748
           +           E+RKIS+V VP FTRKS+HF+ +N R SVLS+YS KES  +L  I KN
Sbjct: 775 IAPTTGDLLSNGELRKISEVRVPQFTRKSRHFSESNKRLSVLSMYSSKESFTNLVDILKN 834

Query: 749 EEPDSPPQGS 758
              D   Q S
Sbjct: 835 GNIDVHKQQS 844

 Score =  106 bits (264), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 54/121 (44%), Positives = 82/121 (67%), Gaps = 3/121 (2%)

Query: 914  SSHGSFLKKLSKGKILE--LDVRAKISEKRLYEGLHKLLEGWKQYGLKNLGINTADMIIS 971
            S +GSF +K SK    +  +++ AK+S K+L+ GL KLL GW QYGLKN+  +  ++ ++
Sbjct: 1016 SGNGSFFRKFSKSSTSDKSVELYAKVSAKQLFNGLEKLLRGWTQYGLKNIKSHPNNLTLT 1075

Query: 972  GKLVNDGILSLRSTLFEIVILPNGSGRSLIKFNKKTGSTKTLTKFATEIQIILQKEGVLD 1031
            GKL ++ I SLRSTLFEI I P G   S+++F K +G+ K + K   E++ +L KEGVL+
Sbjct: 1076 GKLSSENIFSLRSTLFEISIYPRGK-MSVVQFKKVSGAFKAVKKLVNEVENVLSKEGVLE 1134

Query: 1032 E 1032
            +
Sbjct: 1135 K 1135

>TBLA0A07150 Chr1 (1776160..1780335) [4176 bp, 1391 aa] {ON}
           Anc_1.52 YDR507C
          Length = 1391

 Score =  559 bits (1440), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 267/445 (60%), Positives = 330/445 (74%), Gaps = 17/445 (3%)

Query: 16  NIIGPWKLGETLGFGSTGKVQLARHERTGQKTAVKVIPKSIFKSEGSHGNNDSVL----- 70
           N +GPWKLGETLG GSTGKVQLA +  TGQ+ A+KVI K++F ++ ++ ++ ++L     
Sbjct: 15  NTVGPWKLGETLGLGSTGKVQLAYNSSTGQQAAIKVISKAVFNNDNANASDSALLTPDSL 74

Query: 71  PFNIEREIVIMKLLSHPNVLSLYDVWETDNNLYLILEYAEKGELFNLLVDRGPLPEREAI 130
           P+ IEREI+IMKLL+HPNVL LYDVWETD+NLY++LEYAEKGELFNLLV+RGPLPE EAI
Sbjct: 75  PYGIEREIIIMKLLNHPNVLRLYDVWETDSNLYMVLEYAEKGELFNLLVERGPLPENEAI 134

Query: 131 KCFKQIIIAISYCHALGIVHRDLKPENLLLDNSYNIKIADFGMAALQTDAGMLETSCGSP 190
           + F+QIII ISYCHALGIVHRDLKPENLLLD+ YNIKIADFGMAAL+T+  +LETSCGSP
Sbjct: 135 RFFRQIIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEDKLLETSCGSP 194

Query: 191 HYAAPEIVSGLPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRDLLLKVQKGQFEMPN 250
           HYAAPEI+SGLPY G  +DVWSCG+ILFALLTGRLPFDEE+GN+R+LLLKVQ GQFEMP 
Sbjct: 195 HYAAPEIISGLPYHGLETDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPG 254

Query: 251 NAEISGDAQDLIRRILVVDPTQRIKIRDILSHPLLKKYQTIKDSKSIKDLPRENTYLYPL 310
           N EIS +AQDLI +IL VDP +RIK R+IL HPL++KY +IKDSK+I++LPRE+TYL PL
Sbjct: 255 NDEISREAQDLISKILTVDPKKRIKTREILKHPLVQKYPSIKDSKTIRNLPREDTYLNPL 314

Query: 311 ADADNHTSVTIDDSILQNLVILWHGRPAEEIMKKLQDNGTNTEKTLYALLYRFKLESMKE 370
           +D DN     ID  ILQNLV+LWHGR ++EI KKL++ G N EKTLYALL RFK ++ KE
Sbjct: 315 SD-DNGDVCEIDPKILQNLVVLWHGRDSKEITKKLKEPGANAEKTLYALLDRFKNDTEKE 373

Query: 371 TNKRSRSKINXXXXXXXXXXXXXXXXXAFNHQSLDSAPRKHASRGHSKNFPXXXXXXXXX 430
             ++S+ K                     +H + +++   H SRG   N P         
Sbjct: 374 IKRQSQLK-----------KRQSQVQQTHSHSNSNTSAYSHVSRGALVNTPTKRKNRASM 422

Query: 431 XXXXXTDCSPIPLRSSKRISISSAV 455
                    P+      R  +S+ V
Sbjct: 423 VSVSSAHKRPVSFNRLSRADLSNHV 447

 Score =  100 bits (249), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 136/503 (27%), Positives = 193/503 (38%), Gaps = 130/503 (25%)

Query: 484  PNLGRGXXXXXXXXXXXXXIXXXXXXXXXXXTKRTSSNFATLIDEIFEPEKFELAKREKA 543
            PN+ RG                         TKR SSNFATLID IFE EK+E  ++EK 
Sbjct: 618  PNMQRGSITTKLISTYAQLAEDDDWEFIEKETKRVSSNFATLIDNIFEHEKYEQIRKEKD 677

Query: 544  ELQKKVQEAKRQVSKNA----PISDEKDVGFE----------------------VSDGMR 577
            EL++KV+E K++  +       I  EK +  E                       ++G R
Sbjct: 678  ELERKVRENKKREEEERLVREAIEKEKQIELEKERLQLQKEMEGDIDNAKETVQTTEGKR 737

Query: 578  ELK--KINNK----------------VSSPLMNYEFSQKELLQDIDTLLTNRYQLSSYTR 619
            E    KI  +                VS+PL   E S+           + +   S  TR
Sbjct: 738  EAHNDKIKTETDDEERDIIVDIQPRSVSAPLEKTEKSRDSPFD-----YSKQRNFSLRTR 792

Query: 620  PISRLDPGL--TPVTGAIPHSIKEKTALLQ--------DTEMKIIETIRKSEFLGS---- 665
            P+SRLDPGL  +  TG+  ++    T  L         DT+  I+ETIR+S+FLGS    
Sbjct: 793  PVSRLDPGLMYSSGTGSSAYNPSHSTEDLHSTSSLNRIDTQKVILETIRRSKFLGSSFDL 852

Query: 666  ---------------------------LLNVREGISQDN------------NQLASIEVS 686
                                       + +V E +SQ N            N     E+ 
Sbjct: 853  KKELEMVEELESNRIKQQAFQDSHLEEMNDVTEDLSQHNVDTSNDRIVSTTNDRYETEIL 912

Query: 687  PKI---STTPLMYND-QVEIRKISDVEVPHFTRKSKHFTTANNRRSVLSLYSLKESLEDL 742
            PK     T  +  ND  V+ R +S+++VP FTRKSK F+ +N R SVLSLYS +ES  +L
Sbjct: 913  PKSHAGKTQTIGLNDSSVQPRTLSEIKVPQFTRKSKFFSESNKRLSVLSLYSSRESFTNL 972

Query: 743  ----------------NQISKNEEPD---SPPQGSTDNASKSELVDVIEEVTEXXXXXXX 783
                            +  +K++EP+     P   T +   S     I E          
Sbjct: 973  VDMLKEDGINVEPTERSPTTKSQEPEFLFESPSVDTYSRDSSTEDKPINEKENSEPIQSN 1032

Query: 784  XXXXXXXXXXXXXXILYDVPECVDSPQGY-----DINDAHSTQSPASKSTEPKPVVKLPS 838
                             D  +  +SP G+       +D +       K+ +   +VKLP+
Sbjct: 1033 NLRLSFHDRFNRQLSTEDTEKTKNSPSGHIKDEPKKDDDNGVDLSTPKAKDESNLVKLPA 1092

Query: 839  LSSFQRKNASGLGIYQRESSRES 861
            L     K   GLGIYQ+   R S
Sbjct: 1093 LPPLTTKKTDGLGIYQKSKQRTS 1115

 Score = 84.7 bits (208), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 35/101 (34%), Positives = 67/101 (66%)

Query: 930  ELDVRAKISEKRLYEGLHKLLEGWKQYGLKNLGINTADMIISGKLVNDGILSLRSTLFEI 989
            +  ++A ++  ++++GL  L  GW +YGLKN+  +   +  +GK+ ++ ILS +ST+FE+
Sbjct: 1289 DFQLKANVAAPQMFKGLDTLFRGWSKYGLKNIKSSPESLRFTGKVSSENILSFKSTVFEL 1348

Query: 990  VILPNGSGRSLIKFNKKTGSTKTLTKFATEIQIILQKEGVL 1030
             I+ N     L++F K +GS+K++ +   E++ +L+KEGVL
Sbjct: 1349 EIISNSVKTCLLRFKKTSGSSKSVRRLVNEVENVLRKEGVL 1389

>NDAI0A00660 Chr1 (121773..124841) [3069 bp, 1022 aa] {ON} Anc_1.52
          Length = 1022

 Score =  548 bits (1411), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 259/361 (71%), Positives = 307/361 (85%), Gaps = 12/361 (3%)

Query: 16  NIIGPWKLGETLGFGSTGKVQLARHERTGQKTAVKVIPKSIFKSEGSHGNNDSV------ 69
           + IGPWKLG+TLG GSTGKV+LA +E T Q+ A+K+I KSIF S+G+ G +  V      
Sbjct: 13  DTIGPWKLGKTLGLGSTGKVELAYNETTSQQAAIKIISKSIF-SQGTVGESSMVSNSSPD 71

Query: 70  -LPFNIEREIVIMKLLSHPNVLSLYDVWETDNNLYLILEYAEKGELFNLLVDRGPLPERE 128
            LP+ IEREI+IMKLL HPNVLSLYDVWET++ LY+ILEYAEKGELFNLLV+RGPLPE+E
Sbjct: 72  ALPYGIEREIIIMKLLRHPNVLSLYDVWETNSKLYMILEYAEKGELFNLLVERGPLPEKE 131

Query: 129 AIKCFKQIIIAISYCHALGIVHRDLKPENLLLDNSYNIKIADFGMAALQTDAGMLETSCG 188
           AI+ F+QIII ISYCHALGIVHRDLKPENLLLD+  NIKIADFGMAAL+T   MLETSCG
Sbjct: 132 AIRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKLNIKIADFGMAALETKDKMLETSCG 191

Query: 189 SPHYAAPEIVSGLPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRDLLLKVQKGQFEM 248
           SPHYAAPEIVSG+PY GF SDVWSCGVILFALLTGRLPFDEE+GN+R+LLLKVQ G++EM
Sbjct: 192 SPHYAAPEIVSGVPYHGFQSDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQSGEYEM 251

Query: 249 PNNAEISGDAQDLIRRILVVDPTQRIKIRDILSHPLLKKYQTIKDSKSIKDLPRENTYLY 308
           P++ EIS +AQDLI RIL VDP QRIK RDIL HPLL+KY +IKDS+SIK+LPRE+TYLY
Sbjct: 252 PDDDEISKEAQDLIGRILTVDPEQRIKTRDILKHPLLQKYPSIKDSRSIKNLPREDTYLY 311

Query: 309 PLADADNHTSVTIDDSILQNLVILWHGRPAEEIMKKLQDNGTNTEKTLYALLYRFKLESM 368
           PL++ ++     IDDSILQNLV LWHGR  ++I  KL+++G + EKT+YALLYRFK+E+ 
Sbjct: 312 PLSENNS----IIDDSILQNLVALWHGRDKDDIAGKLRESGADAEKTVYALLYRFKVEAE 367

Query: 369 K 369
           K
Sbjct: 368 K 368

 Score =  200 bits (508), Expect = 7e-52,   Method: Compositional matrix adjust.
 Identities = 184/552 (33%), Positives = 275/552 (49%), Gaps = 90/552 (16%)

Query: 515  TKRTSSNFATLIDEIFEPEKFELAKREKAELQKKVQ--------------------EAKR 554
            TKRTSS+FATLIDE+FE EK+E  ++EK EL++KV+                    + K 
Sbjct: 525  TKRTSSDFATLIDELFEHEKYERIRKEKEELERKVRETRVREQRREEEERAELQREQLKL 584

Query: 555  QVSKNAPISDEKDVGFEVSDGMRELKKINNKVSSPLMNYEFSQKELLQDIDTLLTNRYQL 614
            Q   +  IS  K+   E  D  R        VS+P+      + E   + +  L NR Q 
Sbjct: 585  QQKIDEEISKLKEDALE-KDNFRS-------VSAPI-----KENEDEDENENELRNRRQF 631

Query: 615  SSYTRPISRLDPG-LTPVTGAIPHSIK-------EKTALLQDTEMKIIETIRKSEFLGSL 666
            S  TRP+SRLDPG L      IP   +        K++  Q  + KI+ETIR+S+FLGS 
Sbjct: 632  SLQTRPVSRLDPGILYSAPAEIPSYERVVVNESGNKSSAQQ--QRKILETIRRSKFLGSS 689

Query: 667  LNVREGI--SQDNNQLASIEVSPKISTTPLMYNDQVEIRKISDVEVPHFTRKSKHFTTAN 724
             N+++ +  SQ N  + + E    +    L    +  +RKIS+V++P FTRKS+HF+ +N
Sbjct: 690  FNIQQELEFSQRNVLVPTKEQVVDVDEVKL----EGGLRKISEVKIPQFTRKSRHFSDSN 745

Query: 725  NRRSVLSLYSLKESLEDLNQISKN-EEPDSPPQGSTDNASKSELVDVIEEVTEXXXXXXX 783
             R SVLS+YS K+S  +L  I K+  E   P + + +   +S   D + EV+E       
Sbjct: 746  KRLSVLSMYSTKQSYTNLGHILKDGTEESEPAKKTPELLFESGRDDRLYEVSEEPEIQEE 805

Query: 784  XXXXXXXXXXXXXXILYDVPECVDSPQGYDINDAHSTQSPASKSTEPKPVVKLPSLSSFQ 843
                             D+ E V  PQ   +  + +T + A+++       ++  L+ F+
Sbjct: 806  KE---------------DI-ETVTLPQLPPLKQSANTNANANET-------EINGLAIFR 842

Query: 844  RKNASGLGIYQRESSRESLPSVTINISESDKTTENEAQKEIKHDKS-DTILSNHDGKADS 902
             K    L    +E  +E +PS      +       + + E+K ++  D I  N  G  + 
Sbjct: 843  PKENIELEDITKEV-KEVIPSQDHGKDKPIAINNPKQRLEVKPERQLDEIAPNKVGTTEK 901

Query: 903  YKGDISNIVRESSHGSFLKKLSKG----KILELDVRAKISEKRLYEGLHKLLEGWKQYGL 958
             +           + SF +K S      K  + ++   I  ++LY GL KLLEGW QYGL
Sbjct: 902  KR-----------NVSFFRKFSNNSATIKGYDHEIYVNIGSRQLYTGLRKLLEGWTQYGL 950

Query: 959  KNLGINTADMIISGKLVNDGILSLRSTLFEIVILPNGSGRSLIKFNKKTGSTKTLTKFAT 1018
            K++  +   M I+GKL ND ILSLRSTLFE+++ P GS  SLI F K  GS+K + +  T
Sbjct: 951  KDVRSDNTAMKITGKLANDNILSLRSTLFELLVEPKGSKYSLIGFTKVQGSSKVVRRLFT 1010

Query: 1019 EIQIILQKEGVL 1030
            EI+ +L KEGVL
Sbjct: 1011 EIEKVLNKEGVL 1022

>TDEL0C06490 Chr3 complement(1191461..1194922) [3462 bp, 1153 aa]
           {ON} Anc_1.52 YDR507C
          Length = 1153

 Score =  548 bits (1412), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 256/369 (69%), Positives = 308/369 (83%), Gaps = 9/369 (2%)

Query: 16  NIIGPWKLGETLGFGSTGKVQLARHERTGQKTAVKVIPKSIFKSEGS------HGNNDSV 69
           N IGPWKLGETLG GSTGKVQLA  E T Q+ A+KVI K+IF  +GS        +    
Sbjct: 15  NKIGPWKLGETLGLGSTGKVQLAYDESTNQQAAIKVISKAIFNVKGSVKDSSVAASTPDS 74

Query: 70  LPFNIEREIVIMKLLSHPNVLSLYDVWETDNNLYLILEYAEKGELFNLLVDRGPLPEREA 129
           LP+ IEREI+IMKLL+HPNVL LYDVWET++NLY++LEYA+KGELFNLLV+RGPLPE+EA
Sbjct: 75  LPYGIEREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAQKGELFNLLVERGPLPEKEA 134

Query: 130 IKCFKQIIIAISYCHALGIVHRDLKPENLLLDNSYNIKIADFGMAALQTDAGMLETSCGS 189
           I+ F+QI+I ISYCHALGIVHRDLKPENLLLD+ +NIKIADFGMAAL+T+  +LETSCGS
Sbjct: 135 IRFFRQIVIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALETEDKLLETSCGS 194

Query: 190 PHYAAPEIVSGLPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRDLLLKVQKGQFEMP 249
           PHYAAPEIVSG+PY GFASDVWSCGVILFALLTGRLPFD+E+GN+R+LLL+VQ G++EMP
Sbjct: 195 PHYAAPEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDDEDGNIRNLLLQVQSGRYEMP 254

Query: 250 NNAEISGDAQDLIRRILVVDPTQRIKIRDILSHPLLKKYQTIKDSKSIKDLPRENTYLYP 309
            + EIS DAQDLI RIL VDP QRIK RDIL HPLL+KY +I DSKSI++LPRE+TYL+P
Sbjct: 255 GDDEISPDAQDLIARILTVDPEQRIKARDILKHPLLQKYPSINDSKSIRNLPREDTYLHP 314

Query: 310 LADADNHTSVTIDDSILQNLVILWHGRPAEEIMKKLQDNGTNTEKTLYALLYRFKLESMK 369
           L++ +   S  ID++ILQNLV+LWHGR   EI+ KL++ G N EKTLYALL RFK ++  
Sbjct: 315 LSEGE---SAEIDENILQNLVVLWHGREQLEIINKLREPGANAEKTLYALLDRFKSDTEN 371

Query: 370 ETNKRSRSK 378
           ++ K  +SK
Sbjct: 372 DSVKHPQSK 380

 Score =  212 bits (539), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 201/608 (33%), Positives = 295/608 (48%), Gaps = 107/608 (17%)

Query: 515  TKRTSSNFATLIDEIFEPEKFELAKREKAELQKKV----------------------QEA 552
            TKRTSS+FATL D+IFE EKFE  +REK EL++KV                      QE 
Sbjct: 556  TKRTSSDFATLCDQIFEHEKFEQIRREKEELERKVRETKEREERERREKEIEEKRKIQEK 615

Query: 553  ----KRQVSKNAPISDE-KDVGFEVSDGMR---------ELKKINNK-VSSPLMNYEFSQ 597
                +RQ+     + +E  ++G E+  GM          E   +N + VS PL       
Sbjct: 616  QDLERRQLEIQRQMDEEVANLGKELQGGMNADQDADEGDEHGAVNGRSVSEPLQKKSADP 675

Query: 598  KELLQ-DIDTLLTNRYQLSSYTRPISRLDPGL--TPVTGAIPHSIKEKTALLQDTEMKII 654
               LQ +ID LL  R   S  TRP+SRLDPG+  +  +    ++  E  A L + ++ I+
Sbjct: 676  MADLQANIDDLLRQR-TFSLQTRPVSRLDPGVFSSDSSEKDQYTGSEDRAKLNNDKI-IL 733

Query: 655  ETIRKSEFLGSLLNVREGISQ--DN-------------------NQLASIEVSPKISTT- 692
            ETIR+S+FLGS  ++ + + +  DN                   N     ++ PK +T  
Sbjct: 734  ETIRRSKFLGSSFDINKELKRAADNEAKKQRQSKATSDRIISTTNDEYETQILPKNATAS 793

Query: 693  -PLM-YNDQVEIRKISDVEVPHFTRKSKHFTTANNRRSVLSLYSLKESLEDLNQISKNEE 750
             PL  +N Q E RKISD++VP FTRKS+ F  +N R SVLS+YS K+S  +L  +   E 
Sbjct: 794  APLKDHNHQAEPRKISDIKVPQFTRKSRQFGDSNKRLSVLSMYSSKQSYTNLADLLNEEA 853

Query: 751  PDSPP-QGSTDNASKSELVDVIEEVTEXXXXXXXXXXXXXXXXXXXXXILYDVPECVDSP 809
             ++   + S ++ S  E   + E V E                      LY+VPE  +  
Sbjct: 854  SNAKGNRDSPNDQSGHEPEFLFENVQEDGEVTGDSSHDGR---------LYEVPEDSNMT 904

Query: 810  Q---GYDINDAHSTQSPASKSTEPKPVVKLPSLSSFQRKNASGLGIYQRESSRESLPS-V 865
            +     +  D   T +   ++ E K V +LP+L     K A GLGIYQ  SS ESLP   
Sbjct: 905  KEKLKLNFADRFKTSNGEDRTAEDKNV-RLPTLPPLDGKEAKGLGIYQ--SSSESLPEPA 961

Query: 866  TINISESDKTTENEAQK-----EIKHDKS----------DTILSNH--DGKADSYKGDIS 908
              N+    +  EN+  +      IK D +          +  +  H  DG   S +    
Sbjct: 962  QHNVKSMIQNDENQPSETAEVLSIKEDNAQVERQQEAPLNASIPKHRTDGAQKSERMPSK 1021

Query: 909  NIVRESSHGSFLKKLSKGK------ILELDVRAKISEKRLYEGLHKLLEGWKQYGLKNLG 962
                +  + SF +K SK          + ++ A ++ K+L+ GL  LL+GWK+YGLK + 
Sbjct: 1022 EGSEKKRNTSFFRKFSKSSNEKTNGEFDAELYASVAAKQLFNGLQNLLQGWKKYGLKGVK 1081

Query: 963  INTADMIISGKLVNDGILSLRSTLFEIVILPNGSGRSLIKFNKKTGSTKTLTKFATEIQI 1022
                 + ++GKL ++ ILSLRSTLFE+V+   G G S++ F KK+GSTKTL +  +EI+ 
Sbjct: 1082 SMPDKLTLTGKLSSENILSLRSTLFEMVVWSRGKG-SIVGFRKKSGSTKTLKRLVSEIEK 1140

Query: 1023 ILQKEGVL 1030
            +L KE VL
Sbjct: 1141 VLLKERVL 1148

>Kpol_2002.46 s2002 (95107..98478) [3372 bp, 1123 aa] {ON}
           (95107..98478) [3372 nt, 1124 aa]
          Length = 1123

 Score =  547 bits (1409), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 259/370 (70%), Positives = 309/370 (83%), Gaps = 11/370 (2%)

Query: 16  NIIGPWKLGETLGFGSTGKVQLARHERTGQKTAVKVIPKSIFKSEGSHGNNDSV------ 69
           + IGPWKLGETLG GSTGKVQLA +E T Q+ A+KVI KS+F    S GNN S+      
Sbjct: 14  DTIGPWKLGETLGLGSTGKVQLAYNESTNQQAAIKVISKSVF---SSMGNNSSMVSSTPD 70

Query: 70  -LPFNIEREIVIMKLLSHPNVLSLYDVWETDNNLYLILEYAEKGELFNLLVDRGPLPERE 128
            L + IEREI+IMKLL+HPNVL LYDVWET+NNLY++LEYAEKGELFNLLV++GPLPE E
Sbjct: 71  SLSYGIEREIIIMKLLNHPNVLRLYDVWETNNNLYMVLEYAEKGELFNLLVEKGPLPENE 130

Query: 129 AIKCFKQIIIAISYCHALGIVHRDLKPENLLLDNSYNIKIADFGMAALQTDAGMLETSCG 188
           AI+ F+QIII +SYCHALGIVHRDLKPEN+LLD+  NIKIADFGMAAL+T+  +LETSCG
Sbjct: 131 AIRFFRQIIIGMSYCHALGIVHRDLKPENILLDHKLNIKIADFGMAALETEDKLLETSCG 190

Query: 189 SPHYAAPEIVSGLPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRDLLLKVQKGQFEM 248
           SPHYAAPEIVSGLPY G  +DVWSCGVILFALLTGRLPFDEE+GN+R+LLLKVQKG+FEM
Sbjct: 191 SPHYAAPEIVSGLPYHGLETDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQKGEFEM 250

Query: 249 PNNAEISGDAQDLIRRILVVDPTQRIKIRDILSHPLLKKYQTIKDSKSIKDLPRENTYLY 308
           P + EIS +AQDL+ +ILVVDP +RIK R+IL HPLL+KY +IKDSK+I++LPRE+TYL 
Sbjct: 251 PGDDEISKEAQDLLYKILVVDPEKRIKSREILKHPLLQKYPSIKDSKTIRNLPREDTYLN 310

Query: 309 PLADADNHTSVTIDDSILQNLVILWHGRPAEEIMKKLQDNGTNTEKTLYALLYRFKLESM 368
           PL   D   + TID +ILQNLV+LWHGR  ++I KKL++ G N EKTLYALLYRFK++S 
Sbjct: 311 PLIGNDGGDA-TIDKTILQNLVVLWHGRNEDDIAKKLREPGANAEKTLYALLYRFKVDSE 369

Query: 369 KETNKRSRSK 378
           +E  K S+ K
Sbjct: 370 QEALKNSQIK 379

 Score =  182 bits (462), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 181/597 (30%), Positives = 276/597 (46%), Gaps = 114/597 (19%)

Query: 515  TKRTSSNFATLIDEIFEPEKFELAKREKAELQKKVQEAKRQVSKN--------APISDEK 566
            TKR SS+FATLIDEIFE EK+E  ++EK EL++KV+E K +  +         A I+ E+
Sbjct: 558  TKRVSSDFATLIDEIFEHEKYEQIRKEKEELERKVRENKEREERQKRQKEVELAAIARER 617

Query: 567  ------------DVGFEVSDGMRELK------KINNKVSSPLMNYEFSQKELLQDIDTLL 608
                         +  E+    +  +      K    +SSP+ N   ++ E  +D     
Sbjct: 618  EELQRRLEEEETQITKELQQDTKNFQEDEVVHKNVRSISSPVENGNEAKSE--EDA---- 671

Query: 609  TNRYQLSSYTRPISRLDPGLT-----PVTGAIPHSIKEKTALLQDTEMKIIETIRKSEFL 663
            + +   S  TRP+S+LDPG+      PV   +   ++++     D++  I+ETIR+S+FL
Sbjct: 672  SGQRSFSLQTRPVSKLDPGIKCGSNKPV--QMEEIVEDELDKTIDSQKVILETIRRSKFL 729

Query: 664  GSLLNVREGISQ--------------------------DNNQLASIEVSPKISTTPLMYN 697
            GS  N+ + + Q                          + N+    +V PK +T      
Sbjct: 730  GSSFNIDKELKQVKKDAEVKRMRKSQKEDRDVSGRIVSETNEQYETQVLPKNATAFGALK 789

Query: 698  D---QVEIRKISDVEVPHFTRKSKHFTTANNRRSVLSLYSLKESLEDLNQISKNEEPDSP 754
            D   +VE RKISD++VP FTRKSK FT +N R SVLS+YS  +S  +L  + K    D  
Sbjct: 790  DDSEEVEPRKISDIQVPQFTRKSKLFTDSNKRLSVLSIYSSTQSYTNLANVLKEGGVDIG 849

Query: 755  PQGSTDNASKSELVDVIEEVTEXXXXXXXXXXXXXXXXXXXXXILYDVPECVDSPQGYDI 814
                ++N   SE  +   E                                    QG +I
Sbjct: 850  VNEGSNNVEVSEEPEFQFETVGTEIENNKYEEEKEIENENNLS------------QGANI 897

Query: 815  NDAHSTQSPASKSTEPKPVVKLPSLSSF-QRKNASGLGIYQRESSRES-----LPSVTIN 868
               ++ +   + +      VKLP+L      K + GLGIY  +S  E      +PS+  N
Sbjct: 898  KLNYADRFDTAGNVNE---VKLPTLPPLGDDKVSDGLGIYSSKSGSEGNESKPVPSIKEN 954

Query: 869  ISES---DKTTE-----NEAQKEIKHDKSDTILSNHDGKADSYKGDISNIVRESSHGSFL 920
             SE    +K  E     N+   + +  K   ++ N++ K  S K             SF 
Sbjct: 955  KSEETLKEKNVEPKPPLNDVVPKTRDTKKTNVVQNNNAKHSSDK---------PRSTSFF 1005

Query: 921  KKLSKGKILELDVR-------AKISEKRLYEGLHKLLEGWKQYGLKNLGINTADMIISGK 973
            +K+SKG  ++ D         + +S  +LY GL  LL+GWK YGLK +  N     IS +
Sbjct: 1006 RKISKGLTVQNDTTGYDVKLFSNVSVTQLYNGLFNLLKGWKDYGLKEIKSNKEAFSISVR 1065

Query: 974  LVNDGILSLRSTLFEIVILPNGSGRSLIKFNKKTGSTKTLTKFATEIQIILQKEGVL 1030
            L +D ILSLRST  ++V+   G   S+I F KK+GS+KTL +  +E++ +L+KEGVL
Sbjct: 1066 LSSDNILSLRSTFVDMVVFSEGK-HSVIGFRKKSGSSKTLKRLTSEVEKVLRKEGVL 1121

>KLTH0F01672g Chr6 (127277..130771) [3495 bp, 1164 aa] {ON} similar
           to uniprot|Q12263 Saccharomyces cerevisiae YDR507C
          Length = 1164

 Score =  545 bits (1404), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 255/364 (70%), Positives = 302/364 (82%), Gaps = 9/364 (2%)

Query: 18  IGPWKLGETLGFGSTGKVQLARHERTGQKTAVKVIPKSIFKSEGSH----GNND-SVLPF 72
           IGPWKLG TLG GSTGKV +A+HE TGQ+ AVK++ KSIF ++ +     G+ND  VLP+
Sbjct: 23  IGPWKLGSTLGAGSTGKVVMAQHESTGQQAAVKIVSKSIFGNQSNSSTIVGSNDPDVLPY 82

Query: 73  NIEREIVIMKLLSHPNVLSLYDVWETDNNLYLILEYAEKGELFNLLVDRGPLPEREAIKC 132
            IEREI+IMKLL+HPNVL LYDVWET+++LY++LEY EKGELFNLLVDRGPLPE EA++ 
Sbjct: 83  GIEREIIIMKLLNHPNVLRLYDVWETNSSLYMVLEYVEKGELFNLLVDRGPLPENEAVRF 142

Query: 133 FKQIIIAISYCHALGIVHRDLKPENLLLDNSYNIKIADFGMAALQTDAGMLETSCGSPHY 192
           F+QIII ISYCHALGIVHRDLKPENLLLD+ +NIKIADFGMAAL++   +LETSCGSPHY
Sbjct: 143 FRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALESKDKLLETSCGSPHY 202

Query: 193 AAPEIVSGLPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRDLLLKVQKGQFEMPNNA 252
           AAPEIVSGLPY GF SDVWSCG+ILFALLTGRLPFDEE+GN+R+LLLKVQ G+FEMP+  
Sbjct: 203 AAPEIVSGLPYHGFESDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGKFEMPDTN 262

Query: 253 EISGDAQDLIRRILVVDPTQRIKIRDILSHPLLKKYQTIKDSKSIKDLPRENTYLYPLAD 312
           EISG+AQDLI +IL VDP  RIK R IL HPLL+KY +IKDSKSI++LPRE+TYL PL  
Sbjct: 263 EISGEAQDLIAKILTVDPAARIKSRGILKHPLLQKYPSIKDSKSIRNLPREDTYLNPLDS 322

Query: 313 ADNHTSVTIDDSILQNLVILWHGRPAEEIMKKLQDNGTNTEKTLYALLYRFKLESMKETN 372
            D     TIDD+I+ NLV+LWHGR   EI  KL++ G N EKT YALL+RFK +S +E  
Sbjct: 323 VDG----TIDDTIIGNLVVLWHGRDRNEITNKLKEPGANLEKTFYALLFRFKHDSQQEQL 378

Query: 373 KRSR 376
           K+ R
Sbjct: 379 KQQR 382

 Score =  163 bits (413), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 181/624 (29%), Positives = 280/624 (44%), Gaps = 125/624 (20%)

Query: 515  TKRTSSNFATLIDEIFEPEKFE-------------------------------------- 536
            TKRTS++FATL DEIFE EK+E                                      
Sbjct: 554  TKRTSADFATLCDEIFEHEKYEQIRREKEELERRVREAKEQEERERRQREEEERRQREEE 613

Query: 537  LAKREKAELQK--KVQEAKRQVSKNAPISDEKDVGFEVSDGMRELKKINNKVSSPL---- 590
            LA++ + E ++  + +E +  + +   +  E   G+E S G+   K  N  VS+P+    
Sbjct: 614  LARQREFEEERYHRQREVQENIDREMALLKE---GYETSSGVDPNK--NRSVSAPVESVL 668

Query: 591  -MNYEFSQKELLQDIDTLLTNRYQLSSYTRPISRLDPGLTPVTGAIPHSIKEKTALLQDT 649
             ++   S   L  DI  LL NR   S  TRP SRLDPG+  +       IK+    L+ T
Sbjct: 669  KVDKRSSMDALDGDIMDLL-NRRTFSLETRPKSRLDPGIYTLEEVPNSDIKDGGRDLK-T 726

Query: 650  EMKIIETIRKSEFLGSLLNVREGISQDNN----QLASI---------------------- 683
            E  I+ETIR+S+FLGS  ++ + ++++      + A++                      
Sbjct: 727  EKTILETIRRSKFLGSSFDINKELARERRLKEERAAALKQRKKEDRVVSNATGNYSENGY 786

Query: 684  --EVSPKISTTPLMYNDQ-VEIRKISDVEVPHFTRKSKHFTTANNRRSVLSLYSLKESLE 740
              +  PK +    + ND   + RKIS+V+VP FTR+S+HFT +N R SVLS+YS K S  
Sbjct: 787  EPQTLPKNAAATKISNDAGSDPRKISEVQVPQFTRRSRHFTASNKRLSVLSMYSTKASFT 846

Query: 741  DLNQISKNEEPDSPPQGSTDNASKSELVDVIEEVTEXXXXXXXXXXXXXXXXXXXXXILY 800
            +L    + +       GS  + S+      +E  TE                      LY
Sbjct: 847  NLADHLRGKTDLQSINGSPPSTSR------MEPETEFMFESVDGEGKETADTSADSR-LY 899

Query: 801  DVPECVDSPQG-----YDINDA---HSTQSPASKSTEPKPVVKLPSLSSFQRKNA---SG 849
            +V E  D P+G       +N A   +   SP  +S E    +KLPSL    +  +   +G
Sbjct: 900  EVAEGND-PKGAARSAVRLNFADRFNKPTSPPPQSVEDPNGIKLPSLPPLDKAKSDGVNG 958

Query: 850  LGIYQ-----RESSRESLPSVTINISESDKTTEN---EAQKEIKHDKSDT--------IL 893
            LG+YQ      E+     P   I +    K       E QK++     ++        + 
Sbjct: 959  LGLYQPASDSSETEIHHQPKSMIPVDAEQKEAAEAKPEEQKQVPPKDVESAPAPLNKVMK 1018

Query: 894  SNHDGKADSYKGDISNIVRESSHGSFLKKLS-----KGKILELDVR--AKISEKRLYEGL 946
             N + + +       N V++++  SF ++ S     + +  E D +    I   +++  L
Sbjct: 1019 KNTEAEKNQPNQPAPNAVKKNNK-SFFRRFSGKSDDEKRPGEYDFKFDTVIEGTQMFNAL 1077

Query: 947  HKLLEGWKQYGLKNLGINTADMIISGKLVNDGILSLRSTLFEIVILPNGSGRSLIKFNKK 1006
             KLL  WK YGLK++  + +   I GK+ +D +LSLRSTLFEI I+  G G S++ F KK
Sbjct: 1078 SKLLAAWKDYGLKDVVASPSQKKIKGKMSSDNMLSLRSTLFEISIVSKGEG-SIVGFTKK 1136

Query: 1007 TGSTKTLTKFATEIQIILQKEGVL 1030
            +GSTKT  K   EI+ IL+ +  L
Sbjct: 1137 SGSTKTFKKLVKEIEKILESKKAL 1160

>TPHA0E03640 Chr5 complement(769962..773375) [3414 bp, 1137 aa] {ON}
           Anc_1.52 YDR507C
          Length = 1137

 Score =  541 bits (1394), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 256/394 (64%), Positives = 312/394 (79%), Gaps = 21/394 (5%)

Query: 1   MAVANMETYRITKPLNIIGPWKLGETLGFGSTGKVQLARHERTGQKTAVKVIPKSIFK-- 58
           M  AN+    +T   N IGPWKLGETLGFGSTGKVQLA +E+T Q+ A+K+I KS+F   
Sbjct: 1   MLKANISDVTVTG--NNIGPWKLGETLGFGSTGKVQLATNEQTNQQAAIKIISKSVFDHL 58

Query: 59  ----------------SEGSHGNNDSVLPFNIEREIVIMKLLSHPNVLSLYDVWETDNNL 102
                           + GS  +N   LP+ IEREI+IMKLL+H NVL LYDVWET+NNL
Sbjct: 59  VNSNNNNNSALAASDVNNGSVQHNQEALPYGIEREIIIMKLLNHTNVLRLYDVWETNNNL 118

Query: 103 YLILEYAEKGELFNLLVDRGPLPEREAIKCFKQIIIAISYCHALGIVHRDLKPENLLLDN 162
           Y++LEYAEKGELFNLLV++GPL E EA++ F+QIII +SYCHALGIVHRDLKPEN+LLD+
Sbjct: 119 YMVLEYAEKGELFNLLVEKGPLAENEAVRFFRQIIIGMSYCHALGIVHRDLKPENILLDH 178

Query: 163 SYNIKIADFGMAALQTDAGMLETSCGSPHYAAPEIVSGLPYEGFASDVWSCGVILFALLT 222
             NIKIADFGMAAL+T+  +LETSCGSPHYAAPEIVSGLPY G  +D+WSCGVILFALLT
Sbjct: 179 KSNIKIADFGMAALETEDKLLETSCGSPHYAAPEIVSGLPYNGLETDIWSCGVILFALLT 238

Query: 223 GRLPFDEENGNVRDLLLKVQKGQFEMPNNAEISGDAQDLIRRILVVDPTQRIKIRDILSH 282
           GRLPFDEE+GN+R+LLLKVQKG+FEMP + E+S +AQDLI +IL V+P QRIK R+IL H
Sbjct: 239 GRLPFDEEDGNIRNLLLKVQKGEFEMPGSDELSLEAQDLIGKILTVNPKQRIKTREILKH 298

Query: 283 PLLKKYQTIKDSKSIKDLPRENTYLYPLADADNHTSVTIDDSILQNLVILWHGRPAEEIM 342
           PLL+KY  IKDSK+I+DLPRE+TYL PLAD +N     ID+SILQNL +LWHG+   EI+
Sbjct: 299 PLLQKYPNIKDSKTIRDLPREDTYLNPLAD-NNGVDTEIDESILQNLTVLWHGKDKNEII 357

Query: 343 KKLQDNGTNTEKTLYALLYRFKLESMKETNKRSR 376
           KKL++ G N EKTLY LL+RFK ++ +E +K S+
Sbjct: 358 KKLKEPGANAEKTLYVLLHRFKEDTERENHKNSQ 391

 Score =  181 bits (458), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 181/590 (30%), Positives = 283/590 (47%), Gaps = 100/590 (16%)

Query: 515  TKRTSSNFATLIDEIFEPEKFELAKREKAELQKKVQEAKRQVSKNAPISDEKDVGFEVSD 574
            TKR SS+FATLIDEIFE EKFE  ++EK EL++KV EAK++  +    ++          
Sbjct: 572  TKRVSSDFATLIDEIFEHEKFEKIRKEKEELERKVIEAKQKEERERKEAEAAAKEEARVR 631

Query: 575  GMRELKKINNKVSSPLMNYEFSQKELLQDIDTLLTNRYQ--------------------- 613
              +EL ++ NK    L N    +  LL+D    + +  Q                     
Sbjct: 632  REKELARM-NKEEEQLQNDIDEEARLLKDEFNFVNDETQENPINSRSVSEPVKNGGTDEK 690

Query: 614  ----LSSYTRPISRLDPGLT-PVTGAIPHSIKEKTALLQDTEMKIIETIRKSEFLGSLLN 668
                 S  TRPISRLDPGL     G + ++      L  + +  I+ETIR+S+FLGS  +
Sbjct: 691  GQRNFSLQTRPISRLDPGLMFSKLGDVDNNSSVDENLTMNNQKTILETIRRSKFLGSSFD 750

Query: 669  VREGISQDNNQL-----------ASIEVSPKISTTPLMYNDQ------------------ 699
            + + ++  N +              +E   +I++T  + N+                   
Sbjct: 751  INKELNNANEERKRLRQLQLQKQKELEEKERIASTSYVSNENQVLSKNAIGVVDLKDFSS 810

Query: 700  -VEIRKISDVEVPHFTRKSKHFTTANNRRSVLSLYSLKESLEDLNQISKNEEPDSPPQGS 758
             VE RKIS+V+VP FTRKSK+F+ +N R SVLS YS K+S  +L  + K E P      +
Sbjct: 811  DVEPRKISEVQVPQFTRKSKYFSESNKRLSVLSFYSSKQSYTNLVDMIK-ENPVEDEDVT 869

Query: 759  TD---NASKSELVDVIEEVTEXXXXXXXXXXXXXXXXXXXXXILYDVPECVDSPQGYDIN 815
             D   N   S+  D +EE  E                     +  +VP+ VD     +  
Sbjct: 870  EDPGFNFEDSQY-DYLEEKNE-----------------APLEVSDEVPKEVDDKVQEEEK 911

Query: 816  DAHSTQ-------SPASKSTEPKPVV--KLPSLSSFQRKNASGLGIYQRESSRESLPSVT 866
            ++ S +       S  + +T+ +     K P++ S  +    GLG+Y +    E  P  +
Sbjct: 912  NSVSMKLNFADRFSNVNSNTKQESSFEDKFPNILS--KSGTEGLGLYSKNEKTEPKPVKS 969

Query: 867  INISESDK-----TTENEAQKEIKHDKSDTILSNHDGKADSYK-GDISNIVRESSHGSFL 920
            + I E DK       E    K +   +++   S   G + S K  + S+ +R+ S  S  
Sbjct: 970  M-IPEEDKVNSSPVVEAPLNKVVNKTRAEN-KSTSKGPSGSQKVSNTSSFLRKISGKSSN 1027

Query: 921  KKLSKGKILELDVRAKISEKRLYEGLHKLLEGWKQYGLKNLGINTADMIISGKLVNDGIL 980
              ++KG   E+++ + ++E +L+ GL  LL+GW  YGLK++ ++    +I GKL ND IL
Sbjct: 1028 STVAKG-AFEVNLYSSVTETQLFNGLQNLLKGWTNYGLKDVKVDKQKKMIVGKLSNDNIL 1086

Query: 981  SLRSTLFEIVILPNGSGRSLIKFNKKTGSTKTLTKFATEIQIILQKEGVL 1030
            SLRST+ E+ +    S  S+I   KK+GS+KT+ + A+EI+ +L KEGVL
Sbjct: 1087 SLRSTIVELCVFTE-SKFSVIGIRKKSGSSKTMRRLASEIEKVLSKEGVL 1135

>KNAG0F00290 Chr6 (31750..35127) [3378 bp, 1125 aa] {ON} Anc_1.52
           YDR507C
          Length = 1125

 Score =  541 bits (1393), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 252/357 (70%), Positives = 300/357 (84%), Gaps = 8/357 (2%)

Query: 18  IGPWKLGETLGFGSTGKVQLARHERTGQKTAVKVIPKSIFKSEGSHGNNDS----VLPFN 73
           IG WK+GETLG GSTGKVQLA ++ TG + A+KVI K+IF+        D+     LP+ 
Sbjct: 15  IGSWKMGETLGLGSTGKVQLAYNKTTGNQAAIKVISKTIFQDSNVTSMVDNTTPDALPYG 74

Query: 74  IEREIVIMKLLSHPNVLSLYDVWETDNNLYLILEYAEKGELFNLLVDRGPLPEREAIKCF 133
           IEREIVIMKLL+H NVL LYDVWET++NLY++LEYAEKGELFNLLV+RGPLPE EAI+ F
Sbjct: 75  IEREIVIMKLLNHANVLRLYDVWETNSNLYMVLEYAEKGELFNLLVERGPLPENEAIRFF 134

Query: 134 KQIIIAISYCHALGIVHRDLKPENLLLDNSYNIKIADFGMAALQTDAGMLETSCGSPHYA 193
           +QIII ISYCHALGIVHRDLKPENLLLD  YNIKIADFGMAAL+T+  +LETSCGSPHYA
Sbjct: 135 RQIIIGISYCHALGIVHRDLKPENLLLDTKYNIKIADFGMAALETEDKLLETSCGSPHYA 194

Query: 194 APEIVSGLPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRDLLLKVQKGQFEMPNNAE 253
           APEIVSG+PY GFASDVWSCGVIL+ALLTGRLPFDEE+GN+R+LLLKVQ GQFEMP + E
Sbjct: 195 APEIVSGIPYHGFASDVWSCGVILYALLTGRLPFDEEDGNIRNLLLKVQAGQFEMPEDDE 254

Query: 254 ISGDAQDLIRRILVVDPTQRIKIRDILSHPLLKKYQTIKDSKSIKDLPRENTYLYPLADA 313
           IS +AQ+LI +ILVV+P +RI  RDIL HPLL+KY +IKDSKSI++LPRE+TYL+PLA+ 
Sbjct: 255 ISKEAQNLISKILVVNPAERITARDILKHPLLQKYPSIKDSKSIRNLPREDTYLHPLAE- 313

Query: 314 DNHTSVTIDDSILQNLVILWHGRPAEEIMKKLQDNGTNTEKTLYALLYRFKLESMKE 370
              T+  ID++ILQNLV+LWHGR   EI  KL+++G N EKTLYA+L RFKL+  +E
Sbjct: 314 ---TNSAIDENILQNLVVLWHGRDPAEIRVKLKEHGANAEKTLYAMLNRFKLDVEQE 367

 Score =  186 bits (471), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 188/608 (30%), Positives = 290/608 (47%), Gaps = 120/608 (19%)

Query: 515  TKRTSSNFATLIDEIFEPEKFELAKREKAELQKKVQEA---------KRQVSKNAPISDE 565
            TKRTSSNFATLIDEIFE EK+E  ++EK EL +KV+EA         ++++ +     + 
Sbjct: 542  TKRTSSNFATLIDEIFEHEKYEQIRKEKEELARKVREAKEREEAERKQKELQEREKQRER 601

Query: 566  KDVGFEVSDGMR------------------ELKKINNKVSSPLM----NYEFSQKELLQD 603
            +    E +D  R                  E K  +  VS PL       E   KELL+ 
Sbjct: 602  ERKENETNDRQRIMEEEIENLKKELDMMSHEGKTESRSVSEPLNKKQGGVEIEVKELLRQ 661

Query: 604  IDTLLTNRYQLSSYTRPISRLDPGL----------TPVTGAIPHSIKEKTALLQDTEMKI 653
             +  L         TRP SRLDPGL           P        +  K      TE  I
Sbjct: 662  RNAALQ--------TRPKSRLDPGLFFDSAESDTRNPSLQVFEGEVDNKLK----TEKAI 709

Query: 654  IETIRKSEFLGSLLNVREGISQDN----------------NQLASIEVSPK--ISTTPL- 694
            +ETIR+S+FLGS  ++ + +   +                + L   +V PK  I+T PL 
Sbjct: 710  LETIRRSKFLGSSFDISKELKSASARSDYSRAPGRVITAPSNLERSDVLPKNAIATAPLR 769

Query: 695  MYNDQVEIRKISDVEVPHFTRKSKHFTTANNRRSVLSLYSLKESLEDLNQISKNEEPDSP 754
            +++DQ E+RKISD++VP FTRKS++F+ ++ R SVLS+YS ++S ++L+ +   E  ++ 
Sbjct: 770  IHSDQPEVRKISDIKVPQFTRKSRNFSESSKRLSVLSMYSTRQSFKNLSDMMNFESENTD 829

Query: 755  PQ------GSTDNASKSELVDVIEEVTEXXXXXXXXXXXXXXXXXXXXXILYDVPECVDS 808
                     + ++A +SE +   E V E                      LY+V E  +S
Sbjct: 830  AAENRGQIATPNSAGQSEFL--FESVNEEAENTNNTSTDGK---------LYEVSESPES 878

Query: 809  --PQGYDINDAHSTQSPASKSTEPKPVVKLPSLSSFQRKNASGLGIYQ----------RE 856
               +G  +N +       S++     +  LP L        +GLGIYQ          +E
Sbjct: 879  SSKKGLRVNLSDRYNKANSEADMENKLPILPPLDP----EIAGLGIYQDQPEEVNAKPQE 934

Query: 857  SSRESLPSVTINISESDKTTENEAQKEIKHDKSDTILSNHDGKADSYKGD-ISNIVRESS 915
               +S  + T +ISE +    +   + I+      I       A   + D  +   +E++
Sbjct: 935  KKSKSKSAETGDISEGEPEVSDLKAENIRKAPQPPITEKKKLDAKKQRNDERTKASKENT 994

Query: 916  HGS-FLKKLS-----------KGKI-LELDVRAKISEKRLYEGLHKLLEGWKQYGLKNLG 962
              + FL+KLS           K K+  E  +   +S  ++Y+GL+ LL GW  YGLK++ 
Sbjct: 995  FSNNFLRKLSGQSNTTTQSVKKTKLGAEDGIHTTVSATQMYQGLYNLLRGWGSYGLKSIK 1054

Query: 963  INTADMIISGKLVNDGILSLRSTLFEIVILPNGSGRSLIKFNKKTGSTKTLTKFATEIQI 1022
             N+ +M I+GKL ++ ILSLRST+FEI+I+  G G S +   KK+GSTK + + A E++ 
Sbjct: 1055 GNSENMTITGKLASENILSLRSTIFEIIIIREGKG-SKVDIKKKSGSTKAVNRLAGEVKN 1113

Query: 1023 ILQKEGVL 1030
            +L KEGV+
Sbjct: 1114 VLVKEGVM 1121

>ZYRO0F17402g Chr6 complement(1445685..1449254) [3570 bp, 1189 aa]
           {ON} similar to uniprot|Q12263 Saccharomyces cerevisiae
           YDR507C
          Length = 1189

 Score =  533 bits (1372), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 251/373 (67%), Positives = 304/373 (81%), Gaps = 13/373 (3%)

Query: 18  IGPWKLGETLGFGSTGKVQLARHERTGQKTAVKVIPKSIFKSEGSHGNNDSV------LP 71
           +GPWKLGETLGFGSTGKVQLA +E T Q  AVK I K+IF ++ + GN+         LP
Sbjct: 17  VGPWKLGETLGFGSTGKVQLACNEITQQSAAVKEISKAIFSAKTAPGNSSIAASTPDPLP 76

Query: 72  FNIEREIVIMKLLSHPNVLSLYDVWETDNNLYLILEYAEKGELFNLLVDRGPLPEREAIK 131
           + IEREI+IMKLL+HPNVL LYDVWET+ +LY++LEYAEKGELFNLLV+ GPLPE EA+ 
Sbjct: 77  YGIEREIIIMKLLNHPNVLRLYDVWETNPSLYMVLEYAEKGELFNLLVENGPLPENEAVC 136

Query: 132 CFKQIIIAISYCHALGIVHRDLKPENLLLDNSYNIKIADFGMAALQTDAGMLETSCGSPH 191
            F+QIII +SYCHALGIVHRDLKPENLLLD+  NIKIADFGMAAL+T+  +LETSCGSPH
Sbjct: 137 FFRQIIIGVSYCHALGIVHRDLKPENLLLDHDLNIKIADFGMAALETEDKLLETSCGSPH 196

Query: 192 YAAPEIVSGLPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRDLLLKVQKGQFEMPNN 251
           YAAPEIVSG+PY GFASD+WSCGVI FALLTGRLPFDEE+GN+R+LLLKVQ G+FEMP++
Sbjct: 197 YAAPEIVSGIPYHGFASDIWSCGVIFFALLTGRLPFDEEDGNIRNLLLKVQSGKFEMPDD 256

Query: 252 AEISGDAQDLIRRILVVDPTQRIKIRDILSHPLLKKYQTIKDSKSIKDLPRENTYLYPLA 311
            EIS +AQDL+ +IL VDP  RIK R+IL HPLL+KY  + D+KSI++LPRE+TYL+PL+
Sbjct: 257 DEISPEAQDLLAKILTVDPECRIKPREILKHPLLQKYPNVSDNKSIRNLPREDTYLHPLS 316

Query: 312 DADNHTSVTIDDSILQNLVILWHGRPAEEIMKKLQDNGTNTEKTLYALLYRFKLESMKET 371
           D+    S  +D +ILQNLV+LWHGRPA EI  KL+D G N EKTLYALL RFK ++ +E 
Sbjct: 317 DSG---SSEVDQNILQNLVVLWHGRPAGEIAAKLKDPGANAEKTLYALLARFKNDTEREA 373

Query: 372 NK----RSRSKIN 380
            +    + RS +N
Sbjct: 374 ARQKQIKKRSSLN 386

 Score =  111 bits (278), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 98/285 (34%), Positives = 140/285 (49%), Gaps = 65/285 (22%)

Query: 515 TKRTSSNFATLIDEIFEPEKFELAKREKAELQKKVQ------------------------ 550
           TKRTSS+FATLIDEIFE EKFE  ++EKAEL+++V+                        
Sbjct: 550 TKRTSSDFATLIDEIFEHEKFEQIRKEKAELERRVKETKEREERERKEREEKELNEKLEN 609

Query: 551 --EAKRQV-SKNAPISDEKDVGFEVSDGMRELKKINNKVSSPLMNYEF-SQKELLQDIDT 606
               KR++ ++ A   D  D   +V    +    + + VS+PL   +  S   +  DI+ 
Sbjct: 610 DARQKREMEAQEAQGDDGTDTESDVHSNNQAPNGVRS-VSAPLERKKRDSMVNVQSDIEE 668

Query: 607 LLTNRYQLSSYTRPISRLDPGL-------TPVTGAIPHSIKEKTALLQDTEMKIIETIRK 659
           +   R  +S  TRP+SRLDPGL        P  G      K +      T+  I+ETIR+
Sbjct: 669 IFGQR-TMSLQTRPVSRLDPGLFYAEESNEPEAGDTEEEKKLR------TQKNILETIRR 721

Query: 660 SEFLGSLLNV-----------------REGISQDNNQLASIEVSP--KISTTPLMYNDQV 700
           S+FLGS  ++                 R+      N+     V P   ++T PL   DQ 
Sbjct: 722 SKFLGSSFDIGKELQNEELKKKASQPHRDRTVSQTNEPYDTRVLPTQAVATAPL--RDQ- 778

Query: 701 EIRKISDVEVPHFTRKSKHFTTANNRRSVLSLYSLKESLEDLNQI 745
           E RKIS++ VP FTRKS+ F+ +N R SVLS+YS K S  +L+ +
Sbjct: 779 EPRKISEISVPQFTRKSRFFSDSNKRLSVLSMYSTKHSYNNLSNL 823

 Score = 94.4 bits (233), Expect = 9e-19,   Method: Compositional matrix adjust.
 Identities = 48/118 (40%), Positives = 75/118 (63%), Gaps = 6/118 (5%)

Query: 918  SFLKKLSKGK-----ILELDVRAKISEKRLYEGLHKLLEGWKQYGLKNLGINTADMIISG 972
            SF +K SK         + ++   +S K+L+ GL  LL GW QYGLK++  +   M ++G
Sbjct: 1071 SFFRKFSKSNEKDTTGFDGEINTTVSAKQLFLGLQNLLHGWTQYGLKDVRSHPEKMTLTG 1130

Query: 973  KLVNDGILSLRSTLFEIVILPNGSGRSLIKFNKKTGSTKTLTKFATEIQIILQKEGVL 1030
            KL ++ ILSLRSTLFE+V+   G   S++ F KK+GS+K + +  +E++ +L KEGV+
Sbjct: 1131 KLTSENILSLRSTLFEMVVWSRGK-VSVVGFRKKSGSSKAMRRLVSEVEKVLLKEGVI 1187

>AFR696C Chr6 complement(1722130..1725558) [3429 bp, 1142 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR507C
           (GIN4) and YCL024W (KCC4)
          Length = 1142

 Score =  531 bits (1367), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 250/353 (70%), Positives = 295/353 (83%), Gaps = 7/353 (1%)

Query: 18  IGPWKLGETLGFGSTGKVQLARHERTGQKTAVKVIPKSIFKSEGSH--GNND-SVLPFNI 74
           IGPWKLGETLG GSTGKV LA++  TGQ  AVKVI KS+F ++GS   G+ND  VLP+ I
Sbjct: 16  IGPWKLGETLGAGSTGKVLLAQNTETGQIAAVKVISKSVFNAQGSTFVGSNDPDVLPYGI 75

Query: 75  EREIVIMKLLSHPNVLSLYDVWETDNNLYLILEYAEKGELFNLLVDRGPLPEREAIKCFK 134
           EREI+IMKLL+HPNVL LYDVWET  +LY++LEY EKGELFNLLV RGPLPE EA++ F+
Sbjct: 76  EREIIIMKLLNHPNVLRLYDVWETAQDLYMVLEYVEKGELFNLLVQRGPLPENEAVRFFR 135

Query: 135 QIIIAISYCHALGIVHRDLKPENLLLDNSYNIKIADFGMAALQTDAGMLETSCGSPHYAA 194
           QIII ISYCHALGIVHRDLKPENLLLD+ +NIK+ADFGMAAL++   +LETSCGSPHYAA
Sbjct: 136 QIIIGISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMAALESKDKLLETSCGSPHYAA 195

Query: 195 PEIVSGLPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRDLLLKVQKGQFEMPNNAEI 254
           PEIVSGLPY GF SDVWSCGVIL+ALLTGRLPFDEE+GN+R+LLLKVQ G++E+P   EI
Sbjct: 196 PEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEEDGNIRNLLLKVQSGKYEIPGEDEI 255

Query: 255 SGDAQDLIRRILVVDPTQRIKIRDILSHPLLKKYQTIKDSKSIKDLPRENTYLYPLADAD 314
           S +A+DLI +IL V+P QRIK R+IL HPLL+KY +IKDSKSI++LPRE+TYL PL    
Sbjct: 256 SPEARDLIVQILTVEPEQRIKTREILKHPLLQKYPSIKDSKSIRNLPREDTYLNPL---- 311

Query: 315 NHTSVTIDDSILQNLVILWHGRPAEEIMKKLQDNGTNTEKTLYALLYRFKLES 367
           +H   TID +ILQNLV+LWHGR   EI  KL++ G N EKT YALL+RFK E+
Sbjct: 312 DHNDGTIDQAILQNLVVLWHGRDKNEITMKLKEPGANLEKTFYALLHRFKFEN 364

 Score = 92.8 bits (229), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 47/94 (50%), Positives = 61/94 (64%)

Query: 937  ISEKRLYEGLHKLLEGWKQYGLKNLGINTADMIISGKLVNDGILSLRSTLFEIVILPNGS 996
            + + +++  L+KLL GW  YGLK +    A   I+GKL +D ILSLRST FEIVIL    
Sbjct: 1045 VGDSKMFRALNKLLNGWTSYGLKEVRSMPASYTITGKLSSDNILSLRSTAFEIVILSVAD 1104

Query: 997  GRSLIKFNKKTGSTKTLTKFATEIQIILQKEGVL 1030
              S +KF KK+GS KT T+   EI+ IL+KE VL
Sbjct: 1105 TGSSVKFTKKSGSKKTFTRLVNEIEKILEKESVL 1138

 Score = 90.5 bits (223), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 92/326 (28%), Positives = 140/326 (42%), Gaps = 110/326 (33%)

Query: 515 TKRTSSNFATLIDEIFEPEKFELAKREKAEL----------------------------- 545
            KRTSS+FATLID IFE EK+E  +REK EL                             
Sbjct: 529 AKRTSSDFATLIDNIFEHEKYEQIRREKEELERKVREAKEREERERRARAEAERRKREEE 588

Query: 546 -----------------QKKVQE-AKRQVSKNAPISDEKDVGFEVSDGMRELKK-INNKV 586
                            QK ++E   R  ++ A    EK +       +R + + +  K 
Sbjct: 589 ERRRRREVEELIRQRELQKSLEEQVARLKAEVAATKQEKRISLAQEQHVRSISEPMERKG 648

Query: 587 SSPLMNYEFSQKELLQDIDTLLTNRYQLSSYTRPISRLDPGLTPVTGAIPHSIKEKTALL 646
           + P     F    L  +I++LL  R  LS  TRPISRLDPG+          + E+  +L
Sbjct: 649 TRPSKRDSFLA--LQNNINSLLKRR-TLSLETRPISRLDPGI---------RLSEENTIL 696

Query: 647 QD----------TEMKIIETIRKSEFLGSLLNV--------REGISQDNNQLA------- 681
           +D           E  I+ETIR+S+FLGS  ++        RE + + N + +       
Sbjct: 697 EDDLECNEDRLRVEKNILETIRRSKFLGSQYDIDKELQRVRREKLEKVNMRKSQDRKLEP 756

Query: 682 -------------------------SIEVSPKISTTPLMYNDQVEIRKISDVEVPHFTRK 716
                                    SI +   ++   ++ +++ E RK+S+V++P FTR+
Sbjct: 757 GLHSRQEQRFVSDGTTVTSSHEDSESIILPKNVTAIGVLKDEESEPRKLSEVKIPQFTRR 816

Query: 717 SKHFTTANNRRSVLSLYSLKESLEDL 742
           SKHF+ ++ R SVLS+YS K S  +L
Sbjct: 817 SKHFSASSKRLSVLSMYSTKVSYTNL 842

>Ecym_1058 Chr1 (105835..109329) [3495 bp, 1164 aa] {ON} similar to
           Ashbya gossypii AFR696C
          Length = 1164

 Score =  530 bits (1365), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 248/353 (70%), Positives = 295/353 (83%), Gaps = 7/353 (1%)

Query: 18  IGPWKLGETLGFGSTGKVQLARHERTGQKTAVKVIPKSIFKSEGSH--GNND-SVLPFNI 74
           IGPW LGETLG GSTGKV +A++ +TGQ  AVK+I KSIF ++GS   G+ND  VLP+ I
Sbjct: 17  IGPWMLGETLGVGSTGKVLMAQNVQTGQIAAVKIISKSIFNAQGSTFVGSNDPDVLPYGI 76

Query: 75  EREIVIMKLLSHPNVLSLYDVWETDNNLYLILEYAEKGELFNLLVDRGPLPEREAIKCFK 134
           EREI IMKLL+HPNVL LYDVWET  +LY++LEY EKGELFNLL++RGPLPE EA++ F+
Sbjct: 77  EREITIMKLLNHPNVLRLYDVWETSTDLYMVLEYVEKGELFNLLIERGPLPENEAVRFFR 136

Query: 135 QIIIAISYCHALGIVHRDLKPENLLLDNSYNIKIADFGMAALQTDAGMLETSCGSPHYAA 194
           QIII ISYCHALGIVHRDLKPENLLLD+ +NIK+ADFGMAAL++   +LETSCGSPHYAA
Sbjct: 137 QIIIGISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMAALESKDKLLETSCGSPHYAA 196

Query: 195 PEIVSGLPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRDLLLKVQKGQFEMPNNAEI 254
           PEIVSGLPY GF SDVWSCGVIL+ALLTGRLPFDE++GN+R LLLKVQ G+FEMP+  EI
Sbjct: 197 PEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEDDGNIRKLLLKVQSGEFEMPDKDEI 256

Query: 255 SGDAQDLIRRILVVDPTQRIKIRDILSHPLLKKYQTIKDSKSIKDLPRENTYLYPLADAD 314
           S +AQDLI +IL VDP+ RIK R+IL HPLLKKY +IKDSKSI++LPRE+TYL PL    
Sbjct: 257 SIEAQDLIAKILTVDPSGRIKTREILKHPLLKKYPSIKDSKSIRNLPREDTYLNPL---- 312

Query: 315 NHTSVTIDDSILQNLVILWHGRPAEEIMKKLQDNGTNTEKTLYALLYRFKLES 367
           +H   T+D +IL+NLV+LWHGR   EI+ KL + G N EKT YALL+RFK E+
Sbjct: 313 DHNDGTVDRTILKNLVVLWHGRDENEIVMKLNEQGPNLEKTFYALLHRFKYEN 365

 Score =  140 bits (352), Expect = 7e-33,   Method: Compositional matrix adjust.
 Identities = 135/485 (27%), Positives = 224/485 (46%), Gaps = 73/485 (15%)

Query: 604  IDTLLTNRYQLSSYTRPISRLDPGLTPVTGAIPHSIKEKTALLQDT---EMKIIETIRKS 660
            I+T+L N+  +S  TRPISRLDPG+     A      ++  L + T   E  I+ETIR+S
Sbjct: 691  INTVL-NKRAVSVQTRPISRLDPGIMAQEVAHELDYDDEEILSERTLRREKTILETIRRS 749

Query: 661  EFLGSLLNVR-------------------------EGISQDNNQLASIEVS--------- 686
             FLGS  ++                          + IS  + +  S   +         
Sbjct: 750  NFLGSQFDIHKELKNAKKEKIEKAKKRKQLNRKLPDRISYHDQRFVSDGTTITSAHDGYD 809

Query: 687  ----PKISTTPLMYNDQVEIRKISDVEVPHFTRKSKHFTTANNRRSVLSLYSLKESLEDL 742
                 + +T  ++ +D+ E +K+S+V +P  TR+S+H + ++ R SVLS+YS   S  +L
Sbjct: 810  TTSLTRHTTVGVLRDDESEPKKLSEVRIPEVTRRSRHLSASSKRFSVLSMYSTMTSYTNL 869

Query: 743  NQISKNEEPDSP--PQGSTDNASKSEL-----VDVIEEVT--EXXXXXXXXXXXXXXXXX 793
                K++    P     S+    + E      +D +E ++  +                 
Sbjct: 870  ADFMKSDVQLKPLNDTASSKVTQQPEFMFESTIDNVERISSNDNSHISSMEAPNNTVIKL 929

Query: 794  XXXXILYDVPECVDSPQGYDINDAHSTQSPASKSTEPKPVVKLPSLSSFQRKNAS--GLG 851
                  Y   E ++      ++D  +TQ P ++    K  VKLP+L   ++ N S  GLG
Sbjct: 930  NYADRFYKPVEVIE------LDDTDNTQ-PDTEEDITK--VKLPALPPLEKLNKSPNGLG 980

Query: 852  IYQRESSRESLPSVTINISESDKTTENEAQKEIKHDKSDTILSNHDGKADSYKGDISNIV 911
            IYQ  S RE       +++  ++  ENE        K+        GK    +  ++++ 
Sbjct: 981  IYQHSSPREDFKHAVRSVT-PNENKENEDPAGTTQQKAPL---TSVGKELGIREPLTDLA 1036

Query: 912  RES---SHGSFLKKLSKGKI---LELDVRAKISEKRLYEGLHKLLEGWKQYGLKNLGINT 965
            ++       SF +K SK KI    +  +   ++  +++  L KLL GW  YGLK +  + 
Sbjct: 1037 QQGVPKKRPSFFRKFSKEKIKPEYDYQLDTTVNNTKMFRALDKLLNGWTSYGLKQVRSSP 1096

Query: 966  ADMIISGKLVNDGILSLRSTLFEIVILPNGSGRSLIKFNKKTGSTKTLTKFATEIQIILQ 1025
            +  +I+GKL +D ILSLRST F++V+  +  G S ++F KK+GS KT  +   EI+ IL+
Sbjct: 1097 SVSMITGKLSSDNILSLRSTAFQVVVAGSNHGSS-VRFTKKSGSKKTFARLVNEIEKILE 1155

Query: 1026 KEGVL 1030
            KE VL
Sbjct: 1156 KEKVL 1160

 Score = 48.1 bits (113), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 23/34 (67%), Positives = 28/34 (82%)

Query: 516 KRTSSNFATLIDEIFEPEKFELAKREKAELQKKV 549
           KRTSS+FATLID IFE EK+E  +REK  L++KV
Sbjct: 533 KRTSSDFATLIDNIFEHEKYEQIRREKEGLERKV 566

>SAKL0C01716g Chr3 (143880..147527) [3648 bp, 1215 aa] {ON} similar
           to uniprot|Q12263 Saccharomyces cerevisiae YDR507C
          Length = 1215

 Score =  529 bits (1363), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 250/376 (66%), Positives = 298/376 (79%), Gaps = 16/376 (4%)

Query: 1   MAVANMETYRITKPLNI-----IGPWKLGETLGFGSTGKVQLARHERTGQKTAVKVIPKS 55
           M+  + +   I+ PL       IGPWKLG  LG GS GKV +A+HE TGQ+ AVK++ KS
Sbjct: 1   MSTHSRQNSIISSPLTTLKNDKIGPWKLGSILGAGSAGKVLMAQHETTGQQAAVKIVSKS 60

Query: 56  IFKSEGSH------GNND-SVLPFNIEREIVIMKLLSHPNVLSLYDVWETDNNLYLILEY 108
           IF +   +      G+ND  +LP+ IEREI+IMKLL+H NVL LYDVWET +NLY++LEY
Sbjct: 61  IFGAVAQNNSSTIVGSNDPDLLPYGIEREIIIMKLLNHTNVLRLYDVWETKSNLYMVLEY 120

Query: 109 AEKGELFNLLVDRGPLPEREAIKCFKQIIIAISYCHALGIVHRDLKPENLLLDNSYNIKI 168
            EKGELFNLLV+RGPLPE EA++ F+QIII ISYCHALGIVHRDLKPENLLLD+ +NIKI
Sbjct: 121 VEKGELFNLLVERGPLPENEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKI 180

Query: 169 ADFGMAALQTDAGMLETSCGSPHYAAPEIVSGLPYEGFASDVWSCGVILFALLTGRLPFD 228
           ADFGMAAL++   +LETSCGSPHYAAPEIVSGLPY GF SDVWSCGVIL+ALLTGRLPFD
Sbjct: 181 ADFGMAALESKDKLLETSCGSPHYAAPEIVSGLPYHGFESDVWSCGVILYALLTGRLPFD 240

Query: 229 EENGNVRDLLLKVQKGQFEMPNNAEISGDAQDLIRRILVVDPTQRIKIRDILSHPLLKKY 288
           E+NGN+R LLLKVQ G++EMP N EIS +AQDLI +IL VDP +RIK R+IL HPLL+KY
Sbjct: 241 EDNGNIRSLLLKVQSGEYEMPGNDEISSEAQDLIAKILTVDPDRRIKTREILKHPLLQKY 300

Query: 289 QTIKDSKSIKDLPRENTYLYPLADADNHTSVTIDDSILQNLVILWHGRPAEEIMKKLQDN 348
            +IKDSKSI++LPRE+TYL PL    +H   +IDD ILQNLV+LWHGR   EI+ KL + 
Sbjct: 301 PSIKDSKSIRNLPREDTYLNPL----DHGDGSIDDGILQNLVVLWHGRDRNEIVAKLNEP 356

Query: 349 GTNTEKTLYALLYRFK 364
           G N EKT Y LL+RFK
Sbjct: 357 GANLEKTFYVLLFRFK 372

 Score =  174 bits (442), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 183/674 (27%), Positives = 280/674 (41%), Gaps = 136/674 (20%)

Query: 482  YMPNLGRGXXXXXXXXXXXXXIXXXXXXXXXXXTKRTSSNFATLIDEIFEPEKFELAKRE 541
            ++PN+ RG                         TKRTS++FATL D+IFE EK+E  ++E
Sbjct: 549  FLPNIKRGSITTKLIATYAKLSEEDDWEYIEKETKRTSADFATLCDQIFEHEKYEQIRKE 608

Query: 542  KAELQKKV-----------------------------------------QEAKRQVSKNA 560
            K EL++KV                                         QE +  ++K  
Sbjct: 609  KQELERKVREAKEREERERRKRQEEQEEQERKRRAEEERVLRELEDAKQQELQELMAKEV 668

Query: 561  PISDEKDVGFEVSDGMRELKKINNKVSSPLMNYEF-------SQKELLQDIDTLLTNRYQ 613
             +    D G   ++   +    N  VS+P+ +          S   L  DID LL  R  
Sbjct: 669  AML-RADYGEPQTEPEEQGASKNRCVSAPIASSSAKDDGKRDSIARLSGDIDDLLKRR-T 726

Query: 614  LSSYTRPISRLDPGLTPVT--GAIPHSIKEKTALLQDTEMK----IIETIRKSEFLGSLL 667
            +S  TRP+SRLDPG+      G++   I E+   + +T ++    I+ETIR+S FLGS  
Sbjct: 727  VSLQTRPVSRLDPGIVAAENLGSV---IYEEADGVDETTLRTEKTILETIRRSRFLGSSF 783

Query: 668  NVR-----------EGISQDNNQ--LASIEVS------------PKISTTPLMYNDQ--V 700
            +++           E +++ + Q  L+S   +            PK +      ND+   
Sbjct: 784  DIKKELERAQRKKEEALARQHQQRILSSATAASATNDAYESRALPKNAAAVDTLNDERNP 843

Query: 701  EIRKISDVEVPHFTRKSKHFTTANNRRSVLSLYSLKESLEDLNQISKNEEPDSPPQGSTD 760
            E RKIS+++VP FTR+S+HFT +N R SVLS+YS K S  +L    K         GS  
Sbjct: 844  EPRKISEIKVPQFTRRSRHFTASNKRLSVLSMYSTKSSFTNLADHLKGGADLQEVSGSAP 903

Query: 761  NASKSELVDVIEEVTEXXXXXXXXXXXXXXXXXXXXXILYDVPECVDSPQ-----GYDIN 815
            + +K      I +  E                      LY+VP+  +S +        +N
Sbjct: 904  STTK------ITQEPEFLFESVHEEDSEETPDTTADSRLYEVPDGSESSKTSTKAAMRLN 957

Query: 816  DAHSTQSPASKSTEPKPVVKLPSLSSFQRKNASGLGIYQRESSRESLPSVTINISE---- 871
             A    + A  +     +  LP L     K  +GLGIYQ      + P+ T  + E    
Sbjct: 958  FADRFNTRAGDNPADVKLPPLPPLEKNGSKKPNGLGIYQSPERPRADPNPTSMVHEPKVF 1017

Query: 872  ------------SDKTTENEAQKEIKHDKSDTILSNHDGKADSYKG-------------- 905
                        S K  E+E        KS+   + H   A                   
Sbjct: 1018 SMIPDDIAGPAKSTKPAESENVPTSATKKSEPKNALHSADAPEASQPPLNGMMRKNNDRK 1077

Query: 906  ---DISNIVRESSHGSFLKKLS------KGKILELDVRAKISEKRLYEGLHKLLEGWKQY 956
               DI+    +  + SF +K S      K    +  +   +   +++  L KLL GWK Y
Sbjct: 1078 PLEDITPAAEKKRNRSFFRKFSRSSEEKKSDNFDAKLNTSVEAVQMFNALGKLLGGWKDY 1137

Query: 957  GLKNLGINTADMIISGKLVNDGILSLRSTLFEIVILPNGSGRSLIKFNKKTGSTKTLTKF 1016
            GLK + +      I+GKL +D ILSLRST+FEI++  + S  S++ F KK+GSTKT  + 
Sbjct: 1138 GLKEVRVQGPTKTITGKLSSDNILSLRSTMFEILVRDDSSKGSVVWFVKKSGSTKTFKRL 1197

Query: 1017 ATEIQIILQKEGVL 1030
              E++ +L++E VL
Sbjct: 1198 VKEVEKVLERENVL 1211

>KLTH0D05566g Chr4 (498055..501441) [3387 bp, 1128 aa] {ON} weakly
           similar to uniprot|P34244 Saccharomyces cerevisiae
           YKL101W HSL1 Nim1p-related protein kinase that regulates
           the morphogenesis and septin checkpoints associates with
           the assembled septin filament required along with Hsl7p
           for bud neck recruitment phosphorylation and degradation
           of Swe1p
          Length = 1128

 Score =  389 bits (998), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 201/364 (55%), Positives = 253/364 (69%), Gaps = 33/364 (9%)

Query: 16  NIIGPWKLGETLGFGSTGKVQLARHERTGQKTAVKVIPKSIFKSEGSHGNNDSVLPFNIE 75
           + IGPWKLG+TLG GS+G+V+LA++  TG+  AVK++PK+         +  + LP+ IE
Sbjct: 53  DTIGPWKLGKTLGKGSSGRVRLAKNMETGKLAAVKIVPKT-------KSSRPNALPYGIE 105

Query: 76  REIVIMKLLSHPNVLSLYDVWETDNNLYLILEYAEKGELFNLLVDRGPLPEREAIKCFKQ 135
           REI+IMKL+SHPNV+ LY+VWE    L+L+LEY + GELF+ LV RG L E+EAI  F+Q
Sbjct: 106 REIIIMKLISHPNVMGLYEVWENKLELFLVLEYVDGGELFDYLVSRGRLSEKEAIHYFRQ 165

Query: 136 IIIAISYCHALGIVHRDLKPENLLLD-NSYNIKIADFGMAALQTDAGMLETSCGSPHYAA 194
           II   +YCH+  I HRDLKPENLLLD  +  IKIADFGMAALQT   +LETSCGSPHYA+
Sbjct: 166 IIEGTAYCHSFNICHRDLKPENLLLDKKNKRIKIADFGMAALQTSNKLLETSCGSPHYAS 225

Query: 195 PEIVSGLPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRDLLLKVQKGQFEMPNNAEI 254
           PEIV G  Y G  SDVWSCG+ILFALLTG LPF+++  N++ LLLKVQ G+++MP    I
Sbjct: 226 PEIVMGKTYNGGPSDVWSCGIILFALLTGHLPFNDD--NIKRLLLKVQAGKYQMPQ--AI 281

Query: 255 SGDAQDLIRRILVVDPTQRIKIRDILSHPLLKKYQTIKDSKSIKDLPRENTYLYPLADAD 314
           S +AQDLI RILVVDP +RI I DILSHPL+ KY   K SKS       N+ L+ L+   
Sbjct: 282 SLEAQDLISRILVVDPNKRITINDILSHPLITKYD-YKRSKS-------NSDLHILS--- 330

Query: 315 NHTSVTI---------DDSILQNLVILWHGRPAEEIMKKLQDNGTNTEKTLYALLYRFKL 365
            HTS  I         D +ILQNL ILWHG P + IMK+L +     EKT Y+LL  ++ 
Sbjct: 331 -HTSPQICTIRSERDVDPTILQNLQILWHGAPKDYIMKRLLEPELTEEKTFYSLLLAYQQ 389

Query: 366 ESMK 369
             +K
Sbjct: 390 RQLK 393

>Kwal_26.7788 s26 (511530..515333) [3804 bp, 1267 aa] {ON} YKL101W
           (HSL1) - Putative protein kinase homologous to S. pombe
           cdr1/nim1 [contig 55] FULL
          Length = 1267

 Score =  388 bits (997), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 199/364 (54%), Positives = 251/364 (68%), Gaps = 25/364 (6%)

Query: 16  NIIGPWKLGETLGFGSTGKVQLARHERTGQKTAVKVIPKSIFKSEGSHGNNDSVLPFNIE 75
           + IGPWKLG+TLG GS+G+V+LA++  TG+  A+K++PK+     GS       LP+ IE
Sbjct: 53  DTIGPWKLGKTLGKGSSGRVRLAKNMETGKLAAIKIVPKTKSSRTGS-------LPYGIE 105

Query: 76  REIVIMKLLSHPNVLSLYDVWETDNNLYLILEYAEKGELFNLLVDRGPLPEREAIKCFKQ 135
           REI+IMKL+SHPNV+ LY+VWE    L+L+LEY + GELF+ LV RG LPE+EAI  F+Q
Sbjct: 106 REIIIMKLISHPNVMGLYEVWENKLELFLVLEYVDGGELFDYLVSRGRLPEKEAIHYFRQ 165

Query: 136 IIIAISYCHALGIVHRDLKPENLLLD-NSYNIKIADFGMAALQTDAGMLETSCGSPHYAA 194
           II   +YCH   I HRDLKPENLLLD  +  IKIADFGMAALQT   +LETSCGSPHYA+
Sbjct: 166 IIEGTAYCHGFNICHRDLKPENLLLDKKNKRIKIADFGMAALQTSNKLLETSCGSPHYAS 225

Query: 195 PEIVSGLPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRDLLLKVQKGQFEMPNNAEI 254
           PEIV G  Y G  SDVWSCG+ILFALLTG LPF+++  N++ LLLKVQ G+++MP +  +
Sbjct: 226 PEIVMGKNYNGGPSDVWSCGIILFALLTGHLPFNDD--NIKRLLLKVQAGKYQMPQS--V 281

Query: 255 SGDAQDLIRRILVVDPTQRIKIRDILSHPLLKKYQTIKDSKSIKDLPRENTYLYPLADAD 314
           S  AQDLI RILVVDP +RI I +IL+HPLL KY   K SKS       N+ L+ L+ + 
Sbjct: 282 SSGAQDLISRILVVDPDKRISINEILAHPLLAKYGN-KRSKS-------NSDLHILSHSK 333

Query: 315 NHTSVT-----IDDSILQNLVILWHGRPAEEIMKKLQDNGTNTEKTLYALLYRFKLESMK 369
              S       +D +ILQNL ILWHG P E I+K L       EKT Y+LL  ++    K
Sbjct: 334 PQISTIKSESDVDPTILQNLQILWHGAPKESILKGLLKPELTEEKTFYSLLLAYQQRQSK 393

Query: 370 ETNK 373
           +  K
Sbjct: 394 QKEK 397

>Ecym_7392 Chr7 complement(803240..807544) [4305 bp, 1434 aa] {ON}
           similar to Ashbya gossypii ABL034W
          Length = 1434

 Score =  390 bits (1002), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 192/355 (54%), Positives = 248/355 (69%), Gaps = 22/355 (6%)

Query: 16  NIIGPWKLGETLGFGSTGKVQLARHERTGQKTAVKVIPKSIFKSEGSHGNND-SVLPFNI 74
           + +GPWKLG+TLG GS+G+V+LA++  TG+  A+K++PK   +    H N   + LP+ I
Sbjct: 59  DTVGPWKLGKTLGKGSSGRVRLAKNMETGKLAAIKIVPKRNVR----HNNTQLTSLPYGI 114

Query: 75  EREIVIMKLLSHPNVLSLYDVWETDNNLYLILEYAEKGELFNLLVDRGPLPEREAIKCFK 134
           EREI+IMKL+SHPNV++LY+VWE    LYL+LEY E GELF+ L+ RG LPE+EA+  FK
Sbjct: 115 EREIIIMKLISHPNVMALYEVWENKPELYLVLEYVEGGELFDYLISRGKLPEQEAVHYFK 174

Query: 135 QIIIAISYCHALGIVHRDLKPENLLLD-NSYNIKIADFGMAALQTDAGMLETSCGSPHYA 193
           QI+  +SYCH   I HRDLKPENLLLD  + ++KIADFGMAAL+T   +LETSCGSPHYA
Sbjct: 175 QIVQGVSYCHHFNICHRDLKPENLLLDKKNLSVKIADFGMAALETTDKLLETSCGSPHYA 234

Query: 194 APEIVSGLPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRDLLLKVQKGQFEMPNNAE 253
           +PEIV G  Y G  SDVWSCG+ILFALLTG LPF+++  NV+ LLLKVQ G+++MP N  
Sbjct: 235 SPEIVMGQKYHGSPSDVWSCGIILFALLTGHLPFNDD--NVKKLLLKVQSGKYQMPQN-- 290

Query: 254 ISGDAQDLIRRILVVDPTQRIKIRDILSHPLLKKYQTIKDSKSIKDLPRENTYLYPLADA 313
           IS +A+DLI +IL+VDP  RI I ++L HPLL KYQ  +   S        + L+ L   
Sbjct: 291 ISNEAKDLIAKILIVDPAMRITIDEVLEHPLLLKYQKTRSKSS--------SNLHALDST 342

Query: 314 DN----HTSVTIDDSILQNLVILWHGRPAEEIMKKLQDNGTNTEKTLYALLYRFK 364
            N     +   ID+SIL NL ILWHG P E +  KL   G   EK  Y+LL R++
Sbjct: 343 PNIVVLESEDKIDESILSNLQILWHGAPKEYLTGKLLQQGFTEEKLFYSLLLRYQ 397

>SAKL0E02860g Chr5 complement(228726..232859) [4134 bp, 1377 aa]
           {ON} similar to uniprot|Q75DQ1 Ashbya gossypii ABL034W
           ABL034Wp and weakly similar to YKL101W uniprot|P34244
           Saccharomyces cerevisiae YKL101W HSL1 Nim1p-related
           protein kinase that regulates the morphogenesis and
           septin checkpoints associates with the assembled septin
           filament required along with Hsl7p for bud neck
           recruitment phosphorylation and degradation of Swe1p
          Length = 1377

 Score =  389 bits (998), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 189/358 (52%), Positives = 256/358 (71%), Gaps = 16/358 (4%)

Query: 13  KPLNIIGPWKLGETLGFGSTGKVQLARHERTGQKTAVKVIPKSIFKSEGSHGNNDSV--- 69
           K  + +GPWKLG+TLG GS+G+V+LA++  TG+  A+K++PK + +S  +   +++    
Sbjct: 53  KSRDTVGPWKLGKTLGKGSSGRVRLAKNMETGKLAAIKIVPKKVVRSTNASKKSNAANGN 112

Query: 70  LPFNIEREIVIMKLLSHPNVLSLYDVWETDNNLYLILEYAEKGELFNLLVDRGPLPEREA 129
           LP+ IEREI+IMKL+SHPN+++LY+VWE  + L+L+LEY E GELF+ LV +G LPE+EA
Sbjct: 113 LPYGIEREIIIMKLISHPNIMALYEVWENKSELFLVLEYVEGGELFDYLVSKGKLPEQEA 172

Query: 130 IKCFKQIIIAISYCHALGIVHRDLKPENLLLD-NSYNIKIADFGMAALQTDAGMLETSCG 188
           +  F+QII  ++YCH   I HRDLKPENLL+D  ++ IKIADFGMAAL+T   +LETSCG
Sbjct: 173 VHYFRQIIQGVAYCHNYNICHRDLKPENLLVDKKNHQIKIADFGMAALETTNKLLETSCG 232

Query: 189 SPHYAAPEIVSGLPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRDLLLKVQKGQFEM 248
           SPHYA+PEIV G  Y G  SDVWSCG+ILFALLTG LPF+++  N++ LLLKVQ G++ M
Sbjct: 233 SPHYASPEIVMGKNYHGSPSDVWSCGIILFALLTGHLPFNDD--NIKKLLLKVQSGKYHM 290

Query: 249 PNNAEISGDAQDLIRRILVVDPTQRIKIRDILSHPLLKKYQTIKDSKSIKDLP--RENTY 306
           P N  IS +AQDLI +IL+VDP  RI I ++L HPL+ KY   + SKS  DL        
Sbjct: 291 PQN--ISSEAQDLISKILIVDPRGRITINEVLQHPLITKYDKAR-SKSNSDLHLLSRTPQ 347

Query: 307 LYPLADADNHTSVTIDDSILQNLVILWHGRPAEEIMKKLQDNGTNTEKTLYALLYRFK 364
           L  L   ++     ID SIL NL ILWHG P+E I+ +L  +G   EK  Y+LL++++
Sbjct: 348 LVTLQSKED-----IDGSILGNLQILWHGAPSEYIVARLLQHGFTEEKLFYSLLWQYQ 400

>KLLA0F13552g Chr6 complement(1252906..1256709) [3804 bp, 1267 aa]
           {ON} weakly similar to uniprot|P34244 Saccharomyces
           cerevisiae YKL101W HSL1 Nim1p-related protein kinase
           that regulates the morphogenesis and septin checkpoints
           associates with the assembled septin filament required
           along with Hsl7p for bud neck recruitment
           phosphorylation and degradation of Swe1p
          Length = 1267

 Score =  385 bits (989), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 197/373 (52%), Positives = 254/373 (68%), Gaps = 15/373 (4%)

Query: 4   ANMETYRITKPLN--IIGPWKLGETLGFGSTGKVQLARHERTGQKTAVKVIPKSIFKSEG 61
           AN+   + +K  N   +GPWKLG+TLG GS+G+V+LA++  TG+ +A+K++PK   KS  
Sbjct: 54  ANVNNTKTSKRRNRDTVGPWKLGKTLGKGSSGRVRLAKNMETGKLSAIKIVPKKFVKS-- 111

Query: 62  SHGNNDSVLPFNIEREIVIMKLLSHPNVLSLYDVWETDNNLYLILEYAEKGELFNLLVDR 121
              N    LP+ IEREI+IMKL+SHPNV+ LY+VWE  + LYL+LEY E GELF+ LV +
Sbjct: 112 ---NQIKQLPYGIEREIIIMKLISHPNVMGLYEVWENKSELYLVLEYVEGGELFDYLVSK 168

Query: 122 GPLPEREAIKCFKQIIIAISYCHALGIVHRDLKPENLLLD-NSYNIKIADFGMAALQTDA 180
           G LPE EAI  FKQI+ A++YCH   I HRDLKPENLLLD    +IKIADFGMAAL+T  
Sbjct: 169 GKLPESEAIHYFKQIVQAVAYCHGFNICHRDLKPENLLLDKKKRSIKIADFGMAALETSD 228

Query: 181 GMLETSCGSPHYAAPEIVSGLPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRDLLLK 240
            +LETSCGSPHYA+PEIV G  Y G  SDVWSCG+ILFALLTG LPF+++  NV+ LLLK
Sbjct: 229 KLLETSCGSPHYASPEIVLGRKYHGSPSDVWSCGIILFALLTGHLPFNDD--NVKKLLLK 286

Query: 241 VQKGQFEMPNNAEISGDAQDLIRRILVVDPTQRIKIRDILSHPLLKKYQTIKDSKSIKDL 300
           VQ G+++MP    +S +A+DLI RILVVDP +RI I  IL H LL KY     SKS  DL
Sbjct: 287 VQSGKYQMPQ--WLSVEAKDLISRILVVDPNRRITIDQILQHELLTKYDQKSRSKSNSDL 344

Query: 301 PRENTYLYPLADADNHTSVTIDDSILQNLVILWHGRPAEEIMKKLQDNGTNTEKTLYALL 360
              N     ++ +       ID++IL NL ILWHG   + ++ +L   G   EK  Y+LL
Sbjct: 345 NLLNRTPNIVSFSSER---DIDETILSNLQILWHGAARKHLVTRLMKPGFTEEKMFYSLL 401

Query: 361 YRFKLESMKETNK 373
           + ++ +  K   K
Sbjct: 402 WNYQEKQQKSMQK 414

>ABL034W Chr2 (333432..337709) [4278 bp, 1425 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YKL101W (HSL1)
          Length = 1425

 Score =  387 bits (994), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 191/358 (53%), Positives = 250/358 (69%), Gaps = 27/358 (7%)

Query: 16  NIIGPWKLGETLGFGSTGKVQLARHERTGQKTAVKVIPKSIFKSEGSHGNND-SVLPFNI 74
           + +GPWKLG+TLG GS+G+V+LA++ ++G+  A+K++PK   +    H     + LP+ I
Sbjct: 56  DTVGPWKLGKTLGKGSSGRVRLAKNMQSGKLAAIKIVPKRNVR----HNQKQVTALPYGI 111

Query: 75  EREIVIMKLLSHPNVLSLYDVWETDNNLYLILEYAEKGELFNLLVDRGPLPEREAIKCFK 134
           EREI+IMKL++HPN+++LY+VWE  + LYL+LEY E GELF+ L+ RG LPE+EAI  FK
Sbjct: 112 EREIIIMKLITHPNIMALYEVWENKSELYLVLEYVEGGELFDYLIARGKLPEQEAIHYFK 171

Query: 135 QIIIAISYCHALGIVHRDLKPENLLLD-NSYNIKIADFGMAALQTDAGMLETSCGSPHYA 193
           QI+  +SYCH   I HRDLKPENLLLD  +  +KIADFGMAAL+T   +LETSCGSPHYA
Sbjct: 172 QIVQGVSYCHNFNICHRDLKPENLLLDKKNKTVKIADFGMAALETTNRLLETSCGSPHYA 231

Query: 194 APEIVSGLPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRDLLLKVQKGQFEMPNNAE 253
           +PEIV G  Y G  SDVWSCG+ILFALLTG LPF+++  NVR LLLKVQ G+++MP+N  
Sbjct: 232 SPEIVMGQKYHGSPSDVWSCGIILFALLTGHLPFNDD--NVRKLLLKVQHGRYQMPSN-- 287

Query: 254 ISGDAQDLIRRILVVDPTQRIKIRDILSHPLLKKYQTIKDSKSIKDLPRENTYLYPLADA 313
           +S +A+DLI +ILVVDP +RI +  IL HPLL KY          D P +     PL   
Sbjct: 288 VSKEAKDLISKILVVDPEKRITVDKILEHPLLVKY----------DNPGKGGLACPLEKP 337

Query: 314 -------DNHTSVTIDDSILQNLVILWHGRPAEEIMKKLQDNGTNTEKTLYALLYRFK 364
                  D H+   ID++IL NL ILWHG P E ++ KL  +G   EK  YALL R++
Sbjct: 338 EERPKVLDIHSIDDIDETILSNLQILWHGAPKEYLVDKLLQSGFTEEKLFYALLLRYQ 395

>KAFR0D03200 Chr4 (628993..633339) [4347 bp, 1448 aa] {ON} Anc_2.479
           YKL101W
          Length = 1448

 Score =  377 bits (967), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 204/384 (53%), Positives = 263/384 (68%), Gaps = 37/384 (9%)

Query: 13  KPLNIIGPWKLGETLGFGSTGKVQLARHERTGQKTAVKVIPKS-IFKSEGSHG------- 64
           K  + +GPWKLG+TLG GS+G+V+LA++  TGQ  A+K++PK+ IF+ +  +        
Sbjct: 84  KSRDTVGPWKLGKTLGKGSSGRVRLAKNMETGQLAAIKIVPKTKIFRKQNDNSFQMSSYS 143

Query: 65  ----------NNDS---VLPFNIEREIVIMKLLSHPNVLSLYDVWETDNNLYLILEYAEK 111
                     NND+   + P+ IEREIVIMKL+SHPNV+ LY+VWE  + L+L+LEY + 
Sbjct: 144 SNDESPKHTNNNDTYSKINPYGIEREIVIMKLISHPNVMGLYEVWENKSELFLVLEYVDG 203

Query: 112 GELFNLLVDRGPLPEREAIKCFKQIIIAISYCHALGIVHRDLKPENLLLDNSYN-IKIAD 170
           GELF+ LV RG L EREA+  FKQII  +SYCH+  I HRDLKPENLLLD   N IKIAD
Sbjct: 204 GELFDYLVSRGKLSEREAVHYFKQIIEGVSYCHSFNICHRDLKPENLLLDKKINTIKIAD 263

Query: 171 FGMAALQTDAGMLETSCGSPHYAAPEIVSGLPYEGFASDVWSCGVILFALLTGRLPFDEE 230
           FGMAAL+    +L TSCGSPHYA+PEIV G  Y G  SDVWSCG+ILFALLTG LPF+++
Sbjct: 264 FGMAALELPNKLLVTSCGSPHYASPEIVMGKSYHGSPSDVWSCGIILFALLTGHLPFNDD 323

Query: 231 NGNVRDLLLKVQKGQFEMPNNAEISGDAQDLIRRILVVDPTQRIKIRDILSHPLLKKYQT 290
             +++ LLLKVQ G+F+MP N  IS +A+DLI RILVVDP +RI+I DIL HPL++KY+ 
Sbjct: 324 --SIKKLLLKVQSGKFQMPQN--ISLEAEDLISRILVVDPEKRIQINDILIHPLIRKYED 379

Query: 291 IK-DSK---SIKDLPRENTYLYPLADADNHTSVT------IDDSILQNLVILWHGRPAEE 340
            K DS    S K   + N+ L+ L D    + VT      ID+SIL+NL ILWHG   E 
Sbjct: 380 NKTDSNNVSSYKKSSKSNSNLHILNDM-GPSIVTLKARNEIDESILKNLQILWHGTSREL 438

Query: 341 IMKKLQDNGTNTEKTLYALLYRFK 364
           I+ KL     + EK  Y+LL ++K
Sbjct: 439 IISKLLQTPMSEEKLFYSLLLQYK 462

>YKL101W Chr11 (248920..253476) [4557 bp, 1518 aa] {ON}
           HSL1Nim1p-related protein kinase that regulates the
           morphogenesis and septin checkpoints; associates with
           the assembled septin filament; required along with Hsl7p
           for bud neck recruitment, phosphorylation, and
           degradation of Swe1p
          Length = 1518

 Score =  377 bits (967), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 194/404 (48%), Positives = 267/404 (66%), Gaps = 46/404 (11%)

Query: 1   MAVANMETYRITKPLNIIGPWKLGETLGFGSTGKVQLARHERTGQKTAVKVIPK------ 54
           ++VA   + R  K  + +GPWKLG+TLG GS+G+V+LA++  TGQ  A+K++PK      
Sbjct: 63  VSVATKSSKR--KSRDTVGPWKLGKTLGKGSSGRVRLAKNMETGQLAAIKIVPKKKAFVH 120

Query: 55  -------------SIFKSEGS--------HGNNDSVLPFNIEREIVIMKLLSHPNVLSLY 93
                        S+  S  S        H N+    P+ IEREIVIMKL+SH NV++L+
Sbjct: 121 CSNNGTVPNSYSSSMVTSNVSSPSIASREHSNHSQTNPYGIEREIVIMKLISHTNVMALF 180

Query: 94  DVWETDNNLYLILEYAEKGELFNLLVDRGPLPEREAIKCFKQIIIAISYCHALGIVHRDL 153
           +VWE  + LYL+LEY + GELF+ LV +G LPEREAI  FKQI+  +SYCH+  I HRDL
Sbjct: 181 EVWENKSELYLVLEYVDGGELFDYLVSKGKLPEREAIHYFKQIVEGVSYCHSFNICHRDL 240

Query: 154 KPENLLLD-NSYNIKIADFGMAALQTDAGMLETSCGSPHYAAPEIVSGLPYEGFASDVWS 212
           KPENLLLD  +  IKIADFGMAAL+    +L+TSCGSPHYA+PEIV G PY G  SDVWS
Sbjct: 241 KPENLLLDKKNRRIKIADFGMAALELPNKLLKTSCGSPHYASPEIVMGRPYHGGPSDVWS 300

Query: 213 CGVILFALLTGRLPFDEENGNVRDLLLKVQKGQFEMPNNAEISGDAQDLIRRILVVDPTQ 272
           CG++LFALLTG LPF+++  N++ LLLKVQ G+++MP+N  +S +A+DLI +ILV+DP +
Sbjct: 301 CGIVLFALLTGHLPFNDD--NIKKLLLKVQSGKYQMPSN--LSSEARDLISKILVIDPEK 356

Query: 273 RIKIRDILSHPLLKKYQTIKDSKSIKDLPRE-------NTYLYPLADADN-----HTSVT 320
           RI  ++IL HPL+KKY  +  +K ++ + ++       N+ L+ L +        H+   
Sbjct: 357 RITTQEILKHPLIKKYDDLPVNKVLRKMRKDNMARGKSNSDLHLLNNVSPSIVTLHSKGE 416

Query: 321 IDDSILQNLVILWHGRPAEEIMKKLQDNGTNTEKTLYALLYRFK 364
           ID+SIL++L ILWHG   E I  KL     + EK  Y+LL ++K
Sbjct: 417 IDESILRSLQILWHGVSRELITAKLLQKPMSEEKLFYSLLLQYK 460

>Skud_11.126 Chr11 (235011..239567) [4557 bp, 1518 aa] {ON} YKL101W
           (REAL)
          Length = 1518

 Score =  375 bits (963), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 194/404 (48%), Positives = 267/404 (66%), Gaps = 46/404 (11%)

Query: 1   MAVANMETYRITKPLNIIGPWKLGETLGFGSTGKVQLARHERTGQKTAVKVIPK------ 54
           ++VA   + R  K  + +GPWKLG+TLG GS+G+V+LA++  TGQ  A+K++PK      
Sbjct: 63  ISVATKSSKR--KSRDTVGPWKLGKTLGKGSSGRVRLAKNIETGQLAAIKIVPKKKAFVH 120

Query: 55  -------------SIFKSEGS--------HGNNDSVLPFNIEREIVIMKLLSHPNVLSLY 93
                        S+  S  S        H N+    P+ IEREIVIMKL+SH NV++L+
Sbjct: 121 RSNNGTVPNSYSSSMITSNVSSPSIASKEHSNHTQTNPYGIEREIVIMKLISHANVMALF 180

Query: 94  DVWETDNNLYLILEYAEKGELFNLLVDRGPLPEREAIKCFKQIIIAISYCHALGIVHRDL 153
           +VWE  + LYL+LEY + GELF+ LV +G LPEREAI  FKQI+  +S+CH+  I HRDL
Sbjct: 181 EVWENKSELYLVLEYVDGGELFDYLVSKGKLPEREAIHYFKQIVEGVSFCHSFNICHRDL 240

Query: 154 KPENLLLD-NSYNIKIADFGMAALQTDAGMLETSCGSPHYAAPEIVSGLPYEGFASDVWS 212
           KPENLLLD  +  IKIADFGMAAL+    +L+TSCGSPHYA+PEIV G PY G  SDVWS
Sbjct: 241 KPENLLLDKKNRKIKIADFGMAALELPNKLLKTSCGSPHYASPEIVMGRPYHGGPSDVWS 300

Query: 213 CGVILFALLTGRLPFDEENGNVRDLLLKVQKGQFEMPNNAEISGDAQDLIRRILVVDPTQ 272
           CG++LFALLTG LPF+++  N++ LLLKVQ G+++MP N  +S +A+DLI +ILV++P +
Sbjct: 301 CGIVLFALLTGHLPFNDD--NIKKLLLKVQSGKYQMPMN--LSAEARDLISKILVINPEK 356

Query: 273 RIKIRDILSHPLLKKYQTIKDSKSIKDLPRE-------NTYLYPLADADN-----HTSVT 320
           RI  ++IL+HPL+KKY  +  +K I+ + R+       N+ L+ L +        H+   
Sbjct: 357 RITTQEILNHPLIKKYDNLPINKMIRKMKRDNMARGKSNSDLHLLNNVSPSVVTLHSRGE 416

Query: 321 IDDSILQNLVILWHGRPAEEIMKKLQDNGTNTEKTLYALLYRFK 364
           ID+SIL++L ILWHG   E I  KL     + EK  Y+LL ++K
Sbjct: 417 IDESILRSLQILWHGVSRELITAKLLQKPMSEEKLFYSLLLQYK 460

>Suva_11.123 Chr11 (235064..239644) [4581 bp, 1526 aa] {ON} YKL101W
           (REAL)
          Length = 1526

 Score =  373 bits (958), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 192/392 (48%), Positives = 259/392 (66%), Gaps = 44/392 (11%)

Query: 13  KPLNIIGPWKLGETLGFGSTGKVQLARHERTGQKTAVKVIPK------------------ 54
           K  + +GPWKLG+TLG GS+G+V+LA++  TGQ  A+K++PK                  
Sbjct: 73  KSRDTVGPWKLGKTLGKGSSGRVRLAKNMETGQLAAIKIVPKKKAFVHRSNNGTVPNSYS 132

Query: 55  -SIFKSEGS--------HGNNDSVLPFNIEREIVIMKLLSHPNVLSLYDVWETDNNLYLI 105
            S+  S  S        H N+    P+ IEREIVIMKL+SH NV++L++VWE  + LYL+
Sbjct: 133 SSMVTSNVSSPSIVSKEHSNHSQTNPYGIEREIVIMKLISHANVMALFEVWENKSELYLV 192

Query: 106 LEYAEKGELFNLLVDRGPLPEREAIKCFKQIIIAISYCHALGIVHRDLKPENLLLD-NSY 164
           LEY + GELF+ LV RG LPEREAI  FKQI+  +SYCH+  I HRDLKPENLLLD  + 
Sbjct: 193 LEYVDGGELFDYLVSRGKLPEREAIHYFKQIVEGVSYCHSFNICHRDLKPENLLLDKKNK 252

Query: 165 NIKIADFGMAALQTDAGMLETSCGSPHYAAPEIVSGLPYEGFASDVWSCGVILFALLTGR 224
            IKIADFGMAAL+    +L+TSCGSPHYA+PEIV G PY G  SDVWSCG++LFALLTG 
Sbjct: 253 KIKIADFGMAALELPNKLLKTSCGSPHYASPEIVMGRPYHGGPSDVWSCGIVLFALLTGH 312

Query: 225 LPFDEENGNVRDLLLKVQKGQFEMPNNAEISGDAQDLIRRILVVDPTQRIKIRDILSHPL 284
           LPF+++  N++ LLLKVQ G+++MP N  +S +A++LI +ILV+DP +RI  ++IL HPL
Sbjct: 313 LPFNDD--NIKKLLLKVQSGKYQMPMN--LSLEARNLISKILVIDPEKRITTQEILEHPL 368

Query: 285 LKKYQTIKDSKSIKDLP-------RENTYLYPLADADN-----HTSVTIDDSILQNLVIL 332
           +KKY  +  +K ++ +        + N+ L+ L +        +T   ID+SIL++L IL
Sbjct: 369 IKKYDNLPVNKMLRKMKGDSMTRGKSNSDLHLLDNVSPSIVTLNTKNEIDESILRSLQIL 428

Query: 333 WHGRPAEEIMKKLQDNGTNTEKTLYALLYRFK 364
           WHG   E I  KL     + EK  Y+LL R+K
Sbjct: 429 WHGVSRELITAKLLQKPMSEEKLFYSLLLRYK 460

>Smik_11.139 Chr11 (235511..240115) [4605 bp, 1534 aa] {ON} YKL101W
           (REAL)
          Length = 1534

 Score =  373 bits (958), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 189/392 (48%), Positives = 259/392 (66%), Gaps = 44/392 (11%)

Query: 13  KPLNIIGPWKLGETLGFGSTGKVQLARHERTGQKTAVKVIPKS-IFKSEGSHG------- 64
           K  + +GPWKLG+TLG GS+G+V+LA++  TGQ  A+K++PK   F    ++G       
Sbjct: 73  KSRDTVGPWKLGKTLGKGSSGRVRLAKNMETGQLAAIKIVPKKKAFVHRSTNGTMPNSYS 132

Query: 65  -------------------NNDSVLPFNIEREIVIMKLLSHPNVLSLYDVWETDNNLYLI 105
                              N+    P+ IEREIVIMKL+SH NV++L++VWE  + LYL+
Sbjct: 133 SSMVTSNVSSPSIVSKEYSNHSQTNPYGIEREIVIMKLISHTNVMALFEVWENKSELYLV 192

Query: 106 LEYAEKGELFNLLVDRGPLPEREAIKCFKQIIIAISYCHALGIVHRDLKPENLLLD-NSY 164
           LEY + GELF+ LV +G LPEREAI  FKQI+  +SYCH+  I HRDLKPENLLLD  + 
Sbjct: 193 LEYVDGGELFDYLVSKGKLPEREAIHYFKQIVEGVSYCHSFNICHRDLKPENLLLDKKNR 252

Query: 165 NIKIADFGMAALQTDAGMLETSCGSPHYAAPEIVSGLPYEGFASDVWSCGVILFALLTGR 224
            IKIADFGMAAL+    +L+TSCGSPHYA+PEIV G PY G  SDVWSCG++LFALLTG 
Sbjct: 253 RIKIADFGMAALELPNKLLKTSCGSPHYASPEIVMGRPYHGGPSDVWSCGIVLFALLTGH 312

Query: 225 LPFDEENGNVRDLLLKVQKGQFEMPNNAEISGDAQDLIRRILVVDPTQRIKIRDILSHPL 284
           LPF+++  N++ LLLKVQ G+++MP N  +S +A+DLI +ILV+DP +RI  ++IL HPL
Sbjct: 313 LPFNDD--NIKKLLLKVQSGKYQMPMN--LSAEARDLISKILVIDPAKRITTQEILKHPL 368

Query: 285 LKKYQTIKDSKSIKDLPRE-------NTYLYPLADADN-----HTSVTIDDSILQNLVIL 332
           +KKY  +  +K ++ + R+       N+ L+ L +        ++   ID+SIL++L IL
Sbjct: 369 IKKYDDLPVNKILRKMKRDNMARGKSNSDLHLLNNVSPSIVTLYSRSDIDESILRSLQIL 428

Query: 333 WHGRPAEEIMKKLQDNGTNTEKTLYALLYRFK 364
           WHG   E I  KL     + EK  Y+LL ++K
Sbjct: 429 WHGVSRELITAKLLQKPMSEEKLFYSLLLQYK 460

>KNAG0A06540 Chr1 (1002435..1006733) [4299 bp, 1432 aa] {ON}
           Anc_2.479 YKL101W
          Length = 1432

 Score =  370 bits (951), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 197/384 (51%), Positives = 251/384 (65%), Gaps = 47/384 (12%)

Query: 16  NIIGPWKLGETLGFGSTGKVQLARHERTGQKTAVKVIPKSIFKSEG----SHGNNDSVL- 70
           + +GPWKLG+TLG GS+G+V+LA++   GQ  A+K++PK+     G    S  +N + L 
Sbjct: 83  DTVGPWKLGKTLGKGSSGRVRLAKNMENGQLAAIKIVPKNKCLKGGTDNCSSNDNSTTLT 142

Query: 71  ----------------PFNIEREIVIMKLLSHPNVLSLYDVWETDNNLYLILEYAEKGEL 114
                           P+ IEREIVIMKL+SH NV+ L++VWE  N+L+L+LEY + GEL
Sbjct: 143 TNYSMENTSDKDIPLNPYGIEREIVIMKLISHRNVMGLFEVWENKNDLFLVLEYVDGGEL 202

Query: 115 FNLLVDRGPLPEREAIKCFKQIIIAISYCHALGIVHRDLKPENLLLDNSYN-IKIADFGM 173
           F+ LV +G LPE EA+  FKQII  +++CH+  I HRDLKPENLLLD     IKIADFGM
Sbjct: 203 FDYLVSKGKLPEWEAVHYFKQIIEGVAFCHSYNICHRDLKPENLLLDKKNKIIKIADFGM 262

Query: 174 AALQTDAGMLETSCGSPHYAAPEIVSGLPYEGFASDVWSCGVILFALLTGRLPFDEENGN 233
           AAL+    +LETSCGSPHYA+PEIV G PY G  SDVWSCG+ILFALLTG LPF+++  N
Sbjct: 263 AALELPNKLLETSCGSPHYASPEIVMGKPYHGGPSDVWSCGIILFALLTGHLPFNDD--N 320

Query: 234 VRDLLLKVQKGQFEMPNNAEISGDAQDLIRRILVVDPTQRIKIRDILSHPLLKKYQTIKD 293
           +R LLLKVQ G+F +P N  IS +AQDLI +ILVV+P QRIKI DIL HPL+ KY+    
Sbjct: 321 IRKLLLKVQSGRFRLPRN--ISLEAQDLIAKILVVNPRQRIKISDILKHPLITKYRQFFK 378

Query: 294 SK-------SIKDLPRE------NTYLYPLADADNHTSVTIDDSILQNLVILWHGRPAEE 340
            K       S  +L  E      N  L   AD        ID+SIL+NL ILWHG   E 
Sbjct: 379 VKFNQVPNPSATNLNSEHMLTPNNLKLASRAD--------IDESILRNLQILWHGTSREI 430

Query: 341 IMKKLQDNGTNTEKTLYALLYRFK 364
           I+ KL     + EK  Y+LL+++K
Sbjct: 431 IIAKLLQYPMSAEKIFYSLLWQYK 454

>Kpol_431.9 s431 complement(22310..26968) [4659 bp, 1552 aa] {ON}
           complement(22310..26968) [4659 nt, 1553 aa]
          Length = 1552

 Score =  371 bits (953), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 196/398 (49%), Positives = 258/398 (64%), Gaps = 55/398 (13%)

Query: 18  IGPWKLGETLGFGSTGKVQLARHERTGQKTAVKVIPK----------------------- 54
           +GPWKLG+TLG GS+G+V+LA++  TG+  A+K++PK                       
Sbjct: 91  VGPWKLGKTLGKGSSGRVRLAKNIETGKLAAIKIVPKNKKFNNQHRSKNTNSNNGDLFLS 150

Query: 55  --SIFKSEGSHG--NNDSVL--------PFNIEREIVIMKLLSHPNVLSLYDVWETDNNL 102
             SI  +  +H   N D+          P+ IEREIVIMKLLSHPNV++LY+VWE +N L
Sbjct: 151 YSSIHNTTNTHNARNTDNTAIENSGGGNPYGIEREIVIMKLLSHPNVMALYEVWENNNEL 210

Query: 103 YLILEYAEKGELFNLLVDRGPLPEREAIKCFKQIIIAISYCHALGIVHRDLKPENLLLDN 162
           YL+LEY + GELF+ LV +G L E EA+  FKQII  ISYCH+  I HRDLKPENLLLD 
Sbjct: 211 YLVLEYVDGGELFDYLVSKGKLTESEAVHYFKQIINGISYCHSFNICHRDLKPENLLLDK 270

Query: 163 SYN-IKIADFGMAALQTDAGMLETSCGSPHYAAPEIVSGLPYEGFASDVWSCGVILFALL 221
               IKIADFGMAALQ    +L+TSCGSPHYA+PEIV G  Y G  SD+WSCG+ILFALL
Sbjct: 271 KRRIIKIADFGMAALQVSNRLLQTSCGSPHYASPEIVMGKCYNGAPSDIWSCGIILFALL 330

Query: 222 TGRLPFDEENGNVRDLLLKVQKGQFEMPNNAEISGDAQDLIRRILVVDPTQRIKIRDILS 281
           TG LPF+++  N++ LL+KVQ G+++MP  + IS +A++LI RILVVDP++RI    ILS
Sbjct: 331 TGHLPFNDD--NIKKLLIKVQNGRYQMP--SYISQEAKNLISRILVVDPSKRISTEQILS 386

Query: 282 HPLLKKYQT---IKDSKSIKD-----LPRENTYLYPLADADNHTSVT-------IDDSIL 326
           HPLL KY      KD K  K+       + N+ L  L++   +T +        ID+SIL
Sbjct: 387 HPLLTKYDKRLGKKDRKVTKNNKIMHRGKSNSDLNMLSNIPQNTEIVKLRARSDIDESIL 446

Query: 327 QNLVILWHGRPAEEIMKKLQDNGTNTEKTLYALLYRFK 364
           +NL ILWHG   + I+ KL     + EK +Y+LL+++K
Sbjct: 447 KNLQILWHGISRDIIIAKLLQTPMSEEKLIYSLLWKYK 484

>NCAS0A05770 Chr1 (1132854..1137239) [4386 bp, 1461 aa] {ON}
           Anc_2.479
          Length = 1461

 Score =  369 bits (946), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 194/387 (50%), Positives = 256/387 (66%), Gaps = 42/387 (10%)

Query: 13  KPLNIIGPWKLGETLGFGSTGKVQLARHERTGQKTAVKVIPK-------------SIFKS 59
           K  + +GPWKLG+TLG GS+G+V+LA++  TGQ  A+K++PK             S F +
Sbjct: 93  KSRDTVGPWKLGKTLGKGSSGRVRLAKNIETGQLAAIKIVPKKHKLFMKSSHSNVSFFSA 152

Query: 60  EGSHGNNDSVL----------------PFNIEREIVIMKLLSHPNVLSLYDVWETDNNLY 103
             +  +N S L                P+ IEREIVIMKL+SHPNV++LY+VWE  + LY
Sbjct: 153 ASNSNSNISTLATSPPMNNGSEKNQPNPYGIEREIVIMKLISHPNVMALYEVWENKSELY 212

Query: 104 LILEYAEKGELFNLLVDRGPLPEREAIKCFKQIIIAISYCHALGIVHRDLKPENLLLD-N 162
           L+LEY + GELF+ LV +G L E+EA+  FKQII  +SYCH+  I HRDLKPENLLLD  
Sbjct: 213 LVLEYVDGGELFDYLVSKGKLSEKEAVHYFKQIIQGVSYCHSFNICHRDLKPENLLLDKK 272

Query: 163 SYNIKIADFGMAALQTDAGMLETSCGSPHYAAPEIVSGLPYEGFASDVWSCGVILFALLT 222
           + +IKIADFGMAAL+    +L+TSCGSPHYA+PEIV G  Y G  SDVWSCG+ILFALLT
Sbjct: 273 NKSIKIADFGMAALELPNKLLQTSCGSPHYASPEIVMGKSYHGGPSDVWSCGIILFALLT 332

Query: 223 GRLPFDEENGNVRDLLLKVQKGQFEMPNNAEISGDAQDLIRRILVVDPTQRIKIRDILSH 282
           G LPF+++  N++ LLLKVQ G+F MP  + +S +AQDLI RILV+DP++RI    IL+H
Sbjct: 333 GHLPFNDD--NIKKLLLKVQAGKFRMP--STLSPEAQDLISRILVIDPSKRITTDRILNH 388

Query: 283 PLLKKYQ----TIKDSKSIKDLP-RENTYLYPLADADNHTSVTIDDSILQNLVILWHGRP 337
           PL+ KY+     +   KS  DL   E+    P++    +    ID SIL+NL ILWHG  
Sbjct: 389 PLILKYEPAGKNMVSGKSNSDLHVLEHISPQPISLTSRN---DIDASILKNLQILWHGTS 445

Query: 338 AEEIMKKLQDNGTNTEKTLYALLYRFK 364
            E I+ KL     + EK  Y+LL+++K
Sbjct: 446 RELIIAKLLQTPMSEEKLFYSLLWQYK 472

>TBLA0I01150 Chr9 complement(235187..240424) [5238 bp, 1745 aa] {ON}
           Anc_2.479 YKL101W
          Length = 1745

 Score =  369 bits (947), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 191/389 (49%), Positives = 252/389 (64%), Gaps = 36/389 (9%)

Query: 13  KPLNIIGPWKLGETLGFGSTGKVQLARHERTGQKTAVKVIPKSIF--------------- 57
           K  + +GPWKLG+TLG GS+G+V+LA++ +TGQ  A+K++PK+                 
Sbjct: 65  KTRDTVGPWKLGKTLGKGSSGRVRLAKNMKTGQLAAIKIVPKNFHSKKKRQDSPAKSLSS 124

Query: 58  ---KSEGSHGN--NDSVLPFNIEREIVIMKLLSHPNVLSLYDVWETDNNLYLILEYAEKG 112
              K   +H N  N S   + IEREIVIMKL+SHPNV+ LY+VWE  + LYL+LEY + G
Sbjct: 125 SPDKPYTTHSNETNPSNNSYGIEREIVIMKLISHPNVMGLYEVWENKSELYLVLEYVDGG 184

Query: 113 ELFNLLVDRGPLPEREAIKCFKQIIIAISYCHALGIVHRDLKPENLLLDNSYN-IKIADF 171
           ELF+ LV RG LPEREA+  FKQII  ++YCHA  I HRDLKPENLLLD     IKIADF
Sbjct: 185 ELFDYLVSRGKLPEREAVHYFKQIIQGVAYCHAFNICHRDLKPENLLLDKKNKIIKIADF 244

Query: 172 GMAALQTDAGMLETSCGSPHYAAPEIVSGLPYEGFASDVWSCGVILFALLTGRLPFDEEN 231
           GMAAL+    +L TSCGSPHYA+PEIV G  Y G  +DVWSCG+ILFALLTG LPF+ + 
Sbjct: 245 GMAALEVSDKLLSTSCGSPHYASPEIVMGKSYHGSPTDVWSCGIILFALLTGHLPFNHD- 303

Query: 232 GNVRDLLLKVQKGQFEMPNNAEISGDAQDLIRRILVVDPTQRIKIRDILSHPLLKKYQ-- 289
            N++ LLLKVQ G + MP  +++S DA+DLI +ILVVDP +R+   +IL+H L+ KY   
Sbjct: 304 -NIKKLLLKVQSGVYHMP--SDLSPDAKDLISKILVVDPDKRLTTTEILNHSLITKYDRM 360

Query: 290 --TIKDSKSIKDLPRENT-----YLYPLADADN--HTSVTIDDSILQNLVILWHGRPAEE 340
             T ++  +   + R+ +     ++  L++ D        ID SIL NL ILWHG     
Sbjct: 361 GLTNRNYNNNLSMARDKSNSNLNFINNLSNVDILLQNPCDIDTSILSNLQILWHGESKHA 420

Query: 341 IMKKLQDNGTNTEKTLYALLYRFKLESMK 369
           I+ KL     N EK  Y+LL ++K ++ K
Sbjct: 421 IIDKLLQPNMNEEKLFYSLLLKYKQKNSK 449

>ZYRO0G03366g Chr7 (261014..265864) [4851 bp, 1616 aa] {ON} similar
           to uniprot|P34244 Saccharomyces cerevisiae YKL101W HSL1
           Nim1p-related protein kinase that regulates the
           morphogenesis and septin checkpoints associates with the
           assembled septin filament required along with Hsl7p for
           bud neck recruitment phosphorylation and degradation of
           Swe1p
          Length = 1616

 Score =  367 bits (941), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 194/399 (48%), Positives = 255/399 (63%), Gaps = 55/399 (13%)

Query: 16  NIIGPWKLGETLGFGSTGKVQLARHERTGQKTAVKVIPKSIFKSE--------------- 60
           + +GPWKLG+TLG GS+G+V+LA++  TGQ  A+K++PK   K++               
Sbjct: 96  DTVGPWKLGKTLGKGSSGRVRLAKNMETGQLAAIKIVPKKKCKNDPGSHSSSKSTESDFS 155

Query: 61  ----------------GSHGNNDS----VLPFNIEREIVIMKLLSHPNVLSLYDVWETDN 100
                           G++ N         P+ IEREIVIMKL+SH N+L LY+VWE  +
Sbjct: 156 ATMNTTTNTNRATTNGGTNANAGPSEVPANPYGIEREIVIMKLISHSNILGLYEVWENKS 215

Query: 101 NLYLILEYAEKGELFNLLVDRGPLPEREAIKCFKQIIIAISYCHALGIVHRDLKPENLLL 160
            LYL+LEY + GELF+ LV RG L EREA+  FKQI+  +SYCH+  I HRDLKPENLLL
Sbjct: 216 ELYLVLEYVDGGELFDYLVSRGKLGEREAVHYFKQIVQGVSYCHSFNICHRDLKPENLLL 275

Query: 161 D-NSYNIKIADFGMAALQTDAGMLETSCGSPHYAAPEIVSGLPYEGFASDVWSCGVILFA 219
           D  + +IKIADFGMAAL+    +L+TSCGSPHYA+PEIV G PY G  SDVWSCG+ILFA
Sbjct: 276 DKKNKSIKIADFGMAALEVSNKLLQTSCGSPHYASPEIVMGRPYHGGPSDVWSCGIILFA 335

Query: 220 LLTGRLPFDEENGNVRDLLLKVQKGQFEMPNNAEISGDAQDLIRRILVVDPTQRIKIRDI 279
           LLTG LPF+++  N++ LLLKVQ G+F MP N  +S +A+DL+ +ILVV+P +RI   +I
Sbjct: 336 LLTGHLPFNDD--NIKKLLLKVQSGKFHMPQN--LSAEAKDLMSKILVVNPFKRIATEEI 391

Query: 280 LSHPLLKKY----QTIKDSKSIKDLP----RENTYLYPLADADNHTSV------TIDDSI 325
           L+HPLL KY    + +K   S+  +     + N+ L+ L DA N   V       IDDSI
Sbjct: 392 LNHPLLTKYDKLVKPVKYRSSVNPVALSQGKSNSDLHVL-DASNSNIVDLRSREDIDDSI 450

Query: 326 LQNLVILWHGRPAEEIMKKLQDNGTNTEKTLYALLYRFK 364
           + NL ILWHG   E I+ KL     + EK  Y+LL  +K
Sbjct: 451 VSNLQILWHGASRELIVAKLLQPRMSEEKLFYSLLLSYK 489

>TDEL0A02550 Chr1 (457841..461950) [4110 bp, 1369 aa] {ON} Anc_2.479
           YKL101W
          Length = 1369

 Score =  363 bits (931), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 192/399 (48%), Positives = 250/399 (62%), Gaps = 61/399 (15%)

Query: 16  NIIGPWKLGETLGFGSTGKVQLARHERTGQKTAVKVIPKSIFKSEGSHGNNDSVL----- 70
           + +GPWKLG+TLG GS+G+V+LA++  TGQ  A+K++PK         G ND+       
Sbjct: 74  DTVGPWKLGKTLGKGSSGRVRLAKNMETGQLAAIKIVPKK----NNVLGKNDACSTSSAS 129

Query: 71  ------------------------------PFNIEREIVIMKLLSHPNVLSLYDVWETDN 100
                                         P+ IEREIVIMKL+SH NVL LY+VWE  +
Sbjct: 130 YTSNSSQTSTMMNTTANNYTTAGHSNVATNPYGIEREIVIMKLISHANVLGLYEVWENKS 189

Query: 101 NLYLILEYAEKGELFNLLVDRGPLPEREAIKCFKQIIIAISYCHALGIVHRDLKPENLLL 160
            LYL+LEY + GELF+ LV RG L EREA+  FKQII  +SYCHA  I HRDLKPENLLL
Sbjct: 190 ELYLVLEYVDGGELFDYLVSRGRLCEREAVHYFKQIIQGVSYCHAFNICHRDLKPENLLL 249

Query: 161 D-NSYNIKIADFGMAALQTDAGMLETSCGSPHYAAPEIVSGLPYEGFASDVWSCGVILFA 219
           D  +  IKIADFGMAAL+    +L+TSCGSPHYA+PEIV G  Y G  SDVWSCG+ILFA
Sbjct: 250 DKKNSTIKIADFGMAALEVSNKLLQTSCGSPHYASPEIVMGKQYHGGPSDVWSCGIILFA 309

Query: 220 LLTGRLPFDEENGNVRDLLLKVQKGQFEMPNNAEISGDAQDLIRRILVVDPTQRIKIRDI 279
           LLTG LPF+++  +++ LLLKVQ G+++MP N  +S +AQDLI +IL V+P +R+   +I
Sbjct: 310 LLTGHLPFNDD--SIKKLLLKVQSGKYQMPQN--LSKEAQDLIAKILTVNPAKRLTTEEI 365

Query: 280 LSHPLLKKYQTIKDSKSIKDL------PRENTYLYPLADADNHTSVT--------IDDSI 325
           L HPL+ KY ++  +K  K L       + N  L+ L   +N+ + T        IDD+I
Sbjct: 366 LRHPLIVKYDSMMKTKKYKALYKNMGQGKSNADLHLL---NNYEATTINLNSRKDIDDTI 422

Query: 326 LQNLVILWHGRPAEEIMKKLQDNGTNTEKTLYALLYRFK 364
           L NL ILWHG   E I+ KL     + EK  Y+LL ++K
Sbjct: 423 LNNLQILWHGASRELIVAKLLQPRMSEEKVFYSLLLKYK 461

>CAGL0K08514g Chr11 complement(854143..858612) [4470 bp, 1489 aa]
           {ON} similar to uniprot|P34244 Saccharomyces cerevisiae
           YKL101w serine/threonine-protein kinase
          Length = 1489

 Score =  363 bits (933), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 188/395 (47%), Positives = 257/395 (65%), Gaps = 44/395 (11%)

Query: 13  KPLNIIGPWKLGETLGFGSTGKVQLARHERTGQKTAVKVIPKSIF---------KSEGS- 62
           K  + +GPWKLG+TLG GS+G+V+LA++   G   A+K++PK  +         K+ G  
Sbjct: 85  KSRDTVGPWKLGKTLGKGSSGRVRLAKNIENGTLAAIKIVPKRTYNRRMRDQKMKTAGGV 144

Query: 63  -----------------HGNNDSVLPFNIEREIVIMKLLSHPNVLSLYDVWETDNNLYLI 105
                            +G + ++ P+ IEREIVIMKL+SHPNV+ L +VWE  + LYL+
Sbjct: 145 SSGTDSKDSSNREDPIKNGTDSALNPYGIEREIVIMKLISHPNVMGLLEVWENKSELYLV 204

Query: 106 LEYAEKGELFNLLVDRGPLPEREAIKCFKQIIIAISYCHALGIVHRDLKPENLLLDNSYN 165
           LEY + GELF+ LV +G L E EA+  F QII  +SYCH+  I HRDLKPENLLLD    
Sbjct: 205 LEYVDGGELFDYLVSKGKLSEPEAVHYFTQIIQGVSYCHSFNICHRDLKPENLLLDKKNK 264

Query: 166 -IKIADFGMAALQTDAGMLETSCGSPHYAAPEIVSGLPYEGFASDVWSCGVILFALLTGR 224
            IKIADFGMAAL+    +LETSCGSPHYA+PEIV G PY G  SDVWSCG+ILFALLTG 
Sbjct: 265 VIKIADFGMAALELPNKLLETSCGSPHYASPEIVMGKPYHGGPSDVWSCGIILFALLTGH 324

Query: 225 LPFDEENGNVRDLLLKVQKGQFEMPNNAEISGDAQDLIRRILVVDPTQRIKIRDILSHPL 284
           LPF+++  N++ LLLKVQ G+F++P    ++ DA+DLI RILV +P +R+ I +IL+HPL
Sbjct: 325 LPFNDD--NIKKLLLKVQAGRFQLP--PYLTNDAKDLITRILVTNPEKRLTINEILNHPL 380

Query: 285 LKKYQTIKDSKSIKDL-----PRENTYLYPL-----ADADNHTSVTIDDSILQNLVILWH 334
           +KKY+       I+ L      + N+ L+ L     A    ++   ID SIL++L ILWH
Sbjct: 381 IKKYRN--PPAHIRKLNLLGRGKSNSDLHVLEYNTPATVCLNSEEDIDQSILKSLQILWH 438

Query: 335 GRPAEEIMKKLQDNGTNTEKTLYALLYRFKLESMK 369
           G P + ++++L   G   EK  Y+LL+++KL+  K
Sbjct: 439 GTPRQRLVERLLVEGATEEKLFYSLLFQYKLKHSK 473

>TPHA0G03200 Chr7 (683296..687900) [4605 bp, 1534 aa] {ON} Anc_2.479
           YKL101W
          Length = 1534

 Score =  337 bits (864), Expect = 1e-96,   Method: Compositional matrix adjust.
 Identities = 191/429 (44%), Positives = 252/429 (58%), Gaps = 85/429 (19%)

Query: 16  NIIGPWKLGETLGFGSTGKV---------QLAR--------------------------- 39
           ++IGPWKLG+TLG GS+G+V         QLA                            
Sbjct: 91  DMIGPWKLGKTLGKGSSGRVRLAKNKETGQLAAIKIVPKSKSTKFNNAKKNGNGKDNTYD 150

Query: 40  ----------HERTGQKTAVK---VIPKSIFKSE-GS--------HGNNDSVLPFNIERE 77
                     H R+          ++  SI K+E GS          N D+   + IERE
Sbjct: 151 NKPHLSYSSLHNRSNHSVLHNPSFLMDNSIIKNELGSDLDDDGNDSRNKDNSNRYGIERE 210

Query: 78  IVIMKLLSHPNVLSLYDVWETDNNLYLILEYAEKGELFNLLVDRGPLPEREAIKCFKQII 137
           IVIMKL+SHPNV++LY+VWE  N LYL+LEY + GELF+ LV +G L E EA++ FKQII
Sbjct: 211 IVIMKLVSHPNVMALYEVWENKNELYLVLEYVDGGELFDYLVSKGKLTELEAVRYFKQII 270

Query: 138 IAISYCHALGIVHRDLKPENLLLDNSYN-IKIADFGMAALQTDAGMLETSCGSPHYAAPE 196
             + YCH+  I HRDLKPENLLLD     IKIADFGMAALQ    +L+TSCGSPHYA+PE
Sbjct: 271 RGVQYCHSFNICHRDLKPENLLLDKKRKLIKIADFGMAALQVSNTLLKTSCGSPHYASPE 330

Query: 197 IVSGLPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRDLLLKVQKGQFEMPNNAEISG 256
           IV G  Y G  SDVWSCG+ILFALLTG LPF+++  +++ LL+KVQ G+++MPN   +S 
Sbjct: 331 IVMGKTYNGGPSDVWSCGIILFALLTGHLPFNDD--SIKKLLIKVQNGRYQMPN--YLSK 386

Query: 257 DAQDLIRRILVVDPTQRIKIRDILSHPLLKKY--------------QTIKDSKSIKDLPR 302
           DA+DLI RIL+V+P  R+    IL HPL+ KY              Q IK+  ++    +
Sbjct: 387 DAKDLISRILLVNPKARLTTEQILEHPLITKYDNQYSLKKENKLTKQAIKNYNNLM-RGK 445

Query: 303 ENTYLYPLADADNHTSVT-------IDDSILQNLVILWHGRPAEEIMKKLQDNGTNTEKT 355
            NT L  L +  + T +        IDDSIL+NL ILW+G P E ++ KL  +  + EK 
Sbjct: 446 SNTDLAILQNIPDKTDIIQLRSRNDIDDSILRNLQILWNGVPRETLISKLIQDPVSEEKL 505

Query: 356 LYALLYRFK 364
           +Y+LL+++K
Sbjct: 506 IYSLLWQYK 514

>NDAI0D02750 Chr4 (639802..644349) [4548 bp, 1515 aa] {ON} Anc_2.479
           YKL101W
          Length = 1515

 Score =  317 bits (813), Expect = 7e-90,   Method: Compositional matrix adjust.
 Identities = 162/298 (54%), Positives = 211/298 (70%), Gaps = 9/298 (3%)

Query: 72  FNIEREIVIMKLLSHPNVLSLYDVWETDNNLYLILEYAEKGELFNLLVDRGPLPEREAIK 131
           + IEREIVIMKL+SHPNV+ LY+VWE  + LYLILEY + GELF+ LV RG LPE EAI 
Sbjct: 197 YGIEREIVIMKLISHPNVMGLYEVWENKSELYLILEYVDGGELFDYLVSRGKLPEAEAIH 256

Query: 132 CFKQIIIAISYCHALGIVHRDLKPENLL-LDNSYNIKIADFGMAALQTDAGMLETSCGSP 190
            FKQII  +SYCH+  I HRDLKPENLL      +IKIADFGMAAL+    +L+TSCGSP
Sbjct: 257 YFKQIIQGVSYCHSFNICHRDLKPENLLIDKKKKSIKIADFGMAALELPKKLLQTSCGSP 316

Query: 191 HYAAPEIVSGLPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRDLLLKVQKGQFEMPN 250
           HYA+PEIV G  Y G  SDVWSCG+ILFALLTG LPF+++  N++ LLLKVQ G+++MP 
Sbjct: 317 HYASPEIVMGKSYHGGPSDVWSCGIILFALLTGHLPFNDD--NIKKLLLKVQAGKYQMPK 374

Query: 251 NAEISGDAQDLIRRILVVDPTQRIKIRDILSHPLLKKYQ-TIKDSKSIKDLPRENTYLYP 309
           N  +S +A+DLI RILVV P++R+   +IL+HPL+ KY+ + K    +K     + +L  
Sbjct: 375 N--LSDEAKDLISRILVVSPSKRLTTVEILNHPLILKYEKSSKKKHMVKGKSNSDLHLLD 432

Query: 310 LADADN---HTSVTIDDSILQNLVILWHGRPAEEIMKKLQDNGTNTEKTLYALLYRFK 364
               +N   ++ + ID+SIL+NL ILWHG   + I+ KL     + EK  Y+LL ++K
Sbjct: 433 SISPENITLNSRMDIDESILKNLQILWHGTSRDIIIAKLLQKPISEEKLFYSLLLQYK 490

 Score = 57.8 bits (138), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 23/42 (54%), Positives = 34/42 (80%)

Query: 13  KPLNIIGPWKLGETLGFGSTGKVQLARHERTGQKTAVKVIPK 54
           K  + +GPWKLG+TLG GS+G+V+LA++  TGQ  A+K++PK
Sbjct: 85  KSRDTVGPWKLGKTLGKGSSGRVRLAKNVETGQLAAIKIVPK 126

>CAGL0M08910g Chr13 complement(887703..889541) [1839 bp, 612 aa]
           {ON}
          Length = 612

 Score =  250 bits (638), Expect = 3e-71,   Method: Compositional matrix adjust.
 Identities = 126/269 (46%), Positives = 176/269 (65%), Gaps = 13/269 (4%)

Query: 18  IGPWKLGETLGFGSTGKVQLARHERTGQKTAVKVIPKSIFKSEGSHGNNDSVLPFNIERE 77
           +G +++ +TLG GS GKV+LA H  TGQK A+K+I K +       G         IERE
Sbjct: 36  VGNYQIVKTLGEGSFGKVKLAYHVTTGQKVALKIINKKVLAKSDMQGR--------IERE 87

Query: 78  IVIMKLLSHPNVLSLYDVWETDNNLYLILEYAEKGELFNLLVDRGPLPEREAIKCFKQII 137
           I  ++LL HP+++ LYDV ++ + + +++EYA   ELF+ +V R  + E+EA + F+QII
Sbjct: 88  ISYLRLLRHPHIIKLYDVIKSKDEIIMVIEYA-GNELFDYIVQRNKMSEQEARRFFQQII 146

Query: 138 IAISYCHALGIVHRDLKPENLLLDNSYNIKIADFGMAALQTDAGMLETSCGSPHYAAPEI 197
            A+ YCH   IVHRDLKPENLLLD   N+KIADFG++ + TD   L+TSCGSP+YAAPE+
Sbjct: 147 SAVEYCHRHKIVHRDLKPENLLLDEHLNVKIADFGLSNIMTDGNFLKTSCGSPNYAAPEV 206

Query: 198 VSGLPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRDLLLKVQKGQFEMPNNAEISGD 257
           +SG  Y G   DVWSCGVIL+ +L  RLPFD+E+  V  L   +  G + +P    +S  
Sbjct: 207 ISGKLYAGPEVDVWSCGVILYVMLCRRLPFDDESIPV--LFKNISNGVYTLPKF--LSPG 262

Query: 258 AQDLIRRILVVDPTQRIKIRDILSHPLLK 286
           A DLI+R+L+V+P  RI I +I+     K
Sbjct: 263 ASDLIKRMLIVNPLNRISIHEIMQDEWFK 291

>Kpol_495.14 s495 (33810..35684) [1875 bp, 624 aa] {ON}
           (33810..35684) [1875 nt, 625 aa]
          Length = 624

 Score =  249 bits (636), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 126/269 (46%), Positives = 175/269 (65%), Gaps = 13/269 (4%)

Query: 18  IGPWKLGETLGFGSTGKVQLARHERTGQKTAVKVIPKSIFKSEGSHGNNDSVLPFNIERE 77
           IG +++ +TLG GS GKV+LA H  TGQK A+K+I + +       G         IERE
Sbjct: 39  IGNYQIVKTLGEGSFGKVKLAFHVTTGQKVALKIINRKVLSKSDMQGR--------IERE 90

Query: 78  IVIMKLLSHPNVLSLYDVWETDNNLYLILEYAEKGELFNLLVDRGPLPEREAIKCFKQII 137
           I  ++LL HP+++ LYDV ++ + + +I+EYA   ELF+ +V R  + E EA K F+QII
Sbjct: 91  IAYLRLLRHPHIIRLYDVIKSKDEIIMIIEYAHH-ELFDYIVQRDKMSENEARKFFQQII 149

Query: 138 IAISYCHALGIVHRDLKPENLLLDNSYNIKIADFGMAALQTDAGMLETSCGSPHYAAPEI 197
            A+ YCH   IVHRDLKPENLLLD  YN+KI DFG++ + TD   L+TSCGSP+YAAPE+
Sbjct: 150 SAVDYCHRHMIVHRDLKPENLLLDEHYNVKITDFGLSNIMTDGNFLKTSCGSPNYAAPEV 209

Query: 198 VSGLPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRDLLLKVQKGQFEMPNNAEISGD 257
           +SG  Y G   DVWSCGVIL+ +L  RLPFD+E+  +  L   +  G + +PN   +S  
Sbjct: 210 ISGKLYAGPEVDVWSCGVILYVMLCRRLPFDDESIPI--LFKNISNGIYTLPNF--LSDG 265

Query: 258 AQDLIRRILVVDPTQRIKIRDILSHPLLK 286
           A  LI+++L+V+P  RI I +I+     K
Sbjct: 266 AASLIKKMLIVNPINRISISEIMQDEWFK 294

>TPHA0C00470 Chr3 (81482..83377) [1896 bp, 631 aa] {ON} Anc_5.611
           YDR477W
          Length = 631

 Score =  248 bits (634), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 126/269 (46%), Positives = 175/269 (65%), Gaps = 13/269 (4%)

Query: 18  IGPWKLGETLGFGSTGKVQLARHERTGQKTAVKVIPKSIFKSEGSHGNNDSVLPFNIERE 77
           IG +++ +TLG GS GKV+LA H  T QK A+K+I K +       G         IERE
Sbjct: 27  IGNYQIVKTLGEGSFGKVKLAFHSTTRQKVALKIINKKVLSKSDMQGR--------IERE 78

Query: 78  IVIMKLLSHPNVLSLYDVWETDNNLYLILEYAEKGELFNLLVDRGPLPEREAIKCFKQII 137
           I  ++LL HP+++ LYDV ++ + + +++EYA+  ELF+ +V R  + E E  + F+QII
Sbjct: 79  ISYLRLLRHPHIIKLYDVIKSKDEIIMVIEYADH-ELFDYIVQREKMSENEGRRFFQQII 137

Query: 138 IAISYCHALGIVHRDLKPENLLLDNSYNIKIADFGMAALQTDAGMLETSCGSPHYAAPEI 197
            A+ YCH   IVHRDLKPENLLLD  YN+KI DFG++ + TD   L+TSCGSP+YAAPE+
Sbjct: 138 SAVEYCHRHKIVHRDLKPENLLLDEHYNVKITDFGLSNIITDGNFLKTSCGSPNYAAPEV 197

Query: 198 VSGLPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRDLLLKVQKGQFEMPNNAEISGD 257
           +SG  Y G   DVWSCGVIL+ LL  RLPFD+E  ++  L   +  G + +PN   +S  
Sbjct: 198 ISGKLYAGPEVDVWSCGVILYVLLCRRLPFDDE--SIPTLFKNINNGVYTIPN--FLSEG 253

Query: 258 AQDLIRRILVVDPTQRIKIRDILSHPLLK 286
           A  LI+++L+V+P  RI I DI+  P  K
Sbjct: 254 AASLIKKMLIVNPMNRITIGDIIQDPWFK 282

>YDR477W Chr4 (1412373..1414274) [1902 bp, 633 aa] {ON}
           SNF1AMP-activated serine/threonine protein kinase found
           in a complex containing Snf4p and members of the
           Sip1p/Sip2p/Gal83p family; required for transcription of
           glucose-repressed genes, thermotolerance, sporulation,
           and peroxisome biogenesis
          Length = 633

 Score =  248 bits (633), Expect = 3e-70,   Method: Compositional matrix adjust.
 Identities = 126/269 (46%), Positives = 175/269 (65%), Gaps = 13/269 (4%)

Query: 18  IGPWKLGETLGFGSTGKVQLARHERTGQKTAVKVIPKSIFKSEGSHGNNDSVLPFNIERE 77
           IG +++ +TLG GS GKV+LA H  TGQK A+K+I K +       G         IERE
Sbjct: 52  IGNYQIVKTLGEGSFGKVKLAYHTTTGQKVALKIINKKVLAKSDMQGR--------IERE 103

Query: 78  IVIMKLLSHPNVLSLYDVWETDNNLYLILEYAEKGELFNLLVDRGPLPEREAIKCFKQII 137
           I  ++LL HP+++ LYDV ++ + + +++EYA   ELF+ +V R  + E+EA + F+QII
Sbjct: 104 ISYLRLLRHPHIIKLYDVIKSKDEIIMVIEYA-GNELFDYIVQRDKMSEQEARRFFQQII 162

Query: 138 IAISYCHALGIVHRDLKPENLLLDNSYNIKIADFGMAALQTDAGMLETSCGSPHYAAPEI 197
            A+ YCH   IVHRDLKPENLLLD   N+KIADFG++ + TD   L+TSCGSP+YAAPE+
Sbjct: 163 SAVEYCHRHKIVHRDLKPENLLLDEHLNVKIADFGLSNIMTDGNFLKTSCGSPNYAAPEV 222

Query: 198 VSGLPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRDLLLKVQKGQFEMPNNAEISGD 257
           +SG  Y G   DVWSCGVIL+ +L  RLPFD+E+  V  L   +  G + +P    +S  
Sbjct: 223 ISGKLYAGPEVDVWSCGVILYVMLCRRLPFDDESIPV--LFKNISNGVYTLPKF--LSPG 278

Query: 258 AQDLIRRILVVDPTQRIKIRDILSHPLLK 286
           A  LI+R+L+V+P  RI I +I+     K
Sbjct: 279 AAGLIKRMLIVNPLNRISIHEIMQDDWFK 307

>Smik_4.754 Chr4 (1333667..1335565) [1899 bp, 632 aa] {ON} YDR477W
           (REAL)
          Length = 632

 Score =  247 bits (631), Expect = 5e-70,   Method: Compositional matrix adjust.
 Identities = 126/269 (46%), Positives = 175/269 (65%), Gaps = 13/269 (4%)

Query: 18  IGPWKLGETLGFGSTGKVQLARHERTGQKTAVKVIPKSIFKSEGSHGNNDSVLPFNIERE 77
           IG +++ +TLG GS GKV+LA H  TGQK A+K+I K +       G         IERE
Sbjct: 52  IGNYQIVKTLGEGSFGKVKLAYHTTTGQKVALKIINKKVLAKSDMQGR--------IERE 103

Query: 78  IVIMKLLSHPNVLSLYDVWETDNNLYLILEYAEKGELFNLLVDRGPLPEREAIKCFKQII 137
           I  ++LL HP+++ LYDV ++ + + +++EYA   ELF+ +V R  + E+EA + F+QII
Sbjct: 104 ISYLRLLRHPHIIKLYDVIKSKDEIIMVIEYA-GNELFDYIVQRDKMSEQEARRFFQQII 162

Query: 138 IAISYCHALGIVHRDLKPENLLLDNSYNIKIADFGMAALQTDAGMLETSCGSPHYAAPEI 197
            A+ YCH   IVHRDLKPENLLLD   N+KIADFG++ + TD   L+TSCGSP+YAAPE+
Sbjct: 163 SAVEYCHRHKIVHRDLKPENLLLDEHLNVKIADFGLSNIMTDGNFLKTSCGSPNYAAPEV 222

Query: 198 VSGLPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRDLLLKVQKGQFEMPNNAEISGD 257
           +SG  Y G   DVWSCGVIL+ +L  RLPFD+E+  V  L   +  G + +P    +S  
Sbjct: 223 ISGKLYAGPEVDVWSCGVILYVMLCRRLPFDDESIPV--LFKNISNGVYTLPKF--LSPG 278

Query: 258 AQDLIRRILVVDPTQRIKIRDILSHPLLK 286
           A  LI+R+L+V+P  RI I +I+     K
Sbjct: 279 AAGLIKRMLIVNPLNRISIHEIMQDDWFK 307

>Skud_4.751 Chr4 (1332135..1334039) [1905 bp, 634 aa] {ON} YDR477W
           (REAL)
          Length = 634

 Score =  247 bits (631), Expect = 6e-70,   Method: Compositional matrix adjust.
 Identities = 126/269 (46%), Positives = 175/269 (65%), Gaps = 13/269 (4%)

Query: 18  IGPWKLGETLGFGSTGKVQLARHERTGQKTAVKVIPKSIFKSEGSHGNNDSVLPFNIERE 77
           IG +++ +TLG GS GKV+LA H  TGQK A+K+I K +       G         IERE
Sbjct: 53  IGNYQIVKTLGEGSFGKVKLAYHTTTGQKVALKIINKKVLAKSDMQGR--------IERE 104

Query: 78  IVIMKLLSHPNVLSLYDVWETDNNLYLILEYAEKGELFNLLVDRGPLPEREAIKCFKQII 137
           I  ++LL HP+++ LYDV ++ + + +++EYA   ELF+ +V R  + E+EA + F+QII
Sbjct: 105 ISYLRLLRHPHIIKLYDVIKSKDEIIMVIEYA-GNELFDYIVQRDKMSEQEARRFFQQII 163

Query: 138 IAISYCHALGIVHRDLKPENLLLDNSYNIKIADFGMAALQTDAGMLETSCGSPHYAAPEI 197
            A+ YCH   IVHRDLKPENLLLD   N+KIADFG++ + TD   L+TSCGSP+YAAPE+
Sbjct: 164 SAVEYCHRHKIVHRDLKPENLLLDEHLNVKIADFGLSNIMTDGNFLKTSCGSPNYAAPEV 223

Query: 198 VSGLPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRDLLLKVQKGQFEMPNNAEISGD 257
           +SG  Y G   DVWSCGVIL+ +L  RLPFD+E+  V  L   +  G + +P    +S  
Sbjct: 224 ISGKLYAGPEVDVWSCGVILYVMLCRRLPFDDESIPV--LFKNISNGVYTLPKF--LSPG 279

Query: 258 AQDLIRRILVVDPTQRIKIRDILSHPLLK 286
           A  LI+R+L+V+P  RI I +I+     K
Sbjct: 280 AAGLIKRMLIVNPLNRISIHEIMQDDWFK 308

>Suva_2.651 Chr2 (1164264..1166165) [1902 bp, 633 aa] {ON} YDR477W
           (REAL)
          Length = 633

 Score =  247 bits (630), Expect = 7e-70,   Method: Compositional matrix adjust.
 Identities = 126/269 (46%), Positives = 174/269 (64%), Gaps = 13/269 (4%)

Query: 18  IGPWKLGETLGFGSTGKVQLARHERTGQKTAVKVIPKSIFKSEGSHGNNDSVLPFNIERE 77
           IG +++ +TLG GS GKV+LA H  TGQK A+K+I K +       G         IERE
Sbjct: 51  IGNYQIVKTLGEGSFGKVKLAYHTTTGQKVALKIINKKVLAKSDMQGR--------IERE 102

Query: 78  IVIMKLLSHPNVLSLYDVWETDNNLYLILEYAEKGELFNLLVDRGPLPEREAIKCFKQII 137
           I  ++LL HP+++ LYDV ++ + + +++EYA   ELF+ +V R  + E EA + F+QII
Sbjct: 103 ISYLRLLRHPHIIKLYDVIKSKDEIIMVIEYA-GNELFDYIVQRDKMSEDEARRFFQQII 161

Query: 138 IAISYCHALGIVHRDLKPENLLLDNSYNIKIADFGMAALQTDAGMLETSCGSPHYAAPEI 197
            A+ YCH   IVHRDLKPENLLLD   N+KIADFG++ + TD   L+TSCGSP+YAAPE+
Sbjct: 162 SAVEYCHRHKIVHRDLKPENLLLDEHLNVKIADFGLSNIMTDGNFLKTSCGSPNYAAPEV 221

Query: 198 VSGLPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRDLLLKVQKGQFEMPNNAEISGD 257
           +SG  Y G   DVWSCGVIL+ +L  RLPFD+E+  V  L   +  G + +P    +S  
Sbjct: 222 ISGKLYAGPEVDVWSCGVILYVMLCRRLPFDDESIPV--LFKNISNGVYSLPKF--LSPG 277

Query: 258 AQDLIRRILVVDPTQRIKIRDILSHPLLK 286
           A  LI+R+L+V+P  RI I +I+     K
Sbjct: 278 AASLIKRMLIVNPLNRISIHEIMQDDWFK 306

>KLLA0A03806g Chr1 complement(338807..340615) [1809 bp, 602 aa] {ON}
           highly similar to uniprot|P06782 Saccharomyces
           cerevisiae YDR477W SNF1 Protein serine/threonine kinase
           required for release from glucose repression invertase
           expression sporulation and for expression of catabolite-
           repressed genes when glucose is limiting regulates
           Adr1p- dependent transcription primarily at the level of
           chromatin binding
          Length = 602

 Score =  245 bits (625), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 138/325 (42%), Positives = 192/325 (59%), Gaps = 40/325 (12%)

Query: 18  IGPWKLGETLGFGSTGKVQLARHERTGQKTAVKVIPKSIFKSEGSHGNNDSVLPFNIERE 77
           IG +++ +TLG GS GKV+LA H  TGQK A+K+I K +       G         IERE
Sbjct: 32  IGKYQIIKTLGEGSFGKVKLAYHISTGQKVALKIINKKVLAKSDMQGR--------IERE 83

Query: 78  IVIMKLLSHPNVLSLYDVWETDNNLYLILEYAEKGELFNLLVDRGPLPEREAIKCFKQII 137
           I  ++LL HP+++ LYDV ++ + + +++EYA   ELF+ +V R  +PE+EA + F+QII
Sbjct: 84  ISYLRLLRHPHIIKLYDVIKSKDEIIMVIEYA-GNELFDYIVQRDKMPEQEARRFFQQII 142

Query: 138 IAISYCHALGIVHRDLKPENLLLDNSYNIKIADFGMAALQTDAGMLETSCGSPHYAAPEI 197
            A+ YCH   IVHRDLKPENLLLD   N+KIADFG++ + TD   L+TSCGSP+YAAPE+
Sbjct: 143 SAVDYCHRHKIVHRDLKPENLLLDEHLNVKIADFGLSNIMTDGNFLKTSCGSPNYAAPEV 202

Query: 198 VSGLPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRDLLLKVQKGQFEMPNNAEISGD 257
           +SG  Y G   DVWS GVIL+ +L  RLPFD+E+  V  L   +  G + +PN   +S  
Sbjct: 203 ISGKLYAGPEVDVWSSGVILYVMLCRRLPFDDESIPV--LFKNISNGVYTIPNF--LSQG 258

Query: 258 AQDLIRRILVVDPTQRIKIRDILSHPLLKKYQTIKDSKSIKDLPRENTYLYPLADADNHT 317
           A  LI+++L+V+P  RI + +I+     K            DLP    YL P        
Sbjct: 259 AASLIKKMLIVNPVNRITVHEIMQDEWFK-----------VDLP---DYLVPAESTHQEN 304

Query: 318 SVT-------------IDDSILQNL 329
           S +             IDDS++Q L
Sbjct: 305 SESKTEDGGPSVPLELIDDSLVQTL 329

>NCAS0A08080 Chr1 complement(1594221..1596092) [1872 bp, 623 aa]
           {ON} Anc_5.611
          Length = 623

 Score =  244 bits (624), Expect = 4e-69,   Method: Compositional matrix adjust.
 Identities = 125/269 (46%), Positives = 175/269 (65%), Gaps = 13/269 (4%)

Query: 18  IGPWKLGETLGFGSTGKVQLARHERTGQKTAVKVIPKSIFKSEGSHGNNDSVLPFNIERE 77
           IG +++ +TLG GS GKV+LA H  TGQK A+K+I K +       G         IERE
Sbjct: 43  IGNYQIVKTLGEGSFGKVKLAYHMTTGQKVALKIINKKVLAKSDMQGR--------IERE 94

Query: 78  IVIMKLLSHPNVLSLYDVWETDNNLYLILEYAEKGELFNLLVDRGPLPEREAIKCFKQII 137
           I  ++LL HP+++ LYDV ++ + + +++EYA   ELF+ +V R  + E EA + F+QII
Sbjct: 95  ISYLRLLRHPHIIKLYDVIKSKDEIIMVMEYA-GNELFDYIVQRDKMSEDEARRFFQQII 153

Query: 138 IAISYCHALGIVHRDLKPENLLLDNSYNIKIADFGMAALQTDAGMLETSCGSPHYAAPEI 197
            A+ YCH   IVHRDLKPENLLLD   N+KIADFG++ + TD   L+TSCGSP+YAAPE+
Sbjct: 154 SAVEYCHRHKIVHRDLKPENLLLDEHLNVKIADFGLSNIMTDGNFLKTSCGSPNYAAPEV 213

Query: 198 VSGLPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRDLLLKVQKGQFEMPNNAEISGD 257
           +SG  Y G   DVWSCGVIL+ +L  RLPFD+E+  V  L   +  G + +P    +S  
Sbjct: 214 ISGKLYAGPEVDVWSCGVILYVMLCRRLPFDDESIPV--LFKNINNGVYTIPKF--LSQG 269

Query: 258 AQDLIRRILVVDPTQRIKIRDILSHPLLK 286
           A  LI+++L+V+P  RI I++I+     K
Sbjct: 270 ASTLIKKMLIVNPLNRISIQEIMQDEWFK 298

>TBLA0E03360 Chr5 complement(838512..840476) [1965 bp, 654 aa] {ON}
           Anc_5.611 YDR477W
          Length = 654

 Score =  245 bits (625), Expect = 7e-69,   Method: Compositional matrix adjust.
 Identities = 124/269 (46%), Positives = 176/269 (65%), Gaps = 13/269 (4%)

Query: 18  IGPWKLGETLGFGSTGKVQLARHERTGQKTAVKVIPKSIFKSEGSHGNNDSVLPFNIERE 77
           IG +++ +TLG GS GKV+LA H  TGQK A+K+I + +       G         IERE
Sbjct: 41  IGNYQIIKTLGEGSFGKVKLAYHATTGQKVALKIINRKVLAKSDMQGR--------IERE 92

Query: 78  IVIMKLLSHPNVLSLYDVWETDNNLYLILEYAEKGELFNLLVDRGPLPEREAIKCFKQII 137
           I  ++LL HP+++ LYDV ++ + + +++EYA+  ELF+ +V R  + E+EA + F+QII
Sbjct: 93  ISYLRLLRHPHIIKLYDVIKSKDEIIMVIEYAD-NELFDYIVQRDKMSEQEARRFFQQII 151

Query: 138 IAISYCHALGIVHRDLKPENLLLDNSYNIKIADFGMAALQTDAGMLETSCGSPHYAAPEI 197
            A+ YCH   IVHRDLKPENLLLD   N+KIADFG++ + TD   L+TSCGSP+YAAPE+
Sbjct: 152 SAVDYCHRHKIVHRDLKPENLLLDEHLNVKIADFGLSNIMTDGNFLKTSCGSPNYAAPEV 211

Query: 198 VSGLPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRDLLLKVQKGQFEMPNNAEISGD 257
           +SG  Y G   DVWSCGVIL+ +L  RLPFD+E+  V  L   +  G + +P    +S  
Sbjct: 212 ISGKLYAGPEVDVWSCGVILYVMLCRRLPFDDESIPV--LFKNINNGIYTLPR--FLSEG 267

Query: 258 AQDLIRRILVVDPTQRIKIRDILSHPLLK 286
           A  LI+++L+V+P  RI I +I+     K
Sbjct: 268 ASSLIKKMLIVNPLNRISIHEIMQDEWFK 296

>KLTH0G05698g Chr7 (453530..455323) [1794 bp, 597 aa] {ON} similar
           to uniprot|P06782 Saccharomyces cerevisiae YDR477W SNF1
           Protein serine/threonine kinase required for release
           from glucose repression invertase expression sporulation
           and for expression of catabolite- repressed genes when
           glucose is limiting regulates Adr1p- dependent
           transcription primarily at the level of chromatin
           binding
          Length = 597

 Score =  243 bits (620), Expect = 7e-69,   Method: Compositional matrix adjust.
 Identities = 125/269 (46%), Positives = 175/269 (65%), Gaps = 13/269 (4%)

Query: 18  IGPWKLGETLGFGSTGKVQLARHERTGQKTAVKVIPKSIFKSEGSHGNNDSVLPFNIERE 77
           IG +++ +TLG GS GKV+LA H  TGQK A+K+I K +       G         IERE
Sbjct: 27  IGKYQIIKTLGEGSFGKVKLAYHVTTGQKVALKIINKKVLAKSDMQGR--------IERE 78

Query: 78  IVIMKLLSHPNVLSLYDVWETDNNLYLILEYAEKGELFNLLVDRGPLPEREAIKCFKQII 137
           I  ++LL HP+++ LYDV ++ + + +++EYA   ELF+ +V R  + EREA + F+QII
Sbjct: 79  ISYLRLLRHPHIIKLYDVIKSKDEIVMVIEYA-GNELFDYIVQRDKMSEREARRFFQQII 137

Query: 138 IAISYCHALGIVHRDLKPENLLLDNSYNIKIADFGMAALQTDAGMLETSCGSPHYAAPEI 197
            A+ YCH   IVHRDLKPENLLLD   N+KIADFG++ + TD   L+TSCGSP+YAAPE+
Sbjct: 138 SAVEYCHRHKIVHRDLKPENLLLDEHLNVKIADFGLSNIMTDGNFLKTSCGSPNYAAPEV 197

Query: 198 VSGLPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRDLLLKVQKGQFEMPNNAEISGD 257
           +SG  Y G   DVWS GVIL+ +L  RLPFD+E+  +  L   +  G + +P    +S  
Sbjct: 198 ISGKLYAGPEVDVWSSGVILYVMLCRRLPFDDESIPI--LFKNISNGIYTLPKF--LSPG 253

Query: 258 AQDLIRRILVVDPTQRIKIRDILSHPLLK 286
           A +LI+R+L+V+P  RI I +I+     K
Sbjct: 254 AANLIKRMLIVNPLNRITIHEIMEDEWFK 282

>KAFR0C05860 Chr3 (1160586..1162520) [1935 bp, 644 aa] {ON}
           Anc_5.611 YDR477W
          Length = 644

 Score =  244 bits (622), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 124/263 (47%), Positives = 173/263 (65%), Gaps = 13/263 (4%)

Query: 18  IGPWKLGETLGFGSTGKVQLARHERTGQKTAVKVIPKSIFKSEGSHGNNDSVLPFNIERE 77
           IG +++ +TLG GS GKV+LA H  TGQK A+K+I K I       G         IERE
Sbjct: 46  IGNYQIVKTLGEGSFGKVKLAYHITTGQKVALKIINKKILAKSDMQGR--------IERE 97

Query: 78  IVIMKLLSHPNVLSLYDVWETDNNLYLILEYAEKGELFNLLVDRGPLPEREAIKCFKQII 137
           I  ++LL HP+++ LYDV ++ + + +++E+A   ELF+ ++ R  + E EA + F+QII
Sbjct: 98  ISYLRLLRHPHIIKLYDVIKSKDEIIIVIEFA-SNELFDYIIQRDKMSENEARRFFQQII 156

Query: 138 IAISYCHALGIVHRDLKPENLLLDNSYNIKIADFGMAALQTDAGMLETSCGSPHYAAPEI 197
            A+ YCH   IVHRDLKPENLLLD   N+KIADFG++ + TD   L+TSCGSP+YAAPE+
Sbjct: 157 SAVEYCHRHKIVHRDLKPENLLLDEDLNVKIADFGLSNIMTDGNFLKTSCGSPNYAAPEV 216

Query: 198 VSGLPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRDLLLKVQKGQFEMPNNAEISGD 257
           +SG  Y G   DVWSCGVIL+ +L  RLPFD+E+  V  L   +  G + +P    +S  
Sbjct: 217 ISGKLYAGPEVDVWSCGVILYVMLCRRLPFDDESIPV--LFKNISNGVYILPKF--LSPG 272

Query: 258 AQDLIRRILVVDPTQRIKIRDIL 280
           A  LI+R+L+V+P  RI I +I+
Sbjct: 273 ASSLIKRMLIVNPLNRISIHEIM 295

>TDEL0A04780 Chr1 (842715..844580) [1866 bp, 621 aa] {ON} Anc_5.611
           YDR477W
          Length = 621

 Score =  243 bits (620), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 125/269 (46%), Positives = 174/269 (64%), Gaps = 13/269 (4%)

Query: 18  IGPWKLGETLGFGSTGKVQLARHERTGQKTAVKVIPKSIFKSEGSHGNNDSVLPFNIERE 77
           IG +++ +TLG GS GKV+LA H  TGQK A+K+I K +       G         IERE
Sbjct: 39  IGNYQIVKTLGEGSFGKVKLAYHVTTGQKVALKIINKKVLAKSDMQGR--------IERE 90

Query: 78  IVIMKLLSHPNVLSLYDVWETDNNLYLILEYAEKGELFNLLVDRGPLPEREAIKCFKQII 137
           I  ++LL HP+++ LYDV ++ + + +++EYA   ELF+ +V R  + E+EA + F+QII
Sbjct: 91  ISYLRLLRHPHIIKLYDVIKSKDEIIMVIEYA-GNELFDYIVQRDKMSEKEARRFFQQII 149

Query: 138 IAISYCHALGIVHRDLKPENLLLDNSYNIKIADFGMAALQTDAGMLETSCGSPHYAAPEI 197
            A+ YCH   IVHRDLKPENLLLD   N+KIADFG++ + TD   L+TSCGSP+YAAPE+
Sbjct: 150 SAVEYCHRHKIVHRDLKPENLLLDEHLNVKIADFGLSNIMTDGNFLKTSCGSPNYAAPEV 209

Query: 198 VSGLPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRDLLLKVQKGQFEMPNNAEISGD 257
           +SG  Y G   DVWS GVIL+ +L  RLPFD+E+  V  L   +  G + +P    +S  
Sbjct: 210 ISGKLYAGPEVDVWSSGVILYVMLCRRLPFDDESIPV--LFKNISNGVYTLPKF--LSPG 265

Query: 258 AQDLIRRILVVDPTQRIKIRDILSHPLLK 286
           A  LI+R+L+V+P  RI I +I+     K
Sbjct: 266 AAGLIKRMLIVNPLNRISIHEIMQDEWFK 294

>Kpol_1018.65 s1018 (189779..191584) [1806 bp, 601 aa] {ON}
           (189779..191584) [1806 nt, 602 aa]
          Length = 601

 Score =  242 bits (617), Expect = 3e-68,   Method: Compositional matrix adjust.
 Identities = 123/263 (46%), Positives = 174/263 (66%), Gaps = 13/263 (4%)

Query: 18  IGPWKLGETLGFGSTGKVQLARHERTGQKTAVKVIPKSIFKSEGSHGNNDSVLPFNIERE 77
           IG +++ +TLG GS GKV+LA H  T Q+ A+K+I K I       G         IERE
Sbjct: 39  IGNYQIIKTLGEGSFGKVKLAYHVTTNQRVALKIINKKILAKSDMQGR--------IERE 90

Query: 78  IVIMKLLSHPNVLSLYDVWETDNNLYLILEYAEKGELFNLLVDRGPLPEREAIKCFKQII 137
           I  ++LL HP+++ LYDV ++  ++ +++EYA+  ELF+ +V R  + E EA K F+QII
Sbjct: 91  ISYLRLLRHPHIIKLYDVIKSKEDIIMVIEYADH-ELFDYIVQRDKMSENEARKFFQQII 149

Query: 138 IAISYCHALGIVHRDLKPENLLLDNSYNIKIADFGMAALQTDAGMLETSCGSPHYAAPEI 197
            A+ YCH   IVHRDLKPENLLLD   N+KIADFG++ + TD   L+TSCGSP+YAAPE+
Sbjct: 150 SAVEYCHRHKIVHRDLKPENLLLDEELNVKIADFGLSNIMTDGNFLKTSCGSPNYAAPEV 209

Query: 198 VSGLPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRDLLLKVQKGQFEMPNNAEISGD 257
           +SG  Y G   DVWSCGVIL+ +L  RLPFD+++  V  L   +  G + +P    +S  
Sbjct: 210 ISGKLYAGPEVDVWSCGVILYVMLCRRLPFDDDSIPV--LFKNISNGIYTLP--KFLSPG 265

Query: 258 AQDLIRRILVVDPTQRIKIRDIL 280
           A +LI+R+L+V+P  RI + +I+
Sbjct: 266 AANLIKRMLIVNPLNRISMNEIM 288

>NDAI0H00940 Chr8 complement(209645..211702) [2058 bp, 685 aa] {ON}
           Anc_5.611
          Length = 685

 Score =  243 bits (620), Expect = 4e-68,   Method: Compositional matrix adjust.
 Identities = 125/269 (46%), Positives = 173/269 (64%), Gaps = 13/269 (4%)

Query: 18  IGPWKLGETLGFGSTGKVQLARHERTGQKTAVKVIPKSIFKSEGSHGNNDSVLPFNIERE 77
           IG +++ +TLG GS GKV+LA H  TGQK A+K+I K +       G         IERE
Sbjct: 58  IGNYQIVKTLGEGSFGKVKLAYHMTTGQKVALKIINKKVLAKSDMQGR--------IERE 109

Query: 78  IVIMKLLSHPNVLSLYDVWETDNNLYLILEYAEKGELFNLLVDRGPLPEREAIKCFKQII 137
           I  ++LL HP+++ LYDV ++ + + +++EYA   ELF+ +V R  + E EA + F+QII
Sbjct: 110 ISYLRLLRHPHIIKLYDVIKSKDEIIMVMEYA-GNELFDYIVQRDKMSENEARRFFQQII 168

Query: 138 IAISYCHALGIVHRDLKPENLLLDNSYNIKIADFGMAALQTDAGMLETSCGSPHYAAPEI 197
            A+ YCH   IVHRDLKPENLLLD   N+KIADFG++ + TD   L+TSCGSP+YAAPE+
Sbjct: 169 SAVEYCHRHKIVHRDLKPENLLLDEHLNVKIADFGLSNIMTDGNFLKTSCGSPNYAAPEV 228

Query: 198 VSGLPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRDLLLKVQKGQFEMPNNAEISGD 257
           +SG  Y G   DVWS GVIL+ +L  RLPFD+E+  V  L   +  G + +P    +S  
Sbjct: 229 ISGKLYAGPEVDVWSSGVILYVMLCRRLPFDDESIPV--LFKNINNGVYTIPKF--LSQG 284

Query: 258 AQDLIRRILVVDPTQRIKIRDILSHPLLK 286
           A  LI+R+L+V+P  RI I +I+     K
Sbjct: 285 ASSLIKRMLIVNPLNRISISEIMQDEWFK 313

>AEL230W Chr5 (198401..200227) [1827 bp, 608 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR477W (SNF1)
          Length = 608

 Score =  241 bits (615), Expect = 5e-68,   Method: Compositional matrix adjust.
 Identities = 125/269 (46%), Positives = 174/269 (64%), Gaps = 13/269 (4%)

Query: 18  IGPWKLGETLGFGSTGKVQLARHERTGQKTAVKVIPKSIFKSEGSHGNNDSVLPFNIERE 77
           IG +++ +TLG GS GKV+LA H  TGQK A+K+I K +       G         IERE
Sbjct: 36  IGKYQVIKTLGEGSFGKVKLAHHVSTGQKVALKIINKKVLAKSDMQGR--------IERE 87

Query: 78  IVIMKLLSHPNVLSLYDVWETDNNLYLILEYAEKGELFNLLVDRGPLPEREAIKCFKQII 137
           I  ++LL HP+++ LYDV ++ + + +++EYA   ELF+ +V R  + E EA + F+QII
Sbjct: 88  ISYLRLLRHPHIIKLYDVIKSKDEIIMVIEYA-GNELFDYIVQRDKMSENEARRFFQQII 146

Query: 138 IAISYCHALGIVHRDLKPENLLLDNSYNIKIADFGMAALQTDAGMLETSCGSPHYAAPEI 197
            A+ YCH   IVHRDLKPENLLLD   N+KIADFG++ + TD   L+TSCGSP+YAAPE+
Sbjct: 147 SAVEYCHRHKIVHRDLKPENLLLDEHLNVKIADFGLSNIMTDGNFLKTSCGSPNYAAPEV 206

Query: 198 VSGLPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRDLLLKVQKGQFEMPNNAEISGD 257
           +SG  Y G   DVWS GVIL+ +L  RLPFD+E+  V  L   +  G + +P    +S  
Sbjct: 207 ISGKLYAGPEVDVWSSGVILYVMLCRRLPFDDESIPV--LFKNISNGVYSIPKF--LSQG 262

Query: 258 AQDLIRRILVVDPTQRIKIRDILSHPLLK 286
           A +LI+R+L+V+P  RI I +I+     K
Sbjct: 263 AANLIKRMLIVNPLNRITIHEIMEDEWFK 291

>Kwal_47.18233 s47 complement(743846..745642) [1797 bp, 598 aa] {ON}
           YDR477W (SNF1) - protein serine/threonine kinase [contig
           197] FULL
          Length = 598

 Score =  241 bits (614), Expect = 5e-68,   Method: Compositional matrix adjust.
 Identities = 125/269 (46%), Positives = 173/269 (64%), Gaps = 13/269 (4%)

Query: 18  IGPWKLGETLGFGSTGKVQLARHERTGQKTAVKVIPKSIFKSEGSHGNNDSVLPFNIERE 77
           IG +++ +TLG GS GKV+LA H  TGQK A+K+I K +       G         IERE
Sbjct: 28  IGKYQIIKTLGEGSFGKVKLAYHVTTGQKVALKIINKKVLAKSDMQGR--------IERE 79

Query: 78  IVIMKLLSHPNVLSLYDVWETDNNLYLILEYAEKGELFNLLVDRGPLPEREAIKCFKQII 137
           I  ++LL HP+++ LYDV ++ + + +++EYA   ELF+ +V R  + E EA + F+QII
Sbjct: 80  ISYLRLLRHPHIIKLYDVVKSKDEIVMVIEYA-GNELFDYIVQRDKMSENEARRFFQQII 138

Query: 138 IAISYCHALGIVHRDLKPENLLLDNSYNIKIADFGMAALQTDAGMLETSCGSPHYAAPEI 197
            A+ YCH   IVHRDLKPENLLLD   N+KIADFG++ + TD   L TSCGSP+YAAPE+
Sbjct: 139 SAVEYCHRHKIVHRDLKPENLLLDEHLNVKIADFGLSNIMTDGNFLRTSCGSPNYAAPEV 198

Query: 198 VSGLPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRDLLLKVQKGQFEMPNNAEISGD 257
           +SG  Y G   DVWS GVIL+ +L  RLPFD+E+  V  L   +  G + +P    +S  
Sbjct: 199 ISGKLYAGPEVDVWSSGVILYVMLCRRLPFDDESIPV--LFKNISNGIYTLPKF--LSPG 254

Query: 258 AQDLIRRILVVDPTQRIKIRDILSHPLLK 286
           A +LI+R+L+V+P  RI I +I+     K
Sbjct: 255 AANLIKRMLIVNPLNRITIHEIMQDEWFK 283

>SAKL0G06952g Chr7 (570584..572383) [1800 bp, 599 aa] {ON} similar
           to uniprot|P06782 Saccharomyces cerevisiae YDR477W SNF1
           Protein serine/threonine kinase required for release
           from glucose repression invertase expression sporulation
           and for expression of catabolite-repressed genes when
           glucose is limiting regulates Adr1p-dependent
           transcription primarily at the level of chromatin
           binding
          Length = 599

 Score =  241 bits (614), Expect = 7e-68,   Method: Compositional matrix adjust.
 Identities = 125/269 (46%), Positives = 174/269 (64%), Gaps = 13/269 (4%)

Query: 18  IGPWKLGETLGFGSTGKVQLARHERTGQKTAVKVIPKSIFKSEGSHGNNDSVLPFNIERE 77
           IG +++ +TLG GS GKV+LA H  TGQK A+K+I K +       G         IERE
Sbjct: 29  IGKYQIIKTLGEGSFGKVKLAYHITTGQKVALKIINKKVLAKSDMQGR--------IERE 80

Query: 78  IVIMKLLSHPNVLSLYDVWETDNNLYLILEYAEKGELFNLLVDRGPLPEREAIKCFKQII 137
           I  ++LL HP+++ LYDV ++ + + +++EYA   ELF+ +V R  + E EA + F+QII
Sbjct: 81  ISYLRLLRHPHIIKLYDVIKSKDEIVMVIEYA-GNELFDYIVQRDKMNEDEARRFFQQII 139

Query: 138 IAISYCHALGIVHRDLKPENLLLDNSYNIKIADFGMAALQTDAGMLETSCGSPHYAAPEI 197
            A+ YCH   IVHRDLKPENLLLD   N+KIADFG++ + TD   L+TSCGSP+YAAPE+
Sbjct: 140 SAVEYCHRHKIVHRDLKPENLLLDEHLNVKIADFGLSNIMTDGNFLKTSCGSPNYAAPEV 199

Query: 198 VSGLPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRDLLLKVQKGQFEMPNNAEISGD 257
           +SG  Y G   DVWS GVIL+ +L  RLPFD+E+  V  L   +  G + +P    +S  
Sbjct: 200 ISGKLYAGPEVDVWSSGVILYVMLCRRLPFDDESIPV--LFKNISNGVYTLPKF--LSPG 255

Query: 258 AQDLIRRILVVDPTQRIKIRDILSHPLLK 286
           A +LI+R+L+V+P  RI I +I+     K
Sbjct: 256 ASNLIKRMLIVNPLNRITIHEIMQDEWFK 284

>TPHA0D02840 Chr4 (591733..593637) [1905 bp, 634 aa] {ON} 
          Length = 634

 Score =  240 bits (613), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 121/269 (44%), Positives = 174/269 (64%), Gaps = 13/269 (4%)

Query: 18  IGPWKLGETLGFGSTGKVQLARHERTGQKTAVKVIPKSIFKSEGSHGNNDSVLPFNIERE 77
           IG +++ +TLG GS GKV+LA H  T QK A+K+I K +       G         +ERE
Sbjct: 65  IGNYQIIKTLGEGSFGKVKLAYHVTTNQKVALKIINKKVLAKSDMQGR--------VERE 116

Query: 78  IVIMKLLSHPNVLSLYDVWETDNNLYLILEYAEKGELFNLLVDRGPLPEREAIKCFKQII 137
           I  ++LL HP+++ LYDV ++ + + +++EYA   ELF  +V R  + E EA K F+QII
Sbjct: 117 ISFLRLLRHPHIIKLYDVIKSKDEIIMVIEYA-NNELFEYIVQRDKMTENEARKFFQQII 175

Query: 138 IAISYCHALGIVHRDLKPENLLLDNSYNIKIADFGMAALQTDAGMLETSCGSPHYAAPEI 197
            A+ YCH   IVHRDLKPENLLLD + N+KIADFG++ + TD   L+TSCGSP+YAAPE+
Sbjct: 176 SAVEYCHRHKIVHRDLKPENLLLDENLNVKIADFGLSNIMTDGNFLKTSCGSPNYAAPEV 235

Query: 198 VSGLPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRDLLLKVQKGQFEMPNNAEISGD 257
           +SG  Y G   DVWSCGVIL+ +L  RLPFD++  ++  L   +  G + +P    +S  
Sbjct: 236 ISGKLYAGPEVDVWSCGVILYVMLCRRLPFDDD--SIPALFKNISNGIYTLP--KFLSEG 291

Query: 258 AQDLIRRILVVDPTQRIKIRDILSHPLLK 286
           A +LI+++L+V+P  RI + +I+     K
Sbjct: 292 AANLIKKMLIVNPLNRISMTEIIHDEWFK 320

>ZYRO0A05544g Chr1 (450809..452704) [1896 bp, 631 aa] {ON} highly
           similar to uniprot|P06782 Saccharomyces cerevisiae
           YDR477W SNF1 Protein serine/threonine kinase required
           for release from glucose repression invertase expression
           sporulation and for expression of catabolite- repressed
           genes when glucose is limiting regulates Adr1p-
           dependent transcription primarily at the level of
           chromatin binding
          Length = 631

 Score =  238 bits (608), Expect = 7e-67,   Method: Compositional matrix adjust.
 Identities = 125/269 (46%), Positives = 173/269 (64%), Gaps = 13/269 (4%)

Query: 18  IGPWKLGETLGFGSTGKVQLARHERTGQKTAVKVIPKSIFKSEGSHGNNDSVLPFNIERE 77
           IG +++ +TLG GS GKV+LA H  TGQK A+K+I K +       G         IERE
Sbjct: 48  IGNYQIVKTLGEGSFGKVKLAYHITTGQKVALKIINKKVLAKSDMQGR--------IERE 99

Query: 78  IVIMKLLSHPNVLSLYDVWETDNNLYLILEYAEKGELFNLLVDRGPLPEREAIKCFKQII 137
           I  ++LL HP+++ LYDV ++ + + +++EYA   ELF+ +V R  + E EA + F+QII
Sbjct: 100 ISYLRLLRHPHIIKLYDVIKSKDEIIMVIEYA-GNELFDYIVQRDKMSEEEARRFFQQII 158

Query: 138 IAISYCHALGIVHRDLKPENLLLDNSYNIKIADFGMAALQTDAGMLETSCGSPHYAAPEI 197
            A+ YCH   IVHRDLKPENLLLD   N+KIADFG++ + TD   L+TSCGSP+YAAPE+
Sbjct: 159 SAVEYCHRHKIVHRDLKPENLLLDEHLNVKIADFGLSNIMTDGNFLKTSCGSPNYAAPEV 218

Query: 198 VSGLPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRDLLLKVQKGQFEMPNNAEISGD 257
           +SG  Y G   DVWS GVIL+ +L  RLPFD+E+  V  L   +  G + +P    +S  
Sbjct: 219 ISGKLYAGPEVDVWSSGVILYVMLCRRLPFDDESIPV--LFKNISNGVYTLPKF--LSEG 274

Query: 258 AQDLIRRILVVDPTQRIKIRDILSHPLLK 286
           A  LI+R+L+V+P  RI I +I+     K
Sbjct: 275 AAGLIKRMLIVNPLNRISILEIMQDDWFK 303

>KNAG0B03230 Chr2 complement(625072..626997) [1926 bp, 641 aa] {ON}
           Anc_5.611 YDR477W
          Length = 641

 Score =  238 bits (606), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 121/263 (46%), Positives = 173/263 (65%), Gaps = 13/263 (4%)

Query: 18  IGPWKLGETLGFGSTGKVQLARHERTGQKTAVKVIPKSIFKSEGSHGNNDSVLPFNIERE 77
           IG +++ +TLG GS GKV+LA H  T QK A+K+I K +       G         IERE
Sbjct: 42  IGNYQIVKTLGEGSFGKVKLAYHITTNQKVALKIINKKVLAKSDMQGR--------IERE 93

Query: 78  IVIMKLLSHPNVLSLYDVWETDNNLYLILEYAEKGELFNLLVDRGPLPEREAIKCFKQII 137
           I  ++LL HP+++ LYDV ++ + + +++E+A   ELF+ ++ R  + E+EA + F+QII
Sbjct: 94  ISYLRLLRHPHIIKLYDVIKSKDEIIIVIEFA-SNELFDYIIQRDKMSEQEARRFFQQII 152

Query: 138 IAISYCHALGIVHRDLKPENLLLDNSYNIKIADFGMAALQTDAGMLETSCGSPHYAAPEI 197
            A+ YCH   IVHRDLKPENLLLD   N+KIADFG++ + TD   L+TSCGSP+YAAPE+
Sbjct: 153 SAVEYCHRHKIVHRDLKPENLLLDEDLNVKIADFGLSNIMTDGNFLKTSCGSPNYAAPEV 212

Query: 198 VSGLPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRDLLLKVQKGQFEMPNNAEISGD 257
           +SG  Y G   DVWSCGVIL+ +L  RLPFD+E+  V  L   +  G + +P    +S  
Sbjct: 213 ISGKLYAGPEVDVWSCGVILYVMLCRRLPFDDESIPV--LFKNISNGVYILPKF--LSLG 268

Query: 258 AQDLIRRILVVDPTQRIKIRDIL 280
           A +LI+++L+V+P  RI I +I 
Sbjct: 269 AANLIKKMLIVNPLNRISISEIF 291

>Ecym_5588 Chr5 complement(1205102..1206943) [1842 bp, 613 aa] {ON}
           similar to Ashbya gossypii AEL230W
          Length = 613

 Score =  237 bits (604), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 123/269 (45%), Positives = 173/269 (64%), Gaps = 13/269 (4%)

Query: 18  IGPWKLGETLGFGSTGKVQLARHERTGQKTAVKVIPKSIFKSEGSHGNNDSVLPFNIERE 77
           IG +++ +TLG GS GKV+LA H  T QK A+K+I K +       G         IERE
Sbjct: 40  IGKYQVIKTLGEGSFGKVKLAYHVSTSQKVALKIINKKVLAKSDMQGR--------IERE 91

Query: 78  IVIMKLLSHPNVLSLYDVWETDNNLYLILEYAEKGELFNLLVDRGPLPEREAIKCFKQII 137
           I  ++LL HP+++ LYDV ++ + + +++EYA   ELF+ +V R  + E EA + F+QII
Sbjct: 92  ISYLRLLRHPHIIKLYDVIKSKDEIIMVIEYA-GNELFDYIVQRDKMSENEARRFFQQII 150

Query: 138 IAISYCHALGIVHRDLKPENLLLDNSYNIKIADFGMAALQTDAGMLETSCGSPHYAAPEI 197
            A+ YCH   IVHRDLKPENLLLD   N+KIADFG++ + TD   L+TSCGSP+YAAPE+
Sbjct: 151 SAVEYCHRHKIVHRDLKPENLLLDEHLNVKIADFGLSNIMTDGNFLKTSCGSPNYAAPEV 210

Query: 198 VSGLPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRDLLLKVQKGQFEMPNNAEISGD 257
           +SG  Y G   DVWS GVIL+ +L  RLPFD+E+  V  L   +  G + +P    +S  
Sbjct: 211 ISGKLYAGPEVDVWSSGVILYVMLCRRLPFDDESIPV--LFKNISNGVYSIPKF--LSPG 266

Query: 258 AQDLIRRILVVDPTQRIKIRDILSHPLLK 286
           A +LI+++L+V+P  RI I +I+     K
Sbjct: 267 AANLIKKMLIVNPLNRITIHEIMEDQWFK 295

>Kwal_33.13225 s33 (127676..130570) [2895 bp, 964 aa] {ON} YFR016C -
           Hypothetical ORF [contig 120] FULL
          Length = 964

 Score =  243 bits (621), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 114/176 (64%), Positives = 140/176 (79%), Gaps = 4/176 (2%)

Query: 201 LPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRDLLLKVQKGQFEMPNNAEISGDAQD 260
           LPY GF SDVWSCG+ILFALLTGRLPFDEE+GN+R+LLLKVQ GQFEMP++ EIS +AQD
Sbjct: 10  LPYHGFESDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPDSDEISPEAQD 69

Query: 261 LIRRILVVDPTQRIKIRDILSHPLLKKYQTIKDSKSIKDLPRENTYLYPLADADNHTSVT 320
           LI +IL VDP  RIK R+IL HPLL+KY +IKDSKSI++LPRE+TYL PL   +     +
Sbjct: 70  LIAKILTVDPAARIKSREILKHPLLQKYPSIKDSKSIRNLPREDTYLNPLDSVNG----S 125

Query: 321 IDDSILQNLVILWHGRPAEEIMKKLQDNGTNTEKTLYALLYRFKLESMKETNKRSR 376
           ID+SI+ NLV+LWHGR   EI  +L++ G N EKT YALL+RFK +S +E  K+ R
Sbjct: 126 IDESIINNLVVLWHGRDRNEITAQLKEPGANLEKTFYALLFRFKHDSHQEQLKQQR 181

 Score =  158 bits (399), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 163/501 (32%), Positives = 234/501 (46%), Gaps = 88/501 (17%)

Query: 600  LLQDIDTLLTNRYQLSSYTRPISRLDPGLTPVTGAIPHSIKEKTALLQDTEMKIIETIRK 659
            L  DI  LL NR   S  TRP SRLDPG+   +       K   A L  TE  I+ETIR+
Sbjct: 478  LDNDIMALL-NRRTFSLETRPKSRLDPGIY-TSEEEDFGSKNHGADLS-TEKTILETIRR 534

Query: 660  SEFLGSLLNVREGISQDNN---QLASI-------EVSPKISTTPLM---YNDQV------ 700
            S+FLGS  ++ + ++++     + A++        V+   +T  ++   Y  Q       
Sbjct: 535  SKFLGSSFDINKELARERRLKEERAALAKRKDEERVASNATTANVVGNGYESQTLPKRKM 594

Query: 701  --------EIRKISDVEVPHFTRKSKHFTTANNRRSVLSLYSLKESLEDLNQISKNEE-- 750
                    E RKIS+VEVP FTR+S+HFT +N R SVLS+YS K S  +L    K +   
Sbjct: 595  GSAMEASSEPRKISEVEVPQFTRRSRHFTASNKRLSVLSMYSTKTSFTNLADHLKGKADV 654

Query: 751  ---PDSPPQGS-TDNASKSELVDVIEEVTEXXXXXXXXXXXXXXXXXXXXXILYDVPECV 806
                 SPP  S  D  ++     V +E  E                      LY+V E  
Sbjct: 655  QLIQTSPPSASKMDQEAEFMFESVDKEGKETADTSADSR-------------LYEVAETK 701

Query: 807  DSPQ---GYDINDA---HSTQSPASKSTEPKPVVKLPSLSSFQRKN---ASGLGIYQ--- 854
            D+        +N A   +   SP S+ T+    +KLP+L    +      SGLG+YQ   
Sbjct: 702  DAKNAKPAVKLNFADRFNRPTSPPSQDTDSSAAIKLPALPPLDKNKPNMVSGLGLYQATA 761

Query: 855  ---RESSRESLPSVTINISESDKTTE--NEAQKEIKHDKSDTIL-------------SNH 896
                E ++    S+ I+  ES+ TTE  N   +  +  K+ T++              N 
Sbjct: 762  EPSHEDAQPVAKSMVIDDVESEITTEPRNTVTETEEAAKNSTVVPTAPVAPLNNVMKKNT 821

Query: 897  DGKADSYKGDISNIVRESSHGSFLKKL-SKG----KILELDVRAK--ISEKRLYEGLHKL 949
            D        DI+  V + ++ SF +K  SKG    K  + D R K  I E +++  L KL
Sbjct: 822  DADRKPL-SDITPAVEKKANKSFFRKFSSKGSDEKKSGDYDFRFKTVIEETQMFNALSKL 880

Query: 950  LEGWKQYGLKNLGINTADMIISGKLVNDGILSLRSTLFEIVILPNGSGRSLIKFNKKTGS 1009
            L  WK YGLK++  + +   I GKL +D ILSLRSTLF I ++  G G S ++F KK+GS
Sbjct: 881  LAAWKDYGLKDVIASPSLKQIRGKLSSDNILSLRSTLFIITVVGRGEG-SYVEFTKKSGS 939

Query: 1010 TKTLTKFATEIQIILQKEGVL 1030
             KT  K   EI+ IL+ +  L
Sbjct: 940  NKTFKKLVKEIEKILESKKAL 960

>Kwal_33.13222 s33 (127342..127788) [447 bp, 148 aa] {OFF} YDR507C
           (GIN4) - putative serine/threonine kinase [contig 120]
           PARTIAL
          Length = 148

 Score =  214 bits (544), Expect = 8e-64,   Method: Composition-based stats.
 Identities = 96/120 (80%), Positives = 109/120 (90%)

Query: 81  MKLLSHPNVLSLYDVWETDNNLYLILEYAEKGELFNLLVDRGPLPEREAIKCFKQIIIAI 140
           MKLL H NVL LYDVWET++NLY++LEY EKGELFNLLV+RGPLPE EA++ F+QIII I
Sbjct: 1   MKLLHHANVLRLYDVWETNSNLYMVLEYVEKGELFNLLVERGPLPENEAVRFFRQIIIGI 60

Query: 141 SYCHALGIVHRDLKPENLLLDNSYNIKIADFGMAALQTDAGMLETSCGSPHYAAPEIVSG 200
           SYCHALGIVHRDLKPENLLLD+ +NIKIADFGMAAL++   +LETSCGSPHYAAPEIVSG
Sbjct: 61  SYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALESKDKLLETSCGSPHYAAPEIVSG 120

>CAGL0M02519g Chr13 complement(290723..292993) [2271 bp, 756 aa]
           {ON} highly similar to uniprot|Q03002 Saccharomyces
           cerevisiae YPL141c or uniprot|Q01919 Saccharomyces
           cerevisiae YOR233w KIN4
          Length = 756

 Score =  200 bits (509), Expect = 7e-53,   Method: Compositional matrix adjust.
 Identities = 115/301 (38%), Positives = 162/301 (53%), Gaps = 36/301 (11%)

Query: 18  IGPWKLGETLGFGSTGKVQLARHERTGQKT--------------------AVKVIPKSIF 57
            GP+ +G TLG G  GKV+LA  +   Q+                     A+K+I +   
Sbjct: 45  FGPYVIGATLGEGEFGKVKLAWSKSAYQQCDNTEGNAGNKPMTFKVPKQVAIKLIKRDFI 104

Query: 58  KSEGSHGNNDSVLPFNIEREIVIMKLLSHPNVLSLYDVWETDNNLYLILEYAEKGELFNL 117
             + S           I REI  +K LSHPN++ L +V +    + ++LEYA  GE +  
Sbjct: 105 TKDPSKETK-------IYREINALKHLSHPNIVKLEEVLQNSKYIGIVLEYAAGGEFYKF 157

Query: 118 LVDRGPLPEREAIKCFKQIIIAISYCHALGIVHRDLKPENLLLDNSYNIKIADFGMA-AL 176
           +  +  L E  A + F Q+I A+ Y H+ G+VHRDLK ENLLLDN  N+ I DFG     
Sbjct: 158 IQRKRRLKENHACRLFSQLISAVHYIHSKGLVHRDLKLENLLLDNEENLIITDFGFVNEF 217

Query: 177 QTDAGMLETSCGSPHYAAPE-IVSGLPYEGFASDVWSCGVILFALLTGRLPFDEENGN-- 233
               GM++TSCGSP YAAPE +VS  PY+   +D WSCG+ILFA+L G LP+D++  N  
Sbjct: 218 LRQNGMMKTSCGSPCYAAPELVVSNRPYDARKADTWSCGIILFAMLAGYLPWDDDPKNPD 277

Query: 234 ---VRDLLLKVQKGQFEMPNNAEISGDAQDLIRRILVVDPTQRIKIRDILSHPLLKKYQT 290
              +  L   +     + P    I+   +DL+R+ILV+DP +RI IR I  HP L+ + T
Sbjct: 278 GHDISRLYNYILNTPLKFPE--YINPVPRDLLRKILVIDPKKRINIRSIEKHPWLESHST 335

Query: 291 I 291
            
Sbjct: 336 F 336

>CAGL0M11396g Chr13 (1122109..1125687) [3579 bp, 1192 aa] {ON}
           similar to uniprot|P13186 Saccharomyces cerevisiae
           YLR096w KIN2 ser/thr protein kinase
          Length = 1192

 Score =  203 bits (516), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 102/290 (35%), Positives = 165/290 (56%), Gaps = 26/290 (8%)

Query: 18  IGPWKLGETLGFGSTGKVQLARHERTGQKTAVKVIPKSIFKSEGSHGNNDSVLPFNIE-- 75
           +G W   ET+G GS GKV+LA+H RTG+  A+K++ ++       H   +S  P N +  
Sbjct: 105 LGDWDFLETVGAGSMGKVKLAKHRRTGEVCAIKIVNRAT--KAFLHKEQNSPPPVNNQEI 162

Query: 76  ------------------REIVIMKLLSHPNVLSLYDVWETDNNLYLILEYAEKGELFNL 117
                             RE  + ++  HP++  L+++    N+ Y++ EY   G+L + 
Sbjct: 163 MERQKKLEKEISRDKRAIREASLGQIFYHPHICRLFEMCTMSNHFYMLFEYVAGGQLLDY 222

Query: 118 LVDRGPLPEREAIKCFKQIIIAISYCHALGIVHRDLKPENLLLDNSYNIKIADFGMAALQ 177
           ++  G L E  A K  + +  A+ Y HA  IVHRDLK EN+++ NS  IKI DFG++ + 
Sbjct: 223 IIQHGSLREHHARKFARGVASALQYLHANNIVHRDLKIENIMISNSGEIKIIDFGLSNVY 282

Query: 178 TDAGMLETSCGSPHYAAPEIVSGLPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRDL 237
                L T CGS ++AAPE++   PY G   DVWS GV+L+ L+ G++PFD+EN +V  L
Sbjct: 283 DTRKQLHTFCGSLYFAAPELLKAHPYTGPEVDVWSFGVVLYVLVCGKVPFDDENSSV--L 340

Query: 238 LLKVQKGQFEMPNNAEISGDAQDLIRRILVVDPTQRIKIRDILSHPLLKK 287
             K+++G+ E P +  I  +   L+ ++LVVDP++R  ++ ++ HP + K
Sbjct: 341 HEKIKRGKVEYPQHLSI--EVMSLLSKMLVVDPSRRASLKQVVEHPWMTK 388

>KNAG0J01590 Chr10 (292565..294982) [2418 bp, 805 aa] {ON} Anc_8.654
           YPL141C
          Length = 805

 Score =  200 bits (508), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 118/311 (37%), Positives = 169/311 (54%), Gaps = 27/311 (8%)

Query: 18  IGPWKLGETLGFGSTGKVQLARHERTGQKTAVKVIPKSI----FKSEGSHGNNDSVLPFN 73
            GP+ +G TLG G  GKV++      G K  +  +PK +     K +    +ND      
Sbjct: 39  FGPYLIGSTLGQGGFGKVKMGWTTPMGNK-GIYDVPKQVAIKLIKRDSI--SNDKSKEVK 95

Query: 74  IEREIVIMKLLSHPNVLSLYDVWETDNNLYLILEYAEKGELFNLLVDRGPLPEREAIKCF 133
           I REI  +K L HPN++ L +V +    + ++LEYA  GE +  +  R  L E  A + F
Sbjct: 96  IYREINALKQLHHPNIVKLEEVLQNSKYIGIVLEYASGGEFYKYIQKRRVLKEHVACRLF 155

Query: 134 KQIIIAISYCHALGIVHRDLKPENLLLDNSYNIKIADFGMA-ALQTDAGMLETSCGSPHY 192
            Q+I  + Y H+ G+VHRDLK ENLLLD   N+ I DFG      +   ++ TSCGSP Y
Sbjct: 156 AQLISGVHYIHSKGLVHRDLKLENLLLDKHENLIITDFGFVNEYFSQNELMTTSCGSPCY 215

Query: 193 AAPEIV-SGLPYEGFASDVWSCGVILFALLTGRLPFDEENGN-----VRDLLLKVQKGQF 246
           AAPE+V S  PY+G  +D+WSCG+ILFA+L G LP+D++  N     +  L   +     
Sbjct: 216 AAPELVISTQPYQGRRADLWSCGIILFAMLAGYLPWDDDKDNPDGEDIAKLYYYITHTAL 275

Query: 247 EMPNNAEISGDAQDLIRRILVVDPTQRIKIRDILSHPLLKK-----------YQTIKDSK 295
           + P    I+   +DL+RRILV DP +R+ +R+I  H  LKK           +  I  SK
Sbjct: 276 KFPE--YITPIPRDLLRRILVADPRRRVTLREIQGHQWLKKHAQFLSIQPEEWDRISQSK 333

Query: 296 SIKDLPRENTY 306
           +I  LP+ N +
Sbjct: 334 NITRLPKHNKH 344

>TPHA0G01710 Chr7 complement(350452..352869) [2418 bp, 805 aa] {ON}
           Anc_8.654 YPL141C
          Length = 805

 Score =  195 bits (496), Expect = 6e-51,   Method: Compositional matrix adjust.
 Identities = 108/285 (37%), Positives = 163/285 (57%), Gaps = 31/285 (10%)

Query: 18  IGPWKLGETLGFGSTGKVQLARHERTGQ-----KTAVKVIPKSIFKSEGSHGNNDSVLPF 72
            GP+ +G TLG G  GKV+L   + T +     + A+K+I +            D++L +
Sbjct: 37  FGPYYVGSTLGEGEFGKVKLGWTKTTSKLEMPKQVAIKLIRR------------DAILNY 84

Query: 73  N-----IEREIVIMKLLSHPNVLSLYDVWETDNNLYLILEYAEKGELFNLLVDRGPLPER 127
           +     I REI  +K L+HPN++ L +V +    + ++LE+A  GE +  +  +  L E 
Sbjct: 85  SEKETKIYREINALKHLTHPNIVKLEEVLQNSKYIGIVLEFASGGEFYKYIQKKRRLKET 144

Query: 128 EAIKCFKQIIIAISYCHALGIVHRDLKPENLLLDNSYNIKIADFGMA-ALQTDAGMLETS 186
            A + F Q++  + Y H+ G+VHRDLK ENLLLD   N+ I DFG          +++TS
Sbjct: 145 PACRLFAQLVSGVHYMHSKGLVHRDLKLENLLLDKHENLIITDFGFVNEFSQRNELMKTS 204

Query: 187 CGSPHYAAPE-IVSGLPYEGFASDVWSCGVILFALLTGRLPFDEENGN-----VRDLLLK 240
           CGSP YAAPE +V+  PYE   +DVWSCG+IL+A+L G LP+D++  N     +  L L 
Sbjct: 205 CGSPCYAAPELVVTTEPYEARKADVWSCGIILYAMLAGYLPWDDDPQNPDGDDIAKLYLY 264

Query: 241 VQKGQFEMPNNAEISGDAQDLIRRILVVDPTQRIKIRDILSHPLL 285
           + K   + P    I+   +DL+R+ILV DPT+R+ IR+I  H  L
Sbjct: 265 ITKTALKFP--EYINPIQRDLLRKILVSDPTKRLNIRNIEKHEWL 307

>SAKL0H07084g Chr8 complement(619288..622047) [2760 bp, 919 aa] {ON}
           weakly similar to uniprot|Q03002 Saccharomyces
           cerevisiae YPL141C Hypothetical ORF
          Length = 919

 Score =  196 bits (498), Expect = 7e-51,   Method: Compositional matrix adjust.
 Identities = 106/287 (36%), Positives = 163/287 (56%), Gaps = 11/287 (3%)

Query: 9   YRITKPLNIIGPWKLGETLGFGSTGKVQLARHERTGQKTAVKVIPKSIFKSEGSHGNNDS 68
           YR  +     GP+ +G TLG G  GKV+L   + TG     K +   + + +    N+D 
Sbjct: 32  YRHKRKQVTFGPYIVGSTLGEGEFGKVKLGWSKTTGSNEVPKQVAIKLIRRDTVPKNSDK 91

Query: 69  VLPFNIEREIVIMKLLSHPNVLSLYDVWETDNNLYLILEYAEKGELFNLLVDRGPLPERE 128
            +   I REI  +K L+HPN++ L +V +    + ++LEYA  GE +  +  +  L E  
Sbjct: 92  EV--KIYREINALKHLTHPNIVRLEEVLQNSKYIGIVLEYASGGEFYRYIQKKRRLKEHA 149

Query: 129 AIKCFKQIIIAISYCHALGIVHRDLKPENLLLDNSYNIKIADFGMA-ALQTDAGMLETSC 187
           A + F Q+I  + Y H+ G+VHRDLK ENLLLD + N+ I DFG          +++TSC
Sbjct: 150 ACRLFAQLISGVHYMHSKGLVHRDLKLENLLLDKNENLLITDFGFVNEFNHKNELMKTSC 209

Query: 188 GSPHYAAPE-IVSGLPYEGFASDVWSCGVILFALLTGRLPFDEENGN-----VRDLLLKV 241
           GSP YAAPE +V+  PYE   +D+WSCGVI++A+L G LP+D+++ N     +  L   +
Sbjct: 210 GSPCYAAPELVVTTKPYEARKADIWSCGVIMYAMLAGYLPWDDDSENPEGDDIAKLYHYI 269

Query: 242 QKGQFEMPNNAEISGDAQDLIRRILVVDPTQRIKIRDILSHPLLKKY 288
            K   + P    I+   +DL+RRILV +P +R+ +R +  H  L+ +
Sbjct: 270 TKTPLKFPE--YINPVPRDLLRRILVSNPKKRLNLRQVEQHQWLQPH 314

>Kpol_1072.29 s1072 complement(61987..64668) [2682 bp, 893 aa] {ON}
           complement(61987..64668) [2682 nt, 894 aa]
          Length = 893

 Score =  195 bits (496), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 106/280 (37%), Positives = 161/280 (57%), Gaps = 14/280 (5%)

Query: 18  IGPWKLGETLGFGSTGKVQLA--RHERTGQKTAVKVIPKSIFKSEGSHGNNDSVLPFNIE 75
            GP+ +G TLG G  GKV+L   R+  + Q+ + +V  K I + +    +   +  F   
Sbjct: 41  FGPYYIGSTLGEGEFGKVKLGWTRNPTSNQEVSKQVAIKLIRRDKIVKNSEKEIKIF--- 97

Query: 76  REIVIMKLLSHPNVLSLYDVWETDNNLYLILEYAEKGELFNLLVDRGPLPEREAIKCFKQ 135
           REI  +K L+HPN++ L +V +    + ++LEYA  GE +  +  +  L E    + F Q
Sbjct: 98  REINALKHLTHPNIVKLEEVLQNSKYIGIVLEYASGGEFYRYIQRKRRLKETAGCRLFTQ 157

Query: 136 IIIAISYCHALGIVHRDLKPENLLLDNSYNIKIADFGMA-ALQTDAGMLETSCGSPHYAA 194
           ++  ++Y H+ G+VHRDLK ENLLLD   N+ I DFG       D  +++TSCGSP YAA
Sbjct: 158 LVSGVNYMHSKGLVHRDLKLENLLLDKHENLVITDFGFVNEFLKDNDLMKTSCGSPCYAA 217

Query: 195 PEIV-SGLPYEGFASDVWSCGVILFALLTGRLPFDE-----ENGNVRDLLLKVQKGQFEM 248
           PE+V S  PYE   +D+WSCG+IL+A+L G LP+D+     E  ++  L   + +   + 
Sbjct: 218 PELVISTKPYEARKADIWSCGIILYAMLAGYLPWDDDPQNPEGDDIARLYYFITRTSLKF 277

Query: 249 PNNAEISGDAQDLIRRILVVDPTQRIKIRDILSHPLLKKY 288
           P    IS   +DL+RR+LV DP +R+ IR I  H  L+ +
Sbjct: 278 P--EYISPIPRDLLRRLLVSDPRKRLNIRQIQQHEWLRPH 315

>TDEL0A06000 Chr1 (1053427..1055799) [2373 bp, 790 aa] {ON}
           Anc_8.654 YPL141C
          Length = 790

 Score =  194 bits (493), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 107/278 (38%), Positives = 157/278 (56%), Gaps = 11/278 (3%)

Query: 18  IGPWKLGETLGFGSTGKVQLARHERTGQKTAVKVIPKSIFKSEGSHGNNDSVLPFNIERE 77
            GP+ LG TLG G  G+V+L   + T      K +   + + +    N+D  +   I RE
Sbjct: 41  FGPYILGSTLGEGEFGRVKLGWSKNTSPNEVSKQVAIKLIRRDTIPKNSDKEI--KIYRE 98

Query: 78  IVIMKLLSHPNVLSLYDVWETDNNLYLILEYAEKGELFNLLVDRGPLPEREAIKCFKQII 137
           I  +K LSHPN++ L +V +    + ++LEYA  GE +  +  +  L E  A + F Q+I
Sbjct: 99  INALKHLSHPNIVKLEEVLQNSKYIGIVLEYASGGEFYKYIQKKRRLKEAVACRLFAQLI 158

Query: 138 IAISYCHALGIVHRDLKPENLLLDNSYNIKIADFGMA-ALQTDAGMLETSCGSPHYAAPE 196
             + Y H+ G+VHRDLK ENLLLD   N+ I DFG        + +++TSCGSP YAAPE
Sbjct: 159 SGVQYMHSKGLVHRDLKLENLLLDKHENLVITDFGFVNEFFAHSELMKTSCGSPCYAAPE 218

Query: 197 -IVSGLPYEGFASDVWSCGVILFALLTGRLPFDEENGN-----VRDLLLKVQKGQFEMPN 250
            +VS  PYE   +D+WSCGVIL+A+L G LP+D++  N     +  L   + +   + P 
Sbjct: 219 LVVSSKPYEARKADIWSCGVILYAMLAGYLPWDDDTKNPDGNDIGKLYQYITRTPLKFPE 278

Query: 251 NAEISGDAQDLIRRILVVDPTQRIKIRDILSHPLLKKY 288
              I+   +DL+RRIL  DP +RI +R I  H  +K +
Sbjct: 279 --YITPLPRDLLRRILYPDPKRRISMRSIQKHEWVKPH 314

>KAFR0A03730 Chr1 (761946..764312) [2367 bp, 788 aa] {ON} Anc_8.654
           YPL141C
          Length = 788

 Score =  194 bits (492), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 113/288 (39%), Positives = 169/288 (58%), Gaps = 25/288 (8%)

Query: 18  IGPWKLGETLGFGSTGKVQLA---RHERT--GQKTAVKVIPK-SIFKSEGSHGNNDSVLP 71
            GP+ +G TLG G  GKV+L    ++E T   ++ A+K+I + SI +        D    
Sbjct: 31  FGPYIVGSTLGKGEFGKVKLGWSRKNESTDISKQVAIKLIRRDSILQ--------DREKE 82

Query: 72  FNIEREIVIMKLLSHPNVLSLYDVWETDNNLYLILEYAEKGELFNLLVDRGPLPEREAIK 131
             I REI  +K L+HPN++ L +V +    + ++LEYA  GE +  +  +  L E  A K
Sbjct: 83  IKIYREINALKHLTHPNIVRLEEVLQNSKYIGIVLEYASGGEFYKYIQKKRRLKEPIACK 142

Query: 132 CFKQIIIAISYCHALGIVHRDLKPENLLLDNSYNIKIADFGMAA--LQTDAGMLETSCGS 189
            F Q++  + Y H+ G+VHRDLK ENLLLD + N+ I DFG     LQ +  +++TSCGS
Sbjct: 143 LFAQLVSGVYYMHSKGLVHRDLKLENLLLDKNENLIITDFGFVNEFLQNNE-LMKTSCGS 201

Query: 190 PHYAAPE-IVSGLPYEGFASDVWSCGVILFALLTGRLPFDEENGNVR-----DLLLKVQK 243
           P YAAPE +V+  PY+   +DVWSCG+ILFA+L G LP+D++  N R      L   +  
Sbjct: 202 PCYAAPELVVTSNPYKARKADVWSCGIILFAMLAGYLPWDDDPDNPRGDDIAKLYNYITT 261

Query: 244 GQFEMPNNAEISGDAQDLIRRILVVDPTQRIKIRDILSHPLLKKYQTI 291
              + P  + IS   +DL+R+ILV +P QR+ +R+I +H  LK + + 
Sbjct: 262 SPLKFP--SYISAIPRDLLRKILVANPNQRLSLREIETHQWLKPHSSF 307

>TPHA0J00820 Chr10 (193408..197064) [3657 bp, 1218 aa] {ON}
           Anc_8.279 YLR096W
          Length = 1218

 Score =  195 bits (496), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 103/288 (35%), Positives = 167/288 (57%), Gaps = 22/288 (7%)

Query: 18  IGPWKLGETLGFGSTGKVQLARHERTGQKTAVKVI---PKSIFKSEGS---HGNNDSVLP 71
           +G W   ET+G GS GKV+LARH +T +  A+K++    KS  + E S     + +  L 
Sbjct: 151 LGDWDFLETVGAGSMGKVKLARHHKTNEVCAIKIVNRATKSFLQKEASLPPPKSEEEALE 210

Query: 72  F--NIEREIV----------IMKLLSHPNVLSLYDVWETDNNLYLILEYAEKGELFNLLV 119
              N+E+EI           + ++L HP++  L+++    N+ Y++ EY   G+L + ++
Sbjct: 211 RQKNLEKEISRDKRTIREASLGQILYHPHICRLFEICTMSNHFYMLFEYVSGGQLLDYII 270

Query: 120 DRGPLPEREAIKCFKQIIIAISYCHALGIVHRDLKPENLLLDNSYNIKIADFGMAALQTD 179
             G L E  A K  + I  A+ Y H   IVHRDLK EN+++  S +IKI DFG++ L   
Sbjct: 271 QHGSLREHHARKFTRGIASALQYLHGNNIVHRDLKIENIMISTSGDIKIIDFGLSNLYDS 330

Query: 180 AGMLETSCGSPHYAAPEIVSGLPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRDLLL 239
              L T CGS ++AAPE++   PY G   D+WS GV+L+ L  G++PFD+EN +V  L  
Sbjct: 331 KKQLNTFCGSLYFAAPELLKANPYVGPEVDIWSFGVVLYVLACGKVPFDDENSSV--LHE 388

Query: 240 KVQKGQFEMPNNAEISGDAQDLIRRILVVDPTQRIKIRDILSHPLLKK 287
           K+++G+ + P +  I  +   L+ ++LVVDP +R  ++ I++HP + +
Sbjct: 389 KIKQGKVDYPQHLSI--EVISLLSKMLVVDPKKRASLQQIVNHPWMTR 434

>NDAI0E02320 Chr5 (480203..483001) [2799 bp, 932 aa] {ON} 
          Length = 932

 Score =  193 bits (491), Expect = 5e-50,   Method: Compositional matrix adjust.
 Identities = 108/288 (37%), Positives = 162/288 (56%), Gaps = 26/288 (9%)

Query: 18  IGPWKLGETLGFGSTGKVQLARHER----------TGQKTAVKVIPKSIFKSEGSHGNND 67
            GP+ +G T+G G  GKV+L   +             ++ A+K+I +          + D
Sbjct: 66  FGPYIIGSTIGQGEFGKVKLGWSKNPPSSPPNNLGISKQVAIKLIKRDAI-------SKD 118

Query: 68  SVLPFNIEREIVIMKLLSHPNVLSLYDVWETDNNLYLILEYAEKGELFNLLVDRGPLPER 127
           S     I REI  +K LSHPN++ L +V +    + ++LEYA  GE +  +  +  L E 
Sbjct: 119 SSKELKIYREINALKHLSHPNIVKLEEVLQNSRYIGIVLEYASGGEFYRYIQRKKRLKET 178

Query: 128 EAIKCFKQIIIAISYCHALGIVHRDLKPENLLLDNSYNIKIADFGMA-ALQTDAGMLETS 186
            A + F Q+I  + Y H+ G+VHRDLK ENLLLD   N+ I DFG      +   +++TS
Sbjct: 179 AACRLFAQLINGVHYIHSKGLVHRDLKLENLLLDKHENLVITDFGFVNEFYSHNELMKTS 238

Query: 187 CGSPHYAAPEIV-SGLPYEGFASDVWSCGVILFALLTGRLPFDEENGN-----VRDLLLK 240
           CGSP YAAPE+V S  PYE   +D+WSCG+IL+A+L G LP+D+++GN     +  L   
Sbjct: 239 CGSPCYAAPELVISTKPYEARKADIWSCGIILYAMLAGYLPWDDDSGNPDGDDISRLYYY 298

Query: 241 VQKGQFEMPNNAEISGDAQDLIRRILVVDPTQRIKIRDILSHPLLKKY 288
           + K   + P+   I+   +DL+R+ILV DP +RI ++ I  H  LK +
Sbjct: 299 ITKTPLKFPD--YINPIPRDLLRKILVSDPRRRITMKQIEKHEWLKPH 344

>NCAS0C01590 Chr3 (293327..295921) [2595 bp, 864 aa] {ON} Anc_8.654
          Length = 864

 Score =  192 bits (488), Expect = 7e-50,   Method: Compositional matrix adjust.
 Identities = 109/291 (37%), Positives = 163/291 (56%), Gaps = 26/291 (8%)

Query: 18  IGPWKLGETLGFGSTGKVQLARHERT----------GQKTAVKVIPKSIFKSEGSHGNND 67
            GP+ +G TLG G  GKV+L   + +           ++ A+K+I +          + D
Sbjct: 45  FGPYIIGSTLGEGEFGKVKLGWPKNSLPSSSSGIDVPKQVAIKLIRRDTI-------SKD 97

Query: 68  SVLPFNIEREIVIMKLLSHPNVLSLYDVWETDNNLYLILEYAEKGELFNLLVDRGPLPER 127
           S     I REI  +K L+HPN++ L +V +    + ++LEYA  GE +  +  +  L E 
Sbjct: 98  SSKEIKIYREINALKHLTHPNIVKLEEVLQNSKYIGIVLEYASGGEFYKYIQRKKRLKEG 157

Query: 128 EAIKCFKQIIIAISYCHALGIVHRDLKPENLLLDNSYNIKIADFGMAA-LQTDAGMLETS 186
            A + F Q+I  + Y H+ G+VHRDLK ENLLLD   N+ I DFG  +   +   +++TS
Sbjct: 158 PACRLFAQLINGVHYIHSKGLVHRDLKLENLLLDKHENLIITDFGFVSEFYSHGELMKTS 217

Query: 187 CGSPHYAAPE-IVSGLPYEGFASDVWSCGVILFALLTGRLPFDEENGN-----VRDLLLK 240
           CGSP YAAPE +VS  PYE   +D+WSCGVIL+A+L G LP+D++ GN     +  L   
Sbjct: 218 CGSPCYAAPELVVSTKPYEAKKADIWSCGVILYAMLAGYLPWDDDAGNPDGDDISRLYHY 277

Query: 241 VQKGQFEMPNNAEISGDAQDLIRRILVVDPTQRIKIRDILSHPLLKKYQTI 291
           + +   + P+   I+   +DL+RRIL+ DP +RI I+ I  H  LK +   
Sbjct: 278 ITQTPLKFPD--YINPIPRDLLRRILISDPRRRITIKYIEKHEWLKPHSAF 326

>NDAI0B02070 Chr2 (514024..517800) [3777 bp, 1258 aa] {ON} 
          Length = 1258

 Score =  194 bits (493), Expect = 8e-50,   Method: Compositional matrix adjust.
 Identities = 111/333 (33%), Positives = 181/333 (54%), Gaps = 35/333 (10%)

Query: 18  IGPWKLGETLGFGSTGKVQLARHERTGQKTAVKVIPKSIF------------KSEGSHGN 65
           +G W   ET+G GS GKV+LA+H +T +  A+K++ ++              K+E     
Sbjct: 161 LGDWDFLETVGAGSMGKVKLAKHHQTQEICAIKIVNRATKAFLHKEQSMPPPKNEQEIAE 220

Query: 66  NDSVLPFNIER------EIVIMKLLSHPNVLSLYDVWETDNNLYLILEYAEKGELFNLLV 119
               L   I R      E  + ++L HP++  L+++    N+ Y++ EY   G+L + ++
Sbjct: 221 RQKRLEKEISRDKRTVREASLGQILYHPHICRLFEMCTMSNHFYMLFEYVSGGQLLDYII 280

Query: 120 DRGPLPEREAIKCFKQIIIAISYCHALGIVHRDLKPENLLLDNSYNIKIADFGMAALQTD 179
             G L E  A K  + I  A+ Y H   IVHRDLK EN+++ NS  IKI DFG++ +  +
Sbjct: 281 QHGSLREHHARKFARGIASALQYLHLNNIVHRDLKIENIMISNSGEIKIIDFGLSNVFDN 340

Query: 180 AGMLETSCGSPHYAAPEIVSGLPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRDLLL 239
              L T CGS ++AAPE++   PY G   DVWS G++L+ L+ G++PFD+EN +V  L  
Sbjct: 341 RKQLHTFCGSLYFAAPELLKAHPYTGPEVDVWSFGIVLYVLVCGKVPFDDENSSV--LHE 398

Query: 240 KVQKGQFEMPNNAEISGDAQDLIRRILVVDPTQRIKIRDILSHPLLKKYQTIKDSKSIKD 299
           K+++G+ E PN+  I  +   L+ +++VVDP +R  +R ++ HP + +     D   +  
Sbjct: 399 KIRQGKVEYPNHLSI--EVISLLSKMIVVDPAKRASLRQVVEHPWMTRGY---DFPPLSY 453

Query: 300 LPRENTYLYPLADADNHTSVTIDDSILQNLVIL 332
           LPR      PL      T   ID+++L+ +  L
Sbjct: 454 LPRR----IPL------TPEAIDNNVLREMFRL 476

>Kpol_1012.6 s1012 (11581..13467) [1887 bp, 628 aa] {ON}
           (11581..13467) [1887 nt, 629 aa]
          Length = 628

 Score =  189 bits (479), Expect = 9e-50,   Method: Compositional matrix adjust.
 Identities = 107/286 (37%), Positives = 157/286 (54%), Gaps = 24/286 (8%)

Query: 18  IGPWKLGETLGFGSTGKVQLARHER--------TGQKTAVKVIPKSIFKSEGSHGNNDSV 69
            GP+ LG T+G G  GKV+     +         G++ A+K+I +     +         
Sbjct: 52  FGPYYLGSTIGEGEFGKVKSGWSRKPQNDNGLTIGKQVAIKLIRRDTLAEKKDQE----- 106

Query: 70  LPFNIEREIVIMKLLSHPNVLSLYDVWETDNNLYLILEYAEKGELFNLLVDRGPLPEREA 129
               + REI  +KLLSHPN++ L DV +    + ++LEYA  GE +  L  +  L E  A
Sbjct: 107 --LKVYREINALKLLSHPNIVKLEDVLQNSKYIGIVLEYASGGEFYKYLQRKKRLKEPLA 164

Query: 130 IKCFKQIIIAISYCHALGIVHRDLKPENLLLDNSYNIKIADFGMA-ALQTDAGMLETSCG 188
              F Q+I  ++Y H+ G+VHRDLK ENLLLD   N+ I DFG    + T+  +++T CG
Sbjct: 165 CSTFAQLISGVAYIHSKGLVHRDLKLENLLLDKHSNLVITDFGFVNEISTNNKLMKTPCG 224

Query: 189 SPHYAAPEIV-SGLPYEGFASDVWSCGVILFALLTGRLPFDE-----ENGNVRDLLLKVQ 242
           SP YAAPE+V S  PY+   +D+WS GVIL+A+L G LP+D+     +  N+  L   + 
Sbjct: 225 SPCYAAPELVLSTKPYDARKADIWSAGVILYAMLAGYLPWDDDPENPDGSNIMRLYEYIT 284

Query: 243 KGQFEMPNNAEISGDAQDLIRRILVVDPTQRIKIRDILSHPLLKKY 288
           K   + P+   I   A+DLIR+ILV+ P  R+ I  +  H  LK +
Sbjct: 285 KNNLKFPD--YIEPLARDLIRKILVIQPKSRLNIVQVQQHEWLKPH 328

>NDAI0J01250 Chr10 complement(291314..294844) [3531 bp, 1176 aa]
           {ON} 
          Length = 1176

 Score =  193 bits (491), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 108/309 (34%), Positives = 179/309 (57%), Gaps = 29/309 (9%)

Query: 18  IGPWKLGETLGFGSTGKVQLARHERTGQKTAVKVIPKS--IFKSEGS----HGNNDSVL- 70
           +G W   ET+G GS GKV+LAR+ +T +  A+K++ ++  IF ++ S    H  N  ++ 
Sbjct: 94  LGEWDFIETVGAGSMGKVKLARNRQTREVCAIKIVNRATKIFLTKESKLMSHPTNHIIMN 153

Query: 71  -------PFNIEREIV----------IMKLLSHPNVLSLYDVWETDNNLYLILEYAEKGE 113
                     +E+EI           + ++L HP++  L++++   N+ Y++ EY   G+
Sbjct: 154 EKDILDRQKRLEKEISRDRRTIREASLGQILYHPHICRLFEMYTLSNHFYMLFEYVSGGQ 213

Query: 114 LFNLLVDRGPLPEREAIKCFKQIIIAISYCHALGIVHRDLKPENLLLDNSYNIKIADFGM 173
           L + ++  G L E  A    +QI+ A+ Y HA  IVHRDLK EN+++ ++ NIKI DFG+
Sbjct: 214 LLDYIIQHGSLKESHARNFARQILSALKYLHANNIVHRDLKIENIMISSNGNIKIIDFGL 273

Query: 174 AALQTDAGMLETSCGSPHYAAPEIVSGLPYEGFASDVWSCGVILFALLTGRLPFDEENGN 233
           + L   +  L+T CGS ++AAPE++   PY G   DVWS GV+L+ L+ G++PFD+EN N
Sbjct: 274 SNLYDKSKKLKTYCGSLYFAAPELLRANPYIGPEIDVWSFGVVLYVLVCGKVPFDDENSN 333

Query: 234 VRDLLLKVQKGQFEMPNNAEISGDAQDLIRRILVVDPTQRIKIRDILSHP-LLKKYQTIK 292
           V  L  K+++G+   P    I  +   L+  +LVVDP +R  +  ++ H  ++K Y +I 
Sbjct: 334 V--LHEKIKQGRVFYPQFLSI--EVISLLSTMLVVDPFKRATLDQVMKHHWMVKDYDSIP 389

Query: 293 DSKSIKDLP 301
           D+   K +P
Sbjct: 390 DAHLPKRVP 398

>Skud_4.383 Chr4 (666354..669551) [3198 bp, 1065 aa] {ON} YDR122W
           (REAL)
          Length = 1065

 Score =  193 bits (490), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 104/283 (36%), Positives = 162/283 (57%), Gaps = 22/283 (7%)

Query: 18  IGPWKLGETLGFGSTGKVQLARHERTGQKTAVKVI---PKSIFKSEG---SHGNNDSVLP 71
           +G W+  ET+G GS GKV+LARH RT +  AVK++    K+    E       N   VL 
Sbjct: 115 LGDWEFIETVGAGSMGKVKLARHRRTNEVCAVKIVNRATKAFLHKEQMLPPPKNEQDVLE 174

Query: 72  FNIE------------REIVIMKLLSHPNVLSLYDVWETDNNLYLILEYAEKGELFNLLV 119
              +            RE  + ++L HP++  L+++    N+ Y++ EY   G+L + ++
Sbjct: 175 RQKKLEKEISRDKRTIREASLGQILYHPHICRLFEMCTLSNHFYMLFEYVSGGQLLDYII 234

Query: 120 DRGPLPEREAIKCFKQIIIAISYCHALGIVHRDLKPENLLLDNSYNIKIADFGMAALQTD 179
             G + E +A K  + I  A+ Y HA  IVHRDLK EN+++ +S  IKI DFG++ L   
Sbjct: 235 QHGSIREHQAKKFARGIASALMYLHANNIVHRDLKIENIMISDSSEIKIIDFGLSNLYDS 294

Query: 180 AGMLETSCGSPHYAAPEIVSGLPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRDLLL 239
              L T CGS ++AAPE++   PY G   DVWS GV+LF L+ G++PFD+EN +V  L  
Sbjct: 295 RKQLYTFCGSLYFAAPELLKANPYTGPEVDVWSFGVVLFVLVCGKVPFDDENSSV--LHE 352

Query: 240 KVQKGQFEMPNNAEISGDAQDLIRRILVVDPTQRIKIRDILSH 282
           K+++G+ E P +  I  +   L+ ++LVVDP +R  ++ ++ H
Sbjct: 353 KIKQGKVEYPQHLSI--EVISLLSKMLVVDPKRRATLKQVVEH 393

>AGR058W Chr7 (823626..826841) [3216 bp, 1071 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YLR096W (KIN2) and
           YDR122W (KIN1)
          Length = 1071

 Score =  193 bits (490), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 105/310 (33%), Positives = 170/310 (54%), Gaps = 28/310 (9%)

Query: 1   MAVANMETYRITKPLN--IIGPWKLGETLGFGSTGKVQLARHERTGQKTAVKVIPKSIFK 58
           M  A  E  R+ KP +   +G W   ET+G GS GKV+LA+H  T +  A+K++ ++  K
Sbjct: 32  MGKAGEEERRMPKPFHRKSLGDWDFLETVGAGSMGKVKLAKHRYTNELCAIKIVNRAT-K 90

Query: 59  SEGSHGNNDSVLPFNIE---------------------REIVIMKLLSHPNVLSLYDVWE 97
           S         + P   E                     RE  + ++L HP++  L+++  
Sbjct: 91  SFMHKQQLQGLPPPATEEELLERRKKLEKEVSRDKRTIREASLGQILYHPHICRLFEMCT 150

Query: 98  TDNNLYLILEYAEKGELFNLLVDRGPLPEREAIKCFKQIIIAISYCHALGIVHRDLKPEN 157
             N+ Y++ EY   G+L + ++  G L ER A K  + I  A+ Y H   IVHRDLK EN
Sbjct: 151 MSNHFYMLFEYVSGGQLLDYIIQHGSLRERHARKFARGIASALQYLHLNNIVHRDLKIEN 210

Query: 158 LLLDNSYNIKIADFGMAALQTDAGMLETSCGSPHYAAPEIVSGLPYEGFASDVWSCGVIL 217
           +++ +S  I+I DFG++ +      L T CGS ++AAPE++   PY G   D+WS GV+L
Sbjct: 211 IMISSSGEIRIIDFGLSNMYDPKKQLHTFCGSLYFAAPELLKAHPYTGPEVDIWSFGVVL 270

Query: 218 FALLTGRLPFDEENGNVRDLLLKVQKGQFEMPNNAEISGDAQDLIRRILVVDPTQRIKIR 277
           + L+ G++PFD+EN +V  L  K+++G+ E P +  I  D   L+ ++LVVDP +R  ++
Sbjct: 271 YVLVCGKVPFDDENASV--LHEKIKQGKVEYPQHLSI--DVISLLSKMLVVDPYKRATLK 326

Query: 278 DILSHPLLKK 287
            ++ H  ++K
Sbjct: 327 QVVHHQWMQK 336

>Smik_15.417 Chr15 (725513..727933) [2421 bp, 806 aa] {ON} YOR233W
           (REAL)
          Length = 806

 Score =  191 bits (484), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 108/286 (37%), Positives = 160/286 (55%), Gaps = 21/286 (7%)

Query: 18  IGPWKLGETLGFGSTGKVQLARHERTG-----QKTAVKVIPKSIFKSEGSHGNNDSVLPF 72
            GP+ +G TLG G  GKV+L   + +      ++ A+K+I +   K        D+    
Sbjct: 43  FGPYIIGSTLGEGEFGKVKLGWTKASSPTEVPKQVAIKLIRRDTIKK-------DADKEV 95

Query: 73  NIEREIVIMKLLSHPNVLSLYDVWETDNNLYLILEYAEKGELFNLLVDRGPLPEREAIKC 132
            I REI  +K L+HPN++ L +V +    + ++LE+   GE +  +  +  L E  A + 
Sbjct: 96  KIYREINALKHLTHPNIIYLEEVLQNSKYIGIVLEFVSGGEFYKYIQRKRRLKESSACRL 155

Query: 133 FKQIIIAISYCHALGIVHRDLKPENLLLDNSYNIKIADFGMA-ALQTDAGMLETSCGSPH 191
           F Q+I  ++Y H  G+VHRDLK ENLLLD   N+ I DFG       D  ++ TSCGSP 
Sbjct: 156 FAQLISGVNYMHYKGLVHRDLKLENLLLDKHENLVITDFGFVNEFFKDNELMNTSCGSPC 215

Query: 192 YAAPE-IVSGLPYEGFASDVWSCGVILFALLTGRLPFDEENGN-----VRDLLLKVQKGQ 245
           YAAPE +VS  PYE   +DVWSCGVIL+A+L G LP+D+++ N     +  L   + +  
Sbjct: 216 YAAPELVVSTKPYEARKADVWSCGVILYAMLAGYLPWDDDHENPTGDDIARLYQYITQTP 275

Query: 246 FEMPNNAEISGDAQDLIRRILVVDPTQRIKIRDILSHPLLKKYQTI 291
            + P    I+   +DL+RRILV +P +R+ +R I  H  LK + T 
Sbjct: 276 LKFP--EYITPVPRDLLRRILVPNPRRRVSLRSIERHEWLKPHYTF 319

>NCAS0B03740 Chr2 complement(668231..671380) [3150 bp, 1049 aa] {ON}
           Anc_8.279
          Length = 1049

 Score =  192 bits (488), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 103/288 (35%), Positives = 165/288 (57%), Gaps = 27/288 (9%)

Query: 18  IGPWKLGETLGFGSTGKVQLARHERTGQKTAVKVIPKS--IFKS-EGSHGNNDSVLPF-- 72
           +G W   ET+G GS GKV+LA++ RT +  A+K++ ++  IF S E +  +N   +P   
Sbjct: 68  LGDWDFVETVGAGSMGKVKLAKNRRTNEVCAIKIVNRATKIFLSKEYAAKHNGYTIPLSE 127

Query: 73  --------NIE----------REIVIMKLLSHPNVLSLYDVWETDNNLYLILEYAEKGEL 114
                   N+E          RE  + ++L HP++  LY++    N+ Y++ EY   G+L
Sbjct: 128 KEVIERQKNLEKEASRDKRTVREASLGQILYHPHICRLYEMHTLSNHFYMLFEYVSGGQL 187

Query: 115 FNLLVDRGPLPEREAIKCFKQIIIAISYCHALGIVHRDLKPENLLLDNSYNIKIADFGMA 174
            + ++  G L E  A    +QI  A+ Y H+  IVHRDLK EN+++    NIK+ DFG++
Sbjct: 188 LDYIIQHGSLKESRARTFTRQICSALKYLHSHNIVHRDLKIENIMISKDGNIKLIDFGLS 247

Query: 175 ALQTDAGMLETSCGSPHYAAPEIVSGLPYEGFASDVWSCGVILFALLTGRLPFDEENGNV 234
            L      L+T CGS ++AAPE++   PY G   DVWS GV+L+ L+ G++PFD+EN NV
Sbjct: 248 NLYDKCNKLKTYCGSLYFAAPELLKATPYIGPEIDVWSFGVVLYVLVCGKVPFDDENSNV 307

Query: 235 RDLLLKVQKGQFEMPNNAEISGDAQDLIRRILVVDPTQRIKIRDILSH 282
             L  K+++G+   P    I  +   L+ ++LVVDP +R  +  +++H
Sbjct: 308 --LHEKIKQGKVFYPQFLSI--EVISLLSKMLVVDPFKRATLDQVMNH 351

>ZYRO0F06842g Chr6 (561269..563800) [2532 bp, 843 aa] {ON} similar
           to Saccharomyces cerevisiae YPL141C and to YOR233W
           uniprot|Q01919 Saccharomyces cerevisiae YOR233W KIN4
           Nonessential protein kinase with unknown cellular role
          Length = 843

 Score =  191 bits (484), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 110/279 (39%), Positives = 162/279 (58%), Gaps = 12/279 (4%)

Query: 18  IGPWKLGETLGFGSTGKVQLARHERTGQKTAV-KVIPKSIFKSEGSHGNNDSVLPFNIER 76
            GP+ +G TLG G  GKV+L   +       V K +   + + +    N++  +   I R
Sbjct: 36  FGPYIVGSTLGEGEFGKVKLGWSKAASSSLEVPKQVAIKLIRRDSIPKNSEKEV--KIYR 93

Query: 77  EIVIMKLLSHPNVLSLYDVWETDNNLYLILEYAEKGELFNLLVDRGPLPEREAIKCFKQI 136
           EI  +K LSHPN++ L +V +    + ++LEYA  GE +  +  +  L E  A + F Q+
Sbjct: 94  EINALKHLSHPNIVKLEEVLQNSKYIGIVLEYASGGEFYKYIQRKRRLKEAIACRLFAQL 153

Query: 137 IIAISYCHALGIVHRDLKPENLLLDNSYNIKIADFGMA-ALQTDAGMLETSCGSPHYAAP 195
           +  ++Y H+ G+VHRDLK ENLLLD   N+ I DFG      +   +++TSCGSP YAAP
Sbjct: 154 VSGVNYMHSKGLVHRDLKLENLLLDKHENLVITDFGFVNEFVSHNELMKTSCGSPCYAAP 213

Query: 196 E-IVSGLPYEGFASDVWSCGVILFALLTGRLPFDEE----NGN-VRDLLLKVQKGQFEMP 249
           E +VS  PYE   SDVWSCGVIL+A+L G LP+D++    +GN +  L   + +   + P
Sbjct: 214 ELVVSTKPYEARKSDVWSCGVILYAMLAGYLPWDDDPKNPDGNDIVRLYYYITRTPLKFP 273

Query: 250 NNAEISGDAQDLIRRILVVDPTQRIKIRDILSHPLLKKY 288
               I+  ++DL+RRILV DP +RI +R I  H  LK +
Sbjct: 274 E--YITPLSRDLLRRILVSDPKKRITLRSIHKHEWLKPH 310

>NCAS0B05090 Chr2 (946126..949758) [3633 bp, 1210 aa] {ON} 
          Length = 1210

 Score =  192 bits (488), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 99/291 (34%), Positives = 166/291 (57%), Gaps = 28/291 (9%)

Query: 18  IGPWKLGETLGFGSTGKVQLARHERTGQKTAVKVIPKSIFKSEGSHGNNDSVLPFNIERE 77
           +G W   ET+G GS GKV+LARH +T +  A+K++ +++   +       S+ P   E+E
Sbjct: 159 LGDWDFLETVGAGSMGKVKLARHHQTKEICAIKIVNRAM---KAFLHKEQSMPPPRTEQE 215

Query: 78  IV---------------------IMKLLSHPNVLSLYDVWETDNNLYLILEYAEKGELFN 116
           ++                     + ++L HP++  L+++    N+ Y++ EY   G+L +
Sbjct: 216 VLERQKKLEKEISRDKRTIREASLGQVLYHPHICRLFEMCTMSNHFYMLFEYVSGGQLLD 275

Query: 117 LLVDRGPLPEREAIKCFKQIIIAISYCHALGIVHRDLKPENLLLDNSYNIKIADFGMAAL 176
            ++  G L E  A K  + I  A+ Y HA  IVHRDLK EN+++  S  IKI DFG++ +
Sbjct: 276 YIIQHGSLREHHARKFARGIASALEYIHANNIVHRDLKIENIMISTSGEIKIIDFGLSNV 335

Query: 177 QTDAGMLETSCGSPHYAAPEIVSGLPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRD 236
                 L T CGS ++AAPE++   PY G   DVWS GV+L+ L+ G++PFD+EN +V  
Sbjct: 336 FDRKKQLHTFCGSLYFAAPELLKAHPYTGPEVDVWSFGVVLYVLVCGKVPFDDENSSV-- 393

Query: 237 LLLKVQKGQFEMPNNAEISGDAQDLIRRILVVDPTQRIKIRDILSHPLLKK 287
           L  K+++G+ + PN+  I  +   L+ ++LVVDP +R  ++ ++ HP + +
Sbjct: 394 LHEKIKQGKVDYPNHLSI--EVISLLSKMLVVDPLRRASLKQVVEHPWMTR 442

>SAKL0H16632g Chr8 complement(1461613..1464801) [3189 bp, 1062 aa]
           {ON} similar to uniprot|P13186 Saccharomyces cerevisiae
           YLR096W KIN2 Serine/threonine protein kinase involved in
           regulation of exocytosis localizes to the cytoplasmic
           face of the plasma membrane closely related to Kin1p and
           to YDR122W uniprot|P13185 Saccharomyces cerevisiae
           YDR122W KIN1 Serine/threonine protein kinase involved in
           regulation of exocytosis; localizes to the cytoplasmic
           face of the plasma membrane; closely related to Kin2p
          Length = 1062

 Score =  192 bits (487), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 102/288 (35%), Positives = 163/288 (56%), Gaps = 22/288 (7%)

Query: 18  IGPWKLGETLGFGSTGKVQLARHERTGQKTAVKVIPKSIF------------KSEGSHGN 65
           +G W   ET+G GS GKV+LARH  T +  A+K++ ++              KSE     
Sbjct: 76  LGDWDFLETVGAGSMGKVKLARHRYTSEICAIKIVNRAAKSFVHKQQQMTPPKSEQEALE 135

Query: 66  NDSVLPFNIER------EIVIMKLLSHPNVLSLYDVWETDNNLYLILEYAEKGELFNLLV 119
               L   I R      E  + ++L HP++  L+++    N+ Y++ EY   G+L + ++
Sbjct: 136 RKRKLEKEISRDKRTIREASLGQILYHPHICRLFEMCTMSNHFYMLFEYVSGGQLLDYII 195

Query: 120 DRGPLPEREAIKCFKQIIIAISYCHALGIVHRDLKPENLLLDNSYNIKIADFGMAALQTD 179
             G L ER A K  + I  A+ Y H   IVHRDLK EN+++  S  IKI DFG++ +   
Sbjct: 196 QHGSLRERHARKFARGIASALQYLHMNNIVHRDLKIENIMISTSGEIKIIDFGLSNMYDP 255

Query: 180 AGMLETSCGSPHYAAPEIVSGLPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRDLLL 239
              L T CGS ++AAPE++   PY G   DVWS GV+L+ L+ G++PFD+EN +V  L  
Sbjct: 256 KKQLHTFCGSLYFAAPELLKAHPYIGPEVDVWSFGVVLYVLVCGKVPFDDENASV--LHE 313

Query: 240 KVQKGQFEMPNNAEISGDAQDLIRRILVVDPTQRIKIRDILSHPLLKK 287
           K+++G+ E P +  I  +   L+ ++LVVDP++R  ++ ++SH  +++
Sbjct: 314 KIKQGKVEYPQHLSI--EVISLLSKMLVVDPSKRATLKQVVSHQWMQR 359

>CAGL0M02299g Chr13 (273725..276406) [2682 bp, 893 aa] {ON} similar
           to uniprot|Q12152 Saccharomyces cerevisiae YPL150w
          Length = 893

 Score =  191 bits (484), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 110/279 (39%), Positives = 152/279 (54%), Gaps = 22/279 (7%)

Query: 15  LNIIGPWKLGETLGFGSTGKVQLARHERTGQKTAVKVIPKSIFKSEGSHGNNDSVLPFNI 74
           L  +G +K+ + +G GS GKV LA H  T QK  +K   KS                 N+
Sbjct: 36  LTEVGNYKIQKQIGEGSFGKVYLATHRPTKQKVVLKTGDKS---------------DPNV 80

Query: 75  EREIVIMKLLSHPNVLSLYDVWETDNNLYLILEYAEKGELFNLLVDRGPLPEREAIKCFK 134
            RE+   +   +P +  LY+V  T+  +++ LEY    EL++ L+ +  LP  E  + F 
Sbjct: 81  VREVFYHRQFDYPYITKLYEVIVTETKVWMALEYCPGKELYDHLLSKSRLPTLECAELFA 140

Query: 135 QIIIAISYCHALGIVHRDLKPENLLLDNSYNIKIADFGMAALQTDAGMLETSCGSPHYAA 194
           QI  A+ Y H L  VHRDLK EN+LLD + N K+ DFG         +LET CG+  Y A
Sbjct: 141 QITGAVHYAHTLNCVHRDLKLENVLLDKNGNAKLTDFGFTRESMTKAVLETVCGTTVYMA 200

Query: 195 PEIVSGLPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRDLLLKVQKGQFEMPNNAE- 253
           PE++   PY+GF  D+WS GVIL+ LL G LPFDE++    DLL K QK   + P   E 
Sbjct: 201 PEMIQHKPYDGFKVDIWSLGVILYTLLCGCLPFDEDD----DLLTK-QKIINDTPVIDER 255

Query: 254 -ISGDAQDLIRRILVVDPTQRIKIRDILSHPLLKKYQTI 291
               +AQ+LI ++L  DPT+R     IL HP L+ Y T+
Sbjct: 256 ITIPEAQNLIEQLLSKDPTERPNTSAILLHPFLQPYGTL 294

>Smik_4.367 Chr4 (655941..659141) [3201 bp, 1066 aa] {ON} YDR122W
           (REAL)
          Length = 1066

 Score =  192 bits (487), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 102/283 (36%), Positives = 161/283 (56%), Gaps = 22/283 (7%)

Query: 18  IGPWKLGETLGFGSTGKVQLARHERTGQKTAVKVI---PKSIFKSEG---SHGNNDSVLP 71
           +G W+  ET+G GS GKV+LA+H  T +  AVK++    K+    E       N   VL 
Sbjct: 115 LGDWEFVETVGAGSMGKVKLAKHRYTNEVCAVKIVNRATKAFLHKEQMLPPPKNEQDVLE 174

Query: 72  FNIE------------REIVIMKLLSHPNVLSLYDVWETDNNLYLILEYAEKGELFNLLV 119
              +            RE  + ++L HP++  L+++    N+ Y++ EY   G+L + ++
Sbjct: 175 RQKKLEKEISRDKRTIREASLGQVLYHPHICRLFEMCTLSNHFYMLFEYVSGGQLLDYII 234

Query: 120 DRGPLPEREAIKCFKQIIIAISYCHALGIVHRDLKPENLLLDNSYNIKIADFGMAALQTD 179
             G + E +A K  + I  A+ Y HA  IVHRDLK EN+++ +S  IKI DFG++ L   
Sbjct: 235 QHGSIREHQARKFARGIASALMYLHANNIVHRDLKIENIMISDSSEIKIIDFGLSNLYDS 294

Query: 180 AGMLETSCGSPHYAAPEIVSGLPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRDLLL 239
              L T CGS ++AAPE++   PY G   DVWS GV+LF L+ G++PFD+EN +V  L  
Sbjct: 295 RKQLHTFCGSLYFAAPELLKAHPYTGPEVDVWSFGVVLFVLVCGKVPFDDENSSV--LHE 352

Query: 240 KVQKGQFEMPNNAEISGDAQDLIRRILVVDPTQRIKIRDILSH 282
           K+++G+ E P +  I  +   L+ ++LVVDP +R  ++ ++ H
Sbjct: 353 KIKQGKVEYPQHLSI--EVISLLSKMLVVDPKRRATLKQVVEH 393

>Suva_8.284 Chr8 (514891..517317) [2427 bp, 808 aa] {ON} YOR233W
           (REAL)
          Length = 808

 Score =  189 bits (481), Expect = 4e-49,   Method: Compositional matrix adjust.
 Identities = 113/316 (35%), Positives = 173/316 (54%), Gaps = 24/316 (7%)

Query: 18  IGPWKLGETLGFGSTGKVQLARHERTG-----QKTAVKVIPKSIFKSEGSHGNNDSVLPF 72
            GP+ +G TLG G  GKV+L   + +      ++ A+K+I +   K        D+    
Sbjct: 43  FGPYIVGSTLGEGEFGKVKLGWSKASSPNEVPKQVAIKLIRRDTIKK-------DADKEV 95

Query: 73  NIEREIVIMKLLSHPNVLSLYDVWETDNNLYLILEYAEKGELFNLLVDRGPLPEREAIKC 132
            I REI  +K L+HPN++ L +V +    + ++LE+   GE +  +  +  L E  A + 
Sbjct: 96  KIYREINALKHLTHPNIIYLEEVLQNSKYIGIVLEFVSGGEFYKYIQRKRRLKESSACRL 155

Query: 133 FKQIIIAISYCHALGIVHRDLKPENLLLDNSYNIKIADFGMA-ALQTDAGMLETSCGSPH 191
           F Q+I  ++Y H  G+VHRDLK ENLL+D   N+ I DFG       D  ++ TSCGSP 
Sbjct: 156 FAQLISGVNYMHTKGLVHRDLKLENLLMDKHENLVITDFGFVNEFFEDNELMRTSCGSPC 215

Query: 192 YAAPE-IVSGLPYEGFASDVWSCGVILFALLTGRLPFDEENGN-----VRDLLLKVQKGQ 245
           YAAPE +VS   YE   +DVWSCGVIL+A+L G LP+D+++ N     +  L   + +  
Sbjct: 216 YAAPELVVSTKAYEARKADVWSCGVILYAMLAGYLPWDDDHENPTGDDIARLYQYITQTP 275

Query: 246 FEMPNNAEISGDAQDLIRRILVVDPTQRIKIRDILSHPLLKKYQ---TIKDSKSIKDLPR 302
            + P    I+   +DL+RRILV +P +R+ +R I  H  LK +Q   +I+ +   + L +
Sbjct: 276 LKFP--EYITPIPRDLLRRILVPNPRRRVSLRAIQRHEWLKPHQAFLSIQPNYWDEQLQK 333

Query: 303 ENTYLYPLADADNHTS 318
           E+  L    D   HT+
Sbjct: 334 EHPQLAAGGDVGRHTT 349

>Suva_10.180 Chr10 (337364..340843) [3480 bp, 1159 aa] {ON} YLR096W
           (REAL)
          Length = 1159

 Score =  191 bits (485), Expect = 6e-49,   Method: Compositional matrix adjust.
 Identities = 99/288 (34%), Positives = 168/288 (58%), Gaps = 22/288 (7%)

Query: 18  IGPWKLGETLGFGSTGKVQLARHERTGQKTAVKVI---PKSIFKSEGS---HGNNDSVLP 71
           +G W+  ET+G GS GKV+L +H +T +   +K++    K+    + S     N + +L 
Sbjct: 104 LGDWEFLETVGAGSMGKVKLVKHCQTKEVCVIKIVNRASKAFLHKQHSLPPPKNENELLE 163

Query: 72  FN--IEREIV----------IMKLLSHPNVLSLYDVWETDNNLYLILEYAEKGELFNLLV 119
               +E+EI           + ++L HP++  L+++    N+ Y++ EY   G+L + ++
Sbjct: 164 RQKRLEKEIARDKRTVREASLGQILYHPHICRLFEMCTMSNHFYMLFEYVSGGQLLDYII 223

Query: 120 DRGPLPEREAIKCFKQIIIAISYCHALGIVHRDLKPENLLLDNSYNIKIADFGMAALQTD 179
             G L E  A K  + I  A+ Y HA  IVHRDLK EN+++ NS  IKI DFG++ +   
Sbjct: 224 QHGSLKEHHARKFARGIASALQYLHANNIVHRDLKIENIMISNSGEIKIIDFGLSNIFDS 283

Query: 180 AGMLETSCGSPHYAAPEIVSGLPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRDLLL 239
              L T CGS ++AAPE++   PY G   D+WS G++L+ L+ G++PFD+EN ++  L  
Sbjct: 284 KKKLHTFCGSLYFAAPELLKAQPYTGPEVDIWSFGIVLYVLVCGKVPFDDENSSI--LHE 341

Query: 240 KVQKGQFEMPNNAEISGDAQDLIRRILVVDPTQRIKIRDILSHPLLKK 287
           K++KG+ + P  + +S DA  L+ R++VVDP +R  ++++  HP + +
Sbjct: 342 KIKKGKVDYP--SHLSIDAVSLLTRMIVVDPLKRATLKNVTDHPWMNR 387

>Suva_16.169 Chr16 complement(292738..295314) [2577 bp, 858 aa] {ON}
           YPL141C (REAL)
          Length = 858

 Score =  189 bits (481), Expect = 6e-49,   Method: Compositional matrix adjust.
 Identities = 111/291 (38%), Positives = 160/291 (54%), Gaps = 26/291 (8%)

Query: 18  IGPWKLGETLGFGSTGKVQLARHERTG----------QKTAVKVIPKSIFKSEGSHGNND 67
            GP+ LG TLG G  GKV+L   +             ++ AVK+I +          +ND
Sbjct: 38  FGPYILGSTLGEGEFGKVKLGWPKNFPNSSTSAFDFPKQVAVKLIKRDTI-------SND 90

Query: 68  SVLPFNIEREIVIMKLLSHPNVLSLYDVWETDNNLYLILEYAEKGELFNLLVDRGPLPER 127
                 I REI  +K LSHPN++ L +V +    + ++LEYA  GE +  +  +  L E 
Sbjct: 91  YKKEVKIYREINALKHLSHPNIVKLEEVLQNSRYIGIVLEYACGGEFYKYIQKKRRLKET 150

Query: 128 EAIKCFKQIIIAISYCHALGIVHRDLKPENLLLDNSYNIKIADFGMA-ALQTDAGMLETS 186
            A + F Q+I  + Y H+ G+VHRDLK ENLLLD + N+ I DFG      +   +++TS
Sbjct: 151 NACRLFSQLISGVHYIHSKGLVHRDLKLENLLLDKNENLVITDFGFVNEFCSRNELMKTS 210

Query: 187 CGSPHYAAPE-IVSGLPYEGFASDVWSCGVILFALLTGRLPFDE-----ENGNVRDLLLK 240
           CGSP YAAPE +VS  PYE   +D+WSCGVIL+A+L G LP+D+     E  ++  L   
Sbjct: 211 CGSPCYAAPELVVSTKPYEARKADIWSCGVILYAMLAGYLPWDDDPNNPEGSDIGRLYNY 270

Query: 241 VQKGQFEMPNNAEISGDAQDLIRRILVVDPTQRIKIRDILSHPLLKKYQTI 291
           +     + P+   I    +DL+RRILV DP +RI ++ I  H  LK + + 
Sbjct: 271 ICSTPLKFPD--YILPIPRDLLRRILVSDPKRRINLKQIEKHGWLKSHSSF 319

>NDAI0E01290 Chr5 complement(255593..257782) [2190 bp, 729 aa] {ON}
           Anc_8.654
          Length = 729

 Score =  187 bits (476), Expect = 8e-49,   Method: Compositional matrix adjust.
 Identities = 110/289 (38%), Positives = 163/289 (56%), Gaps = 24/289 (8%)

Query: 18  IGPWKLGETLGFGSTGKVQL--------ARHERTGQKTAVKVIPKSIFKSEGSHGNNDSV 69
            G + LG TLG G  GKV+L        A  +   ++ A+K+I +   K     G++  +
Sbjct: 43  FGNYILGATLGEGEFGKVKLGWSTASPTASLDSNSKQIAIKLIRRDYVKK----GSDKEI 98

Query: 70  LPFNIEREIVIMKLLSHPNVLSLYDVWETDNNLYLILEYAEKGELFNLLVDRGPLPEREA 129
               I REI  +KLL+HPN++ L +V +    + ++LE+A  GE +  L  +  L E  A
Sbjct: 99  ---KIYREINALKLLTHPNIVRLEEVLQNSKYIGIVLEFASGGEFYKYLQRKRRLKEPHA 155

Query: 130 IKCFKQIIIAISYCHALGIVHRDLKPENLLLDNSYNIKIADFGMA-ALQTDAGMLETSCG 188
            + F Q+I  ++Y H+ G+VHRDLK ENLLLD + N+ I DFG          +++ SCG
Sbjct: 156 CQLFAQLISGVTYMHSKGLVHRDLKLENLLLDKNENLIITDFGFVNEFFGSNELMKRSCG 215

Query: 189 SPHYAAPEIV-SGLPYEGFASDVWSCGVILFALLTGRLPFDEENGN-----VRDLLLKVQ 242
           SP YAAPE+V S  PY     D+WSCG+IL+A+L G LP+D+++ N     +  L   + 
Sbjct: 216 SPCYAAPELVLSTEPYRARKVDIWSCGIILYAMLAGYLPWDDDSQNPNGDDIGKLYQYIT 275

Query: 243 KGQFEMPNNAEISGDAQDLIRRILVVDPTQRIKIRDILSHPLLKKYQTI 291
           K   + P  A IS  A+DLIR+IL  +P++RI I  I  H  LK + + 
Sbjct: 276 KTALKFP--AYISPLARDLIRKILTANPSRRISISYICKHDWLKPHASF 322

>Smik_6.339 Chr6 (538177..540774) [2598 bp, 865 aa] {ON} YPL141C
           (REAL)
          Length = 865

 Score =  189 bits (480), Expect = 8e-49,   Method: Compositional matrix adjust.
 Identities = 112/288 (38%), Positives = 159/288 (55%), Gaps = 26/288 (9%)

Query: 18  IGPWKLGETLGFGSTGKVQLARHE----------RTGQKTAVKVIPKSIFKSEGSHGNND 67
            GP+ LG TLG G  GKV+L   +             ++ AVK+I +          +ND
Sbjct: 38  FGPYILGSTLGEGEFGKVKLGWPKSFPSSSNATLEFPKQVAVKLIKRDTI-------SND 90

Query: 68  SVLPFNIEREIVIMKLLSHPNVLSLYDVWETDNNLYLILEYAEKGELFNLLVDRGPLPER 127
                 I REI  +K LSHPN++ L +V +    + ++LEYA  GE +  +  R  L E 
Sbjct: 91  YKKEVKIYREINALKHLSHPNIVKLEEVLQNSRYIGIVLEYACGGEFYRYIQKRRRLKEI 150

Query: 128 EAIKCFKQIIIAISYCHALGIVHRDLKPENLLLDNSYNIKIADFGMA-ALQTDAGMLETS 186
            A + F Q+I  + Y H+ G+VHRDLK ENLLLD + N+ I DFG      +   +++TS
Sbjct: 151 NACRLFSQLISGVHYIHSKGLVHRDLKLENLLLDKNENLVITDFGFVNEFCSRNELMKTS 210

Query: 187 CGSPHYAAPEIV-SGLPYEGFASDVWSCGVILFALLTGRLPFDE-----ENGNVRDLLLK 240
           CGSP YAAPE+V S  PYE   +D+WSCGVIL+A+L G LP+D+     E  ++  L   
Sbjct: 211 CGSPCYAAPELVISAEPYEARKADIWSCGVILYAMLAGYLPWDDDPNNPEGSDIGRLYNY 270

Query: 241 VQKGQFEMPNNAEISGDAQDLIRRILVVDPTQRIKIRDILSHPLLKKY 288
           +     + P+   I    +DL+RRILV DP +RI ++ I  H  LK +
Sbjct: 271 ISLTPLKFPD--YILPIPRDLLRRILVSDPKRRINLKQIKKHEWLKPH 316

>KAFR0H02540 Chr8 complement(483399..485852) [2454 bp, 817 aa] {ON}
           Anc_8.654 YPL141C
          Length = 817

 Score =  189 bits (479), Expect = 9e-49,   Method: Compositional matrix adjust.
 Identities = 114/327 (34%), Positives = 168/327 (51%), Gaps = 38/327 (11%)

Query: 18  IGPWKLGETLGFGSTGKVQLARHERTGQKT------------AVKVIPKSIFKSEG---- 61
            GP+ +G T+G G  GKV+L   +    K             A   +P  + K       
Sbjct: 58  FGPYIIGSTIGQGEFGKVKLGWSKSISNKQSHSPSANGLGLYATPALPIEVPKQVAIKLI 117

Query: 62  --SHGNNDSVLPFNIEREIVIMKLLSHPNVLSLYDVWETDNNLYLILEYAEKGELFNLLV 119
                + D      I REI  +K L+HPN++ L +V +    + ++LEYA  GE +  + 
Sbjct: 118 RRDTISKDPRREIKIYREINALKQLTHPNIVKLDEVLQNSKYIGIVLEYASGGEFYKYIQ 177

Query: 120 DRGPLPEREAIKCFKQIIIAISYCHALGIVHRDLKPENLLLDNSYNIKIADFGMA-ALQT 178
            +  L E  A K F Q+I  ++Y H+ G++HRDLK EN+LLD + N+ I DFG      T
Sbjct: 178 RKKRLKETIACKLFAQLISGVNYIHSKGLIHRDLKLENILLDKNENLIITDFGFVNEFVT 237

Query: 179 DAGMLETSCGSPHYAAPEIV-SGLPYEGFASDVWSCGVILFALLTGRLPFDEE-----NG 232
              +++TSCGSP YAAPE+V S  PYE    D+WSCG+ILFA+L G LP+D++       
Sbjct: 238 SNELMKTSCGSPCYAAPELVISSQPYEARKVDIWSCGIILFAMLAGYLPWDDDPENPSGE 297

Query: 233 NVRDLLLKVQKGQFEMPNNAEISGDAQDLIRRILVVDPTQRIKIRDILSHPLLK------ 286
           N+  L   +     + P    I+   +DL+RRIL+ DP +R+ +R IL H  LK      
Sbjct: 298 NIAKLYFYITTTPLKFP--EYITAIPRDLLRRILIADPKKRVDLRYILKHQWLKPHTPFL 355

Query: 287 -----KYQTIKDSKSIKDLPRENTYLY 308
                ++  I  S+SI  LP+ +   Y
Sbjct: 356 SISPEEWDNISRSQSILRLPKHSKKQY 382

>Ecym_4291 Chr4 complement(620549..623986) [3438 bp, 1145 aa] {ON}
           similar to Ashbya gossypii AGR058W
          Length = 1145

 Score =  190 bits (483), Expect = 9e-49,   Method: Compositional matrix adjust.
 Identities = 101/292 (34%), Positives = 163/292 (55%), Gaps = 28/292 (9%)

Query: 18  IGPWKLGETLGFGSTGKVQLARHERTGQKTAVKVIPKSIFKSEGSHGNNDSVLP--FNIE 75
           +G W   ET+G GS GKV+LA+H  T +  A+K++ ++       H      LP   N E
Sbjct: 112 LGDWDFLETVGAGSMGKVKLAKHRYTNELCAIKIVNRAT--KSFIHKQQQQQLPPPSNEE 169

Query: 76  --------------------REIVIMKLLSHPNVLSLYDVWETDNNLYLILEYAEKGELF 115
                               RE  + ++L HP++  L+++    N+ Y++ EY   G+L 
Sbjct: 170 ELMERRKKLEKEISRDKRTIREASLGQILYHPHICRLFEMCTMSNHFYMLFEYVSGGQLL 229

Query: 116 NLLVDRGPLPEREAIKCFKQIIIAISYCHALGIVHRDLKPENLLLDNSYNIKIADFGMAA 175
           + ++  G L ER A K  + I  A+ Y H   IVHRDLK EN+++ +S  I+I DFG++ 
Sbjct: 230 DYIIQHGSLRERHARKFARGIASALQYLHMNNIVHRDLKIENIMISSSGEIRIIDFGLSN 289

Query: 176 LQTDAGMLETSCGSPHYAAPEIVSGLPYEGFASDVWSCGVILFALLTGRLPFDEENGNVR 235
           L      L T CGS ++AAPE++   PY G   D+WS GV+L+ L+ G++PFD+EN +V 
Sbjct: 290 LYDPKKQLHTFCGSLYFAAPELLKAHPYTGPEVDIWSFGVVLYVLVCGKVPFDDENASV- 348

Query: 236 DLLLKVQKGQFEMPNNAEISGDAQDLIRRILVVDPTQRIKIRDILSHPLLKK 287
            L  K+++G+ E P +  I  D   L+ ++LVVDP +R  ++ +++H  ++K
Sbjct: 349 -LHEKIKQGKVEYPQHLSI--DVISLLSKMLVVDPLKRATLKQVVNHQWMQK 397

>Kpol_1066.46 s1066 (82874..86551) [3678 bp, 1225 aa] {ON}
           (82874..86551) [3678 nt, 1226 aa]
          Length = 1225

 Score =  191 bits (484), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 103/296 (34%), Positives = 171/296 (57%), Gaps = 23/296 (7%)

Query: 18  IGPWKLGETLGFGSTGKVQLARHERTGQKTAVKVI---PKSIFKSEGS---HGNNDSVLP 71
           +G W   ET+G GS GKV+LA+H RT +  A+K++    K+    E S     N+  ++ 
Sbjct: 142 LGDWNFLETVGAGSMGKVKLAKHHRTNEICAIKIVNRATKAFLHKEQSLPAPANDQEIME 201

Query: 72  F--NIEREIV----------IMKLLSHPNVLSLYDVWETDNNLYLILEYAEKGELFNLLV 119
              N+E+EI           + ++L HP++  L+++    N+ Y++ EY   G+L + ++
Sbjct: 202 RQKNLEKEISRDKRTIREASLGQILYHPHICRLFEMCTMSNHFYMLFEYVSGGQLLDYII 261

Query: 120 DRGPLPEREAIKCFKQIIIAISYCHALGIVHRDLKPENLLLDNSYNIKIADFGMAALQTD 179
             G L E  A +  + I  A+ Y HA  IVHRDLK EN+++  S  IK+ DFG++ L  +
Sbjct: 262 QHGSLREHHARRFARGIASALQYLHANNIVHRDLKIENIMISTSGEIKLIDFGLSNLYDN 321

Query: 180 AGMLETSCGSPHYAAPEIVSGLPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRDLLL 239
              L T CGS ++AAPE++   PY G   DVWS GV+L+ L+ G++PFD+EN +V  L  
Sbjct: 322 RKQLHTFCGSLYFAAPELLKANPYTGPEVDVWSFGVVLYVLVCGKVPFDDENSSV--LHE 379

Query: 240 KVQKGQFEMPNNAEISGDAQDLIRRILVVDPTQRIKIRDILSHP-LLKKYQTIKDS 294
           K+++G+ E   +  +S +   L+ ++LVVDP +R  ++ ++ H  +++ Y T   S
Sbjct: 380 KIKQGKVEY--SQHLSIEVISLLSKMLVVDPKRRASLKQVVDHHWMVRGYDTAPPS 433

>Suva_2.283 Chr2 (489490..492759) [3270 bp, 1089 aa] {ON} YDR122W
           (REAL)
          Length = 1089

 Score =  190 bits (482), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 102/283 (36%), Positives = 161/283 (56%), Gaps = 22/283 (7%)

Query: 18  IGPWKLGETLGFGSTGKVQLARHERTGQKTAVKVI---PKSIFKSEG---SHGNNDSVLP 71
           +G W+  ET+G GS GKV+LA+H  T +  AVK++    K+    E       N   VL 
Sbjct: 128 LGDWEFVETVGAGSMGKVKLAKHHYTNEVCAVKIVNRATKAFLHKEQMLPPPKNEQDVLE 187

Query: 72  FNIE------------REIVIMKLLSHPNVLSLYDVWETDNNLYLILEYAEKGELFNLLV 119
              +            RE  + ++L HP++  L+++    N+ Y++ EY   G+L + ++
Sbjct: 188 RQKKLEKEISRDKRTIREASLGQILYHPHICRLFEMCTLSNHFYMLFEYVSGGQLLDYII 247

Query: 120 DRGPLPEREAIKCFKQIIIAISYCHALGIVHRDLKPENLLLDNSYNIKIADFGMAALQTD 179
             G + E +A K  + I  A+ Y HA  IVHRDLK EN+++ +S  IKI DFG++ L   
Sbjct: 248 QHGSIREHQARKFARGIASALMYLHANNIVHRDLKIENIMISDSSEIKIIDFGLSNLYDS 307

Query: 180 AGMLETSCGSPHYAAPEIVSGLPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRDLLL 239
              L T CGS ++AAPE++   PY G   DVWS GV+LF L+ G++PFD+EN +V  L  
Sbjct: 308 RKQLHTFCGSLYFAAPELLKANPYTGPEVDVWSFGVVLFVLVCGKVPFDDENSSV--LHE 365

Query: 240 KVQKGQFEMPNNAEISGDAQDLIRRILVVDPTQRIKIRDILSH 282
           K+++G+ E P +  I  +   L+ ++LVVDP +R  ++ ++ H
Sbjct: 366 KIKQGKVEYPQHLSI--EVISLLSKMLVVDPKRRATLKQVVEH 406

>KAFR0B02800 Chr2 (571295..574582) [3288 bp, 1095 aa] {ON} Anc_8.279
           YLR096W
          Length = 1095

 Score =  189 bits (481), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 101/286 (35%), Positives = 163/286 (56%), Gaps = 22/286 (7%)

Query: 18  IGPWKLGETLGFGSTGKVQLARHERTGQKTAVKVI---PKSIFKSEGSHG---NNDSVLP 71
           +G W   ET+G GS GKV+LARH +T +  A+K++    K+    E S     N + +L 
Sbjct: 98  LGDWDFLETVGAGSMGKVKLARHHQTNEICAIKIVNRATKAYLHKEQSLAPPKNENEMLE 157

Query: 72  FNIE------------REIVIMKLLSHPNVLSLYDVWETDNNLYLILEYAEKGELFNLLV 119
              +            RE  + ++L HP++  L+++    N+ Y++ EY   G+L + ++
Sbjct: 158 RQKKLEKEISRDKRTIREASLGQVLYHPHICRLFEMCTMSNHFYMLFEYVSGGQLLDYII 217

Query: 120 DRGPLPEREAIKCFKQIIIAISYCHALGIVHRDLKPENLLLDNSYNIKIADFGMAALQTD 179
             G L E  A K  + +  A+ Y HA  IVHRDLK EN+++  S  IKI DFG++ +   
Sbjct: 218 QHGSLREHHARKFARGVASALQYLHANNIVHRDLKIENIMISTSGEIKIIDFGLSNVFDT 277

Query: 180 AGMLETSCGSPHYAAPEIVSGLPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRDLLL 239
              L T CGS ++AAPE++   PY G   D+WS GV+L+ L+ G++PFD+EN +V  L  
Sbjct: 278 RKQLHTFCGSLYFAAPELLKANPYIGPEVDIWSFGVVLYVLVCGKVPFDDENSSV--LHE 335

Query: 240 KVQKGQFEMPNNAEISGDAQDLIRRILVVDPTQRIKIRDILSHPLL 285
           K+++G+ E PN+  I  +   L+ ++LVVDP +R  +  ++ HP +
Sbjct: 336 KIKQGKVEYPNHLSI--EVISLLSKMLVVDPLKRANLTKVIEHPWM 379

>YPL141C Chr16 complement(283464..286061) [2598 bp, 865 aa] {ON}
           FRK1Protein kinase of unknown cellular role; similar to
           Kin4p; green fluorescent protein (GFP)-fusion protein
           localizes to the cytoplasm; interacts with rRNA
           transcription and ribosome biogenesis factors and the
           long chain fatty acyl-CoA synthetase Faa3
          Length = 865

 Score =  188 bits (478), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 109/291 (37%), Positives = 160/291 (54%), Gaps = 26/291 (8%)

Query: 18  IGPWKLGETLGFGSTGKVQLARHERTG----------QKTAVKVIPKSIFKSEGSHGNND 67
            GP+ LG TLG G  GKV+L   +             ++ A+K+I +          +ND
Sbjct: 38  FGPYILGSTLGEGEFGKVKLGWPKNFSNSSNSTFDFPKQVAIKLIKRDSI-------SND 90

Query: 68  SVLPFNIEREIVIMKLLSHPNVLSLYDVWETDNNLYLILEYAEKGELFNLLVDRGPLPER 127
                 I REI  +K LSHPN++ L +V +    + ++LEYA  GE +  +  +  L E 
Sbjct: 91  YRKEVKIYREINALKHLSHPNIVKLEEVLQNSRYIGIVLEYACGGEFYKYIQKKRRLKEM 150

Query: 128 EAIKCFKQIIIAISYCHALGIVHRDLKPENLLLDNSYNIKIADFGMA-ALQTDAGMLETS 186
            A + F Q+I  + Y H+ G+VHRDLK ENLLLD + N+ I DFG      +   +++TS
Sbjct: 151 NACRLFSQLISGVHYIHSKGLVHRDLKLENLLLDKNENLVITDFGFVNEFCSRNELMKTS 210

Query: 187 CGSPHYAAPEIV-SGLPYEGFASDVWSCGVILFALLTGRLPFDE-----ENGNVRDLLLK 240
           CGSP YAAPE+V S  PYE   +D+WSCGVIL+A+L G LP+D+     E  ++  L   
Sbjct: 211 CGSPCYAAPELVISAEPYEARKADIWSCGVILYAILAGYLPWDDDPNNPEGSDIGRLYNY 270

Query: 241 VQKGQFEMPNNAEISGDAQDLIRRILVVDPTQRIKIRDILSHPLLKKYQTI 291
           +     + P+   I    +DL+RR+LV DP +RI ++ I  H  LK + + 
Sbjct: 271 INSTPLKFPD--YILPIPRDLLRRMLVSDPKKRINLKQIKKHEWLKPHSSF 319

>TBLA0C04600 Chr3 (1112043..1115990) [3948 bp, 1315 aa] {ON}
           Anc_8.279 YLR096W
          Length = 1315

 Score =  189 bits (481), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 99/286 (34%), Positives = 162/286 (56%), Gaps = 28/286 (9%)

Query: 18  IGPWKLGETLGFGSTGKVQLARHERTGQKTAVKVIPKSIFKSEGSHGNNDSVLPFNIERE 77
           +G W   ET+G GS GKV+LA+H  T +  A+KV+ ++   ++G      ++ P   E+E
Sbjct: 180 LGDWDFLETVGAGSMGKVKLAKHHYTNEICAIKVVNRA---TKGFLHKEQTLPPPQTEQE 236

Query: 78  IV---------------------IMKLLSHPNVLSLYDVWETDNNLYLILEYAEKGELFN 116
           I+                     + ++L HP++  L+++    N+ Y++ EY   G+L +
Sbjct: 237 ILERQKNLEKEISRDKRTIREASLGQILYHPHICRLFEMCTMSNHFYMLFEYVSGGQLLD 296

Query: 117 LLVDRGPLPEREAIKCFKQIIIAISYCHALGIVHRDLKPENLLLDNSYNIKIADFGMAAL 176
            ++  G L E  A K  + I  A+ Y H+  IVHRDLK EN+++  S  IKI DFG++ L
Sbjct: 297 YIIQHGSLREHHARKFARGIASALQYLHSNNIVHRDLKIENIMISTSGEIKIIDFGLSNL 356

Query: 177 QTDAGMLETSCGSPHYAAPEIVSGLPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRD 236
                 L T CGS ++AAPE++   PY G   DVWS GV+L+ L+ G++PFD+EN +V  
Sbjct: 357 YDTTRQLHTFCGSLYFAAPELLKAHPYTGPEVDVWSFGVVLYVLVCGKVPFDDENSSV-- 414

Query: 237 LLLKVQKGQFEMPNNAEISGDAQDLIRRILVVDPTQRIKIRDILSH 282
           L  K+++G+ + P +  I  +   L+ ++LVVDP +R  +R ++ H
Sbjct: 415 LHEKIKQGKVDYPQHLSI--EVISLLSKMLVVDPKKRATLRQVVEH 458

>YDR122W Chr4 (694700..697894) [3195 bp, 1064 aa] {ON}
           KIN1Serine/threonine protein kinase involved in
           regulation of exocytosis; localizes to the cytoplasmic
           face of the plasma membrane; closely related to Kin2p
          Length = 1064

 Score =  189 bits (479), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 101/283 (35%), Positives = 161/283 (56%), Gaps = 22/283 (7%)

Query: 18  IGPWKLGETLGFGSTGKVQLARHERTGQKTAVKVI---PKSIFKSEG---SHGNNDSVLP 71
           +G W+  ET+G GS GKV+LA+H  T +  AVK++    K+    E       N   VL 
Sbjct: 117 LGDWEFVETVGAGSMGKVKLAKHRYTNEVCAVKIVNRATKAFLHKEQMLPPPKNEQDVLE 176

Query: 72  FNIE------------REIVIMKLLSHPNVLSLYDVWETDNNLYLILEYAEKGELFNLLV 119
              +            RE  + ++L HP++  L+++    N+ Y++ EY   G+L + ++
Sbjct: 177 RQKKLEKEISRDKRTIREASLGQILYHPHICRLFEMCTLSNHFYMLFEYVSGGQLLDYII 236

Query: 120 DRGPLPEREAIKCFKQIIIAISYCHALGIVHRDLKPENLLLDNSYNIKIADFGMAALQTD 179
             G + E +A K  + I  A+ Y HA  IVHRDLK EN+++ +S  IKI DFG++ +   
Sbjct: 237 QHGSIREHQARKFARGIASALIYLHANNIVHRDLKIENIMISDSSEIKIIDFGLSNIYDS 296

Query: 180 AGMLETSCGSPHYAAPEIVSGLPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRDLLL 239
              L T CGS ++AAPE++   PY G   DVWS GV+LF L+ G++PFD+EN +V  L  
Sbjct: 297 RKQLHTFCGSLYFAAPELLKANPYTGPEVDVWSFGVVLFVLVCGKVPFDDENSSV--LHE 354

Query: 240 KVQKGQFEMPNNAEISGDAQDLIRRILVVDPTQRIKIRDILSH 282
           K+++G+ E P +  I  +   L+ ++LVVDP +R  ++ ++ H
Sbjct: 355 KIKQGKVEYPQHLSI--EVISLLSKMLVVDPKRRATLKQVVEH 395

>Skud_12.164 Chr12 (315700..319182) [3483 bp, 1160 aa] {ON} YLR096W
           (REAL)
          Length = 1160

 Score =  189 bits (479), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 96/288 (33%), Positives = 170/288 (59%), Gaps = 22/288 (7%)

Query: 18  IGPWKLGETLGFGSTGKVQLARHERTGQKTAVKVIPKS----IFKSEG--SHGNNDSVLP 71
           +G W+  ET+G GS GKV+L +H +T +   +K++ ++    + K     S  N + +L 
Sbjct: 103 LGDWEFLETVGAGSMGKVKLVKHRQTKEVCVIKIVNRASKAYLHKQHTLPSPKNENEILE 162

Query: 72  FN--IEREIV----------IMKLLSHPNVLSLYDVWETDNNLYLILEYAEKGELFNLLV 119
               +E+EI           + ++L HP++  L+++    N+ Y++ EY   G+L + ++
Sbjct: 163 RQKRLEKEIARDKRTVREASLGQILYHPHICRLFEMCTMSNHFYMLFEYVSGGQLLDYII 222

Query: 120 DRGPLPEREAIKCFKQIIIAISYCHALGIVHRDLKPENLLLDNSYNIKIADFGMAALQTD 179
             G L E  A K  + I  A+ Y HA  IVHRDLK EN+++ +S  IKI DFG++ +   
Sbjct: 223 QHGSLKEHHARKFARGIASALQYLHANNIVHRDLKIENIMISSSGEIKIIDFGLSNIFDY 282

Query: 180 AGMLETSCGSPHYAAPEIVSGLPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRDLLL 239
              L T CGS ++AAPE++   PY G   D+WS G++L+ L+ G++PFD+EN ++  L  
Sbjct: 283 RKQLHTFCGSLYFAAPELLKAQPYTGPEVDIWSFGIVLYVLVCGKVPFDDENSSI--LHE 340

Query: 240 KVQKGQFEMPNNAEISGDAQDLIRRILVVDPTQRIKIRDILSHPLLKK 287
           K++KG+ + P  + +S +A  L+ R++V+DP +R  +++++ HP + +
Sbjct: 341 KIKKGKVDYP--SHLSIEAISLLTRMIVIDPLKRATLKNVVDHPWMNR 386

>CAGL0J03872g Chr10 (368472..370457) [1986 bp, 661 aa] {ON} similar
           to uniprot|Q01919 Saccharomyces cerevisiae YOR233w KIN4
           ser/thr protein kinase or and similar to uniprot|Q03002
           Saccharomyces cerevisiae YPL141c
          Length = 661

 Score =  184 bits (468), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 109/284 (38%), Positives = 164/284 (57%), Gaps = 16/284 (5%)

Query: 18  IGPWKLGETLGFGSTGKVQLA--RHERTG--QKTAV-KVIPKSIFKSEGSHGNNDSVLPF 72
            GP+ +G TLG G  GKV+L   R   TG  Q+ AV K +   + + +    N++  +  
Sbjct: 41  FGPYIVGSTLGEGEFGKVKLGWTRTPSTGPEQRPAVSKQVAIKLIRRDTIVKNSEKEI-- 98

Query: 73  NIEREIVIMKLLSHPNVLSLYDVWETDNNLYLILEYAEKGELFNLLVDRGPLPEREAIKC 132
            I REI  +K L+HPNV+ L +V +    + ++LEYA  GE +  +  +  L E  A + 
Sbjct: 99  KIYREINALKHLTHPNVVRLEEVLQNSKYIGIVLEYASGGEFYKYIQRKRRLKESTACRL 158

Query: 133 FKQIIIAISYCHALGIVHRDLKPENLLLDNSYNIKIADFGMA-ALQTDAGMLETSCGSPH 191
           F Q+I  ++Y H+  +VHRDLK ENLLLD + N+ I DFG       D   ++TSCGSP 
Sbjct: 159 FAQLISGVTYMHSKNLVHRDLKLENLLLDKNENLVITDFGFVNEFLPDNEYMKTSCGSPC 218

Query: 192 YAAPEIV-SGLPYEGFASDVWSCGVILFALLTGRLPFDEENGN-----VRDLLLKVQKGQ 245
           YAAPE+V S  PY    +DVWSCG+IL+A+L G LP+D+++ N     +  L   + +  
Sbjct: 219 YAAPELVISTRPYVARKADVWSCGIILYAMLAGYLPWDDDSTNPEGDDIGKLYQYITRTP 278

Query: 246 FEMPNNAEISGDAQDLIRRILVVDPTQRIKIRDILSHPLLKKYQ 289
            + P    I+   +DL+R+ILV DP +R+ ++ I  H  LK ++
Sbjct: 279 LKFP--EYITPIPRDLLRKILVPDPNKRVNMQYIHRHEWLKPHR 320

>KLLA0F19536g Chr6 (1808263..1811577) [3315 bp, 1104 aa] {ON}
           similar to uniprot|P13186 Saccharomyces cerevisiae
           YLR096W KIN2 Serine/threonine protein kinase involved in
           regulation of exocytosis localizes to the cytoplasmic
           face of the plasma membrane closely related to Kin1p and
           to YDR122W uniprot|P13185 Saccharomyces cerevisiae
           YDR122W KIN1 Serine/threonine protein kinase involved in
           regulation of exocytosis; localizes to the cytoplasmic
           face of the plasma membrane; closely related to Kin2p
          Length = 1104

 Score =  188 bits (478), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 99/290 (34%), Positives = 161/290 (55%), Gaps = 26/290 (8%)

Query: 18  IGPWKLGETLGFGSTGKVQLARHERTGQKTAVKVIPKSIFKSEGSHGNNDSVLPFNIE-- 75
           +G W   ET+G GS GKV+LA+H  T +  A+K++ ++       H  N    P   E  
Sbjct: 95  LGDWDFLETVGAGSMGKVKLAKHRLTNEVCAIKIVNRA--AKSYMHKQNQLPPPKTEEEL 152

Query: 76  ------------------REIVIMKLLSHPNVLSLYDVWETDNNLYLILEYAEKGELFNL 117
                             RE  + ++L HP++  L+++    N+ Y++ EY   G+L + 
Sbjct: 153 MERKKKLEKELSRDRRTIREASLGQILYHPHICRLFEMCTMSNHFYMLFEYVSGGQLLDY 212

Query: 118 LVDRGPLPEREAIKCFKQIIIAISYCHALGIVHRDLKPENLLLDNSYNIKIADFGMAALQ 177
           ++  G L ER A K  + I  A+ Y H   IVHRDLK EN+++  S  IKI DFG++ L 
Sbjct: 213 IIQHGSLRERHARKFVRGIASALQYLHLNNIVHRDLKIENIMISTSGEIKIIDFGLSNLY 272

Query: 178 TDAGMLETSCGSPHYAAPEIVSGLPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRDL 237
            +   L T CGS ++AAPE++   PY G   D+WS GV+++ L+ G++PFD+EN +V  L
Sbjct: 273 DNKKQLHTFCGSLYFAAPELLKANPYIGPEVDIWSFGVVIYVLVCGKVPFDDENASV--L 330

Query: 238 LLKVQKGQFEMPNNAEISGDAQDLIRRILVVDPTQRIKIRDILSHPLLKK 287
             K++KG+ E P +  I  +   L+ ++LVVDP +R  ++ + +H  +++
Sbjct: 331 HEKIKKGKVEYPQHLSI--ECISLLSKMLVVDPLKRASLKQVCNHQWMQR 378

>KNAG0G02110 Chr7 (477260..480838) [3579 bp, 1192 aa] {ON} Anc_8.279
           YLR096W
          Length = 1192

 Score =  188 bits (478), Expect = 5e-48,   Method: Compositional matrix adjust.
 Identities = 106/303 (34%), Positives = 166/303 (54%), Gaps = 23/303 (7%)

Query: 18  IGPWKLGETLGFGSTGKVQLARHERTGQKTAVKVIPKSIF------------KSEGSHGN 65
           +G W   ET+G GS GKV+LA+H  T +  A+K++ ++              KSE     
Sbjct: 106 LGDWDFLETVGAGSMGKVKLAKHHHTNEICAIKIVNRATKAFLHKEQNLPPPKSEQEILQ 165

Query: 66  NDSVLPFNIER------EIVIMKLLSHPNVLSLYDVWETDNNLYLILEYAEKGELFNLLV 119
               L   I R      E  + ++L HP++  L+++    N+ Y++ EY   G+L + ++
Sbjct: 166 RQKRLEKEISRDKRTIREASLGQILYHPHICRLFEMCTMSNHFYMLFEYVSGGQLLDYII 225

Query: 120 DRGPLPEREAIKCFKQIIIAISYCHALGIVHRDLKPENLLLDNSYNIKIADFGMAALQTD 179
             G L E  A K  + I  A+ Y HA  IVHRDLK EN+++  S  IKI DFG++ +   
Sbjct: 226 QHGSLREHHARKFARGIGSALQYLHANNIVHRDLKIENIMISTSGEIKIIDFGLSNVYDP 285

Query: 180 AGMLETSCGSPHYAAPEIVSGLPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRDLLL 239
              L T CGS ++AAPE++   PY G   DVWS GV+L+ L+ G++PFD+E  +V  L  
Sbjct: 286 RKQLHTFCGSLYFAAPELLKARPYLGPEVDVWSFGVVLYVLVCGKVPFDDEVSSV--LHE 343

Query: 240 KVQKGQFEMPNNAEISGDAQDLIRRILVVDPTQRIKIRDILSHPLLKK-YQTIKDSKSIK 298
           K+++G  E PN+  I  +   L+ ++LVVDP +R  ++ ++ HP + + Y  I  S   K
Sbjct: 344 KIKQGNVEYPNHLSI--EVLSLLSKMLVVDPERRASLKQVIEHPWMNRGYDYITPSYLPK 401

Query: 299 DLP 301
            +P
Sbjct: 402 RIP 404

>Skud_15.399 Chr15 (714789..717212) [2424 bp, 807 aa] {ON} YOR233W
           (REAL)
          Length = 807

 Score =  186 bits (472), Expect = 6e-48,   Method: Compositional matrix adjust.
 Identities = 113/318 (35%), Positives = 171/318 (53%), Gaps = 24/318 (7%)

Query: 18  IGPWKLGETLGFGSTGKVQLARHE-----RTGQKTAVKVIPKSIFKSEGSHGNNDSVLPF 72
            GP+ +G TLG G  GKV+L   +        ++ A+K+I +   K        D+    
Sbjct: 43  FGPYIVGSTLGEGEFGKVKLGWTKAFSPNEVPKQVAIKLIRRDSIKK-------DADKEV 95

Query: 73  NIEREIVIMKLLSHPNVLSLYDVWETDNNLYLILEYAEKGELFNLLVDRGPLPEREAIKC 132
            I REI  +K L+HPN++ L +V +    + ++LE+   GE +  +  +  L E  A + 
Sbjct: 96  KIYREINALKHLTHPNIIYLEEVLQNSKYIGIVLEFVSGGEFYKYIQRKRRLKESSACRL 155

Query: 133 FKQIIIAISYCHALGIVHRDLKPENLLLDNSYNIKIADFGMA-ALQTDAGMLETSCGSPH 191
           F Q+I  + Y H+ G+VHRDLK ENLLLD   N+ I DFG       D  ++ TSCGSP 
Sbjct: 156 FAQLISGVDYMHSKGLVHRDLKLENLLLDKHENLVITDFGFVNEFFEDNELMRTSCGSPC 215

Query: 192 YAAPE-IVSGLPYEGFASDVWSCGVILFALLTGRLPFDEENGN-----VRDLLLKVQKGQ 245
           YAAPE +VS   YE   +DVWSCGVIL+A+L G LP+D+++ N     +  L   + +  
Sbjct: 216 YAAPELVVSTKAYEARKADVWSCGVILYAMLAGYLPWDDDHENPTGDDIARLYQYITQTP 275

Query: 246 FEMPNNAEISGDAQDLIRRILVVDPTQRIKIRDILSHPLLKKYQ---TIKDSKSIKDLPR 302
            + P    I+   +DL+RRILV +P +R+ +R I  H  LK +    +I+ +   + L +
Sbjct: 276 LKFPE--YITPVPRDLLRRILVPNPRRRVSVRAIQRHEWLKPHHAFLSIQPNYWDEQLRK 333

Query: 303 ENTYLYPLADADNHTSVT 320
           E   L    D   HT+ +
Sbjct: 334 ERPQLSTRGDVGRHTTYS 351

>TBLA0C01750 Chr3 (412762..415707) [2946 bp, 981 aa] {ON} Anc_8.654
           YPL141C
          Length = 981

 Score =  187 bits (474), Expect = 9e-48,   Method: Compositional matrix adjust.
 Identities = 113/289 (39%), Positives = 162/289 (56%), Gaps = 24/289 (8%)

Query: 18  IGPWKLGETLGFGSTGKVQLARHERTGQ-------KTAVKVIPKSIFKSEGSHGNNDSVL 70
            GP+ L  TLG G  GKV+L   + + Q       + A+K+I +S    +GS+       
Sbjct: 81  FGPYILSSTLGEGEFGKVKLGWSKASTQASNEIPKQVAIKLIKRSSILPKGSNKE----- 135

Query: 71  PFNIEREIVIMKLLSHPNVLSLYDVWETDNNLYLILEYAEKGELFNLLVDRGPLPEREAI 130
              + REI  +K L HPN++ L DV +    + ++LEYA  GE +  +  +  L E  A 
Sbjct: 136 -IKVYREINALKQLCHPNIVKLDDVLQNSKYIGIVLEYASGGEFYKYIQRKKRLKEINAS 194

Query: 131 KCFKQIIIAISYCHALGIVHRDLKPENLLLDNSYNIKIADFGMAA--LQTDAGMLETSCG 188
           K F Q+I  + Y H+ G+VHRDLK ENLLLD   N+ I DFG      QT+  ML T CG
Sbjct: 195 KLFSQLISGVHYMHSKGLVHRDLKLENLLLDKHENLIITDFGFVNEFFQTNELML-TPCG 253

Query: 189 SPHYAAPEIV-SGLPYEGFASDVWSCGVILFALLTGRLPFDEE----NGN-VRDLLLKVQ 242
           SP YAAPE+V S  PYE   +D+WSCG+IL+A+L G LP+D++    +GN +  L   + 
Sbjct: 254 SPCYAAPELVISKHPYEARKADLWSCGIILYAMLAGYLPWDDDIKNPDGNDIARLYYYIT 313

Query: 243 KGQFEMPNNAEISGDAQDLIRRILVVDPTQRIKIRDILSHPLLKKYQTI 291
               + P    I    +DL+R+ILV +  +RI +R I++H  LK + T 
Sbjct: 314 TTPLKFP--EYIQPLPRDLLRKILVPNYKKRINMRRIINHEWLKPHFTF 360

>YLR096W Chr12 (332590..336033) [3444 bp, 1147 aa] {ON}
           KIN2Serine/threonine protein kinase involved in
           regulation of exocytosis; localizes to the cytoplasmic
           face of the plasma membrane; closely related to Kin1p
          Length = 1147

 Score =  187 bits (475), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 96/288 (33%), Positives = 168/288 (58%), Gaps = 22/288 (7%)

Query: 18  IGPWKLGETLGFGSTGKVQLARHERTGQKTAVKVIPKS----IFKSEG--SHGNNDSVLP 71
           +G W+  ET+G GS GKV+L +H +T +   +K++ ++    + K     S  N   +L 
Sbjct: 96  LGDWEFLETVGAGSMGKVKLVKHRQTKEICVIKIVNRASKAYLHKQHSLPSPKNESEILE 155

Query: 72  FN--IEREIV----------IMKLLSHPNVLSLYDVWETDNNLYLILEYAEKGELFNLLV 119
               +E+EI           + ++L HP++  L+++    N+ Y++ EY   G+L + ++
Sbjct: 156 RQKRLEKEIARDKRTVREASLGQILYHPHICRLFEMCTMSNHFYMLFEYVSGGQLLDYII 215

Query: 120 DRGPLPEREAIKCFKQIIIAISYCHALGIVHRDLKPENLLLDNSYNIKIADFGMAALQTD 179
             G L E  A K  + I  A+ Y HA  IVHRDLK EN+++ +S  IKI DFG++ +   
Sbjct: 216 QHGSLKEHHARKFARGIASALQYLHANNIVHRDLKIENIMISSSGEIKIIDFGLSNIFDY 275

Query: 180 AGMLETSCGSPHYAAPEIVSGLPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRDLLL 239
              L T CGS ++AAPE++   PY G   D+WS G++L+ L+ G++PFD+EN ++  L  
Sbjct: 276 RKQLHTFCGSLYFAAPELLKAQPYTGPEVDIWSFGIVLYVLVCGKVPFDDENSSI--LHE 333

Query: 240 KVQKGQFEMPNNAEISGDAQDLIRRILVVDPTQRIKIRDILSHPLLKK 287
           K++KG+ + P++  I  +   L+ R++VVDP +R  +++++ HP + +
Sbjct: 334 KIKKGKVDYPSHLSI--EVISLLTRMIVVDPLRRATLKNVVEHPWMNR 379

>Skud_16.140 Chr16 complement(255090..257687) [2598 bp, 865 aa] {ON}
           YPL141C (REAL)
          Length = 865

 Score =  185 bits (470), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 107/288 (37%), Positives = 159/288 (55%), Gaps = 26/288 (9%)

Query: 18  IGPWKLGETLGFGSTGKVQLARHERTG----------QKTAVKVIPKSIFKSEGSHGNND 67
            GP+ LG TLG G  GKV+L   +             ++ AVK+I +          +N+
Sbjct: 38  FGPYILGSTLGEGEFGKVKLGWPKNFSNSSATTFEFPKQVAVKLIKRDTI-------SNN 90

Query: 68  SVLPFNIEREIVIMKLLSHPNVLSLYDVWETDNNLYLILEYAEKGELFNLLVDRGPLPER 127
                 I REI  +K LSHPN++ L +V +    + ++LEYA  GE +  +  +  L E 
Sbjct: 91  YKKEVKIYREINALKHLSHPNIVKLEEVLQNSRYIGIVLEYACGGEFYKYIQKKRRLKET 150

Query: 128 EAIKCFKQIIIAISYCHALGIVHRDLKPENLLLDNSYNIKIADFGMA-ALQTDAGMLETS 186
            A + F Q++  + Y H+ G+VHRDLK ENLLLD + N+ I DFG      +   +++TS
Sbjct: 151 NACRLFSQLVSGVYYIHSKGLVHRDLKLENLLLDKNENLVITDFGFVNEFCSRNELMKTS 210

Query: 187 CGSPHYAAPEIV-SGLPYEGFASDVWSCGVILFALLTGRLPFDEENGN-----VRDLLLK 240
           CGSP YAAPE+V S  PYE   +D+WSCGVIL+A+L G LP+D+++ N     +  L   
Sbjct: 211 CGSPCYAAPELVISAEPYEARKADIWSCGVILYAMLAGYLPWDDDSNNPEGSDIGRLYNY 270

Query: 241 VQKGQFEMPNNAEISGDAQDLIRRILVVDPTQRIKIRDILSHPLLKKY 288
           +     + P+   I    +DL+RRILV DP +R+ ++ I  H  L  +
Sbjct: 271 INSTPLKFPD--YILPIPRDLLRRILVPDPKKRMNLKQIKKHEWLNSH 316

>Smik_12.155 Chr12 (312480..315968) [3489 bp, 1162 aa] {ON} YLR096W
           (REAL)
          Length = 1162

 Score =  186 bits (473), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 96/288 (33%), Positives = 169/288 (58%), Gaps = 22/288 (7%)

Query: 18  IGPWKLGETLGFGSTGKVQLARHERTGQKTAVKVIPKS----IFKSEG--SHGNNDSVLP 71
           +G W+  ET+G GS GKV+L +H +T +   +K++ ++    + K     S  N + VL 
Sbjct: 104 LGDWEFLETVGAGSMGKVKLVKHRQTKEVCVIKIVNRASKAYLHKQHSLPSPKNENEVLE 163

Query: 72  FN--IEREIV----------IMKLLSHPNVLSLYDVWETDNNLYLILEYAEKGELFNLLV 119
               +E+EI           + ++L HP++  L+++    N+ Y++ EY   G+L + ++
Sbjct: 164 RQKRLEKEIARDKRTIREASLGQILYHPHICRLFEMCTMSNHFYMLFEYVSGGQLLDYII 223

Query: 120 DRGPLPEREAIKCFKQIIIAISYCHALGIVHRDLKPENLLLDNSYNIKIADFGMAALQTD 179
             G L E  A K  + I  A+ Y H+  IVHRDLK EN+++ +S  IKI DFG++ +   
Sbjct: 224 QHGSLKEHHARKFARGIASALQYLHSNNIVHRDLKIENIMISSSGEIKIIDFGLSNIFDY 283

Query: 180 AGMLETSCGSPHYAAPEIVSGLPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRDLLL 239
              L T CGS ++AAPE++   PY G   D+WS G++L+ L+ G++PFD+EN ++  L  
Sbjct: 284 RKQLHTFCGSLYFAAPELLKAQPYTGPEVDIWSFGIVLYVLVCGKVPFDDENSSI--LHE 341

Query: 240 KVQKGQFEMPNNAEISGDAQDLIRRILVVDPTQRIKIRDILSHPLLKK 287
           K++KG+ + P++  I  +A  L+ +++VVDP +R  ++ ++ HP + +
Sbjct: 342 KIKKGKVDYPSHLSI--EAISLLTKMIVVDPLRRATLKTVVDHPWMNR 387

>YOR233W Chr15 (775846..778248) [2403 bp, 800 aa] {ON}
           KIN4Serine/threonine protein kinase that inhibits the
           mitotic exit network (MEN) when the spindle position
           checkpoint is activated; localized asymmetrically to
           mother cell cortex, spindle pole body and bud neck
          Length = 800

 Score =  184 bits (467), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 106/286 (37%), Positives = 160/286 (55%), Gaps = 21/286 (7%)

Query: 18  IGPWKLGETLGFGSTGKVQLARHERTG-----QKTAVKVIPKSIFKSEGSHGNNDSVLPF 72
            GP+ +G TLG G  GKV+L   + +      ++ A+K+I +   K        D+    
Sbjct: 43  FGPYIIGSTLGEGEFGKVKLGWTKASSSNEVPKQVAIKLIRRDTIKK-------DADKEI 95

Query: 73  NIEREIVIMKLLSHPNVLSLYDVWETDNNLYLILEYAEKGELFNLLVDRGPLPEREAIKC 132
            I REI  +K L+HPN++ L +V +    + ++LE+   GE +  +  +  L E  A + 
Sbjct: 96  KIYREINALKHLTHPNIIYLEEVLQNSKYIGIVLEFVSGGEFYKYIQRKRRLKESSACRL 155

Query: 133 FKQIIIAISYCHALGIVHRDLKPENLLLDNSYNIKIADFGMA-ALQTDAGMLETSCGSPH 191
           F Q+I  ++Y H  G+VHRDLK ENLLLD   N+ I DFG       D  +++TSCGSP 
Sbjct: 156 FAQLISGVNYMHYKGLVHRDLKLENLLLDKHENLVITDFGFVNEFFEDNELMKTSCGSPC 215

Query: 192 YAAPE-IVSGLPYEGFASDVWSCGVILFALLTGRLPFDEENGN-----VRDLLLKVQKGQ 245
           YAAPE +VS   YE   +DVWSCGVIL+A+L G LP+D+++ N     +  L   + +  
Sbjct: 216 YAAPELVVSTKAYEARKADVWSCGVILYAMLAGYLPWDDDHENPTGDDIARLYKYITQTP 275

Query: 246 FEMPNNAEISGDAQDLIRRILVVDPTQRIKIRDILSHPLLKKYQTI 291
            + P    I+   +DL+RRILV +P +RI ++ I  H  LK ++  
Sbjct: 276 LKFP--EYITPIPRDLLRRILVPNPRRRINLQTIKRHVWLKPHEAF 319

>Kwal_26.8709 s26 (907885..910374) [2490 bp, 829 aa] {ON} YPL141C -
           Hypothetical ORF [contig 67] FULL
          Length = 829

 Score =  184 bits (468), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 105/284 (36%), Positives = 159/284 (55%), Gaps = 22/284 (7%)

Query: 18  IGPWKLGETLGFGSTGKVQLARHERTG------QKTAVKVIPKSIFKSEGSHGNNDSVLP 71
            GP+ +G TLG G  GKV+L   + +       ++ A+K+I +            +S   
Sbjct: 37  FGPYIVGSTLGEGEFGKVKLGWSKTSNSSMDVPKQVAIKLIRRDTIP-------KNSEKE 89

Query: 72  FNIEREIVIMKLLSHPNVLSLYDVWETDNNLYLILEYAEKGELFNLLVDRGPLPEREAIK 131
             I REI  +K L+HPN++ L +V +    + ++LEYA  GE +  +  +  L E  A +
Sbjct: 90  IKIYREINALKHLNHPNIVRLEEVLQNSKYIGIVLEYASGGEFYKYIQKKRRLKEGPACR 149

Query: 132 CFKQIIIAISYCHALGIVHRDLKPENLLLDNSYNIKIADFGMA-ALQTDAGMLETSCGSP 190
            F Q+I  + Y H+ G+VHRDLK ENLLLD + N+ I DFG       +  +++TSCGSP
Sbjct: 150 LFAQLISGVYYMHSKGLVHRDLKLENLLLDKNENLLITDFGFVNEFLPENELMKTSCGSP 209

Query: 191 HYAAPE-IVSGLPYEGFASDVWSCGVILFALLTGRLPFDEENGN-----VRDLLLKVQKG 244
            YAAPE +V+  PYE   +DVWSCGVIL+A+L G LP+D++  N     +  L   + + 
Sbjct: 210 CYAAPELVVTARPYEARKADVWSCGVILYAMLAGYLPWDDDPENPDGDDIGKLYRYITRT 269

Query: 245 QFEMPNNAEISGDAQDLIRRILVVDPTQRIKIRDILSHPLLKKY 288
             + P+   I+   +DL+R IL+ DP +RI I   L H  L+ +
Sbjct: 270 PLKFPDY--IAPVPRDLLREILIPDPKRRITISKTLKHQWLQPH 311

>TDEL0F04060 Chr6 (749896..753276) [3381 bp, 1126 aa] {ON} Anc_8.279
           YLR096W
          Length = 1126

 Score =  186 bits (471), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 99/286 (34%), Positives = 160/286 (55%), Gaps = 28/286 (9%)

Query: 18  IGPWKLGETLGFGSTGKVQLARHERTGQKTAVKVIPKSIFKSEGSHGNNDSVLPFNIERE 77
           +G W   ET+G GS GKV+LA+H  T +  A+K++ ++   +        S+ P   E E
Sbjct: 75  LGEWDFLETVGAGSMGKVKLAKHRYTKEVCAIKIVNRA---TNAFLHKEQSLPPPKKEEE 131

Query: 78  IV---------------------IMKLLSHPNVLSLYDVWETDNNLYLILEYAEKGELFN 116
           I+                     + ++L HP++  L+++    N+ Y++ EY   G+L +
Sbjct: 132 ILERQKKLEKEISRDKRTIREASLGQILYHPHICRLFEMCTMSNHFYMLFEYVSGGQLLD 191

Query: 117 LLVDRGPLPEREAIKCFKQIIIAISYCHALGIVHRDLKPENLLLDNSYNIKIADFGMAAL 176
            ++  G L E  A K  + I  A+ Y HA  IVHRDLK EN+++  S  IKI DFG++ L
Sbjct: 192 YIIQHGSLREHHARKFTRGIASALQYLHANNIVHRDLKIENIMISTSGEIKIIDFGLSNL 251

Query: 177 QTDAGMLETSCGSPHYAAPEIVSGLPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRD 236
              +  L T CGS ++AAPE++   PY G   DVWS GV+L+ L+ G++PFD+EN +V  
Sbjct: 252 FDKSKQLHTFCGSLYFAAPELLKASPYTGPEVDVWSFGVVLYVLVCGKVPFDDENSSV-- 309

Query: 237 LLLKVQKGQFEMPNNAEISGDAQDLIRRILVVDPTQRIKIRDILSH 282
           L  K+++G+ E P +  I  +   L+ ++LVVDP +R  ++ ++ H
Sbjct: 310 LHEKIKQGKVEYPQHLSI--EVISLLSKMLVVDPHRRASLKQVVEH 353

>KLTH0D10714g Chr4 (880389..883007) [2619 bp, 872 aa] {ON} similar
           to uniprot|Q03002 Saccharomyces cerevisiae YPL141C
           Hypothetical ORF
          Length = 872

 Score =  184 bits (468), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 103/284 (36%), Positives = 159/284 (55%), Gaps = 22/284 (7%)

Query: 18  IGPWKLGETLGFGSTGKVQLARHERTG------QKTAVKVIPKSIFKSEGSHGNNDSVLP 71
            GP+ +G TLG G  GKV++   + +       ++ A+K+I +            +S   
Sbjct: 37  FGPYIVGSTLGEGEFGKVKMGWSKTSSSSMDVPKQVAIKLIRRDTIP-------KNSEKE 89

Query: 72  FNIEREIVIMKLLSHPNVLSLYDVWETDNNLYLILEYAEKGELFNLLVDRGPLPEREAIK 131
             I REI  +K L+HPN++ L +V +    + ++LEYA  GE +  +  +  L E  A +
Sbjct: 90  VKIYREINALKHLNHPNIVRLEEVLQNSKYIGIVLEYASGGEFYKYIQKKRRLKESAACR 149

Query: 132 CFKQIIIAISYCHALGIVHRDLKPENLLLDNSYNIKIADFGMA-ALQTDAGMLETSCGSP 190
            F Q+I  + Y H+ G+VHRDLK ENLLLD + N+ I DFG       +  +++TSCGSP
Sbjct: 150 LFAQLISGVYYMHSKGLVHRDLKLENLLLDKNENLLITDFGFVNEFLPENELMKTSCGSP 209

Query: 191 HYAAPE-IVSGLPYEGFASDVWSCGVILFALLTGRLPFDEENGN-----VRDLLLKVQKG 244
            YAAPE +V+  PYE   +D+WSCGVI++A+L G LP+D++  N     +  L   + + 
Sbjct: 210 CYAAPELVVTARPYEARKADIWSCGVIMYAMLAGYLPWDDDPENPDGDDIGKLYRYITRT 269

Query: 245 QFEMPNNAEISGDAQDLIRRILVVDPTQRIKIRDILSHPLLKKY 288
             + P+   I+   +DL+R ILV DP +RI I   L H  L+ +
Sbjct: 270 PLKFPD--YIAPVPRDLLRAILVADPKKRITIAQTLHHQWLQPH 311

>KLTH0G13288g Chr7 complement(1139058..1142486) [3429 bp, 1142 aa]
           {ON} similar to uniprot|P13186 Saccharomyces cerevisiae
           YLR096W KIN2 Serine/threonine protein kinase involved in
           regulation of exocytosis localizes to the cytoplasmic
           face of the plasma membrane closely related to Kin1p and
           to YDR122W uniprot|P13185 Saccharomyces cerevisiae
           YDR122W KIN1 Serine/threonine protein kinase involved in
           regulation of exocytosis; localizes to the cytoplasmic
           face of the plasma membrane; closely related to Kin2p
          Length = 1142

 Score =  186 bits (471), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 100/288 (34%), Positives = 166/288 (57%), Gaps = 22/288 (7%)

Query: 18  IGPWKLGETLGFGSTGKVQLARHERTGQKTAVKVI---PKSIFKSEGSHG---NNDSVLP 71
           +G W   ET+G GS GKV+LA+H  T +  A+K++    K++   E         + VL 
Sbjct: 181 LGDWDFLETVGAGSMGKVKLAKHRLTHEVCAIKIVNRATKALIHKESQQPPPRTQEEVLE 240

Query: 72  F--NIEREIV----------IMKLLSHPNVLSLYDVWETDNNLYLILEYAEKGELFNLLV 119
               +E+EI           + ++L HP++  L+++    N+ Y++ EY   G+L + ++
Sbjct: 241 RERKLEKEISRDKRTIRESSLGQILYHPHICRLFEMCTMSNHFYMLFEYVSGGQLLDYII 300

Query: 120 DRGPLPEREAIKCFKQIIIAISYCHALGIVHRDLKPENLLLDNSYNIKIADFGMAALQTD 179
             G L ER A K  + I  A+ Y H   IVHRDLK EN+++  S  IKI DFG++ +   
Sbjct: 301 QHGSLRERSARKFARGIASALQYLHLNNIVHRDLKIENIMISTSGEIKIIDFGLSNMFNP 360

Query: 180 AGMLETSCGSPHYAAPEIVSGLPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRDLLL 239
              L T CGS ++AAPE++   PY G   DVWS GV+L+ L+ G++PFD+EN +V  L  
Sbjct: 361 KKQLHTFCGSLYFAAPELLKACPYTGPEVDVWSFGVVLYVLVCGKVPFDDENSSV--LHE 418

Query: 240 KVQKGQFEMPNNAEISGDAQDLIRRILVVDPTQRIKIRDILSHPLLKK 287
           K+++G+ E P +  I  +   L+ ++LVVDP++R  ++ +++H  +++
Sbjct: 419 KIKQGKVEYPQHLSI--EVISLLSKMLVVDPSKRATLKQVVNHQWMQR 464

>SAKL0H06754g Chr8 (594995..597649) [2655 bp, 884 aa] {ON} similar
           to uniprot|Q12152 Saccharomyces cerevisiae YPL150W
           Hypothetical ORF
          Length = 884

 Score =  184 bits (468), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 102/272 (37%), Positives = 152/272 (55%), Gaps = 20/272 (7%)

Query: 18  IGPWKLGETLGFGSTGKVQLARHERTGQKTAVKVIPKSIFKSEGSHGN-NDSVLPFNIER 76
           IG +K+ + +G GS GKV LA H  T QK  +K             GN ND     N+ R
Sbjct: 34  IGNYKIVKLIGEGSFGKVYLANHRLTHQKVVLKT------------GNKNDP----NVVR 77

Query: 77  EIVIMKLLSHPNVLSLYDVWETDNNLYLILEYAEKGELFNLLVDRGPLPEREAIKCFKQI 136
           E+   +    P++  LY+V  T++ +++ LEY    EL+  L+ +  +   E+ K F QI
Sbjct: 78  EVFYHRQFDFPHITKLYEVIVTESKVWMALEYCPGKELYEYLLMQHRISLEESGKLFAQI 137

Query: 137 IIAISYCHALGIVHRDLKPENLLLDNSYNIKIADFGMAALQTDAGMLETSCGSPHYAAPE 196
           + A+ Y H+L  VHRDLK EN+LLD     KI DFG         MLET CG+  Y APE
Sbjct: 138 VSAVYYAHSLQCVHRDLKLENILLDKKGRAKITDFGFTRECATKTMLETVCGTTVYMAPE 197

Query: 197 IVSGLPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRDLLLKVQKGQFEMPNNAEISG 256
           ++    Y+GF  D+WS GVIL+ ++ G +PFDEE+       +  ++  +   N+  +S 
Sbjct: 198 LIERKSYDGFKIDIWSLGVILYTMIHGTMPFDEEDETKTKWKIINEEPFY---NDDVVSK 254

Query: 257 DAQDLIRRILVVDPTQRIKIRDILSHPLLKKY 288
           DA+DLI ++L  DP+QR ++  +L+HP L+ Y
Sbjct: 255 DAKDLISQLLCKDPSQRPQLSQVLAHPFLQPY 286

>TPHA0D01140 Chr4 (238656..240524) [1869 bp, 622 aa] {ON} Anc_8.654
           YPL141C
          Length = 622

 Score =  181 bits (458), Expect = 4e-47,   Method: Compositional matrix adjust.
 Identities = 101/299 (33%), Positives = 159/299 (53%), Gaps = 34/299 (11%)

Query: 18  IGPWKLGETLGFGSTGKVQLA------------------RHERTGQKTAVKVIPKSIFKS 59
            G + LG+TLG G  GKV+L                    +    ++ A+K+I +    +
Sbjct: 56  FGLYTLGQTLGEGEFGKVKLGYINNDNIDTLNSSGSKLGNYSHMPKQVAIKLIRRDTLSA 115

Query: 60  EGSHGNNDSVLPFNIEREIVIMKLLSHPNVLSLYDVWETDNNLYLILEYAEKGELFNLLV 119
                         + REI  +K+L+HPN++ L +V +    + ++LEYA  GE +  + 
Sbjct: 116 SKESE-------IKLYREINALKMLTHPNIVKLEEVLQNSKYIGIVLEYASGGEFYKYIK 168

Query: 120 DRGPLPEREAIKCFKQIIIAISYCHALGIVHRDLKPENLLLDNSYNIKIADFGMAALQTD 179
            +  L E +A   F Q+I  +SY H+ G+VHRDLK ENLLLD + N+ I DFG     T 
Sbjct: 169 FKKRLKESKACTIFAQLISGVSYIHSKGLVHRDLKLENLLLDKAGNLLITDFGFVNEVTK 228

Query: 180 AG-MLETSCGSPHYAAPEIVSGL-PYEGFASDVWSCGVILFALLTGRLPFDEENGNVR-- 235
              ++ T CGSP YAAPE+V+ + PY    +D+WSCGVIL+A+L G LP+D++  N+   
Sbjct: 229 TNKLMHTPCGSPCYAAPELVTSVEPYNARKADIWSCGVILYAMLAGYLPWDDDPKNINGT 288

Query: 236 ---DLLLKVQKGQFEMPNNAEISGDAQDLIRRILVVDPTQRIKIRDILSHPLLKKYQTI 291
               L   ++    + P    I+   +DL+RR+L +DP +R+ ++ IL H  +  +Q  
Sbjct: 289 DIVKLYKYIENQPLKFP--EYINMVPRDLLRRMLEIDPAKRMSMKHILQHAWITPHQVF 345

>NCAS0B01470 Chr2 (241003..243186) [2184 bp, 727 aa] {ON} Anc_8.654
          Length = 727

 Score =  182 bits (461), Expect = 6e-47,   Method: Compositional matrix adjust.
 Identities = 105/284 (36%), Positives = 156/284 (54%), Gaps = 25/284 (8%)

Query: 18  IGPWKLGETLGFGSTGKVQLA---------RHERTGQKTAVKVIPKSIFKSEGSHGNNDS 68
            GP+ +G TLG G  GKV++          +     ++ A+K+I +   K +GS      
Sbjct: 35  FGPYIVGATLGEGEFGKVKMGWSTTSSSSGKITEDSKQVAIKLIRRDFIK-KGSEKE--- 90

Query: 69  VLPFNIEREIVIMKLLSHPNVLSLYDVWETDNNLYLILEYAEKGELFNLLVDRGPLPERE 128
                I REI  +K L+HPN++ L +V +    + ++LEYA  GE +  +  +  L E  
Sbjct: 91  ---MKIFREINSLKHLTHPNIVRLEEVLQNSKYIGIVLEYASGGEFYKYVQRKRRLKEAT 147

Query: 129 AIKCFKQIIIAISYCHALGIVHRDLKPENLLLDNSYNIKIADFGMA-ALQTDAGMLETSC 187
           A + F Q+I  +SY H+ GIVHRDLK ENLLLD   N+ I DFG       D  +++TSC
Sbjct: 148 ACRLFAQLISGVSYMHSKGIVHRDLKLENLLLDKHENLIITDFGFVNEFYADNELMKTSC 207

Query: 188 GSPHYAAPEIV-SGLPYEGFASDVWSCGVILFALLTGRLPFDEENGN-----VRDLLLKV 241
           GSP YAAPE+V +  PY+   +D+WSCG+IL+ +L G LP+D++  N     +  L   +
Sbjct: 208 GSPCYAAPELVITTEPYKARKADIWSCGIILYGMLAGYLPWDDDKQNPNGEDIVRLYHYI 267

Query: 242 QKGQFEMPNNAEISGDAQDLIRRILVVDPTQRIKIRDILSHPLL 285
            K   + P    I+   +DL+R ILV +P +R+  R I  H  L
Sbjct: 268 TKTPLKFP--EYITPLPRDLLRHILVSNPVRRMSSRHIKKHEWL 309

>Ecym_8339 Chr8 (684113..686875) [2763 bp, 920 aa] {ON} similar to
           Ashbya gossypii ACR119W
          Length = 920

 Score =  184 bits (466), Expect = 7e-47,   Method: Compositional matrix adjust.
 Identities = 103/281 (36%), Positives = 155/281 (55%), Gaps = 19/281 (6%)

Query: 18  IGPWKLGETLGFGSTGKVQL----ARHERTGQKTAVKVIPKSIFKSEGSHGNNDSVLPFN 73
            GP+ +G TLG G  GKV+L    ++ E   +  A+K++ +        H   +      
Sbjct: 62  FGPYIVGPTLGEGEFGKVKLGWSNSKPEEGSKNVAIKLVRRDTIPK---HSEKE----VK 114

Query: 74  IEREIVIMKLLSHPNVLSLYDVWETDNNLYLILEYAEKGELFNLLVDRGPLPEREAIKCF 133
           I REI  +K L+HPN++ L +V +    + ++L+YA  GE +  +  +  L E  A + F
Sbjct: 115 IYREINALKHLNHPNIVRLEEVLQNSKYIGIVLQYASGGEFYKYIQKKRRLKEPPACRLF 174

Query: 134 KQIIIAISYCHALGIVHRDLKPENLLLDNSYNIKIADFGMAALQTDAGMLETSCGSPHYA 193
            Q+I  + Y H  G+ HRDLK ENLLLD   N+ I DFG         +++TSCGSP YA
Sbjct: 175 AQLISGVYYMHHKGLAHRDLKLENLLLDEHENLMITDFGFVNEFHKNDLMKTSCGSPCYA 234

Query: 194 APE-IVSGLPYEGFASDVWSCGVILFALLTGRLPFDE-----ENGNVRDLLLKVQKGQFE 247
           APE +V+  PYE   +DVWSCGVIL+A+L G LP+D+     E  ++  L   + K   +
Sbjct: 235 APELVVTARPYEARKADVWSCGVILYAMLAGYLPWDDDPENPEGDDIAKLYHYITKSALK 294

Query: 248 MPNNAEISGDAQDLIRRILVVDPTQRIKIRDILSHPLLKKY 288
            P    I    +DL+RRILV +P  R+ + +I +H  L+ +
Sbjct: 295 FPE--YIKPLPRDLLRRILVSNPDTRLSVMEIKNHEWLRPH 333

>ZYRO0F07194g Chr6 complement(581438..584254) [2817 bp, 938 aa] {ON}
           similar to uniprot|Q12152 Saccharomyces cerevisiae
           YPL150W Hypothetical ORF
          Length = 938

 Score =  183 bits (464), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 103/289 (35%), Positives = 156/289 (53%), Gaps = 18/289 (6%)

Query: 15  LNIIGPWKLGETLGFGSTGKVQLARHERTGQKTAVKVIPKSIFKSEGSHGNNDSVLPFNI 74
           L+ +G +K+ + +G GS GKV LA H+ T +K  +K   KS                 N+
Sbjct: 31  LSEVGNYKILKQIGEGSFGKVYLASHKPTHRKVVLKTSDKS---------------DPNL 75

Query: 75  EREIVIMKLLSHPNVLSLYDVWETDNNLYLILEYAEKGELFNLLVDRGPLPEREAIKCFK 134
            RE+   +    P +  LY+V  T+  +++ LEY    EL+  L+    +P  E  K F 
Sbjct: 76  VREVFYHRQFDFPYITKLYEVIVTETKVWMALEYCPGRELYEHLLMLHRIPLDECAKLFA 135

Query: 135 QIIIAISYCHALGIVHRDLKPENLLLDNSYNIKIADFGMAALQTDAGMLETSCGSPHYAA 194
           QI+ A+ Y H+L  VHRDLK EN+LLD + N K+ DFG          LET CG+  Y A
Sbjct: 136 QIVSAVHYAHSLNCVHRDLKLENILLDKNGNAKLTDFGFTRECVSKSSLETICGTTVYMA 195

Query: 195 PEIVSGLPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRDLLLKVQKGQFEMPNNAEI 254
           PE++    Y+GF  D+WS GVIL+ ++ G +PFDE++       +      F   N+  +
Sbjct: 196 PELIQRQAYDGFKIDIWSLGVILYTMINGTMPFDEDDETKTKWKI---VNDFPNFNDNFV 252

Query: 255 SGDAQDLIRRILVVDPTQRIKIRDILSHPLLKKYQTIKDSKSIKDLPRE 303
           S +A+DLI+R+L   P++R  +  ILSHP L+ Y  I  S++ K + R+
Sbjct: 253 SHEAKDLIKRLLAKCPSERPTMEQILSHPFLQPYGQIMLSRTEKIIKRQ 301

>KLLA0F11319g Chr6 (1042436..1044967) [2532 bp, 843 aa] {ON} similar
           to uniprot|Q12152 Saccharomyces cerevisiae YPL150W
           Hypothetical ORF
          Length = 843

 Score =  182 bits (462), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 105/287 (36%), Positives = 156/287 (54%), Gaps = 20/287 (6%)

Query: 15  LNIIGPWKLGETLGFGSTGKVQLARHERTGQKTAVKVIPKSIFKSEGSHGNNDSVLPFNI 74
           L+ IG +K+ + +G GS GKV LA H  T QK  +K             GN       N+
Sbjct: 31  LSEIGNYKISKFIGEGSFGKVYLATHRLTHQKVVLKT------------GNKRDP---NV 75

Query: 75  EREIVIMKLLSHPNVLSLYDVWETDNNLYLILEYAEKGELFNLLVDRGPLPEREAIKCFK 134
            RE+   +    P +  LY+V  T++ ++++LEY    EL+  L+    L   E+ K F 
Sbjct: 76  VREVFYHRQFDFPYITKLYEVIVTESRVWMVLEYCSGHELYEHLLKEQRLSLEESKKLFS 135

Query: 135 QIIIAISYCHALGIVHRDLKPENLLLDNSYNIKIADFGMAALQTDAGMLETSCGSPHYAA 194
           QI  A+ Y H L  VHRDLK EN+LLD + + K+ DFG          LET CG+  Y A
Sbjct: 136 QIASAVYYAHELKCVHRDLKLENVLLDGNGHAKLTDFGFTREMATRSQLETICGTTVYMA 195

Query: 195 PEIVSGLPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRDLLLKVQKGQFEMPNNAE- 253
           PE++    Y+GF  D+WS G+IL+ ++ G +PFDE++    D+  K++    E+  N E 
Sbjct: 196 PELIERKCYDGFKVDIWSLGIILYTMINGYMPFDEDD----DIKTKLKIVNDELDFNQEW 251

Query: 254 ISGDAQDLIRRILVVDPTQRIKIRDILSHPLLKKYQTIKDSKSIKDL 300
           IS DA DLI+ +L  +P +RI +  +LSHP L+ +  +   K+ K L
Sbjct: 252 ISDDAIDLIQGMLRKNPNERISLAQVLSHPFLQPWGVVAKEKTDKVL 298

>NCAS0C01670 Chr3 complement(306682..309372) [2691 bp, 896 aa] {ON}
           Anc_8.668
          Length = 896

 Score =  182 bits (461), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 97/274 (35%), Positives = 147/274 (53%), Gaps = 18/274 (6%)

Query: 15  LNIIGPWKLGETLGFGSTGKVQLARHERTGQKTAVKVIPKSIFKSEGSHGNNDSVLPFNI 74
           L  +G +K+ + +G GS GKV LA+H  T  K  +K           S   ND     NI
Sbjct: 32  LKEVGNYKILDQIGEGSFGKVYLAQHRPTHTKVVLK-----------SSDKNDP----NI 76

Query: 75  EREIVIMKLLSHPNVLSLYDVWETDNNLYLILEYAEKGELFNLLVDRGPLPEREAIKCFK 134
            RE+   +   +P +  LY+V  T+  +++ LEY    EL++ ++    +P  E ++ F 
Sbjct: 77  VREVFYHRQFDYPYITKLYEVIITETKVWMALEYCPGKELYDRVLSMHRVPTDECVQLFA 136

Query: 135 QIIIAISYCHALGIVHRDLKPENLLLDNSYNIKIADFGMAALQTDAGMLETSCGSPHYAA 194
           QI+  + Y H+L  VHRDLK EN+LLD S + K+ DFG          LET CG+  Y A
Sbjct: 137 QIVGGVHYAHSLNCVHRDLKLENILLDKSGDAKLTDFGFTRECMTKTTLETICGTTVYMA 196

Query: 195 PEIVSGLPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRDLLLKVQKGQFEMPNNAEI 254
           PE++    Y+GF  D+WS GVIL+ ++ G +PFDE++    +  +  Q  Q    N   +
Sbjct: 197 PELIERKSYDGFKIDIWSLGVILYTMINGSMPFDEDDETKTEWKIVHQTPQL---NENIV 253

Query: 255 SGDAQDLIRRILVVDPTQRIKIRDILSHPLLKKY 288
           + DA+DLI R+L  +P  R  +  IL HP L+ +
Sbjct: 254 TADAKDLILRLLAKNPNDRPTVEQILKHPFLQPF 287

>KNAG0A03040 Chr1 complement(372150..374084) [1935 bp, 644 aa] {ON}
           Anc_8.654 YPL141C
          Length = 644

 Score =  179 bits (453), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 120/368 (32%), Positives = 182/368 (49%), Gaps = 49/368 (13%)

Query: 18  IGPWKLGETLGFGSTGKVQLAR-----------HERTGQKTAVKVIPKSIFKSEGSHGNN 66
            GP+ +G TLG G  GKV++              +RT ++ A+K+I +          N+
Sbjct: 47  FGPYIVGSTLGEGEFGKVKMGWTRPVTDGNVGPSQRTPRQVAIKLIRRDTIVR-----NS 101

Query: 67  DSVLPFNIEREIVIMKLLSHPNVLSLYDVWETDNNLYLILEYAEKGELFNLLVDRGPLPE 126
           D      I REI  +K L+HPN++ L ++ +    + ++LEYA  GE +  +  +  L E
Sbjct: 102 DKET--KIYREINALKHLTHPNIIVLEEILQNSKYIGIVLEYASGGEFYKYIQRKRRLKE 159

Query: 127 REAIKCFKQIIIAISYCHALGIVHRDLKPENLLLDNSYNIKIADFGMA-ALQTDAGMLET 185
             A + F Q++  + Y H+ G+VHRDLK ENLLLD + N+ I DFG       +  +++T
Sbjct: 160 VNASRLFSQLVSGVHYMHSKGLVHRDLKLENLLLDKNENLMITDFGFVNEFSNENVLMKT 219

Query: 186 SCGSPHYAAPE-IVSGLPYEGFASDVWSCGVILFALLTGRLPFDEENGN-----VRDLLL 239
           SCGSP YAAPE +VS   Y G   D+WSCGVIL+A+L G LP+D++  N     +  L  
Sbjct: 220 SCGSPCYAAPELVVSREAYVGVKVDIWSCGVILYAMLAGYLPWDDDPSNPNGDDISKLYS 279

Query: 240 KVQKGQFEMPNNAEISGDAQDLIRRILVVDPTQRIKIRDILSHPLLKKYQTIKDSKSIKD 299
            +     + P+   ++   +DL+RRILV DP +R  +  I +H  L              
Sbjct: 280 YITATPLKFPD--YVNPLPRDLLRRILVADPRRRYTLGHIENHEWL-------------- 323

Query: 300 LPRENTYLYPLADADNHTSVTIDDSILQNLVILWHGRPAEEIM--------KKLQDNGTN 351
           LPR        +D DN   +  D S L+    +   RP+  +         + L  NGT 
Sbjct: 324 LPRREFLSVSPSDWDNIMKLKNDKSALERNSPVTGSRPSSMVRIDPGKPFPRNLSSNGTA 383

Query: 352 TEKTLYAL 359
            +  L  L
Sbjct: 384 RQTALETL 391

>CAGL0B01925g Chr2 (176316..179150) [2835 bp, 944 aa] {ON} similar
           to uniprot|P13185 Saccharomyces cerevisiae YDR122w KIN1
           or uniprot|P13186 Saccharomyces cerevisiae YLR096w KIN2
          Length = 944

 Score =  181 bits (459), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 101/291 (34%), Positives = 162/291 (55%), Gaps = 31/291 (10%)

Query: 21  WKLGETLGFGSTGKVQLARHERTGQKTAVKVIPKSIFKSEGSHGNNDSVLP--------- 71
           W   ET+G GS GKV+LA+++ + +  A+K++     ++  ++ +    LP         
Sbjct: 67  WDFMETVGAGSMGKVKLAKNKNSNEVCAIKIV----HRATKAYMHKAQQLPPPADENEAK 122

Query: 72  -----FNIE--------REIVIMKLLSHPNVLSLYDVWETDNNLYLILEYAEKGELFNLL 118
                 N E        RE  + ++L HPNV  LY++    N+ Y+  E+   G+L + +
Sbjct: 123 ERQKRLNKEISRDKRTVREASLGQILFHPNVCKLYEMQTLSNHYYMFFEFISGGQLLDYI 182

Query: 119 VDRGPLPEREAIKCFKQIIIAISYCHALGIVHRDLKPENLLLDNSYNIKIADFGMAALQT 178
           +  G L E  A K  + I+ A+ Y HA  IVHRDLK EN++L  +  IK+ DFG++ +  
Sbjct: 183 IQHGSLKENHARKVSRGILSALQYLHANNIVHRDLKIENIMLSKTGEIKLIDFGLSNMYD 242

Query: 179 DAGMLETSCGSPHYAAPEIVSGLPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRDLL 238
               L+T CGS ++AAPE++   PY G   DVWS GV+L+ L+ G++PFD+EN +   L 
Sbjct: 243 PRKSLQTFCGSLYFAAPELLKAHPYLGPEVDVWSFGVVLYVLVCGKVPFDDENSSA--LH 300

Query: 239 LKVQKGQFEMPNNAEISGDAQDLIRRILVVDPTQRIKIRDILSHP-LLKKY 288
            K++KG+   P    I  D   L+ +ILVVDP +R  ++ +++H  +LK Y
Sbjct: 301 EKIKKGKVTYPQFLSI--DVISLLSKILVVDPQKRATLQQVVNHQWMLKGY 349

>KNAG0J01670 Chr10 complement(304021..307050) [3030 bp, 1009 aa]
           {ON} 
          Length = 1009

 Score =  181 bits (460), Expect = 5e-46,   Method: Compositional matrix adjust.
 Identities = 97/276 (35%), Positives = 153/276 (55%), Gaps = 18/276 (6%)

Query: 15  LNIIGPWKLGETLGFGSTGKVQLARHERTGQKTAVKVIPKSIFKSEGSHGNNDSVLPFNI 74
           L ++G +K+ E +G GS GKV LA H  T +K  +K           S   ND     NI
Sbjct: 40  LTVVGNYKILEQIGEGSFGKVYLAMHRPTHRKVVIK-----------SSVKNDP----NI 84

Query: 75  EREIVIMKLLSHPNVLSLYDVWETDNNLYLILEYAEKGELFNLLVDRGPLPEREAIKCFK 134
            RE+   +   +  +  LY++  T++ +++ LEY    EL++ ++    +P  E I+ F 
Sbjct: 85  VREVFYHRQFEYHYITKLYEIIVTESKVWMALEYCPGRELYDHVLQMKRIPAEECIQLFS 144

Query: 135 QIIIAISYCHALGIVHRDLKPENLLLDNSYNIKIADFGMAALQTDAGMLETSCGSPHYAA 194
           QI+ A+ Y H+L  VHRDLK EN+LLD   N K+ DFG      +   LET CG+  Y A
Sbjct: 145 QIVGAVYYAHSLNCVHRDLKLENILLDKDGNAKLTDFGFTRECMEKVNLETICGTTVYMA 204

Query: 195 PEIVSGLPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRDLLLKVQKGQFEMPNNAEI 254
           PE+    PY+GF  D+WS GVIL+ +L+G +PFDE++       +  ++ ++   N+  +
Sbjct: 205 PELTERKPYDGFKIDIWSLGVILYTMLSGSMPFDEDDEAKTKWKIINEEPEY---NSKFM 261

Query: 255 SGDAQDLIRRILVVDPTQRIKIRDILSHPLLKKYQT 290
           + + +DL+R++L  D   R  +R+IL H  L+ Y T
Sbjct: 262 TAEGEDLVRKLLQKDSNLRPSVREILQHEFLQPYGT 297

>ACR119W Chr3 (560761..563556) [2796 bp, 931 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPL141C and YOR233W
           (KIN4)
          Length = 931

 Score =  180 bits (456), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 105/281 (37%), Positives = 152/281 (54%), Gaps = 19/281 (6%)

Query: 18  IGPWKLGETLGFGSTGKVQL----ARHERTGQKTAVKVIPKSIFKSEGSHGNNDSVLPFN 73
            GP+ +G TLG G  GKV+L    AR +   +  A+K+I +            +S     
Sbjct: 42  FGPYIIGPTLGEGEFGKVKLGWSKARLDGDSRNVAIKLIRRDTVP-------KNSEKEIK 94

Query: 74  IEREIVIMKLLSHPNVLSLYDVWETDNNLYLILEYAEKGELFNLLVDRGPLPEREAIKCF 133
           I RE+  +KLLSHPN++ L +V +    + ++L+YA  GE +  +  +  L E  A + F
Sbjct: 95  IYRELNALKLLSHPNIVRLEEVLQNSKYIGIVLQYASGGEFYKYIQKKRRLKEPPACRLF 154

Query: 134 KQIIIAISYCHALGIVHRDLKPENLLLDNSYNIKIADFGMAALQTDAGMLETSCGSPHYA 193
            Q+I  + Y H  G+ HRDLK ENLLLD   N+ I DFG         ++ TSCGSP YA
Sbjct: 155 AQLISGVHYIHYKGLAHRDLKLENLLLDEHENLIITDFGFVNEFHKNDLMRTSCGSPCYA 214

Query: 194 APE-IVSGLPYEGFASDVWSCGVILFALLTGRLPFDE-----ENGNVRDLLLKVQKGQFE 247
           APE +VS  PY    +DVWSCGVIL+A+L G LP+D+     E  ++  L   +     +
Sbjct: 215 APELVVSSKPYSAQKADVWSCGVILYAMLAGYLPWDDDPENPEGEDIAKLYQYITHTSLK 274

Query: 248 MPNNAEISGDAQDLIRRILVVDPTQRIKIRDILSHPLLKKY 288
            P    I    +DL++RILV +P  R+ + DI  H  L+ +
Sbjct: 275 FPE--YIKPIPRDLLKRILVSNPEVRLTVADIEQHAWLQPH 313

>ZYRO0D06776g Chr4 complement(583027..586641) [3615 bp, 1204 aa]
           {ON} similar to uniprot|P13186 Saccharomyces cerevisiae
           YLR096W KIN2 Serine/threonine protein kinase involved in
           regulation of exocytosis localizes to the cytoplasmic
           face of the plasma membrane closely related to Kin1p and
           to YDR122W uniprot|P13185 Saccharomyces cerevisiae
           YDR122W KIN1 Serine/threonine protein kinase involved in
           regulation of exocytosis; localizes to the cytoplasmic
           face of the plasma membrane; closely related to Kin2p
          Length = 1204

 Score =  181 bits (458), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 97/285 (34%), Positives = 156/285 (54%), Gaps = 26/285 (9%)

Query: 18  IGPWKLGETLGFGSTGKVQLARHERTGQKTAVKVIPKSIFKSEGSHGNNDSVLPFNIE-- 75
           +G W   ET+G GS GKV++A+H  T +  A+K+I ++       H       P N +  
Sbjct: 137 LGDWDFLETVGAGSMGKVKIAKHHYTNEICAIKIINRAT--KAFLHKEQQLPPPQNEQEA 194

Query: 76  ------------------REIVIMKLLSHPNVLSLYDVWETDNNLYLILEYAEKGELFNL 117
                             RE  + + L HP++  L+++    N+ Y++ EY   G+L + 
Sbjct: 195 LERQKKLEKEISRDKRTIREASLGQALYHPHICRLFEMCTMSNHFYMLFEYVSGGQLLDY 254

Query: 118 LVDRGPLPEREAIKCFKQIIIAISYCHALGIVHRDLKPENLLLDNSYNIKIADFGMAALQ 177
           ++  G L E  A K  + I  A+ Y HA  IVHRDLK EN+++  S  IKI DFG++ + 
Sbjct: 255 IIQHGSLREHHARKFARGIASALQYLHANNIVHRDLKIENIMISTSGEIKIIDFGLSNMF 314

Query: 178 TDAGMLETSCGSPHYAAPEIVSGLPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRDL 237
                L T CGS ++AAPE++   PY G   DVWS GV+L+ L+ G++PFD+EN +V  L
Sbjct: 315 DPRTQLHTFCGSLYFAAPELLKASPYVGPEVDVWSFGVVLYVLVCGKVPFDDENSSV--L 372

Query: 238 LLKVQKGQFEMPNNAEISGDAQDLIRRILVVDPTQRIKIRDILSH 282
             K+++G+ + P +  I  +   L+ ++LVVDP +R  ++ ++ H
Sbjct: 373 HEKIKQGKVDYPQHLSI--EVISLLSKMLVVDPRKRASLKQVVEH 415

>NDAI0E02390 Chr5 complement(496256..498907) [2652 bp, 883 aa] {ON}
           Anc_8.668
          Length = 883

 Score =  179 bits (455), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 103/285 (36%), Positives = 158/285 (55%), Gaps = 23/285 (8%)

Query: 10  RITKP-LNIIGPWKLGETLGFGSTGKVQLARHERTGQKTAVKVIPKSIFKSEGSHGNNDS 68
           + T P L  +G +K+ + +G GS GKV LA H    + T  KV+ K+  KS+        
Sbjct: 26  QFTSPDLKEVGNYKILDQIGEGSFGKVYLASH----RLTHCKVVLKTSNKSDP------- 74

Query: 69  VLPFNIEREIVIMKLLSHPNVLSLYDVWETDNNLYLILEYAEKGELFNLLVDRGPLPERE 128
               NI RE+   +   +P +  LY+V  T++ +++  EY    +L++ ++    +P   
Sbjct: 75  ----NIVREVFYHRQFDYPYITQLYEVIVTESKVWMAQEYCPGKDLYDHVLSLQRVPSSA 130

Query: 129 AIKCFKQIIIAISYCHALGIVHRDLKPENLLLDNSYNIKIADFGMAALQTDAGMLETSCG 188
            I+ F QI+ A+ Y H+L  VHRDLK EN+LLD + N K+ DFG          LET CG
Sbjct: 131 CIELFTQIVGAVYYAHSLNCVHRDLKLENILLDKNGNAKLTDFGFTRECMTKTSLETICG 190

Query: 189 SPHYAAPEIVSGLPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRDLLLKVQKGQFEM 248
           +  Y APE++    Y+GF  D+WS GVIL+ +L G +PFDE+     D      K   EM
Sbjct: 191 TTVYMAPELIKRESYDGFKIDIWSLGVILYTMLNGSMPFDED-----DETKTEWKIMNEM 245

Query: 249 P--NNAEISGDAQDLIRRILVVDPTQRIKIRDILSHPLLKKYQTI 291
           P  N+  +S DA+DL+ ++L  DP +R  +++IL HP L+ Y ++
Sbjct: 246 PVFNDTILSEDAKDLLIKLLSKDPNERPSMQEILHHPFLQPYGSL 290

>TBLA0B03970 Chr2 complement(904167..907793) [3627 bp, 1208 aa] {ON}
           Anc_8.654 YPL141C
          Length = 1208

 Score =  180 bits (456), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 107/277 (38%), Positives = 155/277 (55%), Gaps = 14/277 (5%)

Query: 18  IGPWKLGETLGFGSTGKVQLARHERTGQKTAV--KVIPKSIFKSEGSHGNNDSVLPFNIE 75
            GP+ +G TLG G  GKV+L   + +   T V  +V  K I +     G+   +    I 
Sbjct: 69  FGPYIVGSTLGEGEFGKVKLGWVKASPNDTQVPKQVAIKLIRRDAIVKGSEKEI---KIY 125

Query: 76  REIVIMKLLSHPNVLSLYDVWETDNNLYLILEYAEKGELFNLLVDRGPLPEREAIKCFKQ 135
           REI  +K L+HPN++ L +V +    + ++LEYA  GE +  +  +  L E  A   F Q
Sbjct: 126 REINALKHLTHPNIVRLEEVLQNSKYIGIVLEYASGGEFYKYIQKKRRLKESVASNLFSQ 185

Query: 136 IIIAISYCHALGIVHRDLKPENLLLDNSYNIKIADFGMA-ALQTDAGMLETSCGSPHYAA 194
           ++  + Y H  G+VHRDLK ENLLLD   N+ I DFG        + +++TSCGSP YAA
Sbjct: 186 LVSGVYYMHCKGLVHRDLKLENLLLDKYGNLIITDFGFVNEFSKFSELMKTSCGSPCYAA 245

Query: 195 PEIV-SGLPYEGFASDVWSCGVILFALLTGRLPFDEE----NGN-VRDLLLKVQKGQFEM 248
           PE+V S  PYE   +D+WSCG+ILFA+L G LP+D++    +GN +  L   +     + 
Sbjct: 246 PELVISTRPYEARKADIWSCGIILFAMLAGYLPWDDDPKNPDGNDIAKLYKYITTTPLKF 305

Query: 249 PNNAEISGDAQDLIRRILVVDPTQRIKIRDILSHPLL 285
           P    IS  A+DL+R IL+  P +R  ++ IL H  L
Sbjct: 306 P--EYISPMARDLLRNILIPYPQKRATLKQILKHQWL 340

>Kwal_26.8751 s26 complement(928853..931399) [2547 bp, 848 aa] {ON}
           YPL150W - Hypothetical ORF [contig 67] FULL
          Length = 848

 Score =  177 bits (448), Expect = 6e-45,   Method: Compositional matrix adjust.
 Identities = 97/275 (35%), Positives = 150/275 (54%), Gaps = 20/275 (7%)

Query: 15  LNIIGPWKLGETLGFGSTGKVQLARHERTGQKTAVKVIPKSIFKSEGSHGNNDSVLPFNI 74
           L  +G +K+ + +G GS GKV LA H  T QK  +K+  K           ND     N+
Sbjct: 31  LQEVGNYKILKIVGEGSFGKVYLASHCLTHQKVVLKMGSK-----------NDP----NV 75

Query: 75  EREIVIMKLLSHPNVLSLYDVWETDNNLYLILEYAEKGELFNLLVDRGPLPEREAIKCFK 134
            RE+   +   + ++  LY+V  T+N +++ LEY    EL+  L+ +  +P  E  + F 
Sbjct: 76  VREVFYHRQFDYSHITKLYEVIVTENYVWMALEYCPGKELYEYLLAKKHIPLEECSELFS 135

Query: 135 QIIIAISYCHALGIVHRDLKPENLLLDNSYNIKIADFGMAALQTDAGMLETSCGSPHYAA 194
           QI+ A+ Y H++  VHRDLK EN+LLD   + K+ DFG        G+LET CG+  Y A
Sbjct: 136 QIVGAVYYAHSMKCVHRDLKLENILLDKKGHAKLTDFGFTRECATKGILETICGTTVYMA 195

Query: 195 PEIVSGLPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRDLLLKVQKGQFE-MPNNAE 253
           PE++   PYEG+  D WS G+IL+ ++ G +PFDE    V ++  K +   +    +N  
Sbjct: 196 PELIERKPYEGYKIDTWSLGIILYTMIHGTMPFDE----VDEVKTKYKIVHYNPTYDNDY 251

Query: 254 ISGDAQDLIRRILVVDPTQRIKIRDILSHPLLKKY 288
           I  + ++LI ++L  DP QR  +  +L HP L+ Y
Sbjct: 252 IDSNGKELISQLLEKDPNQRPSLTQVLQHPFLQPY 286

>KNAG0D01090 Chr4 complement(183319..184437) [1119 bp, 372 aa] {ON} 
          Length = 372

 Score =  167 bits (424), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 93/273 (34%), Positives = 149/273 (54%), Gaps = 23/273 (8%)

Query: 23  LGETLGFGSTGKVQLARHERTGQKTAVKVIPKSIFKSEGSHGNNDSVLPFNIEREIV--- 79
           +G  LG G  GKV   RH+ +G   A+KV+ K+             +L + +ER+ +   
Sbjct: 115 IGLKLGKGKFGKVFCVRHKESGFICALKVMQKT------------DILQYKLERQFIREV 162

Query: 80  -IMKLLSHPNVLSLYDVWETDNNLYLILEYAEKGELFNLLVDRGPLPEREAIKCFKQIII 138
            I   L+HPN+  LY  +  +  +YLI+EY   GEL+  L   GP     A     QI  
Sbjct: 163 EIQSSLNHPNIAKLYGYFHDEKRVYLIMEYMLYGELYKTLEIHGPFENAVATNYVYQIAS 222

Query: 139 AISYCHALGIVHRDLKPENLLLDNSYNIKIADFGMAALQTDAGMLETSCGSPHYAAPEIV 198
           AI Y H   I+HRD+KPEN+L+     +K+ DFG + +        T CG+  Y +PEIV
Sbjct: 223 AILYLHQRHIIHRDIKPENILIGPHNQLKLTDFGWSIINPKGLRRRTFCGTIDYLSPEIV 282

Query: 199 SGLPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRDLLL-KVQKGQFEMPNNAEISGD 257
               Y+    D+W+ G++ + LL G  PF+E   N +DL   ++++G    P   +++ +
Sbjct: 283 DYKEYD-HNVDIWALGIVAYELLVGSPPFEE---NTKDLTYERIRRGDIVFPK--QVTPE 336

Query: 258 AQDLIRRILVVDPTQRIKIRDILSHPLLKKYQT 290
           A+D I RILV++P +R+ +++I+SHP + KY++
Sbjct: 337 ARDFIERILVLEPKKRMTLKEIMSHPWILKYKS 369

>Kpol_1072.19 s1072 (44906..47596) [2691 bp, 896 aa] {ON}
           (44906..47596) [2691 nt, 897 aa]
          Length = 896

 Score =  176 bits (447), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 93/274 (33%), Positives = 150/274 (54%), Gaps = 18/274 (6%)

Query: 15  LNIIGPWKLGETLGFGSTGKVQLARHERTGQKTAVKVIPKSIFKSEGSHGNNDSVLPFNI 74
           LN +G +K+ + +G GS GKV LA H+ T +K  +K              ++D   P N+
Sbjct: 33  LNEVGNYKILKQIGEGSFGKVYLALHKPTHKKVVLK--------------SSDKTDP-NV 77

Query: 75  EREIVIMKLLSHPNVLSLYDVWETDNNLYLILEYAEKGELFNLLVDRGPLPEREAIKCFK 134
            REI   +    P +  LY+V  T+  +++++EY    EL++ L+ +  +   E+ + F 
Sbjct: 78  VREIFYHRQFDFPYITKLYEVIITETKVWMVIEYCPNKELYDYLLSKKRISLDESARIFA 137

Query: 135 QIIIAISYCHALGIVHRDLKPENLLLDNSYNIKIADFGMAALQTDAGMLETSCGSPHYAA 194
           QI+ A+ Y H+L  VHRDLK EN+LLD   N K+ DFG     +    LET CG+  Y A
Sbjct: 138 QIVGAVYYAHSLSCVHRDLKLENILLDKDNNAKLTDFGFTRDFSKNTQLETICGTTVYMA 197

Query: 195 PEIVSGLPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRDLLLKVQKGQFEMPNNAEI 254
           PE++    Y+G+  D+W+ G++L+ ++ G +PFDE++    +L +      ++   N   
Sbjct: 198 PELLRREKYDGYKIDIWALGILLYTIINGTMPFDEDDPKKTELKIISASPDYD---NKYF 254

Query: 255 SGDAQDLIRRILVVDPTQRIKIRDILSHPLLKKY 288
           + D+ DL+ R+L  DP+ R  I  IL HP L  Y
Sbjct: 255 NDDSIDLVNRLLSKDPSMRPTIEQILMHPFLASY 288

>KNAG0H03140 Chr8 complement(589553..592363) [2811 bp, 936 aa] {ON}
           Anc_8.279 YLR096W
          Length = 936

 Score =  176 bits (447), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 99/297 (33%), Positives = 163/297 (54%), Gaps = 27/297 (9%)

Query: 4   ANMETYRITKPLNIIGPWKLGETLGFGSTGKVQLARHERTGQKTAVKVIPKS----IFKS 59
           A  + YR++     +G W    T+G GS GKV+LARH       AVK++ ++    +++ 
Sbjct: 106 ATRQFYRMS-----LGDWDFQTTVGAGSMGKVKLARHRYDDTVCAVKIVNRATKTFLYRQ 160

Query: 60  EGSHG--------NNDSVLPFNIER------EIVIMKLLSHPNVLSLYDVWETDNNLYLI 105
           + +            + +L   I R      E  + ++LSH N+  LY +    N+ Y++
Sbjct: 161 QSAPAPQSKADIKERERLLAKEIARDTRTVREASLGQVLSHQNICQLYQMCTMSNHFYMM 220

Query: 106 LEYAEKGELFNLLVDRGPLPEREAIKCFKQIIIAISYCHALGIVHRDLKPENLLLDNSYN 165
            EY   G+L + ++  G L E  A    + I   ++Y HA  +VHRDLK EN++L  +  
Sbjct: 221 FEYVSGGQLLDYIIQHGSLREPLARSFARAIASGLAYLHANNVVHRDLKIENIMLTAAGE 280

Query: 166 IKIADFGMAALQTDAGMLETSCGSPHYAAPEIVSGLPYEGFASDVWSCGVILFALLTGRL 225
           IKI DFG++ L      L T CGS ++AAPE++   PY G   D+WS GVIL+ L+ G++
Sbjct: 281 IKIIDFGLSNLFDPRAKLTTYCGSLYFAAPELLRAKPYIGPEIDIWSFGVILYVLVVGKV 340

Query: 226 PFDEENGNVRDLLLKVQKGQFEMPNNAEISGDAQDLIRRILVVDPTQRIKIRDILSH 282
           PFD+EN N   L  K+++G+   P  A +S +   L+ ++L V+P +R  +++I++H
Sbjct: 341 PFDDENSNA--LHEKIKRGKVSYP--ATLSIECISLLTKMLTVNPKRRATLKEIVTH 393

>KLTH0D11044g Chr4 complement(901388..903937) [2550 bp, 849 aa] {ON}
           similar to uniprot|Q12152 Saccharomyces cerevisiae
           YPL150W
          Length = 849

 Score =  174 bits (442), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 97/277 (35%), Positives = 149/277 (53%), Gaps = 30/277 (10%)

Query: 15  LNIIGPWKLGETLGFGSTGKVQLARHERTGQKTAVKVIPKSIFKSEGSHGNNDSVLPFNI 74
           L  +G +++ + +G GS GKV LA H  T QK  +K+  K           ND     N+
Sbjct: 31  LRDVGNYRILKIVGEGSFGKVYLASHRLTHQKVVLKMGSK-----------NDP----NV 75

Query: 75  EREIVIMKLLSHPNVLSLYDVWETDNNLYLILEYAEKGELFNLLVDRGPLPEREAIKCFK 134
            RE+   +   +  +  LY+V  T+N++++ LEY    EL+  L+ +  +P  E    F 
Sbjct: 76  VREVFYHRQFDYVYITKLYEVIVTENSVWMALEYCPGKELYEYLLIKKRIPLDECSHLFS 135

Query: 135 QIIIAISYCHALGIVHRDLKPENLLLDNSYNIKIADFGMAALQTDAGMLETSCGSPHYAA 194
           QI+ A+ Y H++  VHRDLK EN+LLD     K+ DFG        G+LET CG+  Y A
Sbjct: 136 QIVGAVFYAHSMKCVHRDLKLENILLDKKGQAKLTDFGFTRECATKGILETVCGTTVYMA 195

Query: 195 PEIVSGLPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRDLLLKVQKGQFEMPNNAE- 253
           PE++   PYEG+  D WS G+IL+ ++ G +PFDEE+    D+     K ++ + NN   
Sbjct: 196 PELIERKPYEGYKIDTWSLGIILYTMIHGAMPFDEED----DI-----KTKYRIVNNEPF 246

Query: 254 -----ISGDAQDLIRRILVVDPTQRIKIRDILSHPLL 285
                I  + +DLI ++L  DP+QR  +  +L HP +
Sbjct: 247 YDDNFIDANGKDLIMQLLQKDPSQRPSLTQVLQHPFM 283

>TDEL0A06140 Chr1 complement(1074016..1076601) [2586 bp, 861 aa]
           {ON} Anc_8.668 YPL150W
          Length = 861

 Score =  173 bits (438), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 101/276 (36%), Positives = 146/276 (52%), Gaps = 22/276 (7%)

Query: 15  LNIIGPWKLGETLGFGSTGKVQLARHERTGQKTAVKVIPKSIFKSEGSHGNNDSVLPFNI 74
           L+ +G +K+ + +G GS GKV LA H+ T +K  +K   K           ND     N+
Sbjct: 31  LSEVGNYKIMKQIGEGSFGKVYLASHKPTHRKVVLKTSDK-----------NDP----NV 75

Query: 75  EREIVIMKLLSHPNVLSLYDVWETDNNLYLILEYAEKGELFNLLVDRGPLPEREAIKCFK 134
            RE+   +   +  +  LY+V  T+  +++ LEY    EL+  L+    +   E  + F 
Sbjct: 76  VREVFYHRQFDYLYITRLYEVIVTETKVWMALEYCPGKELYEHLLALKRISLDECSRLFA 135

Query: 135 QIIIAISYCHALGIVHRDLKPENLLLDNSYNIKIADFGMAALQTDAGMLETSCGSPHYAA 194
           QI+ AI Y H+L  VHRDLK EN+LLD   N K+ DFG          L+T CG+  Y A
Sbjct: 136 QIVGAIYYAHSLNCVHRDLKLENILLDKKGNAKLTDFGFTRECVSKSQLDTICGTTVYMA 195

Query: 195 PEIVSGLPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRDLLLKVQKGQFEMP--NNA 252
           PE+     Y+GF  D+W+ GVIL+ ++ G +PFDE+     D      K   EMP  N  
Sbjct: 196 PELTERKSYDGFKIDIWALGVILYTMINGSMPFDED-----DEAKTKWKIVNEMPEINED 250

Query: 253 EISGDAQDLIRRILVVDPTQRIKIRDILSHPLLKKY 288
            +S DA+DLI ++L  DP +R  I  IL+HP L+ Y
Sbjct: 251 LVSPDAKDLIEQLLAKDPNERPSIEKILTHPFLQPY 286

>TBLA0B03860 Chr2 (887855..890821) [2967 bp, 988 aa] {ON} Anc_8.668
           YPL150W
          Length = 988

 Score =  173 bits (439), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 101/279 (36%), Positives = 149/279 (53%), Gaps = 22/279 (7%)

Query: 15  LNIIGPWKLGETLGFGSTGKVQLARHERTGQKTAVKVIPKSIFKSEGSHGNNDSVLPFNI 74
           L  +G +++   +G GS GKV LA H  T +K    V+ KS  KS+            N+
Sbjct: 31  LTEVGNYRILRQIGEGSFGKVYLAHHLPTHRK----VVLKSSAKSDP-----------NV 75

Query: 75  EREIVIMKLLSHPNVLSLYDVWETDNNLYLILEYAEKGELFNLLVDRGPLPEREAIKCFK 134
            RE+   +    P +  LY++  T+  +++ LEY    EL+  L+    +P  E  + F 
Sbjct: 76  VREVFYHRQFEFPYITKLYEIIVTETKVWMALEYCPGKELYEHLLRLHRIPVDECSRLFA 135

Query: 135 QIIIAISYCHALGIVHRDLKPENLLLDNSYNIKIADFGMAALQTDAGMLETSCGSPHYAA 194
           QI  A+ Y H+L  VHRDLK EN+LLD   N K+ DFG         +LET CG+  Y A
Sbjct: 136 QISGAMYYAHSLNCVHRDLKLENILLDKVGNAKLTDFGFTRECASKNILETICGTTVYMA 195

Query: 195 PEIVSGLPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRDLLLKVQKGQFEMP--NNA 252
           PE++    Y+GF  DVWS GVIL+ LL G +PFDEE    ++   K+     EMP  ++ 
Sbjct: 196 PELIKRERYDGFKIDVWSLGVILYTLLNGFMPFDEEQQ--KNTEWKIVN---EMPSFDST 250

Query: 253 EISGDAQDLIRRILVVDPTQRIKIRDILSHPLLKKYQTI 291
            +  DA DL+ ++L  DP  R  ++++L HP L+ Y  +
Sbjct: 251 LLGPDAVDLLSKLLAKDPIDRPSMKEVLEHPYLQPYGNV 289

>KLLA0D07348g Chr4 (626999..629728) [2730 bp, 909 aa] {ON} similar
           to uniprot|Q03002 Saccharomyces cerevisiae YPL141C
           Hypothetical ORF
          Length = 909

 Score =  171 bits (434), Expect = 5e-43,   Method: Compositional matrix adjust.
 Identities = 102/281 (36%), Positives = 154/281 (54%), Gaps = 19/281 (6%)

Query: 18  IGPWKLGETLGFGSTGKVQLARHERTGQKT---AVKVIPKSIFKSEGSHGNNDSVLPFNI 74
            GP+ +G TLG G  GKV+L   +    ++   A+K+I +            +S     I
Sbjct: 53  FGPYIIGPTLGEGEFGKVKLGWSKSNSDESKNVAIKLIRRDTIP-------KNSEKEVKI 105

Query: 75  EREIVIMKLLSHPNVLSLYDVWETDNNLYLILEYAEKGELFNLLVDRGPLPEREAIKCFK 134
            REI  +K L+HPN+++L +V +    + ++L YA  GE +  +  +  L E  A + F 
Sbjct: 106 YREINALKHLAHPNIVTLEEVLQNSKYIGIVLHYASGGEFYKYIQKKRRLKEPAACRLFA 165

Query: 135 QIIIAISYCHALGIVHRDLKPENLLLDNSYNIKIADFGMA-ALQTDAGMLETSCGSPHYA 193
           Q+I  + Y H  G+ HRDLK ENLLLD   N+ I DFG      +   +++TSCGSP YA
Sbjct: 166 QLISGVHYMHHKGLAHRDLKLENLLLDEHENLIITDFGFVNEFSSRNDLMKTSCGSPCYA 225

Query: 194 APE-IVSGLPYEGFASDVWSCGVILFALLTGRL-----PFDEENGNVRDLLLKVQKGQFE 247
           APE +V+   YE   +DVWSCGVIL+A+L G L     P + +  ++  L   + K   +
Sbjct: 226 APELVVTTKAYEARKADVWSCGVILYAMLAGYLPWDDDPDNPDGDDIAKLYNYITKTSLK 285

Query: 248 MPNNAEISGDAQDLIRRILVVDPTQRIKIRDILSHPLLKKY 288
            P    I+   +D++RRILV DP++RI +  IL H  L+ +
Sbjct: 286 FPE--YINPIPRDILRRILVSDPSKRITVELILKHQWLQPH 324

>TPHA0G01630 Chr7 (336511..339126) [2616 bp, 871 aa] {ON} Anc_8.668
           YPL150W
          Length = 871

 Score =  171 bits (433), Expect = 6e-43,   Method: Compositional matrix adjust.
 Identities = 95/271 (35%), Positives = 149/271 (54%), Gaps = 18/271 (6%)

Query: 18  IGPWKLGETLGFGSTGKVQLARHERTGQKTAVKVIPKSIFKSEGSHGNNDSVLPFNIERE 77
           +G +K+ + +G GS GKV LA H  T +K    V+ KS  K++            N+ RE
Sbjct: 34  VGNYKILKQVGEGSFGKVYLAIHRPTHRK----VVLKSSSKTDP-----------NVVRE 78

Query: 78  IVIMKLLSHPNVLSLYDVWETDNNLYLILEYAEKGELFNLLVDRGPLPEREAIKCFKQII 137
           +   +   HP +  LY++  T+  +++ LEY    EL++ L+    +P  E  + F QI+
Sbjct: 79  VFYHRQFDHPYITKLYEIIITETKVWMSLEYCPGKELYDYLLVMRRIPLDECSRLFAQIV 138

Query: 138 IAISYCHALGIVHRDLKPENLLLDNSYNIKIADFGMAALQTDAGMLETSCGSPHYAAPEI 197
            A+ Y H+L  VHRDLK EN+LLD   N K+ADFG          LET CG+  Y APE+
Sbjct: 139 GAVYYAHSLNCVHRDLKLENILLDMQGNAKLADFGFTRECATKNQLETICGTTVYMAPEL 198

Query: 198 VSGLPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRDLLLKVQKGQFEMPNNAEISGD 257
           +    Y+GF  D+WS GVIL+ L+ G +PFDEE+    +  +  ++  +   N    + +
Sbjct: 199 LRRDTYDGFKIDIWSLGVILYTLINGSMPFDEEDETRTEWKIINEEPDY---NEKIFNAN 255

Query: 258 AQDLIRRILVVDPTQRIKIRDILSHPLLKKY 288
           + +LI+ +L+ DP +R  + +IL H  L+ Y
Sbjct: 256 SIELIKSLLIKDPKKRPSMTEILKHKFLEPY 286

>Ecym_2405 Chr2 (788655..791222) [2568 bp, 855 aa] {ON} similar to
           Ashbya gossypii ACR133C
          Length = 855

 Score =  171 bits (432), Expect = 7e-43,   Method: Compositional matrix adjust.
 Identities = 99/279 (35%), Positives = 147/279 (52%), Gaps = 22/279 (7%)

Query: 15  LNIIGPWKLGETLGFGSTGKVQLARHERTGQKTAVKVIPKSIFKSEGSHGNNDSVLPFNI 74
           L  +G +K+ + +G GS GKV LA H+ T QK  +K   K                  N+
Sbjct: 31  LKEVGNYKILKQVGEGSFGKVYLANHKLTHQKVVLKTGEKK---------------DPNV 75

Query: 75  EREIVIMKLLSHPNVLSLYDVWETDNNLYLILEYAEKGELFNLLVDRGPLPEREAIKCFK 134
            RE+   +    P +  LY+V  T++ +++ LEY    EL++ L+ +  +P  E  K F 
Sbjct: 76  VREVFYHRQFDFPFITKLYEVIVTESKVWMALEYCPGNELYDYLLQKQRIPLDETSKLFA 135

Query: 135 QIIIAISYCHALGIVHRDLKPENLLLDNSYNIKIADFGMAALQTDAGMLETSCGSPHYAA 194
           QI+ A+ Y H+L  VHRDLK EN+LLD      + DFG          LET CG+  Y A
Sbjct: 136 QIVGAVFYAHSLQCVHRDLKLENILLDKQGYAMLTDFGFTRECATKTQLETICGTTVYMA 195

Query: 195 PEIVSGLPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRDLLLKVQKGQFEMPN--NA 252
           PE++    Y+G+  D WS G+IL+ +L G +PFDEE+  +  L     K   EMP   +A
Sbjct: 196 PELIKRESYDGYKVDTWSLGIILYTMLHGFMPFDEEDPTLTGL-----KIMNEMPPIVDA 250

Query: 253 EISGDAQDLIRRILVVDPTQRIKIRDILSHPLLKKYQTI 291
             +  A+DLI ++L   P++R  +  +L HP L+ Y TI
Sbjct: 251 YTNVHAKDLILKLLRKTPSERPSLNKVLEHPFLQPYGTI 289

>Suva_16.160 Chr16 (277393..280149) [2757 bp, 918 aa] {ON} YPL150W
           (REAL)
          Length = 918

 Score =  171 bits (433), Expect = 8e-43,   Method: Compositional matrix adjust.
 Identities = 104/293 (35%), Positives = 154/293 (52%), Gaps = 22/293 (7%)

Query: 15  LNIIGPWKLGETLGFGSTGKVQLARHERTGQKTAVKVIPKSIFKSEGSHGNNDSVLPFNI 74
           L  +G +K+ + +G GS GKV LA H  T +K  +K   K           ND     NI
Sbjct: 35  LTEVGNYKILKQVGEGSFGKVYLALHRPTHRKVCLKTSDK-----------NDP----NI 79

Query: 75  EREIVIMKLLSHPNVLSLYDVWETDNNLYLILEYAEKGELFNLLVDRGPLPEREAIKCFK 134
            RE+   +    P +  LY+V  T+  +++ LEY    EL++ L+    +   E  + F 
Sbjct: 80  VREVFYHRQFDFPYITKLYEVIVTETKVWMALEYCPGKELYDHLLSLHRISLLECAELFA 139

Query: 135 QIIIAISYCHALGIVHRDLKPENLLLDNSYNIKIADFGMAALQTDAGMLETSCGSPHYAA 194
           QI  A+ Y H++  VHRDLK EN+LLD + N K+ DFG          LET CG+  Y A
Sbjct: 140 QISGAVYYAHSMHCVHRDLKLENILLDKNGNAKLTDFGFTRECMTKTTLETVCGTTVYMA 199

Query: 195 PEIVSGLPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRDLLLKVQKGQFEMPN--NA 252
           PE++    Y+GF  D+WS GVIL+ L+TG LPFD++     D +    K   E PN  + 
Sbjct: 200 PELIERRTYDGFKIDIWSLGVILYTLITGSLPFDDD-----DEVKTKWKIVNEEPNYDST 254

Query: 253 EISGDAQDLIRRILVVDPTQRIKIRDILSHPLLKKYQTIKDSKSIKDLPRENT 305
            I  DA+DLI R+L  +P +R  +  +L H  L+ Y ++   ++ K L R+ +
Sbjct: 255 LIPDDAKDLISRLLAKNPKERPSLPQVLHHQFLQPYGSVVLDQTEKTLSRQRS 307

>YPL150W Chr16 (268188..270893) [2706 bp, 901 aa] {ON} Protein
           kinase of unknown cellular role; binds
           phosphatidylinositols and cardiolipin in a large-scale
           study
          Length = 901

 Score =  170 bits (430), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 100/291 (34%), Positives = 156/291 (53%), Gaps = 18/291 (6%)

Query: 15  LNIIGPWKLGETLGFGSTGKVQLARHERTGQKTAVKVIPKSIFKSEGSHGNNDSVLPFNI 74
           L  +G +K+ + +G GS GKV LA H  T +K  +K   K           ND     NI
Sbjct: 35  LTEVGNYKILKQIGEGSFGKVYLALHRPTHRKVCLKTSDK-----------NDP----NI 79

Query: 75  EREIVIMKLLSHPNVLSLYDVWETDNNLYLILEYAEKGELFNLLVDRGPLPEREAIKCFK 134
            RE+   +    P +  LY+V  T++ +++ LEY    EL++ L+    +   E  + F 
Sbjct: 80  VREVFYHRQFDFPYITKLYEVIVTESKVWMALEYCPGKELYDHLLSLRRISLLECGELFA 139

Query: 135 QIIIAISYCHALGIVHRDLKPENLLLDNSYNIKIADFGMAALQTDAGMLETSCGSPHYAA 194
           QI  A+ Y H++  VHRDLK EN+LLD + N K+ DFG          LET CG+  Y A
Sbjct: 140 QISGAVYYAHSMHCVHRDLKLENILLDKNGNAKLTDFGFTRECMTKTTLETVCGTTVYMA 199

Query: 195 PEIVSGLPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRDLLLKVQKGQFEMPNNAEI 254
           PE++    Y+GF  D+WS GVIL+ L+TG LPFD+++       +  ++ +++      I
Sbjct: 200 PELIERRTYDGFKIDIWSLGVILYTLITGYLPFDDDDEAKTKWKIVNEEPKYDA---KVI 256

Query: 255 SGDAQDLIRRILVVDPTQRIKIRDILSHPLLKKYQTIKDSKSIKDLPRENT 305
             DA+DLI R+L  +P +R  +  +L HP L+ Y ++   ++ K L R+ +
Sbjct: 257 PDDARDLISRLLAKNPGERPSLSQVLRHPFLQPYGSVVLDQTQKILCRQRS 307

>Skud_16.132 Chr16 (239797..242571) [2775 bp, 924 aa] {ON} YPL150W
           (REAL)
          Length = 924

 Score =  169 bits (427), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 100/291 (34%), Positives = 155/291 (53%), Gaps = 18/291 (6%)

Query: 15  LNIIGPWKLGETLGFGSTGKVQLARHERTGQKTAVKVIPKSIFKSEGSHGNNDSVLPFNI 74
           L  +G +K+ + +G GS GKV LA H  T +K  +K   K           ND     NI
Sbjct: 35  LTEVGNYKILKQIGEGSFGKVYLALHRPTHRKVCLKTSDK-----------NDP----NI 79

Query: 75  EREIVIMKLLSHPNVLSLYDVWETDNNLYLILEYAEKGELFNLLVDRGPLPEREAIKCFK 134
            RE+   +    P +  LY+V  T++ +++ LEY    EL++ L+    +   E  + F 
Sbjct: 80  VREVFYHRQFDFPYITKLYEVIVTESKVWMALEYCPGKELYDHLLSLHRISLLECGELFA 139

Query: 135 QIIIAISYCHALGIVHRDLKPENLLLDNSYNIKIADFGMAALQTDAGMLETSCGSPHYAA 194
           QI  A+ Y H++  VHRDLK EN+LLD + N K+ DFG          LET CG+  Y A
Sbjct: 140 QISGAVYYAHSMHCVHRDLKLENILLDKNGNAKLTDFGFTRECMTKTTLETVCGTTVYMA 199

Query: 195 PEIVSGLPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRDLLLKVQKGQFEMPNNAEI 254
           PE++    Y+GF  D WS GVIL+ L+TG LPFD+++       +  ++ +++      I
Sbjct: 200 PELIGRKTYDGFKIDTWSLGVILYTLITGSLPFDDDDEAKTKWKIVNEEPKYDP---KLI 256

Query: 255 SGDAQDLIRRILVVDPTQRIKIRDILSHPLLKKYQTIKDSKSIKDLPRENT 305
             DA+DLI R+L  +P +R  +  +L HP L+ Y ++   ++ K L R+ +
Sbjct: 257 PDDAKDLISRLLAKNPGERPSLPQVLRHPFLQPYGSVVLDQTEKILCRQRS 307

>SAKL0D07656g Chr4 complement(627469..628767) [1299 bp, 432 aa] {ON}
           similar to uniprot|P22517 Saccharomyces cerevisiae
           YOL016C CMK2 Calmodulin-dependent protein kinase and
           uniprot|P27466 Saccharomyces cerevisiae YFR014C CMK1
          Length = 432

 Score =  161 bits (408), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 101/267 (37%), Positives = 148/267 (55%), Gaps = 18/267 (6%)

Query: 23  LGETLGFGSTGKVQLARHERTGQKTAVKVIPKSIFKSEGSHGNNDSVLPFNIEREIVIMK 82
            G+TLG GS G V+ AR   TG   AVK++ K   K       ND  L   +  E++I++
Sbjct: 48  FGKTLGAGSFGVVRQARKISTGDNVAVKILLKKALKG------NDVQLQM-LYDELMILQ 100

Query: 83  LLSHPNVLSLYDVWETDNNLYLILEYAEKGELFNLLVDRGPLPEREAIKCFKQIIIAISY 142
            L+HPN++   D +E+    Y++ + A  GELF+ ++ +G   E +A+K   QI+ A+ Y
Sbjct: 101 KLNHPNIVKFKDWFESKEKFYIVTQLATGGELFDRILQKGKFTEVDAVKIVVQILKAVEY 160

Query: 143 CHALGIVHRDLKPENLL-LDNSYN--IKIADFGMAA-LQTDAGMLETSCGSPHYAAPEIV 198
            H+  IVHRDLKPENLL LD S N  + + DFG+A  L+ D  ++  + GS  Y APE++
Sbjct: 161 LHSRNIVHRDLKPENLLYLDKSDNSQLVLGDFGIAKELKNDGDLIHKAAGSMGYVAPEVL 220

Query: 199 SGLPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRDLLLKVQKGQ----FEMPNNAEI 254
           +   + G   D+WS GVI + LL G  PF  E  +V   L +   GQ    F  P    I
Sbjct: 221 TSNGH-GKPCDIWSIGVITYTLLCGYSPFIAE--SVDGFLEECTSGQYPVTFHKPYWNNI 277

Query: 255 SGDAQDLIRRILVVDPTQRIKIRDILS 281
           S +A+  I R+L + P +R    D+LS
Sbjct: 278 SKEAKLFILRVLTISPKKRPTATDLLS 304

>NDAI0G05300 Chr7 (1289208..1290521) [1314 bp, 437 aa] {ON}
           Anc_1.374
          Length = 437

 Score =  161 bits (407), Expect = 7e-42,   Method: Compositional matrix adjust.
 Identities = 99/269 (36%), Positives = 152/269 (56%), Gaps = 14/269 (5%)

Query: 23  LGETLGFGSTGKVQLARHERTGQKTAVKVIPKSIFKSEGSHGNNDSVLPFNIEREIVIMK 82
            G+TLG G+ G V+ AR   TG+  AVK++ K   K     GNN  V    +  E+ I++
Sbjct: 54  FGKTLGAGTFGVVRQARKLTTGEDVAVKILLKKALK-----GNN--VQLQMLYDELAILQ 106

Query: 83  LLSHPNVLSLYDVWETDNNLYLILEYAEKGELFNLLVDRGPLPEREAIKCFKQIIIAISY 142
            L HPN+++  D +E+ +  Y++ + A  GELF+ ++ +G   E +A+    Q+I A+SY
Sbjct: 107 KLHHPNIVAFKDWFESKDKFYIVTQLATGGELFDRIIKKGKFSEVDAVSIMVQLISAVSY 166

Query: 143 CHALGIVHRDLKPENLL-LDNSYN--IKIADFGMAA-LQTDAGMLETSCGSPHYAAPEIV 198
            H+  IVHRDLKPEN+L LDNS N  + IADFG+A  L+++  ++    GS  Y APE++
Sbjct: 167 IHSQNIVHRDLKPENVLYLDNSDNSQLVIADFGIAKELKSNDDLIFKGAGSLGYVAPEVL 226

Query: 199 SGLPYEGFASDVWSCGVILFALLTGRLPFDEEN--GNVRDLLLKVQKGQFEMPNNAEISG 256
           +   + G   D+WS GVI + LL+G   F  E+  G + +        +F  P    IS 
Sbjct: 227 TREGH-GKPCDIWSLGVITYTLLSGYSAFIAESVEGFLEECTRSTYPVKFHSPYWDNISQ 285

Query: 257 DAQDLIRRILVVDPTQRIKIRDILSHPLL 285
           +A+D I R L +DP  R    ++L  P +
Sbjct: 286 EAKDFILRALTIDPNDRPTAEELLQDPWI 314

>ACR133C Chr3 complement(581468..584023) [2556 bp, 851 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPL150W
          Length = 851

 Score =  167 bits (423), Expect = 8e-42,   Method: Compositional matrix adjust.
 Identities = 97/276 (35%), Positives = 146/276 (52%), Gaps = 22/276 (7%)

Query: 15  LNIIGPWKLGETLGFGSTGKVQLARHERTGQKTAVKVIPKSIFKSEGSHGNNDSVLPFNI 74
           L  +G +++ + +G GS GKV LA H+ T QK  +K   KS                 N+
Sbjct: 31  LREVGNYRIVKQVGEGSFGKVYLATHKLTHQKVVLKTGAKS---------------DPNV 75

Query: 75  EREIVIMKLLSHPNVLSLYDVWETDNNLYLILEYAEKGELFNLLVDRGPLPEREAIKCFK 134
            RE+   +   +P +  LY+V  T+  +++ LEY    EL++ L+ +  +P  E  + F 
Sbjct: 76  VREVFYHRQFEYPFITKLYEVIVTETRVWMALEYCPGNELYDYLLLKQRIPLDETRRLFA 135

Query: 135 QIIIAISYCHALGIVHRDLKPENLLLDNSYNIKIADFGMAALQTDAGMLETSCGSPHYAA 194
           QI+ A+ Y H+L  VHRDLK EN+LLD +    + DFG          LET CG+  Y A
Sbjct: 136 QIVSAVFYAHSLQCVHRDLKLENILLDKNGYAMLTDFGFTRECATKTQLETVCGTTVYMA 195

Query: 195 PEIVSGLPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRDLLLKVQKGQFEMPN--NA 252
           PE++    Y+G+  D WS G+IL+ +L G +PFDE++  VR  L    K   E P   + 
Sbjct: 196 PELIKREAYDGYKVDTWSLGIILYTMLHGYMPFDEDD-TVRTGL----KIMHEEPAVLDE 250

Query: 253 EISGDAQDLIRRILVVDPTQRIKIRDILSHPLLKKY 288
             S  A+DLI R+L  +  QR  + ++L HP L+ Y
Sbjct: 251 YTSPQAKDLIVRLLDKNAAQRPNLNEVLQHPFLQPY 286

>Smik_6.347 Chr6 complement(553316..556069) [2754 bp, 917 aa] {ON}
           YPL150W (REAL)
          Length = 917

 Score =  167 bits (424), Expect = 9e-42,   Method: Compositional matrix adjust.
 Identities = 101/291 (34%), Positives = 157/291 (53%), Gaps = 18/291 (6%)

Query: 15  LNIIGPWKLGETLGFGSTGKVQLARHERTGQKTAVKVIPKSIFKSEGSHGNNDSVLPFNI 74
           L  +G +K+ + +G GS GKV LA H  T +K  +K   K           ND     NI
Sbjct: 35  LTEVGNYKILKQIGEGSFGKVYLALHRPTHRKVCLKTSDK-----------NDP----NI 79

Query: 75  EREIVIMKLLSHPNVLSLYDVWETDNNLYLILEYAEKGELFNLLVDRGPLPEREAIKCFK 134
            RE+   +    P +  LY+V  T++ +++ LEY    EL++ L+    L   E  + F 
Sbjct: 80  VREVFYHRQFDFPYITKLYEVIVTESKVWMALEYCPGKELYDHLLSLRRLSLLECGELFA 139

Query: 135 QIIIAISYCHALGIVHRDLKPENLLLDNSYNIKIADFGMAALQTDAGMLETSCGSPHYAA 194
           QI  A+ Y H++  VHRDLK EN+LLD + N K+ DFG          LET CG+  Y A
Sbjct: 140 QISGAVYYAHSMHCVHRDLKLENILLDRNGNAKLTDFGFTRECMTKTTLETVCGTTVYMA 199

Query: 195 PEIVSGLPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRDLLLKVQKGQFEMPNNAEI 254
           PE++    Y+GF  D+WS GVIL+ L+TG LPFD+++       +  ++ +++   +  I
Sbjct: 200 PELIERKTYDGFKIDIWSLGVILYTLITGYLPFDDDDEVKTKWKIVNEEPKYD---SKFI 256

Query: 255 SGDAQDLIRRILVVDPTQRIKIRDILSHPLLKKYQTIKDSKSIKDLPRENT 305
             DA+DLI R+L  +P +R  +  +L HP L+ Y ++   ++ K L R+ +
Sbjct: 257 PDDAKDLISRLLAKNPGERPSLPQVLRHPFLQPYGSVVLDQTEKILCRQRS 307

>CAGL0M02233g Chr13 complement(267332..269635) [2304 bp, 767 aa]
           {ON} highly similar to uniprot|P22216 Saccharomyces
           cerevisiae YPL153c SPK1 ser/thr/tyr protein kinase
          Length = 767

 Score =  164 bits (416), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 97/292 (33%), Positives = 163/292 (55%), Gaps = 33/292 (11%)

Query: 25  ETLGFGSTGKVQLARHERTGQKTAVKVIPKSIFKSEGSHGNNDSVLPFNIEREIVIMKLL 84
           E +G G+   V+ A    TG+  AVK+I K         GN D V      RE+ +++ L
Sbjct: 192 EVVGTGAFATVKKAVERNTGKTFAVKIINK-----RKVVGNMDGV-----SRELEVLQKL 241

Query: 85  SHPNVLSLYDVWETDNNLYLILEYAEKGELFNLLVDRGPLPEREAIKCFKQIIIAISYCH 144
           +HP ++SL   +E + N Y+++E+   G+L + +   G + E    +  +QI+ AI Y H
Sbjct: 242 NHPRIVSLKAFYEDEANYYMVMEFISGGDLMDFVAAHGAVGEEAGREISRQILEAIQYIH 301

Query: 145 ALGIVHRDLKPENLLL--DNSYNIKIADFGMAALQTDAGMLETSCGSPHYAAPEIVSGLP 202
           + GI HRDLKP+N+L+  D+   +KI DFG+A +Q +  +++T CG+  Y APE++ G  
Sbjct: 302 SKGISHRDLKPDNILIEQDDPVLVKITDFGLAKVQGNGSIMKTFCGTLAYVAPEVIGGFT 361

Query: 203 --------------YEGFASDVWSCGVILFALLTGRLPFDEENGNVRDLLL-KVQKGQF- 246
                         Y     D+WS G ++F +LTG LPF   +G+ ++ L  +++KG + 
Sbjct: 362 GATGEEETEEERIEYSSLV-DMWSMGCLVFVILTGHLPF---SGSTQEQLYEQIRKGSYH 417

Query: 247 EMP-NNAEISGDAQDLIRRILVVDPTQRIKIRDILSHPLLKKYQTIKDSKSI 297
           E P  +  IS +A+D I  +L VD ++R+ + D L+HP +K+  +  D+ S+
Sbjct: 418 EGPLKDFRISDEARDFIDGLLQVDQSKRMTVDDALNHPWIKQCSSQFDANSM 469

>Kpol_1065.3 s1065 complement(4445..5575) [1131 bp, 376 aa] {ON}
           complement(4445..5575) [1131 nt, 377 aa]
          Length = 376

 Score =  157 bits (397), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 89/271 (32%), Positives = 148/271 (54%), Gaps = 21/271 (7%)

Query: 21  WKLGETLGFGSTGKVQLARHERTGQKTAVKVIPKSIFKSEGSHGNNDSVLPFNIE----R 76
           +++G  LG G  GKV   RH+ +G   A+KV+            N   ++ FN++    R
Sbjct: 118 FEIGRKLGKGKFGKVYCVRHKPSGLICALKVM------------NKMEIVNFNVQKQFKR 165

Query: 77  EIVIMKLLSHPNVLSLYDVWETDNNLYLILEYAEKGELFNLLVDRGPLPEREAIKCFKQI 136
           EI I   L+H N+  LY  +    N+YL++EY   GEL+ LL   GP+ +  A     Q+
Sbjct: 166 EIDIQYHLNHKNLTKLYAFFHDSKNVYLVMEYLIGGELYKLLKKNGPMNDITASNYVYQM 225

Query: 137 IIAISYCHALGIVHRDLKPENLLLDNSYNIKIADFGMAALQTDAGMLETSCGSPHYAAPE 196
             A++Y H   I+HRDLKPEN+L+  +  IK+ DFG +    +    +T CG+  Y +PE
Sbjct: 226 TDALNYMHKRKIIHRDLKPENILIGFNNQIKLTDFGWSIYNPNNQKRKTLCGTIDYLSPE 285

Query: 197 IVSGLPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRDLLLKVQKGQFEMPNNAEISG 256
           ++S   Y+    DVW+ G++ + L+ G  PF+E+         ++ K   + P N  +S 
Sbjct: 286 LISSREYDE-NVDVWALGILTYELVVGAPPFEEDTK--EQTYKRIAKSDLKFPPN--VSS 340

Query: 257 DAQDLIRRILVVDPTQRIKIRDILSHPLLKK 287
           +A+DLI  +L V P++R  ++ +++HP ++K
Sbjct: 341 EARDLITNLLKVVPSERFNLQQVMNHPWIEK 371

>CAGL0E05720g Chr5 (569265..570341) [1077 bp, 358 aa] {ON} similar
           to uniprot|P38991 Saccharomyces cerevisiae YPL209c IPL1
           ser/thr protein kinase
          Length = 358

 Score =  157 bits (396), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 93/272 (34%), Positives = 151/272 (55%), Gaps = 23/272 (8%)

Query: 21  WKLGETLGFGSTGKVQLARHERTGQKTAVKVIPKSIFKSEGSHGNNDSVLPFNI----ER 76
           +++G  LG G  GKV   RH+++G   A+K I K            + +L FN+    +R
Sbjct: 100 FEVGRKLGKGKFGKVYCVRHKKSGFICALKAIEK------------NEILQFNLLKQLKR 147

Query: 77  EIVIMKLLSHPNVLSLYDVWETDNNLYLILEYAEKGELFNLLVDRGPLPEREAIKCFKQI 136
           E+ I   + HPN++ LY  +  +  +YL++E++  GEL+  L + GP  +  A     QI
Sbjct: 148 EVDIQLGMDHPNIIKLYAHFHDEKRVYLLMEHSINGELYKSLKNNGPFNDVLASHYIYQI 207

Query: 137 IIAISYCHALGIVHRDLKPENLLLDNSYNIKIADFGMAALQTDAGMLETSCGSPHYAAPE 196
             A+ Y H   I+HRD+KPEN+L+     +K+ADFG + L  +    +T CG+  Y +PE
Sbjct: 208 ADALHYMHKKRIIHRDVKPENVLIGFDNVVKLADFGWSILNPEGSKRKTLCGTIDYLSPE 267

Query: 197 IVSGLPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRDLLLK-VQKGQFEMPNNAEIS 255
           +++   Y+    DVW+ GV+ + L+ G  PF+E   N ++L  K + K     P +  IS
Sbjct: 268 MITPREYDE-QVDVWALGVLAYELVVGVPPFEE---NSKELTYKRILKCDLNFPES--IS 321

Query: 256 GDAQDLIRRILVVDPTQRIKIRDILSHPLLKK 287
            DA+DLI ++LV D TQR+ +  + +HP + K
Sbjct: 322 KDAKDLISKLLVTDTTQRLSLTGVKTHPWILK 353

>TPHA0E02820 Chr5 complement(589816..590970) [1155 bp, 384 aa] {ON}
           Anc_6.222 YPL209C
          Length = 384

 Score =  156 bits (395), Expect = 9e-41,   Method: Compositional matrix adjust.
 Identities = 89/258 (34%), Positives = 140/258 (54%), Gaps = 23/258 (8%)

Query: 35  VQLARHERTGQKTAVKVIPKSIFKSEGSHGNNDSVLPFNIER----EIVIMKLLSHPNVL 90
           V   RH +TG   A+K++ KS             +L +N+ +    EI I   L+H N+ 
Sbjct: 140 VYCCRHIKTGFICAIKIMDKS------------EILTYNVTKQFRNEIEIQSNLNHENLT 187

Query: 91  SLYDVWETDNNLYLILEYAEKGELFNLLVDRGPLPEREAIKCFKQIIIAISYCHALGIVH 150
            LY  +     +YLI+EY   GEL+++L   GP  +  A     Q+  AI Y H   I+H
Sbjct: 188 KLYGFFHDSKRVYLIMEYIYNGELYSILKKNGPFNDIVASNFVFQLTNAIRYLHKKRIIH 247

Query: 151 RDLKPENLLLDNSYNIKIADFGMAALQTDAGMLETSCGSPHYAAPEIVSGLPYEGFASDV 210
           RDLKPEN+L+D +  IKI DFG +         +T CG+  Y +PE+++   Y+G   DV
Sbjct: 248 RDLKPENILIDFNNVIKITDFGWSVYNEAGNKRKTLCGTIDYLSPELINSKEYDGLI-DV 306

Query: 211 WSCGVILFALLTGRLPFDEENGNVRDLLLK-VQKGQFEMPNNAEISGDAQDLIRRILVVD 269
           W+ G+I + L+ G  PF+E+    ++L  K ++      P  A +S DA++LI  +L ++
Sbjct: 307 WALGIIAYELIVGTPPFEED---TKELTYKRIKNCDLNFP--AHVSQDAKNLISSLLKLN 361

Query: 270 PTQRIKIRDILSHPLLKK 287
           P++RI + D+L HP + K
Sbjct: 362 PSERITLTDVLKHPWINK 379

>KLTH0D11242g Chr4 (918232..920619) [2388 bp, 795 aa] {ON} similar
           to uniprot|P22216 Saccharomyces cerevisiae YPL153C RAD53
           Protein kinase required for cell-cycle arrest in
           response to DNA damage activated by trans
           autophosphorylation when interacting with
           hyperphosphorylated Rad9p
          Length = 795

 Score =  163 bits (412), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 97/286 (33%), Positives = 156/286 (54%), Gaps = 27/286 (9%)

Query: 25  ETLGFGSTGKVQLARHERTGQKTAVKVIPKSIFKSEGSHGNNDSVLPFNIEREIVIMKLL 84
           E +G G+   V+ A   RTG+  AVK+I K         GN D V      RE+ +++ L
Sbjct: 192 EVVGQGAFATVKKAIERRTGKTHAVKIINK-----RKVMGNMDGVT-----RELEVLRRL 241

Query: 85  SHPNVLSLYDVWETDNNLYLILEYAEKGELFNLLVDRGPLPEREAIKCFKQIIIAISYCH 144
           +HP ++SL   +E   + YL++E+   G+L + +   G + E    +  +Q++ A+ Y H
Sbjct: 242 NHPRIVSLKGFYEDKESYYLVMEFVSGGDLMDFVAAHGSVGEDAGREITRQVLEAVKYIH 301

Query: 145 ALGIVHRDLKPENLLL--DNSYNIKIADFGMAALQTDAGMLETSCGSPHYAAPEIVSGLP 202
           A+GI HRDLKP+N+L+  D+   +KI DFG+A +Q +   ++T CG+  Y APE++SG  
Sbjct: 302 AMGISHRDLKPDNILIERDDPVLVKITDFGLAKIQDNGTFMKTFCGTLAYVAPEVISGKN 361

Query: 203 YE-----GFAS--DVWSCGVILFALLTGRLPFDEENGNVRDLLLKVQKGQF-EMP-NNAE 253
            E      ++S  D+WS G +++ +LTG LPF       ++L  ++  G + E P  +  
Sbjct: 362 SEEKEGNKYSSLVDMWSIGCLVYVILTGHLPF--SGSTQQELYKQISAGSYHEGPLKDYR 419

Query: 254 ISGDAQDLIRRILVVDPTQRIKIRDILSHPLLKKYQTIKDSKSIKD 299
           IS DA+D I   L V+P  R+     L HP ++      DS+S  D
Sbjct: 420 ISDDARDFIESFLQVNPRDRMTAEQALKHPWIR----TADSQSFID 461

>TPHA0O01120 Chr15 complement(217462..218751) [1290 bp, 429 aa] {ON}
           Anc_1.374 YFR014C
          Length = 429

 Score =  156 bits (395), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 93/270 (34%), Positives = 149/270 (55%), Gaps = 16/270 (5%)

Query: 23  LGETLGFGSTGKVQLARHERTGQKTAVKVIPKSIFKSEGSHGNNDSVLPFNIEREIVIMK 82
            G+TLG GS G V+ AR   TG+  AVK++ K   +    H          +  E+ I++
Sbjct: 40  FGKTLGAGSFGVVRQARRISTGEDVAVKILLKKALQGNEVHLQM-------LYDELSILQ 92

Query: 83  LLSHPNVLSLYDVWETDNNLYLILEYAEKGELFNLLVDRGPLPEREAIKCFKQIIIAISY 142
            L HP++++  D +E+ +  Y++ + A  GELF+ ++ RG   E +A+K   Q++ A+ Y
Sbjct: 93  RLHHPHIVAFKDWFESKDKFYIVTQLATGGELFDRILARGKFTENDAVKIIYQLLDAVKY 152

Query: 143 CHALGIVHRDLKPENLLL----DNSYNIKIADFGMA-ALQTDAGMLETSCGSPHYAAPEI 197
            H+  +VHRDLKPEN+L     DNS ++ IADFG+A  L+ +  M+  + GS  Y APE+
Sbjct: 153 IHSQNVVHRDLKPENILYVNNSDNS-DLVIADFGIAKQLKNNDDMIFKAAGSLGYVAPEV 211

Query: 198 VSGLPYEGFASDVWSCGVILFALLTGRLPFDEEN--GNVRDLLLKVQKGQFEMPNNAEIS 255
           ++ +   G A D+WS GVI + LL+G   F  E+  G + +         F  P   +IS
Sbjct: 212 LT-VNGHGKACDIWSLGVITYTLLSGYSAFIAESVEGFLEECTSSTYPVTFHRPYWDKIS 270

Query: 256 GDAQDLIRRILVVDPTQRIKIRDILSHPLL 285
            +A+  I   L ++P +R     +LSHP +
Sbjct: 271 DEAKKFILSALTIEPEERPTAEQLLSHPWI 300

>CAGL0L07326g Chr12 (810529..812049) [1521 bp, 506 aa] {ON} similar
           to uniprot|P39009 Saccharomyces cerevisiae YDL101c DUN1
           protein kinase
          Length = 506

 Score =  157 bits (398), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 102/316 (32%), Positives = 157/316 (49%), Gaps = 40/316 (12%)

Query: 13  KPLNIIGPWKLGETLGFGSTGKVQLARHERTGQKTAVKVIPKSIFKSEGSHGNNDSVLPF 72
           KPL+    + LG+ LG G    V+ A+++ TG+  AVK+             N+D     
Sbjct: 185 KPLSFFDKYLLGKDLGSGHYAIVKEAKNKTTGETVAVKIF--------HPQQNDDQKKNK 236

Query: 73  NIEREIVIMKLLSHPNVLSLYDVW-----ETDNNLYLILEYAEKGELFNLLVDRGPLPER 127
               E  I+  + HPN+++L D +     +T    YL+LE  + GELF+ +V +  LP+ 
Sbjct: 237 QFREETTILMKIHHPNIVNLLDSFVEPISKTQIQKYLVLEKIDDGELFDRIVKKTSLPQE 296

Query: 128 EAIKCFKQIIIAISYCHALGIVHRDLKPENLLL-------------------DNSYNIKI 168
           E+   FKQI+  + Y H+  I+HRD+KPEN+LL                   +    +KI
Sbjct: 297 ESKAIFKQILTGLKYLHSQNIIHRDIKPENILLNIRRRQSPDERQLGPWDEDEIDIQVKI 356

Query: 169 ADFGMAALQTDAGMLETSCGSPHYAAPEIVSGLPYEGFAS--DVWSCGVILFALLTGRLP 226
           ADFG+A    +     T CG+P Y APE+   L  +G+ S  D+WS GVIL+  L G  P
Sbjct: 357 ADFGLAKFTGEMQFTNTLCGTPSYVAPEV---LVKKGYTSKVDLWSAGVILYVCLCGFPP 413

Query: 227 FDEENG--NVRDLLLKVQKGQFEMPNNAEISGDAQDLIRRILVVDPTQRIKIRDILSHPL 284
           F ++ G  ++++ ++   K  F  P   EI   A  LI  +LV+DP  R  +    +HP 
Sbjct: 414 FSDQLGPPSLKEQIMSA-KYAFYSPYWDEIDDAALHLISNLLVLDPENRYDVDAAAAHPW 472

Query: 285 LKKYQTIKDSKSIKDL 300
           L     +  S ++K L
Sbjct: 473 LDSVSHLDVSHNLKRL 488

>KAFR0H02510 Chr8 complement(476574..479213) [2640 bp, 879 aa] {ON}
           Anc_8.668 YPL150W
          Length = 879

 Score =  162 bits (409), Expect = 5e-40,   Method: Compositional matrix adjust.
 Identities = 108/343 (31%), Positives = 176/343 (51%), Gaps = 41/343 (11%)

Query: 18  IGPWKLGETLGFGSTGKVQLARHERTGQKTAVKVIPKSIFKSEGSHGNNDSVLPFNIERE 77
           +G +++ + +G GS GKV LA H  T +K  +K   K           ND     NI RE
Sbjct: 38  VGNYRILKQIGEGSFGKVYLALHRPTHRKVVLKTSDK-----------NDP----NIVRE 82

Query: 78  IVIMKLLSHPNVLSLYDVWETDNNLYLILEYAEKGELFNLLVDRGPLPEREAIKCFKQII 137
           +   +   +P +  +Y++  T+  +++ LEY    EL++ L+    +P  E  + F QI+
Sbjct: 83  VFYHRQFDYPYITKVYEIIVTETKVWMALEYCPGKELYDHLLFSKRIPIAECTELFAQIV 142

Query: 138 IAISYCHALGIVHRDLKPENLLLDNSYNIKIADFGMAALQTDAGMLETSCGSPHYAAPEI 197
            A+ Y H+L  VHRDLK EN+LLD     K+ DFG          LET CG+  Y APE+
Sbjct: 143 GAVYYAHSLNCVHRDLKLENILLDKHGRAKLTDFGFTRECMTRSTLETVCGTTVYMAPEL 202

Query: 198 VSGLPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRDLLLKVQKGQFEMPNNAEISGD 257
           +    Y+GF  D+W+ GVIL+ ++ G +PFDE++  V+    K+     +  NN   S D
Sbjct: 203 IERKSYDGFKIDIWALGVILYTMIYGAMPFDEDD-EVK-TKWKIVNEDPDFTNNIS-SND 259

Query: 258 AQDLIRRILVVDPTQRIKIRDILSHPLLKKYQTIKDSKSIKDLPRENTYLYPLADADNHT 317
            +DLI+++L  DPT+R  IR+IL H  LK Y      K+ K + R+              
Sbjct: 260 VKDLIKKLLKKDPTERPTIREILKHDFLKPYGFTILEKTDKIIQRQ-------------- 305

Query: 318 SVTIDDSILQNLVILWHGRPAEEIMKKLQDNGTNTEKTLYALL 360
                    +N  I +H +  + ++K+L+ +G +T+   ++++
Sbjct: 306 ---------RNDSIHFHSKIEKRLLKRLKRSGFDTQSIKHSIM 339

>SAKL0H06534g Chr8 complement(575439..577853) [2415 bp, 804 aa] {ON}
           similar to uniprot|P22216 Saccharomyces cerevisiae
           YPL153C RAD53 Protein kinase required for cell-cycle
           arrest in response to DNA damage activated by trans
           autophosphorylation when interacting with
           hyperphosphorylated Rad9p
          Length = 804

 Score =  161 bits (408), Expect = 5e-40,   Method: Compositional matrix adjust.
 Identities = 96/290 (33%), Positives = 161/290 (55%), Gaps = 28/290 (9%)

Query: 12  TKPLNIIGPWKL-GETLGFGSTGKVQLARHERTGQKTAVKVIPKSIFKSEGSHGNNDSVL 70
           ++P  I   + +  E +G G+   V+ A   +TG+  AVK+I K         GN D V 
Sbjct: 178 SQPTGIFKDYSIKDEVVGQGAFAIVKKAVERKTGKTFAVKIISK-----RKVMGNIDGVT 232

Query: 71  PFNIEREIVIMKLLSHPNVLSLYDVWETDNNLYLILEYAEKGELFNLLVDRGPLPEREAI 130
                RE+ +++ L+HP ++ L   +E D + YL++E+   G+L + +   G + E    
Sbjct: 233 -----RELEVLRRLNHPRIVRLKGFYEDDESYYLLMEFVSGGDLMDFVAAHGSVGEDAGR 287

Query: 131 KCFKQIIIAISYCHALGIVHRDLKPENLLL--DNSYNIKIADFGMAALQTDAGMLETSCG 188
           +  KQ++ A+ Y H +GI HRDLKP+N+L+  D+   +KI DFG+A +Q +   ++T CG
Sbjct: 288 EITKQVLEAVKYIHGMGISHRDLKPDNILIEQDDPVMVKITDFGLAKIQGNGTFMKTFCG 347

Query: 189 SPHYAAPEIVSGLPYEG-------FAS--DVWSCGVILFALLTGRLPFDEENGNVRDLLL 239
           +  Y APE++SG   E        ++S  D+WS G +++ +LTG LPF   +G+ +D L 
Sbjct: 348 TLAYVAPEVISGKNSEDKSQNKNKYSSLVDMWSIGCLVYVILTGHLPF---SGSTQDQLY 404

Query: 240 K-VQKGQF-EMP-NNAEISGDAQDLIRRILVVDPTQRIKIRDILSHPLLK 286
           K + +G + E P  +  IS +A++ I  +L V+P  R+     L HP +K
Sbjct: 405 KQISRGSYHEGPLKDFRISDEARNFIDSLLQVNPKDRLTAEKALDHPWIK 454

>TBLA0A02050 Chr1 (495735..497039) [1305 bp, 434 aa] {ON} 
          Length = 434

 Score =  155 bits (391), Expect = 8e-40,   Method: Compositional matrix adjust.
 Identities = 89/269 (33%), Positives = 151/269 (56%), Gaps = 16/269 (5%)

Query: 21  WKLGETLGFGSTGKVQLARHERTGQKTAVKVIPKSIFKSEGSHGNNDSVLPFNIEREIVI 80
           +++G  LG G  GKV   +H+++G  +A+KV+ K    S  +            +RE+ +
Sbjct: 175 FEIGRGLGKGKFGKVYCVKHKQSGFISALKVMKKKEIVSYNAEKQ--------FKREVEV 226

Query: 81  MKLLSHPNVLSLYDVWETDNNLYLILEYAEKGELF-NLLVDRGPLPEREAIKCFKQIIIA 139
              L+HPN++ ++  ++ +  +YLI+EY   GEL+ +L  + GP  +  A     QI  A
Sbjct: 227 QNSLNHPNIVKIFGFFQDEIFVYLIMEYLINGELYKSLKNNNGPFNDILASNYIYQIADA 286

Query: 140 ISYCHALGIVHRDLKPENLLLDNSYNIKIADFGMAALQTDAGMLETSCGSPHYAAPEIVS 199
           + Y H+  I+HRD+KPEN++L  +  IK+ADFG +         +T CG+  Y APE+V+
Sbjct: 287 LKYMHSKHIIHRDIKPENIVLGFNNKIKLADFGWSICTPPNLRRKTICGTIDYLAPELVT 346

Query: 200 GLPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRDLLLK-VQKGQFEMPNNAEISGDA 258
              Y+ +  D+W+ G++ + L+ G  PF+EE    +DL  K +       P    +S DA
Sbjct: 347 FKEYD-YNVDIWALGILTYELIVGNPPFEEE---TKDLTYKRIINVDLNFP--QTVSMDA 400

Query: 259 QDLIRRILVVDPTQRIKIRDILSHPLLKK 287
           +DLI R+L  DP++R+ + D++ HP + K
Sbjct: 401 RDLITRLLRFDPSKRMPLVDVMKHPWITK 429

>Kwal_26.8796 s26 (946406..948796) [2391 bp, 796 aa] {ON} YPL153C
           (RAD53) - protein kinase, Mec1p and Tel1p regulate
           rad53p phosphorylation [contig 68] FULL
          Length = 796

 Score =  160 bits (405), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 100/286 (34%), Positives = 156/286 (54%), Gaps = 27/286 (9%)

Query: 25  ETLGFGSTGKVQLARHERTGQKTAVKVIPKSIFKSEGSHGNNDSVLPFNIEREIVIMKLL 84
           E +G G+   V+ A   +TG+  AVK+I K         G  D V      RE+ +++ L
Sbjct: 192 EVVGQGAFATVKKAIERKTGKTHAVKIISKRKVV-----GVMDGV-----ARELEVLQRL 241

Query: 85  SHPNVLSLYDVWETDNNLYLILEYAEKGELFNLLVDRGPLPEREAIKCFKQIIIAISYCH 144
            HP ++SL   +E  ++ YL++E+   G+L + +   G + E    +  +QI+ A+ Y H
Sbjct: 242 DHPRIVSLKGFYEDKDSHYLVMEFVSGGDLMDFVAAHGSVGEDAGREITRQILEAVKYIH 301

Query: 145 ALGIVHRDLKPENLLL--DNSYNIKIADFGMAALQTDAGMLETSCGSPHYAAPEIVSGL- 201
           ++GI HRDLKP+N+L+  D+   +KI DFG+A +Q +   ++T CG+  Y APE++SG  
Sbjct: 302 SMGISHRDLKPDNILIERDDPVLVKITDFGLAKIQGNGTFMKTFCGTLAYVAPEVISGKN 361

Query: 202 --PYEG--FAS--DVWSCGVILFALLTGRLPFDEENGNVRDLLLKVQKGQF-EMP-NNAE 253
               EG  ++S  D+WS G +++ +LTG LPF     N  DL  ++  G + E P  +  
Sbjct: 362 SGEKEGNTYSSLVDMWSIGCLVYVILTGHLPFSGSTQN--DLYKQITAGSYHEGPLKDYR 419

Query: 254 ISGDAQDLIRRILVVDPTQRIKIRDILSHPLLKKYQTIKDSKSIKD 299
           IS DA+D I   L VDP  R+     L HP +K      DS+S  D
Sbjct: 420 ISDDARDFIESFLQVDPRNRMTAEQALRHPWIKA----ADSQSYVD 461

>Smik_4.135 Chr4 complement(256861..258402) [1542 bp, 513 aa] {ON}
           YDL101C (REAL)
          Length = 513

 Score =  156 bits (394), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 99/306 (32%), Positives = 159/306 (51%), Gaps = 40/306 (13%)

Query: 12  TKPLNIIGPWKLGETLGFGSTGKVQLARHERTGQKTAVKVIPKSIFKSEGSHGNNDSVLP 71
           TKP++    + LG+ LG G    V+ A++++TGQ+ AVK+          +  N+D    
Sbjct: 191 TKPVSFFDKYLLGKELGSGHYALVKEAKNKKTGQQVAVKIF--------HAQQNDDQKKN 242

Query: 72  FNIEREIVIMKLLSHPNVLSLYDVW-----ETDNNLYLILEYAEKGELFNLLVDRGPLPE 126
                E  I+  + HPN+++L D +     ++    YL+LE  + GELF  +V +  L +
Sbjct: 243 KQFREETNILMRVQHPNIVNLLDSFVEPISKSQIQKYLVLEKIDDGELFERIVRKTCLRQ 302

Query: 127 REAIKCFKQIIIAISYCHALGIVHRDLKPENLLLD-----NS--------------YNIK 167
            E+   FKQ++  + Y H   I+HRD+KPEN+LL+     NS                +K
Sbjct: 303 DESKALFKQLLTGLKYLHEQNIIHRDIKPENVLLNITRRKNSSQVQLGPWDEDEIDIQVK 362

Query: 168 IADFGMAALQTDAGMLETSCGSPHYAAPEIVSGLPYEGFAS--DVWSCGVILFALLTGRL 225
           IADFG+A    +     T CG+P Y APE+++    +G+ S  D+WS GVIL+  L G  
Sbjct: 363 IADFGLAKFTGEMQFTNTLCGTPSYVAPEVLTK---KGYTSKVDLWSAGVILYVCLCGFP 419

Query: 226 PFDEENG--NVRDLLLKVQKGQFEMPNNAEISGDAQDLIRRILVVDPTQRIKIRDILSHP 283
           PF ++ G  ++++ +L+  K  F  P   +I      LI  +LV++P +R  I D ++HP
Sbjct: 420 PFSDQLGPPSLKEQILQA-KYAFYSPYWDKIDDSVLHLISNLLVLNPDERYNIDDAMNHP 478

Query: 284 LLKKYQ 289
             K  Q
Sbjct: 479 WFKDTQ 484

>Kwal_56.23717 s56 complement(674222..676798) [2577 bp, 858 aa] {ON}
           YDR122W (KIN1) - Serine/threonine protein kinase [contig
           174] PARTIAL
          Length = 858

 Score =  159 bits (403), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 75/188 (39%), Positives = 118/188 (62%), Gaps = 4/188 (2%)

Query: 100 NNLYLILEYAEKGELFNLLVDRGPLPEREAIKCFKQIIIAISYCHALGIVHRDLKPENLL 159
           N+ Y++ EY   G+L + ++  G L ER A K  + I  A+ Y H   IVHRDLK EN++
Sbjct: 6   NHFYMLFEYVSGGQLLDYIIQHGSLRERSARKFARGIASALQYLHMNNIVHRDLKIENIM 65

Query: 160 LDNSYNIKIADFGMAALQTDAGMLETSCGSPHYAAPEIVSGLPYEGFASDVWSCGVILFA 219
           +  S  IKI DFG++ +      L T CGS ++AAPE++   PY G   DVWS GV+LF 
Sbjct: 66  ISTSGEIKIIDFGLSNMYNPKKQLHTFCGSLYFAAPELLKACPYTGPEVDVWSFGVVLFV 125

Query: 220 LLTGRLPFDEENGNVRDLLLKVQKGQFEMPNNAEISGDAQDLIRRILVVDPTQRIKIRDI 279
           L+ G++PFD+EN +V  L  K+++G+ E P +  I  +   L+ ++LVVDPT+R  ++ +
Sbjct: 126 LVCGKVPFDDENSSV--LHEKIKQGKVEYPQHLSI--EVISLLSKMLVVDPTKRASLKQV 181

Query: 280 LSHPLLKK 287
           ++H  +++
Sbjct: 182 VNHQWMQR 189

>Skud_6.89 Chr6 (166257..167594) [1338 bp, 446 aa] {ON} YFR014C
           (REAL)
          Length = 446

 Score =  154 bits (388), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 93/271 (34%), Positives = 150/271 (55%), Gaps = 18/271 (6%)

Query: 23  LGETLGFGSTGKVQLARHERTGQKTAVKVIPKSIFKSEGSHGNNDSVLPFNIEREIVIMK 82
            G+TLG G+ G V+ AR+  TG+  AVK++ K   K     GN   +    +  E+ I++
Sbjct: 39  FGKTLGAGTFGVVRQARNTETGEDVAVKILIKKALK-----GNKIQLEA--LYDELDILQ 91

Query: 83  LLSHPNVLSLYDVWETDNNLYLILEYAEKGELFNLLVDRGPLPEREAIKCFKQIIIAISY 142
            L HPN+++  D +E+ +  Y+I + A+ GELF+ ++ +G   E +A++   +I+ A+ Y
Sbjct: 92  RLHHPNIVAFKDWFESKDKFYIITQLAKGGELFDRILKKGKFTEVDAVRILVEILSAVKY 151

Query: 143 CHALGIVHRDLKPENLLLDNSYN---IKIADFGMAA-LQTDAGMLETSCGSPHYAAPEIV 198
            H+  IVHRDLKPENLL  +  +   + +ADFG+A  L++D  ++    GS  Y APE++
Sbjct: 152 MHSQNIVHRDLKPENLLYVDKSDESPLVVADFGIAKRLKSDEELIYKPAGSLGYVAPEVL 211

Query: 199 SGLPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRDLLLKVQKGQ----FEMPNNAEI 254
           +   + G   D+WS GVI + LL G   F  E   V+D L +   G+    F  P    +
Sbjct: 212 TQDGH-GKPCDIWSIGVITYTLLCGYSAFKAE--RVQDFLDECTTGEHPVRFHRPYWDSV 268

Query: 255 SGDAQDLIRRILVVDPTQRIKIRDILSHPLL 285
           SG A+  I + L +DP +R     +L  P +
Sbjct: 269 SGKAKQFILKALNLDPAERPTAAQLLDDPWI 299

>TBLA0A02030 Chr1 complement(491365..492576) [1212 bp, 403 aa] {ON}
           Anc_6.214 YPL203W
          Length = 403

 Score =  152 bits (384), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 92/271 (33%), Positives = 148/271 (54%), Gaps = 22/271 (8%)

Query: 21  WKLGETLGFGSTGKVQLARHERTGQKTAVKVIPKS-IFKSEGSHGNNDSVLPFNIEREIV 79
           +++  TLG GS G+V L R    G+  A+KV+ K  I K +     ND       ER + 
Sbjct: 93  FQIMRTLGTGSFGRVHLVRSVHNGRYYAIKVLKKQQIIKMKQIEHTND-------ERRM- 144

Query: 80  IMKLLSHPNVLSLYDVWETDNNLYLILEYAEKGELFNLLVDRGPLPEREAIKCFKQIIIA 139
            +KL+ HP ++ L+  ++   NL+++++Y E GELF+LL      P   A     ++++A
Sbjct: 145 -LKLVEHPFIIRLWGTFQDSRNLFMVMDYIEGGELFSLLRKSQRFPNPVAKFYAAEVVLA 203

Query: 140 ISYCHALGIVHRDLKPENLLLDNSYNIKIADFGMAALQTDAGMLETSCGSPHYAAPEIVS 199
           + Y HA  I++RDLKPEN+LLD + +IK+ADFG A  +  + +  T CG+P Y APE+++
Sbjct: 204 LEYLHANNIIYRDLKPENILLDRNGHIKVADFGFA--KEVSSVTWTLCGTPDYIAPEVIA 261

Query: 200 GLPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRDLLLKVQKGQFEMPNNAEISGDAQ 259
             PY   + D WS GV+++ +L G  PF +          K+ +G+   P       D  
Sbjct: 262 TKPYNK-SVDWWSLGVLIYEMLAGYTPFYDVTP--MKTYEKILQGKINFPQG--FHPDVI 316

Query: 260 DLIRRILVVDPTQRI-----KIRDILSHPLL 285
           DL+ R++  D T+R+       RD+ +HP  
Sbjct: 317 DLLTRLITSDLTKRLGNLQNGSRDVKNHPWF 347

>Kwal_56.24091 s56 (845680..846825) [1146 bp, 381 aa] {ON} YPL209C
           (IPL1) - Protein kinase [contig 166] FULL
          Length = 381

 Score =  151 bits (382), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 86/258 (33%), Positives = 137/258 (53%), Gaps = 23/258 (8%)

Query: 35  VQLARHERTGQKTAVKVIPKSIFKSEGSHGNNDSVLPFNIE----REIVIMKLLSHPNVL 90
           V   +H+RTG   A+K + KS             ++ +N++    RE+ I   L HPN+ 
Sbjct: 137 VYCVKHKRTGFICALKAMKKS------------EIVQYNVQKQFRREVEIQSSLKHPNLT 184

Query: 91  SLYDVWETDNNLYLILEYAEKGELFNLLVDRGPLPEREAIKCFKQIIIAISYCHALGIVH 150
            LY  +  +  +YL++EY   GEL+  L   GP  +  A     Q+  A++Y H+  I+H
Sbjct: 185 RLYGYFHDEKRVYLLMEYLVNGELYKHLRSHGPFNDITASHFVHQMADALNYMHSKNILH 244

Query: 151 RDLKPENLLLDNSYNIKIADFGMAALQTDAGMLETSCGSPHYAAPEIVSGLPYEGFASDV 210
           RD+KPEN+LL     +K+ DFG +         +T CG+  Y +PE++    Y+    DV
Sbjct: 245 RDIKPENILLGFQNTLKLTDFGWSVSNVGNSKRKTLCGTMDYLSPELIKSREYDN-KVDV 303

Query: 211 WSCGVILFALLTGRLPFDEENGNVRDLLLK-VQKGQFEMPNNAEISGDAQDLIRRILVVD 269
           W+ GV+ + LL G  PF+E+    ++L  K + K     P+  ++S  A+DLI R+L  D
Sbjct: 304 WALGVLTYELLVGSPPFEED---TKELTYKRIIKRDLRFPD--QVSPHARDLISRLLEYD 358

Query: 270 PTQRIKIRDILSHPLLKK 287
           P  RI ++D+  HP +KK
Sbjct: 359 PQNRIPLKDVKRHPWIKK 376

>YFR014C Chr6 complement(172537..173877) [1341 bp, 446 aa] {ON}
           CMK1Calmodulin-dependent protein kinase; may play a role
           in stress response, many Ca++/calmodulin dependent
           phosphorylation substrates demonstrated in vitro, amino
           acid sequence similar to Cmk2p and mammalian Cam Kinase
           II
          Length = 446

 Score =  153 bits (386), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 95/271 (35%), Positives = 152/271 (56%), Gaps = 18/271 (6%)

Query: 23  LGETLGFGSTGKVQLARHERTGQKTAVKVIPKSIFKSEGSHGNNDSVLPFNIEREIVIMK 82
            G+TLG G+ G V+ A++  TG+  AVK++ K   K     GN   V    +  E+ I++
Sbjct: 39  FGKTLGAGTFGVVRQAKNTETGEDVAVKILIKKALK-----GNK--VQLEALYDELDILQ 91

Query: 83  LLSHPNVLSLYDVWETDNNLYLILEYAEKGELFNLLVDRGPLPEREAIKCFKQIIIAISY 142
            L HPN+++  D +E+ +  Y+I + A+ GELF+ ++ +G   E +A++   +I+ A+ Y
Sbjct: 92  RLHHPNIVAFKDWFESKDKFYIITQLAKGGELFDRILKKGKFTEEDAVRILVEILSAVKY 151

Query: 143 CHALGIVHRDLKPENLL-LDNSYN--IKIADFGMAA-LQTDAGMLETSCGSPHYAAPEIV 198
            H+  IVHRDLKPENLL +D S    + +ADFG+A  L++D  +L    GS  Y APE++
Sbjct: 152 MHSQNIVHRDLKPENLLYIDKSDESPLVVADFGIAKRLKSDEELLYKPAGSLGYVAPEVL 211

Query: 199 SGLPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRDLLLKVQKGQ----FEMPNNAEI 254
           +   + G   D+WS GVI + LL G   F  E   V+D L +   G+    F  P    +
Sbjct: 212 TQDGH-GKPCDIWSIGVITYTLLCGYSAFRAE--RVQDFLDECTTGEYPVKFHRPYWDSV 268

Query: 255 SGDAQDLIRRILVVDPTQRIKIRDILSHPLL 285
           S  A+  I + L +DP++R    ++L  P +
Sbjct: 269 SNKAKQFILKALNLDPSKRPTAAELLEDPWI 299

>Skud_13.154 Chr13 complement(255263..257380) [2118 bp, 705 aa] {ON}
           YMR001C (REAL)
          Length = 705

 Score =  157 bits (397), Expect = 6e-39,   Method: Compositional matrix adjust.
 Identities = 94/269 (34%), Positives = 146/269 (54%), Gaps = 15/269 (5%)

Query: 21  WKLGETLGFGSTGKVQLARHERTGQKTAVKVIPKSIFKSEGSHGNNDSVLPFNIEREIVI 80
           +  G  LG G   +    + + +G+  A K + K+  KSE +           +  EI I
Sbjct: 82  YHRGHFLGEGGFARCFQIKDD-SGEIFAAKTVAKASIKSEKTRKK--------LLSEIQI 132

Query: 81  MKLLSHPNVLSLYDVWETDNNLYLILEYAEKGELFNLLVDRGPLPEREAIKCFKQIIIAI 140
            K +SHPN++   D +E D+N+Y++LE    G L  LL  R  L E E      QI  AI
Sbjct: 133 HKSMSHPNIVQFIDCFEDDSNVYILLEICPNGSLMELLKRRKVLTEPEVRFFTTQICGAI 192

Query: 141 SYCHALGIVHRDLKPENLLLDNSYNIKIADFGMAA-LQTDAGMLETSCGSPHYAAPEIVS 199
            Y H+  ++HRDLK  N+  D++YN+KI DFG+AA L  ++    T CG+P+Y APE++ 
Sbjct: 193 KYMHSRRVIHRDLKLGNIFFDSNYNLKIGDFGLAAVLANESERKYTICGTPNYIAPEVLM 252

Query: 200 GLPYEG--FASDVWSCGVILFALLTGRLPFDEENGNVRDLLLKVQKGQFEMPNNAEISGD 257
           G  + G  F  D+WS GV+L+ALL G+ PF   + N   +  +++   F  P +  IS +
Sbjct: 253 G-KHSGHSFEVDIWSLGVMLYALLIGKPPFQARDVNT--IYERIKCRDFSFPKDKPISDE 309

Query: 258 AQDLIRRILVVDPTQRIKIRDILSHPLLK 286
            + LIR IL +DP +R  + +I+ +   +
Sbjct: 310 GKILIRDILSLDPIERPSLTEIMDYVWFR 338

>YMR001C Chr13 complement(269019..271136) [2118 bp, 705 aa] {ON}
           CDC5Polo-like kinase with multiple functions in mitosis
           and cytokinesis through substrate phosphorylation, also
           functions in adaptation to DNA damage during meiosis;
           has similarity to Xenopus Plx1 and S. pombe Plo1p;
           possible Cdc28p substrate
          Length = 705

 Score =  157 bits (397), Expect = 6e-39,   Method: Compositional matrix adjust.
 Identities = 97/295 (32%), Positives = 156/295 (52%), Gaps = 22/295 (7%)

Query: 21  WKLGETLGFGSTGKVQLARHERTGQKTAVKVIPKSIFKSEGSHGNNDSVLPFNIEREIVI 80
           +  G  LG G   +    + + +G+  A K + K+  KSE +           +  EI I
Sbjct: 82  YHRGHFLGEGGFARCFQIKDD-SGEIFAAKTVAKASIKSEKTRKK--------LLSEIQI 132

Query: 81  MKLLSHPNVLSLYDVWETDNNLYLILEYAEKGELFNLLVDRGPLPEREAIKCFKQIIIAI 140
            K +SHPN++   D +E D+N+Y++LE    G L  LL  R  L E E      QI  AI
Sbjct: 133 HKSMSHPNIVQFIDCFEDDSNVYILLEICPNGSLMELLKRRKVLTEPEVRFFTTQICGAI 192

Query: 141 SYCHALGIVHRDLKPENLLLDNSYNIKIADFGMAA-LQTDAGMLETSCGSPHYAAPEIVS 199
            Y H+  ++HRDLK  N+  D++YN+KI DFG+AA L  ++    T CG+P+Y APE++ 
Sbjct: 193 KYMHSRRVIHRDLKLGNIFFDSNYNLKIGDFGLAAVLANESERKYTICGTPNYIAPEVLM 252

Query: 200 GLPYEG--FASDVWSCGVILFALLTGRLPFDEENGNVRDLLLKVQKGQFEMPNNAEISGD 257
           G  + G  F  D+WS GV+L+ALL G+ PF   + N   +  +++   F  P +  IS +
Sbjct: 253 G-KHSGHSFEVDIWSLGVMLYALLIGKPPFQARDVNT--IYERIKCRDFSFPRDKPISDE 309

Query: 258 AQDLIRRILVVDPTQRIKIRDILSHPLLKKY-------QTIKDSKSIKDLPRENT 305
            + LIR IL +DP +R  + +I+ +   +           + ++ + +D+P E +
Sbjct: 310 GKILIRDILSLDPIERPSLTEIMDYVWFRGTFPPSIPSTVMSEAPNFEDIPEEQS 364

>KLTH0C10912g Chr3 (898372..900465) [2094 bp, 697 aa] {ON} highly
           similar to uniprot|P32562 Saccharomyces cerevisiae
           YMR001C
          Length = 697

 Score =  157 bits (396), Expect = 7e-39,   Method: Compositional matrix adjust.
 Identities = 93/267 (34%), Positives = 146/267 (54%), Gaps = 19/267 (7%)

Query: 23  LGETLGFGSTGKVQLARHERTGQKTAVKVIPKSIFKSEGSHGNNDSVLPFNIEREIVIMK 82
           LGE  GF    +++    + +G+  A K + K   KSE +           +  EI I K
Sbjct: 85  LGEG-GFARCFQIK----DDSGKIFAAKTVAKISIKSEKTRKK--------LLSEIQIHK 131

Query: 83  LLSHPNVLSLYDVWETDNNLYLILEYAEKGELFNLLVDRGPLPEREAIKCFKQIIIAISY 142
            + H N++   D +E D N+Y++LE    G L +LL  R  L E E      QI+ A+ Y
Sbjct: 132 SMRHFNIVQFIDCFEDDTNVYILLEICPNGSLMDLLKRRKVLTEPEVRFFTTQIVGAVKY 191

Query: 143 CHALGIVHRDLKPENLLLDNSYNIKIADFGMAA-LQTDAGMLETSCGSPHYAAPEIVSGL 201
            H+  ++HRDLK  N+  D  YN+KI DFG+AA L  D     T CG+P+Y APE+++G 
Sbjct: 192 MHSRRVIHRDLKLGNIFFDKHYNLKIGDFGLAAVLANDRERKYTVCGTPNYIAPEVLTG- 250

Query: 202 PYEG--FASDVWSCGVILFALLTGRLPFDEENGNVRDLLLKVQKGQFEMPNNAEISGDAQ 259
            + G  +  D+WSCGV+++ALL G+ PF  +  N+  +  +++ G +  P +  IS +A 
Sbjct: 251 KHTGHSYEVDIWSCGVMIYALLIGKPPFQAKEVNI--IYERIKCGDYVFPRDKCISQEAL 308

Query: 260 DLIRRILVVDPTQRIKIRDILSHPLLK 286
            LIR IL +DP +R  + +I+ +   +
Sbjct: 309 TLIRDILSIDPLERPSLDEIIDYVWFR 335

>KLTH0H11396g Chr8 complement(973355..974668) [1314 bp, 437 aa] {ON}
           similar to uniprot|P22517 Saccharomyces cerevisiae
           YOL016C CMK2 Calmodulin-dependent protein kinase and to
           YFR014C uniprot|P27466 Saccharomyces cerevisiae YFR014C
           CMK1 Calmodulin-dependent protein kinase
          Length = 437

 Score =  152 bits (384), Expect = 7e-39,   Method: Compositional matrix adjust.
 Identities = 95/272 (34%), Positives = 148/272 (54%), Gaps = 20/272 (7%)

Query: 23  LGETLGFGSTGKVQLARHERTGQKTAVKVIPKSIFKSEGSHGNNDSVLPFNIEREIVIMK 82
            G TLG GS G V+ AR   TG+  AVK++ K   K +      D  L   +  E+ I++
Sbjct: 48  FGRTLGAGSFGVVRQARKLSTGENVAVKILLKKALKGK------DVQLQM-LYDELSILQ 100

Query: 83  LLSHPNVLSLYDVWETDNNLYLILEYAEKGELFNLLVDRGPLPEREAIKCFKQIIIAISY 142
            L HPN++   D +E+ +  Y++ + A  GELF+ ++ +G   E++A++   QI+ A+ Y
Sbjct: 101 KLDHPNIVKFKDWFESKDKFYIVTQLAMGGELFDRILKKGKFTEKDAVRIVYQILKAVEY 160

Query: 143 CHALGIVHRDLKPENLLL----DNSYNIKIADFGMAA-LQTDAGMLETSCGSPHYAAPEI 197
            H+  IVHRDLKPENLL     D+S  + + DFG+A  L  +  ++  + GS  Y APE+
Sbjct: 161 LHSRNIVHRDLKPENLLYLAEKDDS-PLVLGDFGIAKELNNEDELIHKAAGSMGYVAPEV 219

Query: 198 VSGLPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRDLLLKVQKGQ----FEMPNNAE 253
           ++   + G   D+WS GV+ + LL G  PF  E  +V   L +   G+    F  P  + 
Sbjct: 220 LTTSGH-GKPCDIWSLGVVTYTLLCGYSPFVAE--SVEGFLEECTSGRYPVTFHKPYWSS 276

Query: 254 ISGDAQDLIRRILVVDPTQRIKIRDILSHPLL 285
           IS DA+D I + L V P  R    ++L+H  +
Sbjct: 277 ISDDAKDFILQALTVTPRYRPSATELLNHKWI 308

>NCAS0A08880 Chr1 (1756271..1757539) [1269 bp, 422 aa] {ON}
           Anc_1.374
          Length = 422

 Score =  152 bits (383), Expect = 8e-39,   Method: Compositional matrix adjust.
 Identities = 92/269 (34%), Positives = 151/269 (56%), Gaps = 14/269 (5%)

Query: 23  LGETLGFGSTGKVQLARHERTGQKTAVKVIPKSIFKSEGSHGNNDSVLPFNIEREIVIMK 82
            G+TLG G+ G V+ AR   + +  AVK++ K+  K       ND  L   +  E+ I++
Sbjct: 40  FGKTLGAGTFGVVRQARQLSSQEDVAVKILLKNALKG------NDVQLQM-LYDELSILQ 92

Query: 83  LLSHPNVLSLYDVWETDNNLYLILEYAEKGELFNLLVDRGPLPEREAIKCFKQIIIAISY 142
            L HPN+++  D +E+ +  Y++ + A  GELF+ ++ +G   E +A+    Q++ A+ Y
Sbjct: 93  RLHHPNIVAFKDWFESRDKFYIVTQLATGGELFDRIIKKGKFTEVDAVNIMVQLLDAVKY 152

Query: 143 CHALGIVHRDLKPENLL-LDNS--YNIKIADFGMAA-LQTDAGMLETSCGSPHYAAPEIV 198
            H+  IVHRDLKPEN+L LD S    + IADFG+A  L+++  ++    GS  Y APE++
Sbjct: 153 IHSQNIVHRDLKPENVLYLDPSDESQLVIADFGIAKELKSNDDLIFKGAGSLGYVAPEVL 212

Query: 199 SGLPYEGFASDVWSCGVILFALLTGRLPFDEEN--GNVRDLLLKVQKGQFEMPNNAEISG 256
           +   + G   D+WS GVI + LL+G  PF  E+  G + +        QF  P    IS 
Sbjct: 213 TKEGH-GKPCDIWSLGVITYTLLSGYSPFIAESVEGFLEECTRSRYPVQFHKPYWDSISD 271

Query: 257 DAQDLIRRILVVDPTQRIKIRDILSHPLL 285
           +A+D I + L +DP +R    ++++ P +
Sbjct: 272 EAKDFILKALTIDPEERPSAEELMNDPWI 300

>Smik_6.350 Chr6 (559997..562465) [2469 bp, 822 aa] {ON} YPL153C
           (REAL)
          Length = 822

 Score =  157 bits (398), Expect = 8e-39,   Method: Compositional matrix adjust.
 Identities = 94/281 (33%), Positives = 157/281 (55%), Gaps = 30/281 (10%)

Query: 23  LGETLGFGSTGKVQLARHERTGQKTAVKVIPKSIFKSEGSHGNNDSVLPFNIEREIVIMK 82
           + E +G G+   V+ A    TG+  AVK+I K         GN D V      RE+ +++
Sbjct: 200 IDEVVGQGAFATVKKAIERTTGKTFAVKIISK-----RKVIGNMDGV-----TRELEVLQ 249

Query: 83  LLSHPNVLSLYDVWETDNNLYLILEYAEKGELFNLLVDRGPLPEREAIKCFKQIIIAISY 142
            L+HP ++ L   +E  ++ Y+++E+   G+L + +   G + E    +  +QI+ A+ Y
Sbjct: 250 KLNHPRIVRLKGFYEDADSYYMVMEFVSGGDLMDFVAAHGAVGEDAGREISRQILTAVKY 309

Query: 143 CHALGIVHRDLKPENLLL--DNSYNIKIADFGMAALQTDAGMLETSCGSPHYAAPEIVSG 200
            H++GI HRDLKP+N+L+  D+   +KI DFG+A +Q +   ++T CG+  Y APE++ G
Sbjct: 310 IHSMGISHRDLKPDNILIEQDDPVLVKITDFGLAKVQGNGSFMKTFCGTLAYVAPEVIRG 369

Query: 201 L-------PYE---GFAS--DVWSCGVILFALLTGRLPFDEENGNVRDLLLK-VQKGQF- 246
                    YE    ++S  D+WS G +++ +LTG LPF   +G+ +D L K + +G + 
Sbjct: 370 KDSSASPDEYEERNEYSSLVDMWSMGCLVYVILTGHLPF---SGSTQDQLYKQIGRGSYH 426

Query: 247 EMP-NNAEISGDAQDLIRRILVVDPTQRIKIRDILSHPLLK 286
           E P  +  IS +A+D I  +L VDP+ R+     L HP +K
Sbjct: 427 EGPLKDFRISEEARDFIDSLLQVDPSNRLTAAKALDHPWIK 467

>CAGL0F04741g Chr6 (478256..479584) [1329 bp, 442 aa] {ON} similar
           to uniprot|P22517 Saccharomyces cerevisiae YOL016c CMK2
           Ca2+/calmodulin-dependent ser/thr protein kinase type II
          Length = 442

 Score =  152 bits (384), Expect = 9e-39,   Method: Compositional matrix adjust.
 Identities = 92/269 (34%), Positives = 150/269 (55%), Gaps = 14/269 (5%)

Query: 23  LGETLGFGSTGKVQLARHERTGQKTAVKVIPKSIFKSEGSHGNNDSVLPFNIEREIVIMK 82
            G+TLG G+ G V+ AR+  T +  AVK++ K   K       ND  L   +  E+ I++
Sbjct: 47  FGKTLGAGTFGVVRQARYSPTNEDVAVKILLKKALKG------NDVQLQM-LYDELSILQ 99

Query: 83  LLSHPNVLSLYDVWETDNNLYLILEYAEKGELFNLLVDRGPLPEREAIKCFKQIIIAISY 142
           +L HPN++   D +E+ +  Y++ + A  GELF+ ++ +G   ER+A+    QI+ A+ Y
Sbjct: 100 MLKHPNIVEFKDWFESKDKFYIVTQLAVGGELFDRILAKGKFTERDAVSITMQILSAVDY 159

Query: 143 CHALGIVHRDLKPENLL-LDNSYN--IKIADFGMA-ALQTDAGMLETSCGSPHYAAPEIV 198
            H+  +VHRDLKPEN+L +D S +  + IADFG+A  LQ +  ++  + GS  Y APE++
Sbjct: 160 MHSKNVVHRDLKPENVLYIDKSDDSQLVIADFGIAKQLQDNDDLIFKAAGSLGYVAPEVL 219

Query: 199 SGLPYEGFASDVWSCGVILFALLTGRLPFDEE--NGNVRDLLLKVQKGQFEMPNNAEISG 256
           +   + G   D+WS GVI++ LL G   F  E  +G + +         F  P    IS 
Sbjct: 220 TNNGH-GKPCDIWSIGVIVYTLLCGYSAFVAETVDGFLEECTQNKYPVTFHKPYWDNISD 278

Query: 257 DAQDLIRRILVVDPTQRIKIRDILSHPLL 285
           +A++ I R L +DP +R    +++  P +
Sbjct: 279 EAKNFILRALTLDPAERPTAAELMKDPWI 307

>YPL209C Chr16 complement(156490..157593) [1104 bp, 367 aa] {ON}
           IPL1Aurora kinase subunit of the conserved chromosomal
           passenger complex (CPC; Ipl1p-Sli15p-Bir1p-Nbl1p),
           involved in regulating kinetochore-microtubule
           attachments; helps maintain condensed chromosomes during
           anaphase and early telophase; required for SPB cohesion
           and prevention of multipolar spindle formation
          Length = 367

 Score =  150 bits (378), Expect = 9e-39,   Method: Compositional matrix adjust.
 Identities = 90/268 (33%), Positives = 143/268 (53%), Gaps = 23/268 (8%)

Query: 35  VQLARHERTGQKTAVKVIPKSIFKSEGSHGNNDSVLPFNIE----REIVIMKLLSHPNVL 90
           V   RH  TG   A+KV+ K            + ++ +N++    RE+ I   L+HPN+ 
Sbjct: 118 VYCVRHRSTGYICALKVMEK------------EEIIKYNLQKQFRREVEIQTSLNHPNLT 165

Query: 91  SLYDVWETDNNLYLILEYAEKGELFNLLVDRGPLPEREAIKCFKQIIIAISYCHALGIVH 150
             Y  +  +  +YL++EY   GE++ LL   GP  +  A     QI  A+ Y H   I+H
Sbjct: 166 KSYGYFHDEKRVYLLMEYLVNGEMYKLLRLHGPFNDILASDYIYQIANALDYMHKKNIIH 225

Query: 151 RDLKPENLLLDNSYNIKIADFGMAALQTDAGMLETSCGSPHYAAPEIVSGLPYEGFASDV 210
           RD+KPEN+L+  +  IK+ DFG + +       +T CG+  Y +PE+V    Y+    D 
Sbjct: 226 RDIKPENILIGFNNVIKLTDFGWSIINPPENRRKTVCGTIDYLSPEMVESREYDH-TIDA 284

Query: 211 WSCGVILFALLTGRLPFDEENGNVRDLLLK-VQKGQFEMPNNAEISGDAQDLIRRILVVD 269
           W+ GV+ F LLTG  PF+EE   ++D   K +     +MP+N  IS DAQDLI ++L  D
Sbjct: 285 WALGVLAFELLTGAPPFEEE---MKDTTYKRIAALDIKMPSN--ISQDAQDLILKLLKYD 339

Query: 270 PTQRIKIRDILSHPLLKKYQTIKDSKSI 297
           P  R+++ D+  HP + + +   ++K +
Sbjct: 340 PKDRMRLGDVKMHPWILRNKPFWENKRL 367

>NCAS0D02100 Chr4 (385878..388058) [2181 bp, 726 aa] {ON} Anc_6.31
          Length = 726

 Score =  156 bits (395), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 81/207 (39%), Positives = 123/207 (59%), Gaps = 6/207 (2%)

Query: 77  EIVIMKLLSHPNVLSLYDVWETDNNLYLILEYAEKGELFNLLVDRGPLPEREAIKCFKQI 136
           EI I K + HPN++   D +E D N+Y++LE    G L +L+  R  L E E      QI
Sbjct: 139 EIQIHKSMKHPNIVHFVDCFEDDTNVYILLEICSNGSLMDLMKKRKTLTEPEVRFFTTQI 198

Query: 137 IIAISYCHALGIVHRDLKPENLLLDNSYNIKIADFGMAA-LQTDAGMLETSCGSPHYAAP 195
             A+ Y H+  ++HRDLK  N+  D  YN+K+ DFG+AA L  +     T CG+P+Y AP
Sbjct: 199 CGAVKYMHSRRVIHRDLKLGNIFFDKDYNLKVGDFGLAAVLANNRERKYTVCGTPNYIAP 258

Query: 196 EIVSGLPYEG--FASDVWSCGVILFALLTGRLPFDEENGNVRDLLLKVQKGQFEMPNNAE 253
           E++ G  + G  F  D+WS GV+++ALL G+ PF  ++ NV  +  +++  Q+  P +  
Sbjct: 259 EVLMG-KHAGHSFEVDIWSIGVMIYALLVGKPPFQAKDVNV--IYDRIKACQYGYPKDKY 315

Query: 254 ISGDAQDLIRRILVVDPTQRIKIRDIL 280
           +S +A+ LI  IL VDP +R  IR+I+
Sbjct: 316 VSSEAKTLIADILCVDPVERPSIREII 342

>Skud_15.144 Chr15 complement(254620..255969) [1350 bp, 449 aa] {ON}
           YOL016C (REAL)
          Length = 449

 Score =  152 bits (384), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 102/297 (34%), Positives = 160/297 (53%), Gaps = 15/297 (5%)

Query: 23  LGETLGFGSTGKVQLARHERTGQKTAVKVIPKSIFKSEGSHGNNDSVLPFNIEREIVIMK 82
            G TLG GS G V+ AR   T +  A+K++ K   +     GNN  V    +  E+ I++
Sbjct: 49  FGRTLGAGSFGVVRQARKLSTNEDVAIKILLKKALQ-----GNN--VQLQMLYEELSILQ 101

Query: 83  LLSHPNVLSLYDVWETDNNLYLILEYAEKGELFNLLVDRGPLPEREAIKCFKQIIIAISY 142
            LSHPN+++  D +E+ +  Y++ + A  GELF+ ++ RG   E +A++   QI+ A+ Y
Sbjct: 102 KLSHPNIVAFKDWFESKDKFYIVTQLATGGELFDRILSRGKFTEVDAVEIVVQILGAVEY 161

Query: 143 CHALGIVHRDLKPENLL-LDNSYN--IKIADFGMA-ALQTDAGMLETSCGSPHYAAPEIV 198
            H+  +VHRDLKPEN+L +D S N  + IADFG+A  L+    ++  + GS  Y APE++
Sbjct: 162 MHSKNVVHRDLKPENVLYVDKSENSPLVIADFGIAKQLKGKEDLIYKAAGSLGYVAPEVL 221

Query: 199 SGLPYEGFASDVWSCGVILFALLTGRLPFDEEN--GNVRDLLLKVQKGQFEMPNNAEISG 256
           +   + G   D+WS GVI + LL G  PF  E+  G + +         F MP    IS 
Sbjct: 222 TQDGH-GKPCDIWSIGVITYTLLCGYSPFIAESVEGFMEECTAYRYPVTFHMPYWDSISV 280

Query: 257 DAQDLIRRILVVDPTQRIKIRDILSHPLLKKYQTIKDSKSIKDLPRENTYLYPLADA 313
           DA+  I + L +DP  R    ++L  P +   + ++ S  + D+ R  +    L DA
Sbjct: 281 DAKHFILKALRLDPADRPTATELLDDPWITS-KRVETSNILPDVKRGFSLRKKLRDA 336

>Suva_15.155 Chr15 complement(267680..269038) [1359 bp, 452 aa] {ON}
           YOL016C (REAL)
          Length = 452

 Score =  152 bits (384), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 95/269 (35%), Positives = 149/269 (55%), Gaps = 14/269 (5%)

Query: 23  LGETLGFGSTGKVQLARHERTGQKTAVKVIPKSIFKSEGSHGNNDSVLPFNIEREIVIMK 82
            G TLG GS G V+ AR   T +  A+K++ K   +     GNN  +    +  E+ I++
Sbjct: 49  FGRTLGAGSFGVVRQARKLSTNEDVAIKILLKKALQ-----GNNIQLQ--MLYEELSILQ 101

Query: 83  LLSHPNVLSLYDVWETDNNLYLILEYAEKGELFNLLVDRGPLPEREAIKCFKQIIIAISY 142
            LSHPN++S  D +E+ +  Y++ + A  GELF+ ++ RG   E +A++   QI+ A+ Y
Sbjct: 102 KLSHPNIVSFKDWFESKDKFYIVTQLATGGELFDRILSRGKFTEIDAVEIIVQILGAVEY 161

Query: 143 CHALGIVHRDLKPENLL-LDNSYN--IKIADFGMA-ALQTDAGMLETSCGSPHYAAPEIV 198
            H+  +VHRDLKPEN+L +D S N  + IADFG+A  L+    ++  + GS  Y APE++
Sbjct: 162 IHSKNVVHRDLKPENVLYVDKSDNSPLVIADFGIAKQLKGKEDLIYKAAGSLGYVAPEVL 221

Query: 199 SGLPYEGFASDVWSCGVILFALLTGRLPFDEEN--GNVRDLLLKVQKGQFEMPNNAEISG 256
           +   + G   D+WS GVI + LL G  PF  E+  G + +         F MP    IS 
Sbjct: 222 TQDGH-GKPCDIWSVGVITYTLLCGYSPFIAESVEGFMEECTASRYPVTFHMPYWDNISV 280

Query: 257 DAQDLIRRILVVDPTQRIKIRDILSHPLL 285
           DA+  I + L+++P  R    ++L  P +
Sbjct: 281 DAKRFILKALILNPADRPTATELLDDPWI 309

>Suva_13.163 Chr13 complement(259136..261253) [2118 bp, 705 aa] {ON}
           YMR001C (REAL)
          Length = 705

 Score =  156 bits (394), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 93/266 (34%), Positives = 145/266 (54%), Gaps = 15/266 (5%)

Query: 24  GETLGFGSTGKVQLARHERTGQKTAVKVIPKSIFKSEGSHGNNDSVLPFNIEREIVIMKL 83
           G  LG G   +    + + +G+  A K + K+  KSE +           +  EI I K 
Sbjct: 85  GHFLGEGGFARCFQIKDD-SGEIFAAKTVAKASIKSEKTRKK--------LLSEIQIHKS 135

Query: 84  LSHPNVLSLYDVWETDNNLYLILEYAEKGELFNLLVDRGPLPEREAIKCFKQIIIAISYC 143
           ++HPN++   D +E D+N+Y++LE    G L  LL  R  L E E      QI  AI Y 
Sbjct: 136 MAHPNIVQFVDCFEDDSNVYILLEICPNGSLMELLKRRKVLTEPEVRFFTTQICGAIKYM 195

Query: 144 HALGIVHRDLKPENLLLDNSYNIKIADFGMAA-LQTDAGMLETSCGSPHYAAPEIVSGLP 202
           H+  ++HRDLK  N+  D++YN+KI DFG+AA L  ++    T CG+P+Y APE++ G  
Sbjct: 196 HSRRVIHRDLKLGNIFFDSNYNLKIGDFGLAAVLANESERKYTICGTPNYIAPEVLMG-K 254

Query: 203 YEG--FASDVWSCGVILFALLTGRLPFDEENGNVRDLLLKVQKGQFEMPNNAEISGDAQD 260
           + G  F  D+WS GV+L+ALL G+ PF   + N   +  +++   F  P +  IS + + 
Sbjct: 255 HSGHSFEVDIWSLGVMLYALLIGKPPFQARDVNT--IYERIKCRDFSFPKDKPISDEGKI 312

Query: 261 LIRRILVVDPTQRIKIRDILSHPLLK 286
           LIR IL +DP +R  + +I+ +   +
Sbjct: 313 LIRDILSLDPIERPSLTEIMDYVWFR 338

>KAFR0K00330 Chr11 (74162..75283) [1122 bp, 373 aa] {ON} Anc_6.214
           YPL203W
          Length = 373

 Score =  150 bits (378), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 91/271 (33%), Positives = 146/271 (53%), Gaps = 22/271 (8%)

Query: 21  WKLGETLGFGSTGKVQLARHERTGQKTAVKVIPKS-IFKSEGSHGNNDSVLPFNIEREIV 79
           +++  TLG GS G+V L R    G+  A+KV+ K  I K +     ND       ER + 
Sbjct: 63  FQIMRTLGTGSFGRVHLVRSVHNGRYYAIKVLKKQQIVKMKQIEHTND-------ERRM- 114

Query: 80  IMKLLSHPNVLSLYDVWETDNNLYLILEYAEKGELFNLLVDRGPLPEREAIKCFKQIIIA 139
            +KL+ HP ++ ++  ++  NNL+++++Y E GELF+LL      P   A     ++++A
Sbjct: 115 -LKLVEHPFLIRMWGTFQDSNNLFMVMDYIEGGELFSLLRKSQRFPNPVAKFYAAEVVLA 173

Query: 140 ISYCHALGIVHRDLKPENLLLDNSYNIKIADFGMAALQTDAGMLETSCGSPHYAAPEIVS 199
           + Y H   I++RDLKPEN+LLD + +IKI DFG A   T      T CG+P Y APE+++
Sbjct: 174 LEYLHFNNIIYRDLKPENILLDRNGHIKITDFGFAKEVTTVTW--TLCGTPDYIAPEVIA 231

Query: 200 GLPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRDLLLKVQKGQFEMPNNAEISGDAQ 259
             PY   + D WS G++++ +L G  PF   +        K+  G+   P  +  + D  
Sbjct: 232 TKPYNK-SVDWWSLGILIYEMLAGYTPF--YDTTPMKTYEKILHGRVTYP--SFFNSDVV 286

Query: 260 DLIRRILVVDPTQRI-----KIRDILSHPLL 285
           DL+ +++  D T+RI       ++I SHP  
Sbjct: 287 DLLSKLITADLTRRIGNLQNGTQEIKSHPWF 317

>Suva_11.56 Chr11 complement(119479..120675) [1197 bp, 398 aa] {ON}
           YKL166C (REAL)
          Length = 398

 Score =  150 bits (379), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 92/286 (32%), Positives = 150/286 (52%), Gaps = 22/286 (7%)

Query: 6   METYRITKPLNIIGPWKLGETLGFGSTGKVQLARHERTGQKTAVKVIPK-SIFKSEGSHG 64
           M  YR T     +G +++  TLG GS G+V L R    G+  A+K + K +I K +    
Sbjct: 73  MLQYRETSGKYSLGDFQILRTLGTGSFGRVHLIRSNHNGRFYALKTLKKHTIVKLKQVEH 132

Query: 65  NNDSVLPFNIEREIVIMKLLSHPNVLSLYDVWETDNNLYLILEYAEKGELFNLLVDRGPL 124
            ND       ER +  + ++SHP ++ ++  ++    ++++++Y E GELF+LL      
Sbjct: 133 TND-------ERRM--LSIVSHPFIIRMWGTFQDSQQVFMVMDYIEGGELFSLLRKSQRF 183

Query: 125 PEREAIKCFKQIIIAISYCHALGIVHRDLKPENLLLDNSYNIKIADFGMAALQTDAGMLE 184
           P   A     ++ +A+ Y H+  I++RDLKPEN+LLD + +IKI DFG A    D     
Sbjct: 184 PNPVAKFYAAEVCLALEYLHSKDIIYRDLKPENILLDKNGHIKITDFGFAKFVPDVTY-- 241

Query: 185 TSCGSPHYAAPEIVSGLPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRDLLLKVQKG 244
           T CG+P Y APE+VS  PY   + D WS G++++ +L G  PF   N N       +   
Sbjct: 242 TLCGTPDYIAPEVVSTKPYNK-SVDWWSFGILIYEMLAGYTPF--YNSNTMKTYENILNA 298

Query: 245 QFEMPNNAEISGDAQDLIRRILVVDPTQRI-----KIRDILSHPLL 285
           + + P       DAQDL+++++  D ++R+        D+ +HP  
Sbjct: 299 ELKFP--PFFHPDAQDLLKKLITRDLSERLGNLQNGSEDVKNHPWF 342

>YDL101C Chr4 complement(280307..281848) [1542 bp, 513 aa] {ON}
           DUN1Cell-cycle checkpoint serine-threonine kinase
           required for DNA damage-induced transcription of certain
           target genes, phosphorylation of Rad55p and Sml1p, and
           transient G2/M arrest after DNA damage; also regulates
           postreplicative DNA repair
          Length = 513

 Score =  153 bits (386), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 95/306 (31%), Positives = 157/306 (51%), Gaps = 40/306 (13%)

Query: 12  TKPLNIIGPWKLGETLGFGSTGKVQLARHERTGQKTAVKVIPKSIFKSEGSHGNNDSVLP 71
           T+P++    + LG+ LG G    V+ A++++TGQ+ AVK+          +  N+D    
Sbjct: 191 TRPVSFFDKYLLGKELGAGHYALVKEAKNKKTGQQVAVKIF--------HAQQNDDQKKN 242

Query: 72  FNIEREIVIMKLLSHPNVLSLYDVW-----ETDNNLYLILEYAEKGELFNLLVDRGPLPE 126
                E  I+  + HPN+++L D +     ++    YL+LE  + GELF  +V +  L +
Sbjct: 243 KQFREETNILMRVQHPNIVNLLDSFVEPISKSQIQKYLVLEKIDDGELFERIVRKTCLRQ 302

Query: 127 REAIKCFKQIIIAISYCHALGIVHRDLKPENLLLDNS-------------------YNIK 167
            E+   FKQ++  + Y H   I+HRD+KPEN+LL+ +                     +K
Sbjct: 303 DESKALFKQLLTGLKYLHEQNIIHRDIKPENILLNITRRENPSQVQLGPWDEDEIDIQVK 362

Query: 168 IADFGMAALQTDAGMLETSCGSPHYAAPEIVSGLPYEGFAS--DVWSCGVILFALLTGRL 225
           IADFG+A    +     T CG+P Y APE+++    +G+ S  D+WS GVIL+  L G  
Sbjct: 363 IADFGLAKFTGEMQFTNTLCGTPSYVAPEVLTK---KGYTSKVDLWSAGVILYVCLCGFP 419

Query: 226 PFDEENG--NVRDLLLKVQKGQFEMPNNAEISGDAQDLIRRILVVDPTQRIKIRDILSHP 283
           PF ++ G  ++++ +L+  K  F  P   +I      LI  +LV++P +R  I + L+HP
Sbjct: 420 PFSDQLGPPSLKEQILQA-KYAFYSPYWDKIDDSVLHLISNLLVLNPDERYNIDEALNHP 478

Query: 284 LLKKYQ 289
                Q
Sbjct: 479 WFNDIQ 484

>Smik_7.319 Chr7 complement(534132..535472) [1341 bp, 446 aa] {ON}
           YFR014C (REAL)
          Length = 446

 Score =  151 bits (382), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 94/271 (34%), Positives = 151/271 (55%), Gaps = 18/271 (6%)

Query: 23  LGETLGFGSTGKVQLARHERTGQKTAVKVIPKSIFKSEGSHGNNDSVLPFNIEREIVIMK 82
            G+TLG G+ G V+ AR+  TG+  AVK++ K   K     GN   +    +  E+ I++
Sbjct: 39  FGKTLGAGTFGVVRQARNTETGEDVAVKILIKKALK-----GNKIQLEA--LYDELDILQ 91

Query: 83  LLSHPNVLSLYDVWETDNNLYLILEYAEKGELFNLLVDRGPLPEREAIKCFKQIIIAISY 142
            L HPN+++  D +E+ +  Y+I + A+ GELF+ ++ +G   E +A++   +I+ A+ Y
Sbjct: 92  RLHHPNIVAFKDWFESKDKFYIITQLAKGGELFDRILKKGKFTEVDAVRILVEILSAVKY 151

Query: 143 CHALGIVHRDLKPENLL-LDNSYN--IKIADFGMAA-LQTDAGMLETSCGSPHYAAPEIV 198
            H+  IVHRDLKPENLL +D S    + +ADFG+A  L++D  ++    GS  Y APE++
Sbjct: 152 MHSQNIVHRDLKPENLLYIDKSDESPLVVADFGIAKRLKSDEELIYKPAGSLGYVAPEVL 211

Query: 199 SGLPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRDLLLKVQKGQ----FEMPNNAEI 254
           +   + G   D+WS GVI + LL G   F  E   V+D L +   G+    F  P    +
Sbjct: 212 TQDGH-GKPCDIWSLGVITYTLLCGYSAFKAE--RVQDFLDECTTGEYPVRFHRPYWDSV 268

Query: 255 SGDAQDLIRRILVVDPTQRIKIRDILSHPLL 285
           S  A+  I + L +DP++R     +L  P +
Sbjct: 269 SDKAKQFILKALNLDPSKRPTAAQLLEDPWI 299

>KNAG0J01700 Chr10 (309962..312424) [2463 bp, 820 aa] {ON} 
          Length = 820

 Score =  157 bits (396), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 92/280 (32%), Positives = 149/280 (53%), Gaps = 31/280 (11%)

Query: 25  ETLGFGSTGKVQLARHERTGQKTAVKVIPKSIFKSEGSHGNNDSVLPFNIEREIVIMKLL 84
           E +G G+   V+ A    TG+  AVK+I K         GN D V      RE+ +++ L
Sbjct: 206 EVVGQGAFATVKKAIETATGRTYAVKIINKRKVM-----GNLDGVT-----RELTVLQKL 255

Query: 85  SHPNVLSLYDVWETDNNLYLILEYAEKGELFNLLVDRGPLPEREAIKCFKQIIIAISYCH 144
            HP++++L   +E  +N Y+++E+   G+L + +   GP+ E    +  +QI+ A+ Y H
Sbjct: 256 DHPSIVTLKGFYEDKDNYYMVMEFVSGGDLMDFVAAHGPVGEDAGREITRQILEAVKYIH 315

Query: 145 ALGIVHRDLKPENLLL--DNSYNIKIADFGMAALQTDAGMLETSCGSPHYAAPEIVSG-- 200
           ++GI HRDLKP+N+L+  D+   +KI DFG+A +Q     + T CG+  Y APE+V+G  
Sbjct: 316 SVGISHRDLKPDNILIKQDDPVLVKITDFGLAKMQEHGAFMNTFCGTLAYVAPEVVNGRQ 375

Query: 201 ------LP------YEGFASDVWSCGVILFALLTGRLPFDEENGNVRDLLLKVQKGQF-E 247
                 +P      Y     D+WS G +++ +LTG LPF       + L  ++ K  + E
Sbjct: 376 QTSEPAVPKGERSHYSSLV-DMWSMGCLVYVILTGHLPF--SGSTPQQLYEQIGKASYHE 432

Query: 248 MP-NNAEISGDAQDLIRRILVVDPTQRIKIRDILSHPLLK 286
           +P  +  IS  A+D I  +L VDP  R+     L HP ++
Sbjct: 433 VPLKDCRISDQARDFIDCLLQVDPNNRLSAARALEHPWIQ 472

>Skud_16.70 Chr16 complement(129918..131021) [1104 bp, 367 aa] {ON}
           YPL209C (REAL)
          Length = 367

 Score =  149 bits (377), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 86/268 (32%), Positives = 144/268 (53%), Gaps = 23/268 (8%)

Query: 35  VQLARHERTGQKTAVKVIPKSIFKSEGSHGNNDSVLPFNIER----EIVIMKLLSHPNVL 90
           V   RH+ TG   A+KV+ K            + ++ +N++R    E+ I   L+HPN+ 
Sbjct: 118 VYCVRHKSTGYICALKVMEK------------EEIIRYNLQRQFRREVEIQMSLNHPNLT 165

Query: 91  SLYDVWETDNNLYLILEYAEKGELFNLLVDRGPLPEREAIKCFKQIIIAISYCHALGIVH 150
             Y  +  +  +YL++EY   GE++ LL   GP  +  A     QI  A+ Y H   I+H
Sbjct: 166 KSYGYFHDEKRVYLLMEYLVNGEMYKLLRSHGPFNDILASDYIYQIANALDYMHKKNIIH 225

Query: 151 RDLKPENLLLDNSYNIKIADFGMAALQTDAGMLETSCGSPHYAAPEIVSGLPYEGFASDV 210
           RD+KPEN+L+  +  IK+ DFG + +       +T CG+  Y +PE++    Y+    D 
Sbjct: 226 RDIKPENILIGFNNTIKLTDFGWSIINPPESRRKTVCGTIDYLSPEMIESREYDH-TIDA 284

Query: 211 WSCGVILFALLTGRLPFDEENGNVRDLLLK-VQKGQFEMPNNAEISGDAQDLIRRILVVD 269
           W+ G++ F LLTG  PF+EE   ++D   K +     ++P+N  +S DAQDLI ++L  D
Sbjct: 285 WALGILAFELLTGAPPFEEE---MKDTTYKRIAALDIKIPSN--VSQDAQDLILKLLKYD 339

Query: 270 PTQRIKIRDILSHPLLKKYQTIKDSKSI 297
           P  R+++ D+  HP + + +   ++K +
Sbjct: 340 PKDRMRLEDVKMHPWILRNKPFWENKRL 367

>ZYRO0E07018g Chr5 (531316..532419) [1104 bp, 367 aa] {ON} similar
           to uniprot|P38991 Saccharomyces cerevisiae YPL209C IPL1
           Aurora kinase involved in regulating
           kinetochore-microtubule attachments associates with
           Sli5p which stimulates Ipl1p kinase activity and
           promotes its association with the mitotic spindle
           potential Cdc28p substrate
          Length = 367

 Score =  149 bits (377), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 84/258 (32%), Positives = 139/258 (53%), Gaps = 21/258 (8%)

Query: 34  KVQLARHERTGQKTAVKVIPKSIFKSEGSHGNNDSVLPFNIE----REIVIMKLLSHPNV 89
           +V   RH+ TG   A+KV+ K              ++ +N++    RE+ I   L+H N+
Sbjct: 122 RVYCVRHKVTGFICAMKVMEKQ------------EIMQYNVQKQFRREVEIQSSLNHQNL 169

Query: 90  LSLYDVWETDNNLYLILEYAEKGELFNLLVDRGPLPEREAIKCFKQIIIAISYCHALGIV 149
             LY  +  D  +YL++EY   GEL+ LL  +GPL +  A     Q+  A+ Y H   I+
Sbjct: 170 TKLYGYFHDDKRVYLLMEYLVNGELYKLLRAKGPLDDIFASHYVYQMADALDYMHQRNII 229

Query: 150 HRDLKPENLLLDNSYNIKIADFGMAALQTDAGMLETSCGSPHYAAPEIVSGLPYEGFASD 209
           HRD+KPEN+L+     +K+ DFG + +       +T CG+  Y +PE+++   Y+    D
Sbjct: 230 HRDVKPENILIGFDNTVKLTDFGWSIINPRGTKRKTMCGTLDYLSPELIASKEYDD-KVD 288

Query: 210 VWSCGVILFALLTGRLPFDEENGNVRDLLLKVQKGQFEMPNNAEISGDAQDLIRRILVVD 269
           VW+ GV+ F L+    PF+E++  +     ++ +G  + PN+  IS DAQDLI ++L  +
Sbjct: 289 VWALGVLTFELVVNSPPFEEDSKELTS--KRIVRGDLKFPNH--ISSDAQDLITKLLRHN 344

Query: 270 PTQRIKIRDILSHPLLKK 287
              RI +R++  HP + K
Sbjct: 345 SKDRISLREVKQHPWITK 362

>Smik_15.153 Chr15 complement(261920..263248) [1329 bp, 442 aa] {ON}
           YOL016C (REAL)
          Length = 442

 Score =  151 bits (381), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 96/269 (35%), Positives = 150/269 (55%), Gaps = 14/269 (5%)

Query: 23  LGETLGFGSTGKVQLARHERTGQKTAVKVIPKSIFKSEGSHGNNDSVLPFNIEREIVIMK 82
            G TLG GS G V+ AR   T +  A+K++ K   +     GNN  V    +  E+ I++
Sbjct: 49  FGRTLGAGSFGVVRQARKLSTNEDVAIKILLKKALQ-----GNN--VQLQMLYEELSILQ 101

Query: 83  LLSHPNVLSLYDVWETDNNLYLILEYAEKGELFNLLVDRGPLPEREAIKCFKQIIIAISY 142
            LSHPN++S  D +E+ +  Y++ + A  GELF+ ++ RG   E +A++   QI+ A+ Y
Sbjct: 102 KLSHPNIVSFKDWFESKDKFYIVTQLATGGELFDRILSRGKFTEVDAVEIVVQILGAVEY 161

Query: 143 CHALGIVHRDLKPENLL-LDNSYN--IKIADFGMA-ALQTDAGMLETSCGSPHYAAPEIV 198
            H+  +VHRDLKPEN+L +D S N  + IADFG+A  L+    ++  + GS  Y APE++
Sbjct: 162 MHSKNVVHRDLKPENVLYVDKSENSPLVIADFGIAKQLKGKEDLIYKAAGSLGYVAPEVL 221

Query: 199 SGLPYEGFASDVWSCGVILFALLTGRLPFDEEN--GNVRDLLLKVQKGQFEMPNNAEISG 256
           +   + G   D+WS GVI + LL G  PF  E+  G + +         F +P    IS 
Sbjct: 222 TQDGH-GKPCDIWSIGVITYTLLCGYSPFIAESVEGFMEECTASRYPVTFHIPYWDNISI 280

Query: 257 DAQDLIRRILVVDPTQRIKIRDILSHPLL 285
           DA+  I + L ++PT+R    ++L  P +
Sbjct: 281 DAKRFILKALRLNPTERPTATELLDDPWI 309

>KAFR0H02430 Chr8 complement(464446..466800) [2355 bp, 784 aa] {ON}
           Anc_8.676 YPL153C
          Length = 784

 Score =  156 bits (394), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 94/277 (33%), Positives = 156/277 (56%), Gaps = 28/277 (10%)

Query: 25  ETLGFGSTGKVQLARHERTGQKTAVKVIPKSIFKSEGSHGNNDSVLPFNIEREIVIMKLL 84
           E +G G+   V+ A    TG+  AVK+I K         GN D V      RE+ ++K L
Sbjct: 191 EVVGQGAFATVKKAVERTTGKTYAVKIINK-----RKVMGNLDGVT-----RELEVLKRL 240

Query: 85  SHPNVLSLYDVWETDNNLYLILEYAEKGELFNLLVDRGPLPEREAIKCFKQIIIAISYCH 144
           +HP ++SL   +E + + Y+++E+   G+L + +   G + E    +  +QI+ A+ Y H
Sbjct: 241 NHPRIVSLKGFYEDNESYYMVMEFVSGGDLMDFVAAHGAVGEDAGKEISRQILEAVKYIH 300

Query: 145 ALGIVHRDLKPENLLL--DNSYNIKIADFGMAALQTDAGMLETSCGSPHYAAPEIV-SGL 201
           ++GI HRDLKP+N+L+  D+   +KI DFG+A +Q +   ++T CG+  Y APE++ S  
Sbjct: 301 SMGISHRDLKPDNILIEQDDPVLVKITDFGLAKVQGNGTFMKTFCGTLAYVAPEVIGSSS 360

Query: 202 PY-------EGFAS--DVWSCGVILFALLTGRLPFDEENGNVRDLLLK-VQKGQF-EMP- 249
            Y         ++S  D+WS G +++ +LTG LPF   +G+ ++ L K + +G + E P 
Sbjct: 361 KYNEEDEERNEYSSLVDMWSMGCLVYVILTGHLPF---SGSTQEQLYKQISRGSYHEGPL 417

Query: 250 NNAEISGDAQDLIRRILVVDPTQRIKIRDILSHPLLK 286
            +  IS +A+D I  +L VDP+ R+     L HP +K
Sbjct: 418 KDYRISDEARDFIDSLLQVDPSNRLTAARALEHPWIK 454

>Skud_10.50 Chr10 complement(84697..85890) [1194 bp, 397 aa] {ON}
           YJL164C (REAL)
          Length = 397

 Score =  150 bits (378), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 89/285 (31%), Positives = 149/285 (52%), Gaps = 24/285 (8%)

Query: 10  RITKPLNIIGPWKLGETLGFGSTGKVQLARHERTGQKTAVKVIPKSIFK--SEGSHGNND 67
           R+T     +  +++  TLG GS G+V L R    G+  A+KV+ K I     +  H N+ 
Sbjct: 76  RVTGGKYSLQDFQILRTLGTGSFGRVHLIRSRHNGRYYAMKVLKKEIVVRLKQVEHTND- 134

Query: 68  SVLPFNIEREIVIMKLLSHPNVLSLYDVWETDNNLYLILEYAEKGELFNLLVDRGPLPER 127
                    E +++ +++HP ++ ++  ++    +++I++Y E GELF+LL      P  
Sbjct: 135 ---------ERLMLSIVTHPFIIRMWGTFQDSQQIFMIMDYIEGGELFSLLRKSQRFPNP 185

Query: 128 EAIKCFKQIIIAISYCHALGIVHRDLKPENLLLDNSYNIKIADFGMAALQTDAGMLETSC 187
            A     ++ +A+ Y H+  I++RDLKPEN+LLD + +IKI DFG A    D     T C
Sbjct: 186 VAKFYAAEVCLALEYLHSKDIIYRDLKPENILLDKNGHIKITDFGFAKYVPDVTY--TLC 243

Query: 188 GSPHYAAPEIVSGLPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRDLLLKVQKGQFE 247
           G+P Y APE+VS  PY   + D WS G++++ +L G  PF   + N      K+   +  
Sbjct: 244 GTPDYIAPEVVSTKPYNK-SIDWWSFGILIYEMLAGYTPF--YDSNTMKTYEKILNAELR 300

Query: 248 MPNNAEISGDAQDLIRRILVVDPTQRI-----KIRDILSHPLLKK 287
            P     + D +DL+ R++  D +QR+        D+ +HP  K+
Sbjct: 301 FP--PFFNEDVKDLLSRLITRDLSQRLGNLQNGTEDVKNHPWFKE 343

>Smik_13.159 Chr13 complement(260249..262366) [2118 bp, 705 aa] {ON}
           YMR001C (REAL)
          Length = 705

 Score =  155 bits (392), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 93/269 (34%), Positives = 145/269 (53%), Gaps = 15/269 (5%)

Query: 21  WKLGETLGFGSTGKVQLARHERTGQKTAVKVIPKSIFKSEGSHGNNDSVLPFNIEREIVI 80
           +  G  LG G   +    + + +G   A K + K+  KSE +           +  EI I
Sbjct: 82  YHRGHFLGEGGFARCFQIKDD-SGDIFAAKTVAKASIKSEKTRKK--------LLSEIQI 132

Query: 81  MKLLSHPNVLSLYDVWETDNNLYLILEYAEKGELFNLLVDRGPLPEREAIKCFKQIIIAI 140
            K ++HPN++   D +E D+N+Y++LE    G L  LL  R  L E E      QI  AI
Sbjct: 133 HKSMAHPNIVQFIDCFEDDSNVYILLEICPNGSLMELLKRRKVLSEPEVRFFTTQICGAI 192

Query: 141 SYCHALGIVHRDLKPENLLLDNSYNIKIADFGMAA-LQTDAGMLETSCGSPHYAAPEIVS 199
            Y H+  ++HRDLK  N+  D++YN+KI DFG+AA L  ++    T CG+P+Y APE++ 
Sbjct: 193 KYMHSRRVIHRDLKLGNIFFDSNYNLKIGDFGLAAVLANESERKYTICGTPNYIAPEVLM 252

Query: 200 GLPYEG--FASDVWSCGVILFALLTGRLPFDEENGNVRDLLLKVQKGQFEMPNNAEISGD 257
           G  + G  F  D+WS GV+L+ALL G+ PF   + N   +  +++   F  P +  IS +
Sbjct: 253 G-KHSGHSFEVDIWSLGVMLYALLIGKPPFQARDVNT--IYERIKCRDFSFPKDKPISDE 309

Query: 258 AQDLIRRILVVDPTQRIKIRDILSHPLLK 286
            + LIR IL +DP +R  + +I+ +   +
Sbjct: 310 GKILIRDILSLDPIERPSLTEIMDYVWFR 338

>KNAG0I01480 Chr9 (287733..289055) [1323 bp, 440 aa] {ON} Anc_1.374
           YFR014C
          Length = 440

 Score =  150 bits (380), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 96/273 (35%), Positives = 153/273 (56%), Gaps = 18/273 (6%)

Query: 21  WKLGETLGFGSTGKVQLARHERTGQKTAVKVIPKSIFKSEGSHGNNDSVLPFNIEREIVI 80
           ++ G+T+G G+ G V+ A    TG++ AVK+I K     EG    ND  L   +  E+ I
Sbjct: 41  YEFGKTMGAGTFGVVRKATKISTGEEVAVKIILKKAL--EG----NDIQLQM-LYDELAI 93

Query: 81  MKLLSHPNVLSLYDVWETDNNLYLILEYAEKGELFNLLVDRGPLPEREAIKCFKQIIIAI 140
           ++ L HPN++     +E+ + +Y++ + A  GELF+ ++ RG   E +A+    QI+ A+
Sbjct: 94  LQQLKHPNIVEFKAWFESKDKIYIVTQLATGGELFDTILKRGKFTELDAVDIVVQILKAV 153

Query: 141 SYCHALGIVHRDLKPENLL-LDNS--YNIKIADFGMAA-LQTDAGMLETSCGSPHYAAPE 196
            Y H+  +VHRDLKPEN+L +D S    I IADFG+A  L+ +  ++  + GS  Y APE
Sbjct: 154 EYIHSQNVVHRDLKPENILYVDESEKSQIVIADFGIAKRLEGEGDLIFKAAGSLGYVAPE 213

Query: 197 IV--SGLPYEGFASDVWSCGVILFALLTGRLPFDEE--NGNVRDLLLKVQKGQFEMPNNA 252
           ++  SG    G   D+WS G+I + LL G  PF  E  +G + +++   +   F  P   
Sbjct: 214 VLLNSG---HGKPCDIWSVGIIAYTLLCGYSPFVAEDVDGFLDEIVENEEPIAFHSPYWD 270

Query: 253 EISGDAQDLIRRILVVDPTQRIKIRDILSHPLL 285
           EIS +A+  I R + +DP QR    ++L  P +
Sbjct: 271 EISNEAKQFILRAVTIDPFQRPTATELLKDPWI 303

>Suva_4.145 Chr4 complement(268826..270370) [1545 bp, 514 aa] {ON}
           YDL101C (REAL)
          Length = 514

 Score =  152 bits (384), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 97/303 (32%), Positives = 157/303 (51%), Gaps = 40/303 (13%)

Query: 12  TKPLNIIGPWKLGETLGFGSTGKVQLARHERTGQKTAVKVIPKSIFKSEGSHGNNDSVLP 71
           TKP++    + LG+ LG G    V+ A++++TGQ+ AVK+          +  N+D    
Sbjct: 192 TKPVSFFDKYLLGKELGAGHYALVKEAKNKKTGQQVAVKIF--------HAQQNDDQKKN 243

Query: 72  FNIEREIVIMKLLSHPNVLSLYDVW-----ETDNNLYLILEYAEKGELFNLLVDRGPLPE 126
                E  I+  + HPN+++L D +     ++    YL+LE  + GELF  +V +  L +
Sbjct: 244 KQFREETNILMRVHHPNIVNLLDSFVEPISKSQIQKYLVLEKIDDGELFERIVRKTCLGQ 303

Query: 127 REAIKCFKQIIIAISYCHALGIVHRDLKPENLLL-----DNS--------------YNIK 167
            E+   FKQ++  + Y H   I+HRD+KPEN+LL     +NS                +K
Sbjct: 304 DESRALFKQLLTGLKYLHEQNIIHRDIKPENILLNITRRENSNQVQLGPWDEDEIDIQVK 363

Query: 168 IADFGMAALQTDAGMLETSCGSPHYAAPEIVSGLPYEGFAS--DVWSCGVILFALLTGRL 225
           IADFG+A    +     T CG+P Y APE+   L  +G+ S  D+WS GVIL+  L G  
Sbjct: 364 IADFGLAKFTGEMQFTNTLCGTPSYVAPEV---LTKKGYTSKVDLWSAGVILYVCLCGFP 420

Query: 226 PFDEENG--NVRDLLLKVQKGQFEMPNNAEISGDAQDLIRRILVVDPTQRIKIRDILSHP 283
           PF ++ G  ++++ +++  K  F  P   +I      LI  +LV++P +R  I + ++HP
Sbjct: 421 PFSDQLGPPSLKEQIMQA-KYAFYSPYWDKIDDSVLHLISNLLVLNPDERYNIDEAMNHP 479

Query: 284 LLK 286
             K
Sbjct: 480 WFK 482

>TDEL0E05310 Chr5 (972769..973893) [1125 bp, 374 aa] {ON} Anc_6.222
           YPL209C
          Length = 374

 Score =  149 bits (375), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 82/262 (31%), Positives = 141/262 (53%), Gaps = 21/262 (8%)

Query: 34  KVQLARHERTGQKTAVKVIPKSIFKSEGSHGNNDSVLPFNIE----REIVIMKLLSHPNV 89
           +V   +H++TG   A+K + KS             ++ +N++    RE+ I   LSHPN+
Sbjct: 129 RVYCVKHKKTGFICAMKAMEKS------------ELVQYNVQKQFRREVEIQSSLSHPNL 176

Query: 90  LSLYDVWETDNNLYLILEYAEKGELFNLLVDRGPLPEREAIKCFKQIIIAISYCHALGIV 149
             LY  +  D  +YL++EY   GEL+ +L  RGP  +  A     Q+  A+ + H   I+
Sbjct: 177 TKLYGFFHDDKRVYLLMEYLVNGELYKVLKARGPFNDIVASHYVYQMADALDFMHQKNII 236

Query: 150 HRDLKPENLLLDNSYNIKIADFGMAALQTDAGMLETSCGSPHYAAPEIVSGLPYEGFASD 209
           HRD+KPEN+L+     +K+ DFG + +       +T CG+  Y +PE+++   Y+    D
Sbjct: 237 HRDVKPENILMGFGNVVKLTDFGWSIISARGVRRKTLCGTIDYLSPELITSREYDD-KVD 295

Query: 210 VWSCGVILFALLTGRLPFDEENGNVRDLLLKVQKGQFEMPNNAEISGDAQDLIRRILVVD 269
           VW+ GV+ + L+    PF+E++ +      ++  G  + P+   IS DAQDLIR++L   
Sbjct: 296 VWALGVLTYELIVNSPPFEEDSKD--STYKRIVSGDLKFPDT--ISSDAQDLIRKLLRHK 351

Query: 270 PTQRIKIRDILSHPLLKKYQTI 291
              RI ++D+  HP + K+++ 
Sbjct: 352 AKDRISLQDVKRHPWILKHKSF 373

>ACL006W Chr3 (344395..346521) [2127 bp, 708 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR001C (CDC5)
          Length = 708

 Score =  155 bits (391), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 93/266 (34%), Positives = 142/266 (53%), Gaps = 15/266 (5%)

Query: 24  GETLGFGSTGKVQLARHERTGQKTAVKVIPKSIFKSEGSHGNNDSVLPFNIEREIVIMKL 83
           G  LG G   +      + +G+  A K + K   KSE +           +  EI I K 
Sbjct: 76  GMFLGEGGFARC-FQMKDDSGKVFAAKTVAKISIKSEKTRKK--------LLSEIQIHKS 126

Query: 84  LSHPNVLSLYDVWETDNNLYLILEYAEKGELFNLLVDRGPLPEREAIKCFKQIIIAISYC 143
           + HPN++   D +E D N+Y++LE    G L +LL  R  L E E      QI+ AI Y 
Sbjct: 127 MKHPNIVQFTDCFEDDTNVYILLEICPNGSLMDLLKQRKQLTEPEVRFFTTQIVGAIKYM 186

Query: 144 HALGIVHRDLKPENLLLDNSYNIKIADFGMAA-LQTDAGMLETSCGSPHYAAPEIVSGLP 202
           H+  I+HRDLK  N+  D  +N+KI DFG+AA L  D     T CG+P+Y APE+++G  
Sbjct: 187 HSRRIIHRDLKLGNIFFDKHFNLKIGDFGLAAVLANDRERKYTICGTPNYIAPEVLTG-K 245

Query: 203 YEG--FASDVWSCGVILFALLTGRLPFDEENGNVRDLLLKVQKGQFEMPNNAEISGDAQD 260
           + G  F  D+WS GV+++ALL G+ PF  +  N   +  +++   F  P +  IS +A+ 
Sbjct: 246 HTGHSFEVDIWSIGVMIYALLIGKPPFQAKEVNT--IYERIKVCDFSFPKDKPISSEAKV 303

Query: 261 LIRRILVVDPTQRIKIRDILSHPLLK 286
           LI+ IL +DP +R  + +I+ +   +
Sbjct: 304 LIKDILSLDPLERPSLAEIMEYVWFR 329

>KLLA0C06138g Chr3 (540409..542535) [2127 bp, 708 aa] {ON} similar
           to uniprot|P32562 Saccharomyces cerevisiae YMR001C
          Length = 708

 Score =  155 bits (391), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 92/259 (35%), Positives = 139/259 (53%), Gaps = 15/259 (5%)

Query: 24  GETLGFGSTGKVQLARHERTGQKTAVKVIPKSIFKSEGSHGNNDSVLPFNIEREIVIMKL 83
           G  LG G   +    + ++ G+  A K + K   KSE +           +  EI I K 
Sbjct: 93  GHFLGEGGFARCFQMKDDK-GKVFAAKTVAKLSIKSEKTRRK--------LLSEIQIHKS 143

Query: 84  LSHPNVLSLYDVWETDNNLYLILEYAEKGELFNLLVDRGPLPEREAIKCFKQIIIAISYC 143
           + HPN++   D +E D N+Y++LE    G +  LL  R  L E E   C  QII AI Y 
Sbjct: 144 MKHPNIVQFTDCFEDDTNVYILLEICPNGSVMELLRQRKHLTEPEVRFCMIQIIGAIRYM 203

Query: 144 HALGIVHRDLKPENLLLDNSYNIKIADFGMAA-LQTDAGMLETSCGSPHYAAPEIVSGLP 202
           H+  ++HRDLK  N+  D  YN+KI DFG+AA L  D     T CG+P+Y APE+++G  
Sbjct: 204 HSRRVIHRDLKLGNIFFDKEYNLKIGDFGLAAVLANDKERKYTICGTPNYIAPEVLTG-K 262

Query: 203 YEG--FASDVWSCGVILFALLTGRLPFDEENGNVRDLLLKVQKGQFEMPNNAEISGDAQD 260
           + G  +  D+WS GV+L+ALL G+ PF  +   V  +  +++   F  P +  +S DA++
Sbjct: 263 HTGHSYEVDIWSIGVMLYALLFGKPPFQAK--EVETIYERIKCRDFIFPADKPVSSDAKN 320

Query: 261 LIRRILVVDPTQRIKIRDI 279
           LI  +L ++P  R  + +I
Sbjct: 321 LISHLLQLNPAARPSLYEI 339

>YJL164C Chr10 complement(109966..111159) [1194 bp, 397 aa] {ON}
           TPK1cAMP-dependent protein kinase catalytic subunit;
           promotes vegetative growth in response to nutrients via
           the Ras-cAMP signaling pathway; inhibited by regulatory
           subunit Bcy1p in the absence of cAMP; partially
           redundant with Tpk2p and Tpk3p
          Length = 397

 Score =  149 bits (376), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 89/285 (31%), Positives = 149/285 (52%), Gaps = 24/285 (8%)

Query: 10  RITKPLNIIGPWKLGETLGFGSTGKVQLARHERTGQKTAVKVIPKSIFK--SEGSHGNND 67
           R+T     +  +++  TLG GS G+V L R    G+  A+KV+ K I     +  H N+ 
Sbjct: 76  RVTSGKYSLQDFQILRTLGTGSFGRVHLIRSRHNGRYYAMKVLKKEIVVRLKQVEHTND- 134

Query: 68  SVLPFNIEREIVIMKLLSHPNVLSLYDVWETDNNLYLILEYAEKGELFNLLVDRGPLPER 127
                    E +++ +++HP ++ ++  ++    +++I++Y E GELF+LL      P  
Sbjct: 135 ---------ERLMLSIVTHPFIIRMWGTFQDAQQIFMIMDYIEGGELFSLLRKSQRFPNP 185

Query: 128 EAIKCFKQIIIAISYCHALGIVHRDLKPENLLLDNSYNIKIADFGMAALQTDAGMLETSC 187
            A     ++ +A+ Y H+  I++RDLKPEN+LLD + +IKI DFG A    D     T C
Sbjct: 186 VAKFYAAEVCLALEYLHSKDIIYRDLKPENILLDKNGHIKITDFGFAKYVPDVTY--TLC 243

Query: 188 GSPHYAAPEIVSGLPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRDLLLKVQKGQFE 247
           G+P Y APE+VS  PY   + D WS G++++ +L G  PF   + N      K+   +  
Sbjct: 244 GTPDYIAPEVVSTKPYNK-SIDWWSFGILIYEMLAGYTPF--YDSNTMKTYEKILNAELR 300

Query: 248 MPNNAEISGDAQDLIRRILVVDPTQRI-----KIRDILSHPLLKK 287
            P     + D +DL+ R++  D +QR+        D+ +HP  K+
Sbjct: 301 FP--PFFNEDVKDLLSRLITRDLSQRLGNLQNGTEDVKNHPWFKE 343

>KLLA0B02332g Chr2 complement(206863..207948) [1086 bp, 361 aa] {ON}
           similar to uniprot|P38991 Saccharomyces cerevisiae
           YPL209C IPL1 Aurora kinase involved in regulating
           kinetochore-microtubule attachments associates with
           Sli5p which stimulates Ipl1p kinase activity and
           promotes its association with the mitotic spindle
           potential Cdc28p substrate
          Length = 361

 Score =  148 bits (373), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 85/269 (31%), Positives = 140/269 (52%), Gaps = 21/269 (7%)

Query: 21  WKLGETLGFGSTGKVQLARHERTGQKTAVKVIPKSIFKSEGSHGNNDSVLPFNIE----R 76
           +++G+ LG G  GKV   +H  TG   A+K + K              ++ + I+    R
Sbjct: 100 FEIGKILGKGKFGKVYCVKHRETGLICALKAMEKK------------EIVQYTIQKQFRR 147

Query: 77  EIVIMKLLSHPNVLSLYDVWETDNNLYLILEYAEKGELFNLLVDRGPLPEREAIKCFKQI 136
           E+ I     H N+  LY  +  +  +YL++EY   GEL+  L + GPL E  A     Q+
Sbjct: 148 EVEIQGSFKHKNLTQLYGFFYDEKRVYLLMEYVYYGELYKFLKNNGPLNETLASYFVYQM 207

Query: 137 IIAISYCHALGIVHRDLKPENLLLDNSYNIKIADFGMAALQTDAGMLETSCGSPHYAAPE 196
             A+ Y H+  I+HRD+KPEN+L+  +  IK+ DFG +    D    +T CG+  Y +PE
Sbjct: 208 ANALDYMHSKNILHRDIKPENILIGFNNTIKLTDFGWSVYNEDGQKRKTLCGTIDYLSPE 267

Query: 197 IVSGLPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRDLLLKVQKGQFEMPNNAEISG 256
           ++    Y     DVW+ GV+ + LL G  PF+E+   +     ++ +   + P N  +S 
Sbjct: 268 LIKSREYNN-KVDVWALGVLTYELLVGSPPFEEDTKEM--TYRRILRCDLKFPLN--VSP 322

Query: 257 DAQDLIRRILVVDPTQRIKIRDILSHPLL 285
            A+DLI R+L  +P++RI + ++ SH  +
Sbjct: 323 QARDLIVRLLQFEPSKRIPLSEVKSHAWI 351

>KLLA0B07205g Chr2 complement(624606..625973) [1368 bp, 455 aa] {ON}
           similar to uniprot|P05986 Saccharomyces cerevisiae
           YKL166C TPK3 Involved in nutrient control of cell growth
           and division cAMP-dependent protein kinase catalytic
           subunit and to YJL164C uniprot|P06244 Saccharomyces
           cerevisiae YJL164C TPK1 putative catalytic subunit of
           cAMP- dependent protein kinase
          Length = 455

 Score =  150 bits (380), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 94/286 (32%), Positives = 150/286 (52%), Gaps = 26/286 (9%)

Query: 10  RITKPLNIIGPWKLGETLGFGSTGKVQLARHERTGQKTAVKVIPK-SIFKSEGSHGNNDS 68
           R+T     +  +++  TLG GS G+V L R    G+  A+KV+ K ++ K +     ND 
Sbjct: 134 RVTSGKYALYDFQILRTLGTGSFGRVHLVRSNHNGRFYAMKVLKKNTVVKLKQVEHTND- 192

Query: 69  VLPFNIEREIVIMKLLSHPNVLSLYDVWETDNNLYLILEYAEKGELFNLLVDRGPLPERE 128
                 ER +  + ++SHP ++ ++  ++    L++I++Y E GELF+LL      P   
Sbjct: 193 ------ERNM--LSIVSHPFIIRMWGTFQDSQQLFMIMDYIEGGELFSLLRKSQRFPNPV 244

Query: 129 AIKCFKQIIIAISYCHALGIVHRDLKPENLLLDNSYNIKIADFGMAALQTDAGMLETSCG 188
           A     ++ +A+ Y H+ GI++RDLKPEN+LLD + +IK+ DFG A    D     T CG
Sbjct: 245 AKFYAAEVCLALEYLHSKGIIYRDLKPENILLDKNGHIKLTDFGFAKYVPDVTY--TLCG 302

Query: 189 SPHYAAPEIVSGLPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRDLLLKVQKGQFEM 248
           +P Y APE+VS  PY   + D WS GV+++ +L G  PF + N       +K  +     
Sbjct: 303 TPDYIAPEVVSTKPYNK-SVDWWSFGVLIYEMLAGYTPFYDSN------TIKTYENILNA 355

Query: 249 PNNAE--ISGDAQDLIRRILVVDPTQRI-----KIRDILSHPLLKK 287
           P         DAQDLI +++  D +QR+        D+ +HP   +
Sbjct: 356 PVRFPPFFHSDAQDLISKLITRDLSQRLGNLQNGSEDVKNHPWFSE 401

>Kwal_0.96 s0 complement(46082..47365) [1284 bp, 427 aa] {ON}
           YOL016C (CMK2) - Calmodulin-dependent protein kinase
           [contig 76] FULL
          Length = 427

 Score =  150 bits (378), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 90/264 (34%), Positives = 143/264 (54%), Gaps = 14/264 (5%)

Query: 23  LGETLGFGSTGKVQLARHERTGQKTAVKVIPKSIFKSEGSHGNNDSVLPFNIEREIVIMK 82
            G+TLG GS G V+ AR   +G+  A+K++ K   K +      D  L   +  E+ I++
Sbjct: 48  FGKTLGAGSFGVVRQARQVSSGENVAIKILLKKALKGK------DVELQM-LYDELSILQ 100

Query: 83  LLSHPNVLSLYDVWETDNNLYLILEYAEKGELFNLLVDRGPLPEREAIKCFKQIIIAISY 142
            L HPN++   D +E+ +  Y++ + A  GELF+ ++ +G   E +A++   QI+ A+ Y
Sbjct: 101 KLDHPNIVKFKDWFESKDKFYIVTQLATGGELFDRILKQGKFTEEDAVRIVYQILKAVEY 160

Query: 143 CHALGIVHRDLKPENLLL---DNSYNIKIADFGMAA-LQTDAGMLETSCGSPHYAAPEIV 198
            H+  IVHRDLKPENLL         + + DFG+A  L+ D  ++  + GS  Y APE+V
Sbjct: 161 LHSRNIVHRDLKPENLLYLTEAADSQLVLGDFGIAKELKNDDELIHKAAGSMGYVAPEVV 220

Query: 199 SGLPYEGFASDVWSCGVILFALLTGRLPFDEEN--GNVRDLLLKVQKGQFEMPNNAEISG 256
           +   + G   D+WS GV+ + LL G  PF  E+  G + +  +      F  P  + IS 
Sbjct: 221 TTSGH-GKPCDIWSLGVVTYTLLCGYSPFVAESVEGFLEECTIGRTPVTFHKPYWSNISN 279

Query: 257 DAQDLIRRILVVDPTQRIKIRDIL 280
           +A+D I R L V+P  R    ++L
Sbjct: 280 EAKDFILRALTVNPHDRPTATELL 303

>Smik_6.414 Chr6 (666806..667909) [1104 bp, 367 aa] {ON} YPL209C
           (REAL)
          Length = 367

 Score =  148 bits (374), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 88/268 (32%), Positives = 143/268 (53%), Gaps = 23/268 (8%)

Query: 35  VQLARHERTGQKTAVKVIPKSIFKSEGSHGNNDSVLPFNIER----EIVIMKLLSHPNVL 90
           V   RH  TG   A+KV+ K            + ++ +N++R    E+ I   L+HPN+ 
Sbjct: 118 VYCVRHRSTGFICALKVMEK------------EEIIKYNLQRQFRREVEIQTSLNHPNLT 165

Query: 91  SLYDVWETDNNLYLILEYAEKGELFNLLVDRGPLPEREAIKCFKQIIIAISYCHALGIVH 150
             Y  +  +  +YL++EY   GE++ LL   GP  +  A     QI  A+ Y H   I+H
Sbjct: 166 KSYGYFHDEKRVYLLMEYLVNGEMYKLLRSHGPFNDILASDYVYQIANALDYMHKKNIIH 225

Query: 151 RDLKPENLLLDNSYNIKIADFGMAALQTDAGMLETSCGSPHYAAPEIVSGLPYEGFASDV 210
           RD+KPEN+L+  +  IK+ DFG + +       +T CG+  Y +PE++    Y+    D 
Sbjct: 226 RDIKPENILIGFNNIIKLTDFGWSIINPPDSRRKTVCGTIDYLSPEMIESREYDH-TIDA 284

Query: 211 WSCGVILFALLTGRLPFDEENGNVRDLLLK-VQKGQFEMPNNAEISGDAQDLIRRILVVD 269
           W+ GV+ F LLTG  PF+EE   ++D   K +     ++P+N  IS DAQDLI ++L  D
Sbjct: 285 WALGVLAFELLTGAPPFEEE---MKDTTYKRIAALDIKIPSN--ISQDAQDLILKLLKYD 339

Query: 270 PTQRIKIRDILSHPLLKKYQTIKDSKSI 297
           P  R+++ D+  HP + + +   ++K +
Sbjct: 340 PKDRMRLEDVKMHPWILRNKPFWENKRL 367

>YPL153C Chr16 complement(261727..264192) [2466 bp, 821 aa] {ON}
           RAD53Protein kinase, required for cell-cycle arrest in
           response to DNA damage; activated by trans
           autophosphorylation when interacting with
           hyperphosphorylated Rad9p; also interacts with ARS1 and
           plays a role in initiation of DNA replication
          Length = 821

 Score =  155 bits (392), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 95/281 (33%), Positives = 155/281 (55%), Gaps = 30/281 (10%)

Query: 23  LGETLGFGSTGKVQLARHERTGQKTAVKVIPKSIFKSEGSHGNNDSVLPFNIEREIVIMK 82
           + E +G G+   V+ A    TG+  AVK+I K         GN D V      RE+ +++
Sbjct: 200 IDEVVGQGAFATVKKAIERTTGKTFAVKIISK-----RKVIGNMDGVT-----RELEVLQ 249

Query: 83  LLSHPNVLSLYDVWETDNNLYLILEYAEKGELFNLLVDRGPLPEREAIKCFKQIIIAISY 142
            L+HP ++ L   +E   + Y+++E+   G+L + +   G + E    +  +QI+ AI Y
Sbjct: 250 KLNHPRIVRLKGFYEDTESYYMVMEFVSGGDLMDFVAAHGAVGEDAGREISRQILTAIKY 309

Query: 143 CHALGIVHRDLKPENLLL--DNSYNIKIADFGMAALQTDAGMLETSCGSPHYAAPEIVSG 200
            H++GI HRDLKP+N+L+  D+   +KI DFG+A +Q +   ++T CG+  Y APE++ G
Sbjct: 310 IHSMGISHRDLKPDNILIEQDDPVLVKITDFGLAKVQGNGSFMKTFCGTLAYVAPEVIRG 369

Query: 201 L-------PYE---GFAS--DVWSCGVILFALLTGRLPFDEENGNVRDLLLK-VQKGQF- 246
                    YE    ++S  D+WS G +++ +LTG LPF   +G+ +D L K + +G + 
Sbjct: 370 KDTSVSPDEYEERNEYSSLVDMWSMGCLVYVILTGHLPF---SGSTQDQLYKQIGRGSYH 426

Query: 247 EMP-NNAEISGDAQDLIRRILVVDPTQRIKIRDILSHPLLK 286
           E P  +  IS +A+D I  +L VDP  R      L+HP +K
Sbjct: 427 EGPLKDFRISEEARDFIDSLLQVDPNNRSTAAKALNHPWIK 467

>ACR142W Chr3 (597519..600032) [2514 bp, 837 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPL153C (RAD53)
          Length = 837

 Score =  155 bits (392), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 94/281 (33%), Positives = 152/281 (54%), Gaps = 27/281 (9%)

Query: 25  ETLGFGSTGKVQLARHERTGQKTAVKVIPKSIFKSEGSHGNNDSVLPFNIEREIVIMKLL 84
           E +G G+   V+ A    TG+  AVK+I K         GN D V      RE+ +++ L
Sbjct: 221 EVVGQGAFATVKKAVERNTGKTFAVKIINK-----RKVMGNVDGV-----TRELEVLRRL 270

Query: 85  SHPNVLSLYDVWETDNNLYLILEYAEKGELFNLLVDRGPLPEREAIKCFKQIIIAISYCH 144
           +HP ++SL   +E D + YL++E+   G+L + +   G + E    +  +QI+ A+ Y H
Sbjct: 271 NHPRIVSLKGFYEDDESYYLLMEFVSGGDLMDFVAAHGSVGEDAGREITRQILEAVRYIH 330

Query: 145 ALGIVHRDLKPENLLL--DNSYNIKIADFGMAALQTDAGMLETSCGSPHYAAPEIVSGLP 202
             GI HRDLKP+N+L+  D+   +KI DFG+A +Q +   ++T CG+  Y APE++ G  
Sbjct: 331 EQGISHRDLKPDNILIEQDDPVLVKITDFGLAKIQDNTTFMKTFCGTLAYVAPEVIGGKN 390

Query: 203 YEGFAS---------DVWSCGVILFALLTGRLPFDEENGNVRDLLLK-VQKGQF-EMP-N 250
            EG  +         D+WS G +++ +LTG LPF   +G+ ++ L K +  G + E P  
Sbjct: 391 PEGNGANGNLYSSLVDMWSIGCLVYVILTGHLPF---SGSTQEQLYKQIANGSYHEGPLK 447

Query: 251 NAEISGDAQDLIRRILVVDPTQRIKIRDILSHPLLKKYQTI 291
           +  IS +A+D I  +L ++P  R+     L HP L    +I
Sbjct: 448 DYWISDEARDFIDSLLQINPVDRLTAERALQHPWLHPCTSI 488

>TDEL0B06320 Chr2 (1118534..1119868) [1335 bp, 444 aa] {ON}
           Anc_1.374 YFR014C
          Length = 444

 Score =  150 bits (378), Expect = 5e-38,   Method: Compositional matrix adjust.
 Identities = 96/281 (34%), Positives = 157/281 (55%), Gaps = 18/281 (6%)

Query: 21  WKLGETLGFGSTGKVQLARHERTGQKTAVKVIPKSIFKSEGSHGNNDSVLPFNIEREIVI 80
           +  G+TLG G+ G V+ AR   T +  AVK++ K   K       ND  L   +  E+ I
Sbjct: 40  YVFGKTLGAGTFGVVRQARKISTRENVAVKILLKKALK------GNDVQLQL-LYDELKI 92

Query: 81  MKLLSHPNVLSLYDVWETDNNLYLILEYAEKGELFNLLVDRGPLPEREAIKCFKQIIIAI 140
           ++ L HPN++   D +E+ +  Y++ + A  GELF+ ++ +G   E +A+K   QI+ A+
Sbjct: 93  LQKLDHPNIVKFKDWFESKDKFYIVTQLATGGELFDRILSKGKFTEIDAVKIVTQILSAV 152

Query: 141 SYCHALGIVHRDLKPENLL-LDNSYN--IKIADFGMAA-LQTDAGMLETSCGSPHYAAPE 196
            Y H+  IVHRDLKPEN+L +D S +  + +ADFG+A  L++   ++  + GS  Y APE
Sbjct: 153 QYIHSKNIVHRDLKPENILYIDPSDDSPLVLADFGIAKELKSGDELIFKAAGSLGYVAPE 212

Query: 197 IVSGLPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRDLLLKVQKG----QFEMPNNA 252
           +++   + G   D+WS GV+ + LL+G  PF  E  +V   L +  +G    +F  P   
Sbjct: 213 VLTTSGH-GKPCDIWSLGVVTYTLLSGYSPFIAE--SVEGFLEECTEGSKPVKFHKPYWD 269

Query: 253 EISGDAQDLIRRILVVDPTQRIKIRDILSHPLLKKYQTIKD 293
            IS DA++ I R LV+ P++R    ++L  P +    + K+
Sbjct: 270 GISDDAKNFILRALVLSPSKRPTATELLEDPWITCCTSCKN 310

>Ecym_3035 Chr3 complement(70391..72613) [2223 bp, 740 aa] {ON}
           similar to Ashbya gossypii ACL006W
          Length = 740

 Score =  154 bits (390), Expect = 5e-38,   Method: Compositional matrix adjust.
 Identities = 94/269 (34%), Positives = 143/269 (53%), Gaps = 15/269 (5%)

Query: 21  WKLGETLGFGSTGKVQLARHERTGQKTAVKVIPKSIFKSEGSHGNNDSVLPFNIEREIVI 80
           +  G  LG G   +      + +G+  A K + K   KSE +           +  EI I
Sbjct: 73  YHRGMFLGEGGFARC-FQMKDDSGKIFAAKTVAKISIKSEKTRKK--------LLSEIQI 123

Query: 81  MKLLSHPNVLSLYDVWETDNNLYLILEYAEKGELFNLLVDRGPLPEREAIKCFKQIIIAI 140
            K + HPN++   D +E D N+Y++LE    G L +LL  R  L E E      QI+ AI
Sbjct: 124 HKSMRHPNIVQFTDCFEDDTNVYILLEICPNGSLMDLLKQRKQLTEPEVRFFTTQIVGAI 183

Query: 141 SYCHALGIVHRDLKPENLLLDNSYNIKIADFGMAA-LQTDAGMLETSCGSPHYAAPEIVS 199
            Y H+  I+HRDLK  N+  D  +N+KI DFG+AA L  D     T CG+P+Y APE+++
Sbjct: 184 KYMHSRRIIHRDLKLGNIFFDKHFNLKIGDFGLAAVLANDRERKYTICGTPNYIAPEVLT 243

Query: 200 GLPYEG--FASDVWSCGVILFALLTGRLPFDEENGNVRDLLLKVQKGQFEMPNNAEISGD 257
           G  + G  F  DVWS GV+++ALL G+ PF  +  N   +  +++   F  P +  IS +
Sbjct: 244 G-KHTGHSFEVDVWSIGVMIYALLIGKPPFQAKEVNT--IYERIKVCDFNFPRDKPISSE 300

Query: 258 AQDLIRRILVVDPTQRIKIRDILSHPLLK 286
           A+ LI+ IL +DP +R  + +I+ +   +
Sbjct: 301 AKVLIKDILSLDPLERPSLTEIMEYVWFR 329

>Suva_6.78 Chr6 (135988..137325) [1338 bp, 445 aa] {ON} YFR014C
           (REAL)
          Length = 445

 Score =  150 bits (378), Expect = 5e-38,   Method: Compositional matrix adjust.
 Identities = 94/271 (34%), Positives = 152/271 (56%), Gaps = 18/271 (6%)

Query: 23  LGETLGFGSTGKVQLARHERTGQKTAVKVIPKSIFKSEGSHGNNDSVLPFNIEREIVIMK 82
            G+TLG G+ G V+ AR+  TG+  AVK++ K   K     GN   +    +  E+ I++
Sbjct: 39  FGKTLGAGTFGVVRQARNSETGEDVAVKILIKKALK-----GNKIQLEA--LYDELDILQ 91

Query: 83  LLSHPNVLSLYDVWETDNNLYLILEYAEKGELFNLLVDRGPLPEREAIKCFKQIIIAISY 142
            L HPN+++  D +E+++  Y+I + A+ GELF+ ++ +G   E +A++   +I+ A+ Y
Sbjct: 92  RLHHPNIVAFKDWFESNDKFYIITQLAKGGELFDRILKKGKFTEVDAVRILVEILSAVKY 151

Query: 143 CHALGIVHRDLKPENLL-LDNSYN--IKIADFGMAA-LQTDAGMLETSCGSPHYAAPEIV 198
            H+  IVHRDLKPENLL +D S    + IADFG+A  L++D  ++  + GS  Y APE++
Sbjct: 152 MHSQNIVHRDLKPENLLYIDKSDESPLVIADFGIAKRLKSDEELIYKAAGSLGYVAPEVL 211

Query: 199 SGLPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRDLLLKVQKGQ----FEMPNNAEI 254
           +   + G   D+WS GVI + LL G   F  E   V D L +   G+    F  P    +
Sbjct: 212 TQDGH-GKPCDIWSIGVITYTLLCGYSAFKAE--RVLDFLDECTTGKYPVTFHRPYWDSV 268

Query: 255 SGDAQDLIRRILVVDPTQRIKIRDILSHPLL 285
           S  A+  I + L ++P +R    ++L  P +
Sbjct: 269 SDKAKRFILKALDLNPAKRPTAAELLEDPWI 299

>Ecym_2194 Chr2 complement(381633..382733) [1101 bp, 366 aa] {ON}
           similar to Ashbya gossypii AFL101C
          Length = 366

 Score =  148 bits (373), Expect = 5e-38,   Method: Compositional matrix adjust.
 Identities = 90/277 (32%), Positives = 144/277 (51%), Gaps = 23/277 (8%)

Query: 18  IGPWKLGETLGFGSTGKVQLARHERTGQKTAVKVIPKSIFKSEGSHGNNDSVLPFNIE-- 75
           +  +++G+ LG G  GKV   RH  +G   A+K + K              ++ +NIE  
Sbjct: 105 LADFEMGKILGKGKFGKVYCVRHIPSGFICALKAMEKK------------EIIQYNIEKQ 152

Query: 76  --REIVIMKLLSHPNVLSLYDVWETDNNLYLILEYAEKGELFNLLVDRGPLPEREAIKCF 133
             RE+ I   L HPN+  LY  +  +  +YL++EY   GEL+  L  R    +  A    
Sbjct: 153 FRREVEIQSSLRHPNLTQLYGYFHDEKRVYLVMEYLVNGELYKHLKGRNHFSDEVASYYV 212

Query: 134 KQIIIAISYCHALGIVHRDLKPENLLLDNSYNIKIADFGMAALQTDAGMLETSCGSPHYA 193
            Q+  A+ Y H   I+HRD+KPEN+++  +  IK+ DFG + + +     +T CG+  Y 
Sbjct: 213 YQMAGALDYMHERNILHRDIKPENIIIGFNNVIKLTDFGWSVINSKGFKRKTLCGTVDYL 272

Query: 194 APEIVSGLPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRDLLLK-VQKGQFEMPNNA 252
           +PE++    Y+    DVW+ GV+ + LL G  PF+EE+   ++L  K + K     P++ 
Sbjct: 273 SPELIKSREYDE-KVDVWALGVLTYELLVGSPPFEEES---KELTYKRILKRNLVFPDH- 327

Query: 253 EISGDAQDLIRRILVVDPTQRIKIRDILSHPLLKKYQ 289
            I  DA+ LI R+L  DP  RI ++D+  H  + K Q
Sbjct: 328 -IDPDARHLISRLLEYDPANRIALKDVRGHSWILKNQ 363

>Skud_11.58 Chr11 complement(120855..122042) [1188 bp, 395 aa] {ON}
           YKL166C (REAL)
          Length = 395

 Score =  149 bits (375), Expect = 5e-38,   Method: Compositional matrix adjust.
 Identities = 92/286 (32%), Positives = 150/286 (52%), Gaps = 22/286 (7%)

Query: 6   METYRITKPLNIIGPWKLGETLGFGSTGKVQLARHERTGQKTAVKVIPK-SIFKSEGSHG 64
           M  YR T     +G +++  TLG GS G+V L R    G+  A+K + K ++ K +    
Sbjct: 70  MLQYRDTSGKYSLGDFQILRTLGTGSFGRVHLIRSNHNGRFYALKTLKKHTVVKLKQVEH 129

Query: 65  NNDSVLPFNIEREIVIMKLLSHPNVLSLYDVWETDNNLYLILEYAEKGELFNLLVDRGPL 124
            ND       ER +  + ++SHP ++ ++  ++    ++++++Y E GELF+LL      
Sbjct: 130 TND-------ERRM--LSIVSHPFIIRMWGTFQDSQQVFMVMDYIEGGELFSLLRKSQRF 180

Query: 125 PEREAIKCFKQIIIAISYCHALGIVHRDLKPENLLLDNSYNIKIADFGMAALQTDAGMLE 184
           P   A     ++ +A+ Y H+  I++RDLKPEN+LLD + +IKI DFG A    D     
Sbjct: 181 PNPVAKFYAAEVCLALEYLHSKDIIYRDLKPENILLDKNGHIKITDFGFAKYVPDVTY-- 238

Query: 185 TSCGSPHYAAPEIVSGLPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRDLLLKVQKG 244
           T CG+P Y APE+VS  PY   + D WS GV+++ +L G  PF   N N       +   
Sbjct: 239 TLCGTPDYIAPEVVSTKPYNK-SVDWWSFGVLIYEMLAGYTPF--YNSNTMKTYENILNA 295

Query: 245 QFEMPNNAEISGDAQDLIRRILVVDPTQRI-----KIRDILSHPLL 285
           + + P       DAQDL+++++  D ++R+        D+ +HP  
Sbjct: 296 ELKFP--PFFHPDAQDLLKKLITRDLSERLGNLQNGSEDVKNHPWF 339

>YOL016C Chr15 complement(294777..296120) [1344 bp, 447 aa] {ON}
           CMK2Calmodulin-dependent protein kinase; may play a role
           in stress response, many CA++/calmodulan dependent
           phosphorylation substrates demonstrated in vitro, amino
           acid sequence similar to Cmk1p and mammalian Cam Kinase
           II
          Length = 447

 Score =  150 bits (378), Expect = 5e-38,   Method: Compositional matrix adjust.
 Identities = 95/269 (35%), Positives = 148/269 (55%), Gaps = 14/269 (5%)

Query: 23  LGETLGFGSTGKVQLARHERTGQKTAVKVIPKSIFKSEGSHGNNDSVLPFNIEREIVIMK 82
            G TLG GS G V+ AR   T +  A+K++ K   +     GNN  V    +  E+ I++
Sbjct: 49  FGRTLGAGSFGVVRQARKLSTNEDVAIKILLKKALQ-----GNN--VQLQMLYEELSILQ 101

Query: 83  LLSHPNVLSLYDVWETDNNLYLILEYAEKGELFNLLVDRGPLPEREAIKCFKQIIIAISY 142
            LSHPN++S  D +E+ +  Y++ + A  GELF+ ++ RG   E +A++   QI+ A+ Y
Sbjct: 102 KLSHPNIVSFKDWFESKDKFYIVTQLATGGELFDRILSRGKFTEVDAVEIIVQILGAVEY 161

Query: 143 CHALGIVHRDLKPENLL-LDNSYN--IKIADFGMA-ALQTDAGMLETSCGSPHYAAPEIV 198
            H+  +VHRDLKPEN+L +D S N  + IADFG+A  L+ +  ++  + GS  Y APE++
Sbjct: 162 MHSKNVVHRDLKPENVLYVDKSENSPLVIADFGIAKQLKGEEDLIYKAAGSLGYVAPEVL 221

Query: 199 SGLPYEGFASDVWSCGVILFALLTGRLPFDEEN--GNVRDLLLKVQKGQFEMPNNAEISG 256
           +   + G   D+WS GVI + LL G  PF  E+  G + +         F MP    IS 
Sbjct: 222 TQDGH-GKPCDIWSIGVITYTLLCGYSPFIAESVEGFMEECTASRYPVTFHMPYWDNISI 280

Query: 257 DAQDLIRRILVVDPTQRIKIRDILSHPLL 285
           D +  I + L ++P  R    ++L  P +
Sbjct: 281 DVKRFILKALRLNPADRPTATELLDDPWI 309

>Kwal_56.22476 s56 complement(145039..147132) [2094 bp, 697 aa] {ON}
           YMR001C (CDC5) - protein kinase which functions at the
           G(sub)2/M boundary [contig 185] FULL
          Length = 697

 Score =  154 bits (389), Expect = 5e-38,   Method: Compositional matrix adjust.
 Identities = 92/267 (34%), Positives = 145/267 (54%), Gaps = 19/267 (7%)

Query: 23  LGETLGFGSTGKVQLARHERTGQKTAVKVIPKSIFKSEGSHGNNDSVLPFNIEREIVIMK 82
           LGE  GF    +++    +  G+  A K + K   KSE +           +  EI I K
Sbjct: 85  LGEG-GFARCFQIK----DDGGKIFAAKTVAKISIKSEKTRKK--------LLSEIQIHK 131

Query: 83  LLSHPNVLSLYDVWETDNNLYLILEYAEKGELFNLLVDRGPLPEREAIKCFKQIIIAISY 142
            + H N++   D +E D N+Y++LE    G L +LL  R  L E E      QI+ A+ Y
Sbjct: 132 SMRHTNIVQFVDCFEDDTNVYILLEICPNGSLMDLLKRRKMLTEPEVRFFTTQIVGAVKY 191

Query: 143 CHALGIVHRDLKPENLLLDNSYNIKIADFGMAA-LQTDAGMLETSCGSPHYAAPEIVSGL 201
            H+  ++HRDLK  N+  D  YN+K+ DFG+AA L  D     T CG+P+Y APE+++G 
Sbjct: 192 MHSRRVIHRDLKLGNIFFDKHYNLKVGDFGLAAVLANDRERKYTVCGTPNYIAPEVLTG- 250

Query: 202 PYEG--FASDVWSCGVILFALLTGRLPFDEENGNVRDLLLKVQKGQFEMPNNAEISGDAQ 259
            + G  +  D+WSCGV+++ALL G+ PF  +  N+  +  +++ G F  P +  IS +A 
Sbjct: 251 KHTGHSYEVDIWSCGVMIYALLIGKPPFQAKEVNI--IYERIKCGDFVFPKDKFISPEAL 308

Query: 260 DLIRRILVVDPTQRIKIRDILSHPLLK 286
            LI+ IL +DP +R  + +I+ +   +
Sbjct: 309 VLIKDILSIDPLERPSLDEIIDYVWFR 335

>YPL203W Chr16 (166256..167398) [1143 bp, 380 aa] {ON}
           TPK2cAMP-dependent protein kinase catalytic subunit;
           promotes vegetative growth in response to nutrients via
           the Ras-cAMP signaling pathway; partially redundant with
           Tpk1p and Tpk3p; localizes to P-bodies during stationary
           phase
          Length = 380

 Score =  148 bits (373), Expect = 6e-38,   Method: Compositional matrix adjust.
 Identities = 93/272 (34%), Positives = 148/272 (54%), Gaps = 24/272 (8%)

Query: 21  WKLGETLGFGSTGKVQLARHERTGQKTAVKVIPKS-IFKSEGSHGNNDSVLPFNIEREIV 79
           +++  TLG GS G+V L R    G+  A+KV+ K  + K +     ND       ER + 
Sbjct: 70  FQIMRTLGTGSFGRVHLVRSVHNGRYYAIKVLKKQQVVKMKQVEHTND-------ERRM- 121

Query: 80  IMKLLSHPNVLSLYDVWETDNNLYLILEYAEKGELFNLLVDRGPLPEREAIKCFKQIIIA 139
            +KL+ HP ++ ++  ++   N++++++Y E GELF+LL      P   A     ++I+A
Sbjct: 122 -LKLVEHPFLIRMWGTFQDARNIFMVMDYIEGGELFSLLRKSQRFPNPVAKFYAAEVILA 180

Query: 140 ISYCHALGIVHRDLKPENLLLDNSYNIKIADFGMAA-LQTDAGMLETSCGSPHYAAPEIV 198
           + Y HA  I++RDLKPEN+LLD + +IKI DFG A  +QT   +  T CG+P Y APE++
Sbjct: 181 LEYLHAHNIIYRDLKPENILLDRNGHIKITDFGFAKEVQT---VTWTLCGTPDYIAPEVI 237

Query: 199 SGLPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRDLLLKVQKGQFEMPNNAEISGDA 258
           +  PY   + D WS GV+++ +L G  PF   +        K+ +G+   P       D 
Sbjct: 238 TTKPYNK-SVDWWSLGVLIYEMLAGYTPF--YDTTPMKTYEKILQGKVVYP--PYFHPDV 292

Query: 259 QDLIRRILVVDPTQRI-----KIRDILSHPLL 285
            DL+ +++  D T+RI       RDI +HP  
Sbjct: 293 VDLLSKLITADLTRRIGNLQSGSRDIKAHPWF 324

>Skud_16.76 Chr16 (139571..140719) [1149 bp, 382 aa] {ON} YPL203W
           (REAL)
          Length = 382

 Score =  148 bits (373), Expect = 7e-38,   Method: Compositional matrix adjust.
 Identities = 93/272 (34%), Positives = 148/272 (54%), Gaps = 24/272 (8%)

Query: 21  WKLGETLGFGSTGKVQLARHERTGQKTAVKVIPKS-IFKSEGSHGNNDSVLPFNIEREIV 79
           +++  TLG GS G+V L R    G+  A+KV+ K  + K +     ND       ER + 
Sbjct: 72  FQIMRTLGTGSFGRVHLVRSVHNGRYYAIKVLKKQQVVKMKQVEHTND-------ERRM- 123

Query: 80  IMKLLSHPNVLSLYDVWETDNNLYLILEYAEKGELFNLLVDRGPLPEREAIKCFKQIIIA 139
            +KL+ HP ++ ++  ++   N++++++Y E GELF+LL      P   A     ++I+A
Sbjct: 124 -LKLVEHPFLIRMWGTFQDAKNIFMVMDYIEGGELFSLLRKSQRFPNPVAKFYAAEVILA 182

Query: 140 ISYCHALGIVHRDLKPENLLLDNSYNIKIADFGMAA-LQTDAGMLETSCGSPHYAAPEIV 198
           + Y HA  I++RDLKPEN+LLD + +IKI DFG A  +QT   +  T CG+P Y APE++
Sbjct: 183 LEYLHAHNIIYRDLKPENILLDRNGHIKITDFGFAKEVQT---VTWTLCGTPDYIAPEVI 239

Query: 199 SGLPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRDLLLKVQKGQFEMPNNAEISGDA 258
           +  PY   + D WS GV+++ +L G  PF   +        K+ +G+   P       D 
Sbjct: 240 TTKPYNK-SVDWWSLGVLIYEMLAGYTPF--YDTTPMKTYEKILQGKVIYP--PYFHPDV 294

Query: 259 QDLIRRILVVDPTQRI-----KIRDILSHPLL 285
            DL+ +++  D T+RI       RDI +HP  
Sbjct: 295 VDLLSKLITADLTRRIGNLQSGSRDIKAHPWF 326

>NCAS0B04490 Chr2 (814474..815523) [1050 bp, 349 aa] {ON} Anc_8.141
          Length = 349

 Score =  147 bits (370), Expect = 7e-38,   Method: Compositional matrix adjust.
 Identities = 85/256 (33%), Positives = 141/256 (55%), Gaps = 23/256 (8%)

Query: 35  VQLARHERTGQKTAVKVIPKSIFKSEGSHGNNDSVLPFNIE----REIVIMKLLSHPNVL 90
           V   RH+ TG   A+KV+ K+             ++ +N++    RE+ I   L+HPN+ 
Sbjct: 105 VYCVRHKETGFICALKVMDKA------------EIVQYNLQKQFRREVEIQTSLNHPNLT 152

Query: 91  SLYDVWETDNNLYLILEYAEKGELFNLLVDRGPLPEREAIKCFKQIIIAISYCHALGIVH 150
            LY  +  +  +YL++EY   GEL+ LL   GP  +  A +   QI  A++Y H   I+H
Sbjct: 153 KLYGHFHDEKRVYLLMEYLVYGELYKLLRSHGPFNDVIASRFVFQIADALNYLHDKQIIH 212

Query: 151 RDLKPENLLLDNSYNIKIADFGMAALQTDAGMLETSCGSPHYAAPEIVSGLPYEGFASDV 210
           RDLKPEN+L+  +  IK+ DFG + +       +T CG+  Y +PE++    Y+    DV
Sbjct: 213 RDLKPENILIGFNNVIKLTDFGWSIINPRGVKRKTLCGTIDYLSPEMIRSREYDD-KVDV 271

Query: 211 WSCGVILFALLTGRLPFDEENGNVRDLLLK-VQKGQFEMPNNAEISGDAQDLIRRILVVD 269
           W+ GV+ + L+ G  PF+E+    ++L  K + K   + P    +S D +DLI ++L  +
Sbjct: 272 WALGVLTYELIVGSPPFEED---TKELTYKRILKNDIKFPET--VSHDVKDLISKLLKYN 326

Query: 270 PTQRIKIRDILSHPLL 285
           P++RI +RD++ HP +
Sbjct: 327 PSERISMRDVMKHPWI 342

>Smik_10.66 Chr10 complement(108043..109236) [1194 bp, 397 aa] {ON}
           YJL164C (REAL)
          Length = 397

 Score =  148 bits (374), Expect = 7e-38,   Method: Compositional matrix adjust.
 Identities = 89/285 (31%), Positives = 149/285 (52%), Gaps = 24/285 (8%)

Query: 10  RITKPLNIIGPWKLGETLGFGSTGKVQLARHERTGQKTAVKVIPKSIFK--SEGSHGNND 67
           R+T     +  +++  TLG GS G+V L R    G+  A+KV+ K I     +  H N+ 
Sbjct: 76  RVTGGKYSLQDFQILRTLGTGSFGRVHLIRSRHNGRYYAMKVLKKEIVVRLKQVEHTND- 134

Query: 68  SVLPFNIEREIVIMKLLSHPNVLSLYDVWETDNNLYLILEYAEKGELFNLLVDRGPLPER 127
                    E +++ +++HP ++ ++  ++    +++I++Y E GELF+LL      P  
Sbjct: 135 ---------ERLMLSIVTHPFIIRMWGTFQDAQQIFMIMDYIEGGELFSLLRKSQRFPNP 185

Query: 128 EAIKCFKQIIIAISYCHALGIVHRDLKPENLLLDNSYNIKIADFGMAALQTDAGMLETSC 187
            A     ++ +A+ Y H+  I++RDLKPEN+LLD + +IKI DFG A    D     T C
Sbjct: 186 VAKFYAAEVCLALEYLHSKDIIYRDLKPENILLDKNGHIKITDFGFAKYVPDVTY--TLC 243

Query: 188 GSPHYAAPEIVSGLPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRDLLLKVQKGQFE 247
           G+P Y APE+VS  PY   + D WS G++++ +L G  PF   + N      K+   +  
Sbjct: 244 GTPDYIAPEVVSTKPYNK-SIDWWSFGILIYEMLAGYTPF--YDSNTMKTYEKILNAELR 300

Query: 248 MPNNAEISGDAQDLIRRILVVDPTQRI-----KIRDILSHPLLKK 287
            P     + D +DL+ R++  D +QR+        D+ +HP  K+
Sbjct: 301 FP--PFFNEDVKDLLSRLITRDLSQRLGNLQNGTEDVKNHPWFKE 343

>Skud_16.129 Chr16 complement(233341..235824) [2484 bp, 827 aa] {ON}
           YPL153C (REAL)
          Length = 827

 Score =  155 bits (391), Expect = 7e-38,   Method: Compositional matrix adjust.
 Identities = 94/281 (33%), Positives = 155/281 (55%), Gaps = 30/281 (10%)

Query: 23  LGETLGFGSTGKVQLARHERTGQKTAVKVIPKSIFKSEGSHGNNDSVLPFNIEREIVIMK 82
           + E +G G+   V+ A    TG+  AVK+I K         GN D V      RE+ +++
Sbjct: 200 IDEVVGQGAFATVKKAIERTTGKTFAVKIISK-----RKVIGNMDGVT-----RELEVLQ 249

Query: 83  LLSHPNVLSLYDVWETDNNLYLILEYAEKGELFNLLVDRGPLPEREAIKCFKQIIIAISY 142
            L+HP ++ L   +E   + Y+++E+   G+L + +   G + E    +  +QI+ A+ Y
Sbjct: 250 KLNHPRIVRLKGFYEDAESYYMVMEFVSGGDLMDFVAAHGAVGEDAGREISRQILAAVKY 309

Query: 143 CHALGIVHRDLKPENLLL--DNSYNIKIADFGMAALQTDAGMLETSCGSPHYAAPEIVSG 200
            H++GI HRDLKP+N+L+  D+   +KI DFG+A +Q +   ++T CG+  Y APE++ G
Sbjct: 310 IHSMGISHRDLKPDNILIEQDDPVLVKITDFGLAKVQGNGSFMKTFCGTLAYVAPEVIRG 369

Query: 201 -----LPYEG-----FAS--DVWSCGVILFALLTGRLPFDEENGNVRDLLLK-VQKGQF- 246
                 P E      ++S  D+WS G +++ +LTG LPF   +G+ +D L K + +G + 
Sbjct: 370 KDSSVSPDECEERNEYSSLVDMWSMGCLVYVILTGHLPF---SGSTQDQLYKQIGRGSYH 426

Query: 247 EMP-NNAEISGDAQDLIRRILVVDPTQRIKIRDILSHPLLK 286
           E P  +  IS +A+D I  +L VDP  R+     L HP +K
Sbjct: 427 EGPLKDFRISEEARDFIDLLLQVDPNNRLTAAKALDHPWIK 467

>Suva_16.157 Chr16 complement(270891..273389) [2499 bp, 832 aa] {ON}
           YPL153C (REAL)
          Length = 832

 Score =  154 bits (390), Expect = 8e-38,   Method: Compositional matrix adjust.
 Identities = 94/281 (33%), Positives = 154/281 (54%), Gaps = 30/281 (10%)

Query: 23  LGETLGFGSTGKVQLARHERTGQKTAVKVIPKSIFKSEGSHGNNDSVLPFNIEREIVIMK 82
           + E +G G+   V+ A    TG+  AVK+I K         GN D V      RE+ +++
Sbjct: 200 IDEVVGQGAFATVKKAIERTTGKTFAVKIISK-----RKVIGNMDGVT-----RELEVLQ 249

Query: 83  LLSHPNVLSLYDVWETDNNLYLILEYAEKGELFNLLVDRGPLPEREAIKCFKQIIIAISY 142
            L HP ++ L   +E   + Y+++E+   G+L + +   G + E    +  +QI+ A+ Y
Sbjct: 250 KLHHPRIVRLKGFYEDTESYYMVMEFVSGGDLMDFVAAHGAVGEDAGREISRQILEAVKY 309

Query: 143 CHALGIVHRDLKPENLLL--DNSYNIKIADFGMAALQTDAGMLETSCGSPHYAAPEIVSG 200
            H++GI HRDLKP+N+L+  D+   +KI DFG+A +Q +   ++T CG+  Y APE++ G
Sbjct: 310 IHSMGISHRDLKPDNILIEQDDPVLVKITDFGLAKVQGNGSFMKTFCGTLAYVAPEVIRG 369

Query: 201 L-------PYE---GFAS--DVWSCGVILFALLTGRLPFDEENGNVRDLLLK-VQKGQF- 246
                    YE    ++S  D+WS G +++ +LTG LPF   +G+ +D L K + +G + 
Sbjct: 370 KDSSVSPDEYEERNEYSSLVDMWSMGCLVYVILTGHLPF---SGSTQDQLYKQIGRGSYH 426

Query: 247 EMP-NNAEISGDAQDLIRRILVVDPTQRIKIRDILSHPLLK 286
           E P  +  IS +A+D I  +L VDP  R+     L HP +K
Sbjct: 427 EGPLKDFRISEEARDFIDSLLQVDPNNRLTAAKALCHPWIK 467

>Smik_6.408 Chr6 complement(657018..658163) [1146 bp, 381 aa] {ON}
           YPL203W (REAL)
          Length = 381

 Score =  147 bits (372), Expect = 9e-38,   Method: Compositional matrix adjust.
 Identities = 93/272 (34%), Positives = 148/272 (54%), Gaps = 24/272 (8%)

Query: 21  WKLGETLGFGSTGKVQLARHERTGQKTAVKVIPKS-IFKSEGSHGNNDSVLPFNIEREIV 79
           +++  TLG GS G+V L R    G+  A+KV+ K  + K +     ND       ER + 
Sbjct: 71  FQIMRTLGTGSFGRVHLVRSVHNGRYYAIKVLKKQQVVKMKQVEHTND-------ERRM- 122

Query: 80  IMKLLSHPNVLSLYDVWETDNNLYLILEYAEKGELFNLLVDRGPLPEREAIKCFKQIIIA 139
            +KL+ HP ++ ++  ++   N++++++Y E GELF+LL      P   A     ++I+A
Sbjct: 123 -LKLVEHPFLIRMWGTFQDAKNIFMVMDYIEGGELFSLLRKSQRFPNPVAKFYAAEVILA 181

Query: 140 ISYCHALGIVHRDLKPENLLLDNSYNIKIADFGMAA-LQTDAGMLETSCGSPHYAAPEIV 198
           + Y HA  I++RDLKPEN+LLD + +IKI DFG A  +QT   +  T CG+P Y APE++
Sbjct: 182 LEYLHAHNIIYRDLKPENILLDRNGHIKITDFGFAKEVQT---VTWTLCGTPDYIAPEVI 238

Query: 199 SGLPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRDLLLKVQKGQFEMPNNAEISGDA 258
           +  PY   + D WS GV+++ +L G  PF   +        K+ +G+   P       D 
Sbjct: 239 TTKPYNK-SVDWWSLGVLIYEMLAGYTPF--YDTTPMKTYEKILQGKVIYP--PYFHPDV 293

Query: 259 QDLIRRILVVDPTQRI-----KIRDILSHPLL 285
            DL+ +++  D T+RI       RDI +HP  
Sbjct: 294 VDLLSKLITADLTRRIGNLQSGSRDIKAHPWF 325

>KAFR0K00280 Chr11 complement(64906..65988) [1083 bp, 360 aa] {ON}
           Anc_6.222 YPL209C
          Length = 360

 Score =  147 bits (371), Expect = 9e-38,   Method: Compositional matrix adjust.
 Identities = 79/257 (30%), Positives = 143/257 (55%), Gaps = 21/257 (8%)

Query: 35  VQLARHERTGQKTAVKVIPKSIFKSEGSHGNNDSVLPFNIE----REIVIMKLLSHPNVL 90
           V   +H+++G   A+K + K            + ++ +N++    REI I  +L+HPN+ 
Sbjct: 116 VYCVKHKKSGFICALKAMEK------------NEIIQYNLQKQVRREIEIQTILNHPNLT 163

Query: 91  SLYDVWETDNNLYLILEYAEKGELFNLLVDRGPLPEREAIKCFKQIIIAISYCHALGIVH 150
            LY  +  +  +Y+++EY  +GEL+ LL   GP  +  A     QI  A+ Y H   I+H
Sbjct: 164 KLYSFFHDEKRIYIVMEYLIQGELYKLLQSHGPFNDVLASNYVYQIADALDYLHQKHIIH 223

Query: 151 RDLKPENLLLDNSYNIKIADFGMAALQTDAGMLETSCGSPHYAAPEIVSGLPYEGFASDV 210
           RD+KPEN+L+  +  +K+ DFG + +       +T CG+  Y +PEI++   Y+    D+
Sbjct: 224 RDIKPENILIGFNNTVKLTDFGWSIINPKGIRRKTLCGTIDYLSPEIITSKEYD-HTVDI 282

Query: 211 WSCGVILFALLTGRLPFDEENGNVRDLLLKVQKGQFEMPNNAEISGDAQDLIRRILVVDP 270
           W+ GV+ + L+ G   F+EE   +     ++ KG+ + P +  +    +DLI+RILV++P
Sbjct: 283 WALGVLAYELVVGSPAFEEETKEM--TYKRIVKGELKFPEH--LPNIVRDLIQRILVIEP 338

Query: 271 TQRIKIRDILSHPLLKK 287
           ++R+ +++I  HP + K
Sbjct: 339 SKRMSLKEIKRHPWILK 355

>NDAI0F01600 Chr6 complement(392424..393662) [1239 bp, 412 aa] {ON} 
          Length = 412

 Score =  148 bits (374), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 85/258 (32%), Positives = 143/258 (55%), Gaps = 23/258 (8%)

Query: 35  VQLARHERTGQKTAVKVIPKSIFKSEGSHGNNDSVLPFNIER----EIVIMKLLSHPNVL 90
           V   +H+ +G   A+K + KS             ++ +N++R    E+ I   L+HPN+ 
Sbjct: 168 VYCVKHKESGFICALKAMDKS------------EIIQYNLQRQFRREVEIQTSLNHPNLT 215

Query: 91  SLYDVWETDNNLYLILEYAEKGELFNLLVDRGPLPEREAIKCFKQIIIAISYCHALGIVH 150
            LY  +  D  +YLI+EY   GEL+ LL   GP  +  A +   QI  A+++ H  GI+H
Sbjct: 216 KLYGHFYDDKRVYLIMEYLVYGELYKLLRSHGPFNDIIASRFVYQIADALNHLHEKGIIH 275

Query: 151 RDLKPENLLLDNSYNIKIADFGMAALQTDAGMLETSCGSPHYAAPEIVSGLPYEGFASDV 210
           RDLKPEN+L+  +  +K+ DFG + +       +T CG+  Y +PE++    Y+    DV
Sbjct: 276 RDLKPENILIGFNNVLKLTDFGWSIINPKGVKRKTLCGTIDYLSPEMIRSREYDD-TVDV 334

Query: 211 WSCGVILFALLTGRLPFDEENGNVRDLLLK-VQKGQFEMPNNAEISGDAQDLIRRILVVD 269
           W+ GV+ + L+ G  PF+E++   ++L  K + KG+   P    +S D +DLI R+L  D
Sbjct: 335 WALGVLTYELVAGDPPFEEDS---KELTYKRILKGEIRFP--GTVSQDVRDLISRLLKND 389

Query: 270 PTQRIKIRDILSHPLLKK 287
           P +RI +++++ HP + +
Sbjct: 390 PKERILLKEVMVHPWIMR 407

>KLLA0F11143g Chr6 complement(1026129..1028570) [2442 bp, 813 aa]
           {ON} similar to uniprot|P22216 Saccharomyces cerevisiae
           YPL153C RAD53 Protein kinase required for cell-cycle
           arrest in response to DNA damage activated by trans
           autophosphorylation when interacting with
           hyperphosphorylated Rad9p
          Length = 813

 Score =  154 bits (389), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 89/274 (32%), Positives = 154/274 (56%), Gaps = 28/274 (10%)

Query: 27  LGFGSTGKVQLARHERTGQKTAVKVIPKS--IFKSEGSHGNNDSVLPFNIEREIVIMKLL 84
           +G G+   V+ A    TG+  AVK+I K   + K +G            ++RE+ +++ L
Sbjct: 198 VGQGAFATVKKAVERSTGKTFAVKIIHKRKVMDKFDG------------VKRELDVLQKL 245

Query: 85  SHPNVLSLYDVWETDNNLYLILEYAEKGELFNLLVDRGPLPEREAIKCFKQIIIAISYCH 144
           +HP ++ L D +E ++N Y+++E+   G+L + +   G + E    +  +Q++ A+ Y H
Sbjct: 246 NHPRIVKLKDFFEDNDNYYMLMEFVSGGDLMDFVAAHGTVGEDAGREITRQVLEAVKYMH 305

Query: 145 ALGIVHRDLKPENLLL--DNSYNIKIADFGMAALQTDAGMLETSCGSPHYAAPEIVSGLP 202
             GI HRDLKP+N+++  D+   IKI DFG+A +Q     L T CG+  Y APE++ G  
Sbjct: 306 DQGISHRDLKPDNIMIEQDDPVLIKITDFGLAKVQNQNTFLNTFCGTLAYVAPEVIDGKN 365

Query: 203 YEG------FAS--DVWSCGVILFALLTGRLPFDEENGNVRDLLLKVQKGQF-EMP-NNA 252
            E       ++S  D+WS G +++ +LTG LPF  ++ N  +L  ++++G + E P  + 
Sbjct: 366 AEDKTNRDLYSSLVDMWSIGCLVYVILTGHLPFSGQSQN--ELFKQIKRGSYHEGPLKDY 423

Query: 253 EISGDAQDLIRRILVVDPTQRIKIRDILSHPLLK 286
            IS +A++ I  +L VDP +R+     L HP +K
Sbjct: 424 RISEEARNFIDCLLNVDPKERMNAGKALQHPWMK 457

>Skud_4.154 Chr4 complement(275783..277324) [1542 bp, 513 aa] {ON}
           YDL101C (REAL)
          Length = 513

 Score =  150 bits (379), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 97/306 (31%), Positives = 159/306 (51%), Gaps = 40/306 (13%)

Query: 12  TKPLNIIGPWKLGETLGFGSTGKVQLARHERTGQKTAVKVIPKSIFKSEGSHGNNDSVLP 71
           TKP++    + LG+ LG G    V+ A+++++GQ+ AVK+          +  N+D    
Sbjct: 191 TKPVSFFDKYLLGKELGAGHYALVKEAKNKKSGQQVAVKIF--------HAQQNDDQKKN 242

Query: 72  FNIEREIVIMKLLSHPNVLSLYDVW-----ETDNNLYLILEYAEKGELFNLLVDRGPLPE 126
                E  I+  + HPN+++L D +     ++    YL+LE  + GELF  +V +  L +
Sbjct: 243 KQFREETNILMRVHHPNIVNLLDSFVEPISKSQIQKYLVLEKIDDGELFERIVRKTCLRQ 302

Query: 127 REAIKCFKQIIIAISYCHALGIVHRDLKPENLLL-----DNS--------------YNIK 167
            E+   FKQ++  + Y H   I+HRD+KPEN+LL     +NS                +K
Sbjct: 303 DESKALFKQLLTGLKYLHEQNIIHRDIKPENILLNITRRENSNQAQLGPWDEDEIDIQVK 362

Query: 168 IADFGMAALQTDAGMLETSCGSPHYAAPEIVSGLPYEGFAS--DVWSCGVILFALLTGRL 225
           IADFG+A    +     T CG+P Y APE+++    +G++S  D+WS GVIL+  L G  
Sbjct: 363 IADFGLAKFTGEMQFTNTLCGTPSYVAPEVLTK---KGYSSKVDLWSAGVILYVCLCGFP 419

Query: 226 PFDEENG--NVRDLLLKVQKGQFEMPNNAEISGDAQDLIRRILVVDPTQRIKIRDILSHP 283
           PF ++ G  ++++ +L+  K  F  P   +I      LI  +LV++P +R  I + + HP
Sbjct: 420 PFSDQLGPPSLKEQILQA-KYAFYSPYWDKIDDLVLHLISNLLVLNPDERYNIDEAMDHP 478

Query: 284 LLKKYQ 289
             K  Q
Sbjct: 479 WFKDLQ 484

>NDAI0E02110 Chr5 complement(430989..433700) [2712 bp, 903 aa] {ON} 
          Length = 903

 Score =  154 bits (390), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 97/286 (33%), Positives = 151/286 (52%), Gaps = 34/286 (11%)

Query: 25  ETLGFGSTGKVQLARHERTGQKTAVKVIPKSIFKSEGSHGNNDSVLPFNIEREIVIMKLL 84
           E +G G+   V+ A    TG+  AVK+I K   K  GS  N D V      RE+ +++ L
Sbjct: 206 EVVGQGAFATVKKAVERSTGKTFAVKIISKR--KVMGS--NMDGV-----SRELEVLQRL 256

Query: 85  SHPNVLSLYDVWETDNNLYLILEYAEKGELFNLLVDRGPLPEREAIKCFKQIIIAISYCH 144
            HP ++ L   +E   N Y+++E+   G+L + +   G + E    +  +QI+ AI Y H
Sbjct: 257 DHPRIVRLKGFYEDHENYYMLMEFVSGGDLMDFVAAHGAVGEDAGREISRQILEAIKYIH 316

Query: 145 ALGIVHRDLKPENLLL--DNSYNIKIADFGMAALQTDAGMLETSCGSPHYAAPEIVSGL- 201
           ++GI HRDLKP+N+L+  D+   +KI DFG+A +Q +   ++T CG+  Y APEI+SG  
Sbjct: 317 SMGISHRDLKPDNILIEQDDPVLVKITDFGLAKVQDNGTFMKTFCGTLAYVAPEIISGKN 376

Query: 202 ---------------PYEGFASDVWSCGVILFALLTGRLPFDEENGNVRDLLLK-VQKGQ 245
                           Y     D+WS G +++ +LTG LPF   +G+ +  L K + +G 
Sbjct: 377 DGELRENADANSERNEYSSLV-DMWSMGCLVYVILTGHLPF---SGSTQKQLYKQISRGS 432

Query: 246 F-EMP-NNAEISGDAQDLIRRILVVDPTQRIKIRDILSHPLLKKYQ 289
           + E P  +  IS +A+D I  +L V P  R+     L HP +K  Q
Sbjct: 433 YHEGPLKDFRISDEARDFIDSLLQVKPNDRLTAEKALEHPWIKMAQ 478

>SAKL0A04246g Chr1 complement(396019..397221) [1203 bp, 400 aa] {ON}
           similar to uniprot|P38991 Saccharomyces cerevisiae
           YPL209C IPL1 Aurora kinase involved in regulating
           kinetochore-microtubule attachments associates with
           Sli5p which stimulates Ipl1p kinase activity and
           promotes its association with the mitotic spindle
           potential Cdc28p substrate
          Length = 400

 Score =  147 bits (372), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 85/257 (33%), Positives = 137/257 (53%), Gaps = 21/257 (8%)

Query: 35  VQLARHERTGQKTAVKVIPKSIFKSEGSHGNNDSVLPFNIE----REIVIMKLLSHPNVL 90
           V   RH++TG   A+K + K              +  +N++    RE+ I   L HPN+ 
Sbjct: 154 VYCVRHKKTGFICALKAMEKK------------EITQYNVQKQFRREVEIQASLRHPNLT 201

Query: 91  SLYDVWETDNNLYLILEYAEKGELFNLLVDRGPLPEREAIKCFKQIIIAISYCHALGIVH 150
            LY  +  D  +YL++EY   GEL+  L   GP  +  A     Q+  A++Y H   ++H
Sbjct: 202 QLYGYFYDDKRVYLLMEYLVNGELYRHLRVNGPFNDILASYYVNQMADALNYMHDRNVLH 261

Query: 151 RDLKPENLLLDNSYNIKIADFGMAALQTDAGMLETSCGSPHYAAPEIVSGLPYEGFASDV 210
           RD+KPEN+L+     +K+ DFG + + T     +T CG+  Y +PE+V    Y+    DV
Sbjct: 262 RDIKPENILIGFQNTLKLTDFGWSVISTTGAKRKTLCGTLDYLSPELVKYREYDE-KVDV 320

Query: 211 WSCGVILFALLTGRLPFDEENGNVRDLLLKVQKGQFEMPNNAEISGDAQDLIRRILVVDP 270
           W+ GV+ + LL G  PF+E +  +     ++ +     P+  ++S DA+DLI R+L  DP
Sbjct: 321 WALGVLAYELLVGTPPFEEASKEL--TYKRIVRRDLRFPD--QMSIDARDLIGRLLENDP 376

Query: 271 TQRIKIRDILSHPLLKK 287
           + RI ++D+LSHP + K
Sbjct: 377 STRISLKDVLSHPWIVK 393

>TPHA0F02430 Chr6 complement(535865..538261) [2397 bp, 798 aa] {ON}
           Anc_6.31 YMR001C
          Length = 798

 Score =  154 bits (388), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 89/264 (33%), Positives = 146/264 (55%), Gaps = 13/264 (4%)

Query: 25  ETLGFGSTGKVQLARHERTGQKTAVKVIPKSIFKSEGSHGNNDSVLPFNIEREIVIMKLL 84
           E LG G   +      +  G   A K++ K   K+E +         F +  EI I + L
Sbjct: 97  ECLGEGGFARC-FHIKDDVGISFACKIVSKKSIKTERT--------KFKLLSEIQIHQNL 147

Query: 85  SHPNVLSLYDVWETDNNLYLILEYAEKGELFNLLVDRGPLPEREAIKCFKQIIIAISYCH 144
            + +++   D +E + N+Y++LE    G L +LL  R  L E E      Q+  AI+Y H
Sbjct: 148 RYSHIVKFMDCFEDELNVYILLELCPNGSLMDLLKKRKILTEAEVKFMTTQVCGAINYMH 207

Query: 145 ALGIVHRDLKPENLLLDNSYNIKIADFGMAALQTDAGMLE-TSCGSPHYAAPEIV-SGLP 202
           +  I+HRDLK  N+  D ++NIKI DFG+AA  ++    + T CG+P+Y APE++ S   
Sbjct: 208 SNNIIHRDLKLGNVFFDKNFNIKIGDFGLAATLSNVSEKKYTMCGTPNYIAPEVILSKQI 267

Query: 203 YEGFASDVWSCGVILFALLTGRLPFDEENGNVRDLLLKVQKGQFEMPNNAEISGDAQDLI 262
              F +D+WS G++++A++ G+ PF  +  +V  +  K++  Q+E P +  I+ D + LI
Sbjct: 268 GHSFEADIWSLGIMIYAMVLGKPPFQAK--DVTTIYEKIKLCQYEFPPDKYITNDVKVLI 325

Query: 263 RRILVVDPTQRIKIRDILSHPLLK 286
           + +LV+DP+QR +I DIL +   K
Sbjct: 326 QDLLVLDPSQRPRIMDILKYNWFK 349

>Suva_6.245 Chr6 (438131..439315) [1185 bp, 394 aa] {ON} YJL164C
           (REAL)
          Length = 394

 Score =  147 bits (372), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 86/269 (31%), Positives = 142/269 (52%), Gaps = 24/269 (8%)

Query: 26  TLGFGSTGKVQLARHERTGQKTAVKVIPKSIFK--SEGSHGNNDSVLPFNIEREIVIMKL 83
           TLG GS G+V L R    G+  A+KV+ K I     +  H N+          E +++ +
Sbjct: 89  TLGTGSFGRVHLIRSRHNGRYYAMKVLKKEIVVRLKQVEHTND----------ERLMLSI 138

Query: 84  LSHPNVLSLYDVWETDNNLYLILEYAEKGELFNLLVDRGPLPEREAIKCFKQIIIAISYC 143
           ++HP ++ ++  ++    +++I++Y E GELF+LL      P   A     ++ +A+ Y 
Sbjct: 139 VTHPFIIRMWGTFQDAQQIFMIMDYIEGGELFSLLRKSQRFPNPVAKFYAAEVCLALEYL 198

Query: 144 HALGIVHRDLKPENLLLDNSYNIKIADFGMAALQTDAGMLETSCGSPHYAAPEIVSGLPY 203
           H+  I++RDLKPEN+LLD + ++KI DFG A    D     T CG+P Y APE+VS  PY
Sbjct: 199 HSKDIIYRDLKPENILLDKNGHVKITDFGFAKYVPDVTY--TLCGTPDYIAPEVVSTKPY 256

Query: 204 EGFASDVWSCGVILFALLTGRLPFDEENGNVRDLLLKVQKGQFEMPNNAEISGDAQDLIR 263
              + D WS G++++ +L G  PF   + N      K+   +   P     + D +DL+ 
Sbjct: 257 NK-SIDWWSFGILIYEMLAGYTPF--YDSNTMKTYEKILNAELRFP--PFFNDDVKDLLS 311

Query: 264 RILVVDPTQRI-----KIRDILSHPLLKK 287
           R++  D +QR+        D+ +HP  K+
Sbjct: 312 RLITRDLSQRLGNLQNGTEDVKNHPWFKE 340

>KNAG0E00850 Chr5 complement(158992..161127) [2136 bp, 711 aa] {ON}
           Anc_6.31 YMR001C
          Length = 711

 Score =  153 bits (386), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 95/268 (35%), Positives = 140/268 (52%), Gaps = 19/268 (7%)

Query: 24  GETLGFGSTGKVQLARHERTGQKTAVKVIPKSIFKSEGSHGNNDSVLPFNIEREIVIMKL 83
           G  LG G   +    + E +G+  A K + K   KSE +           +  EI I K 
Sbjct: 94  GHFLGEGGFARCFQIKDE-SGKIFAAKTVAKISIKSEKTRKK--------LLSEIQIHKS 144

Query: 84  LSHPNVLSLYDVWETDNNLYLILEYAEKGELFNLLVDRGPLPEREAIKCFKQIIIAISYC 143
           + H NV+   D +E D N+Y++LE    G L  LL  R  + E E      QI  AI Y 
Sbjct: 145 MRHFNVVQFIDCFEDDTNVYILLEICPNGSLMELLKKRRTVTEPEVRYFMTQICGAIKYM 204

Query: 144 HALGIVHRDLKPENLLLDNSYNIKIADFGMAA-LQTDAGMLETSCGSPHYAAPEIV---- 198
           H+  ++HRDLK  N+  D +YN+KI DFG+AA L  D     T CG+P+Y APE++    
Sbjct: 205 HSRRVIHRDLKLGNIFFDKNYNLKIGDFGLAAVLANDRERKYTVCGTPNYIAPEVLMGKH 264

Query: 199 SGLPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRDLLLKVQKGQFEMPNNAEISGDA 258
           SG  YE    D+WS GV+++ALL G+ PF  ++ N+  +  +++   F  P +  IS +A
Sbjct: 265 SGHSYE---VDIWSIGVMIYALLIGKPPFQSKDVNM--IYERIKNRDFAFPKDKYISNEA 319

Query: 259 QDLIRRILVVDPTQRIKIRDILSHPLLK 286
           + LI  IL  DP +R  I +I+ +   +
Sbjct: 320 KTLIHDILSTDPLERPSIEEIIDYVWFR 347

>ZYRO0G08844g Chr7 complement(711678..712766) [1089 bp, 362 aa] {ON}
           highly similar to uniprot|P06245 Saccharomyces
           cerevisiae YPL203W TPK2 Involved in nutrient control of
           cell growth and division cAMP-dependent protein kinase
           catalytic subunit
          Length = 362

 Score =  146 bits (369), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 91/271 (33%), Positives = 146/271 (53%), Gaps = 22/271 (8%)

Query: 21  WKLGETLGFGSTGKVQLARHERTGQKTAVKVIPKS-IFKSEGSHGNNDSVLPFNIEREIV 79
           +++  TLG GS G+V L R    G+  A+KV+ K  + K +     ND       ER + 
Sbjct: 52  FQIMRTLGTGSFGRVHLVRSVHNGRYYAMKVLKKQQVVKMKQIEHTND-------ERHM- 103

Query: 80  IMKLLSHPNVLSLYDVWETDNNLYLILEYAEKGELFNLLVDRGPLPEREAIKCFKQIIIA 139
            +KL+ HP ++ ++  ++   NL+++++Y E GELF+LL      P   A     ++ +A
Sbjct: 104 -LKLVEHPFIIRMWGTFQDAKNLFMVIDYIEGGELFSLLRKSHRFPNPVAKFYAAEVTLA 162

Query: 140 ISYCHALGIVHRDLKPENLLLDNSYNIKIADFGMAALQTDAGMLETSCGSPHYAAPEIVS 199
           + Y H+  I++RDLKPENLLLD + +IKI DFG A  +    +  T CG+P Y APE+++
Sbjct: 163 LDYLHSHNIIYRDLKPENLLLDRNGHIKITDFGFA--KEVVTVTWTLCGTPDYIAPEVIT 220

Query: 200 GLPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRDLLLKVQKGQFEMPNNAEISGDAQ 259
             PY   + D WS GV++F +L G  PF   +        K+ +G+   P       D  
Sbjct: 221 TKPYNK-SVDWWSLGVLIFEMLAGYTPF--YDATAMKTYEKILQGKVNYP--PFFHPDVV 275

Query: 260 DLIRRILVVDPTQRI-----KIRDILSHPLL 285
           DL+ ++++ D T+R+       +DI SHP  
Sbjct: 276 DLLSKLIMADLTRRLGNLQSGSQDIKSHPWF 306

>TBLA0B00490 Chr2 complement(94755..97118) [2364 bp, 787 aa] {ON}
           Anc_6.31 YMR001C
          Length = 787

 Score =  153 bits (387), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 98/312 (31%), Positives = 159/312 (50%), Gaps = 20/312 (6%)

Query: 21  WKLGETLGFGSTGKVQLARHERTGQKTAVKVIPKSIFKSEGSHGNNDSVLPFNIEREIVI 80
           ++ G+ LG G   +    + E +G+  A K + K   K+E +           +  EI I
Sbjct: 142 YRRGQFLGEGGFARCFQIKDE-SGKIFAAKTVAKISIKTEKTRRK--------LLSEIQI 192

Query: 81  MKLLSHPNVLSLYDVWETDNNLYLILEYAEKGELFNLLVDRGPLPEREAIKCFKQIIIAI 140
            K + H N++   D +E   N+Y++L     G L  LL  R  L E E      QI  AI
Sbjct: 193 HKSMKHQNIVQFVDCFEDHINVYILLGMCPNGSLMELLKKRKILTEPEVRFFTVQICGAI 252

Query: 141 SYCHALGIVHRDLKPENLLLDNSYNIKIADFGMAA-LQTDAGMLETSCGSPHYAAPEIV- 198
            Y H+  ++HRDLK  N+  D +YN+KI DFG+AA L  D     T CG+P+Y APE++ 
Sbjct: 253 KYMHSRRVIHRDLKLGNIFFDENYNLKIGDFGLAAVLANDRERKYTVCGTPNYIAPEVLL 312

Query: 199 ---SGLPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRDLLLKVQKGQFEMPNNAEIS 255
              SG  YE    D+WS GV++FALL G+ PF  ++ N   +  +++  ++  P N  IS
Sbjct: 313 GKHSGHSYE---VDIWSIGVMIFALLIGKPPFQAKDVNT--IYSRIKNSEYTFPINKSIS 367

Query: 256 GDAQDLIRRILVVDPTQRIKIRDILSHPLLK-KYQTIKDSKSIKDLPRENTYLYPLADAD 314
            +A+ LI+ IL+ DP  R  I +I+ +   +  + ++  +    ++P  + +L P    +
Sbjct: 368 QEAKTLIQDILINDPIARPSINEIMEYVWFRGTFPSMTSNTVFTEIPEYDQFLTPNESLN 427

Query: 315 NHTSVTIDDSIL 326
           N  +  I   ++
Sbjct: 428 NFRNCMIQSGLI 439

>YKL166C Chr11 complement(134509..135705) [1197 bp, 398 aa] {ON}
           TPK3cAMP-dependent protein kinase catalytic subunit;
           promotes vegetative growth in response to nutrients via
           the Ras-cAMP signaling pathway; partially redundant with
           Tpk1p and Tpk2p; localizes to P-bodies during stationary
           phase
          Length = 398

 Score =  147 bits (371), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 92/286 (32%), Positives = 149/286 (52%), Gaps = 22/286 (7%)

Query: 6   METYRITKPLNIIGPWKLGETLGFGSTGKVQLARHERTGQKTAVKVIPK-SIFKSEGSHG 64
           M  YR T     +  +++  TLG GS G+V L R    G+  A+K + K +I K +    
Sbjct: 73  MLQYRDTSGKYSLSDFQILRTLGTGSFGRVHLIRSNHNGRFYALKTLKKHTIVKLKQVEH 132

Query: 65  NNDSVLPFNIEREIVIMKLLSHPNVLSLYDVWETDNNLYLILEYAEKGELFNLLVDRGPL 124
            ND       ER +  + ++SHP ++ ++  ++    ++++++Y E GELF+LL      
Sbjct: 133 TND-------ERRM--LSIVSHPFIIRMWGTFQDSQQVFMVMDYIEGGELFSLLRKSQRF 183

Query: 125 PEREAIKCFKQIIIAISYCHALGIVHRDLKPENLLLDNSYNIKIADFGMAALQTDAGMLE 184
           P   A     ++ +A+ Y H+  I++RDLKPEN+LLD + +IKI DFG A    D     
Sbjct: 184 PNPVAKFYAAEVCLALEYLHSKDIIYRDLKPENILLDKNGHIKITDFGFAKYVPDVTY-- 241

Query: 185 TSCGSPHYAAPEIVSGLPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRDLLLKVQKG 244
           T CG+P Y APE+VS  PY   + D WS GV+++ +L G  PF   N N       +   
Sbjct: 242 TLCGTPDYIAPEVVSTKPYNK-SVDWWSFGVLIYEMLAGYTPF--YNSNTMKTYENILNA 298

Query: 245 QFEMPNNAEISGDAQDLIRRILVVDPTQRI-----KIRDILSHPLL 285
           + + P       DAQDL+++++  D ++R+        D+ +HP  
Sbjct: 299 ELKFP--PFFHPDAQDLLKKLITRDLSERLGNLQNGSEDVKNHPWF 342

>Smik_11.62 Chr11 complement(120153..121346) [1194 bp, 397 aa] {ON}
           YKL166C (REAL)
          Length = 397

 Score =  147 bits (371), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 91/286 (31%), Positives = 148/286 (51%), Gaps = 22/286 (7%)

Query: 6   METYRITKPLNIIGPWKLGETLGFGSTGKVQLARHERTGQKTAVKVIPK-SIFKSEGSHG 64
           M  YR T     +  +++  TLG GS G+V L R    G+  A+K + K ++ K +    
Sbjct: 72  MLQYRDTSGKYSLSDFQILRTLGTGSFGRVHLIRSNHNGRFYALKTLKKHTVVKLKQVEH 131

Query: 65  NNDSVLPFNIEREIVIMKLLSHPNVLSLYDVWETDNNLYLILEYAEKGELFNLLVDRGPL 124
            ND       ER +  + ++SHP ++ ++  ++    ++++++Y E GELF+LL      
Sbjct: 132 TND-------ERRM--LSIVSHPFIIRMWGTFQDSQQVFMVMDYVEGGELFSLLRKSQRF 182

Query: 125 PEREAIKCFKQIIIAISYCHALGIVHRDLKPENLLLDNSYNIKIADFGMAALQTDAGMLE 184
           P   A     ++ +A+ Y H+  I++RDLKPEN+LLD + +IKI DFG A    D     
Sbjct: 183 PNPVAKFYAAEVCLALEYLHSKDIIYRDLKPENILLDKNGHIKITDFGFAKYVPDVTY-- 240

Query: 185 TSCGSPHYAAPEIVSGLPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRDLLLKVQKG 244
           T CG+P Y APE+VS  PY   + D WS GV+++ +L G  PF   N N       +   
Sbjct: 241 TLCGTPDYIAPEVVSTKPYNK-SVDWWSFGVLIYEMLAGYTPF--YNSNTMKTYENILNA 297

Query: 245 QFEMPNNAEISGDAQDLIRRILVVDPTQRI-----KIRDILSHPLL 285
           + + P       DAQDL+++++  D  +R+        D+ +HP  
Sbjct: 298 ELKFP--PFFHPDAQDLLKKLITRDLCERLGNLQNGSEDVKNHPWF 341

>KLTH0H04180g Chr8 (381111..382172) [1062 bp, 353 aa] {ON} highly
           similar to uniprot|P06245 Saccharomyces cerevisiae
           YPL203W TPK2 Involved in nutrient control of cell growth
           and division cAMP-dependent protein kinase catalytic
           subunit
          Length = 353

 Score =  146 bits (368), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 90/266 (33%), Positives = 144/266 (54%), Gaps = 22/266 (8%)

Query: 26  TLGFGSTGKVQLARHERTGQKTAVKVIPK-SIFKSEGSHGNNDSVLPFNIEREIVIMKLL 84
           TLG GS G+V L R    G+  A+KV+ K  + + +     ND       ER +  +KL+
Sbjct: 48  TLGTGSFGRVHLVRSVHNGRYYAIKVLKKEQVIRMKQIEHTND-------ERRM--LKLV 98

Query: 85  SHPNVLSLYDVWETDNNLYLILEYAEKGELFNLLVDRGPLPEREAIKCFKQIIIAISYCH 144
            HP ++ ++  ++   NL+++++Y E GELF+LL      P   A     ++I+A+ Y H
Sbjct: 99  DHPFLIRMWGTFQDSRNLFMVMDYIEGGELFSLLRKSQRFPNPVAKFYAAEVILALEYLH 158

Query: 145 ALGIVHRDLKPENLLLDNSYNIKIADFGMAALQTDAGMLETSCGSPHYAAPEIVSGLPYE 204
           A  I++RDLKPEN+LLD + +IKI DFG A  + D  +  T CG+P Y APE+++  PY 
Sbjct: 159 AHDIIYRDLKPENILLDRNGHIKITDFGFAK-EVDT-VTWTLCGTPDYIAPEVIATKPYN 216

Query: 205 GFASDVWSCGVILFALLTGRLPFDEENGNVRDLLLKVQKGQFEMPNNAEISGDAQDLIRR 264
             + D WS G+++F +L G  PF   +        K+ +G+   P       D  DL+ +
Sbjct: 217 K-SVDWWSLGILIFEMLAGYTPF--YDATPMKTYEKILQGKVAYP--PFFHPDVVDLLSK 271

Query: 265 ILVVDPTQRI-----KIRDILSHPLL 285
           ++  D T+R+       +D+ SHP  
Sbjct: 272 LITADLTRRLGNLQSGPQDVKSHPWF 297

>SAKL0E01584g Chr5 complement(121830..123917) [2088 bp, 695 aa] {ON}
           highly similar to uniprot|P32562 Saccharomyces
           cerevisiae YMR001C
          Length = 695

 Score =  152 bits (384), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 90/269 (33%), Positives = 142/269 (52%), Gaps = 15/269 (5%)

Query: 21  WKLGETLGFGSTGKVQLARHERTGQKTAVKVIPKSIFKSEGSHGNNDSVLPFNIEREIVI 80
           +  G  LG G   +      + +G+  A K + K   KSE +           +  EI I
Sbjct: 77  YHRGHFLGEGGFARC-FQMKDDSGKIFAAKTVAKISIKSEKTRKK--------LLSEIQI 127

Query: 81  MKLLSHPNVLSLYDVWETDNNLYLILEYAEKGELFNLLVDRGPLPEREAIKCFKQIIIAI 140
            K + HPN++   D +E D N+Y++LE    G L +LL  R  L E E      QI+ AI
Sbjct: 128 HKSMKHPNIVQFIDCFEDDTNVYILLEICPNGSLMDLLKKRKVLTEPEVRYFTTQIVGAI 187

Query: 141 SYCHALGIVHRDLKPENLLLDNSYNIKIADFGMAA-LQTDAGMLETSCGSPHYAAPEIVS 199
            Y H   ++HRDLK  N+  D++YN+KI DFG+AA L  D     T CG+P+Y APE+++
Sbjct: 188 KYMHNRRVIHRDLKLGNIFFDSNYNLKIGDFGLAAVLANDRERKYTVCGTPNYIAPEVLA 247

Query: 200 GLPYEG--FASDVWSCGVILFALLTGRLPFDEENGNVRDLLLKVQKGQFEMPNNAEISGD 257
           G  + G  +  D+WS GV+++ALL G+ PF  +  N+  +  +++ G +  P     S +
Sbjct: 248 G-KHSGHSYEVDIWSIGVMIYALLIGKPPFQAKEVNI--IYERIKSGDYIFPREKPTSKE 304

Query: 258 AQDLIRRILVVDPTQRIKIRDILSHPLLK 286
              LI+ IL +DP +R  + +I+ +   +
Sbjct: 305 VMVLIQDILSIDPIERPSLDEIMDYVWFR 333

>Kpol_1072.16 s1072 complement(37585..39972) [2388 bp, 795 aa] {ON}
           complement(37585..39972) [2388 nt, 796 aa]
          Length = 795

 Score =  153 bits (386), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 92/277 (33%), Positives = 151/277 (54%), Gaps = 29/277 (10%)

Query: 25  ETLGFGSTGKVQLARHERTGQKTAVKVIPKSIFKSEGSHGNNDSVLPFNIEREIVIMKLL 84
           E +G G+   V+ A    TG+  AVK+I K         GN D V      RE+ +++ L
Sbjct: 197 EVVGQGAFAIVKKAVERSTGKTFAVKIINK-----RKVMGNMDGV-----TRELDVLRKL 246

Query: 85  SHPNVLSLYDVWETDNNLYLILEYAEKGELFNLLVDRGPLPEREAIKCFKQIIIAISYCH 144
            HP ++ L   +E +++ YL++E+   G+L + +   G + E    +  +QI+ A+ Y H
Sbjct: 247 DHPRIVRLKGFYEDEDSYYLLMEFVSGGDLMDFVAAHGSVGEDAGREITRQILEAVKYIH 306

Query: 145 ALGIVHRDLKPENLLL--DNSYNIKIADFGMAALQTDAGMLETSCGSPHYAAPEIVSG-- 200
             GI HRDLKP+N+L+  D+   +KI DFG+A +Q +   ++T CG+  Y APE++ G  
Sbjct: 307 LQGISHRDLKPDNILIEQDDPVLVKITDFGLAKVQGNGTFMKTFCGTLAYVAPEVIGGKN 366

Query: 201 --------LPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRDLLLK-VQKGQF-EMP- 249
                   + Y     D+WS G +++ +LTG LPF   +G+ +D L K + +G + E P 
Sbjct: 367 SAEENEDRIEYSSLV-DMWSIGCLVYVILTGHLPF---SGSTQDQLYKQICRGSYHEGPL 422

Query: 250 NNAEISGDAQDLIRRILVVDPTQRIKIRDILSHPLLK 286
            +  IS +A+D I  +L V P +R+     L+HP +K
Sbjct: 423 KDFRISDEARDFIDSLLQVSPNKRLTAIKALNHPWIK 459

>KLTH0F04840g Chr6 complement(427194..428339) [1146 bp, 381 aa] {ON}
           highly similar to uniprot|P05986 Saccharomyces
           cerevisiae YKL166C TPK3 and highly similar to
           uniprot|P06244 Saccharomyces cerevisiae YJL164C TPK1
          Length = 381

 Score =  146 bits (369), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 88/268 (32%), Positives = 140/268 (52%), Gaps = 22/268 (8%)

Query: 26  TLGFGSTGKVQLARHERTGQKTAVKVIPK-SIFKSEGSHGNNDSVLPFNIEREIVIMKLL 84
           TLG GS G+V L R    G+  A+KV+ K +I K +     ND         E  ++ ++
Sbjct: 76  TLGTGSFGRVHLVRSNHNGRFYAMKVLKKRTIVKLKQVEHTND---------ERRMLSIV 126

Query: 85  SHPNVLSLYDVWETDNNLYLILEYAEKGELFNLLVDRGPLPEREAIKCFKQIIIAISYCH 144
           SHP ++ ++  ++    +++I++Y E GELF+LL      P   A     ++ +A+ Y H
Sbjct: 127 SHPFIIRMWGTFQDAEQVFMIMDYIEGGELFSLLRKSQRFPNPVAKFYAAEVCLALEYLH 186

Query: 145 ALGIVHRDLKPENLLLDNSYNIKIADFGMAALQTDAGMLETSCGSPHYAAPEIVSGLPYE 204
           A  I++RDLKPEN+LLD + ++KI DFG A    D     T CG+P Y APE+VS  PY 
Sbjct: 187 AHEIIYRDLKPENVLLDKNGHVKITDFGFAKYVPDVTF--TLCGTPDYIAPEVVSTKPYN 244

Query: 205 GFASDVWSCGVILFALLTGRLPFDEENGNVRDLLLKVQKGQFEMPNNAEISGDAQDLIRR 264
             + D WS G+++F +L G  PF   + N       +   Q + P       D QDL+ +
Sbjct: 245 K-SVDWWSFGILIFEMLAGYTPF--YDSNTMKTYENILNAQLQFP--PFFHADVQDLLSQ 299

Query: 265 ILVVDPTQRI-----KIRDILSHPLLKK 287
           ++  D ++R+        D+ +HP   +
Sbjct: 300 LITRDLSKRLGNLQNGSEDVKNHPWFSE 327

>CAGL0G09020g Chr7 (860266..861351) [1086 bp, 361 aa] {ON} highly
           similar to uniprot|P06245 Saccharomyces cerevisiae
           YPL203w TPK2 cAMP-dependent protein kinase 2 catalytic
           chain
          Length = 361

 Score =  145 bits (367), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 91/266 (34%), Positives = 141/266 (53%), Gaps = 22/266 (8%)

Query: 26  TLGFGSTGKVQLARHERTGQKTAVKVIPKS-IFKSEGSHGNNDSVLPFNIEREIVIMKLL 84
           TLG GS G+V L R    G+  A+KV+ K+ + K +     ND       ER +  +KL+
Sbjct: 56  TLGTGSFGRVHLVRSVHNGRYYAIKVLKKAQVVKMKQIEHTND-------ERRM--LKLV 106

Query: 85  SHPNVLSLYDVWETDNNLYLILEYAEKGELFNLLVDRGPLPEREAIKCFKQIIIAISYCH 144
            HP ++ ++  ++   NL+++++Y E GELF LL      P   A     ++ +A+ Y H
Sbjct: 107 EHPFLIRMWGTFQDSRNLFMVMDYIEGGELFTLLRKSQRFPNPVAKFYAAEVTLALEYLH 166

Query: 145 ALGIVHRDLKPENLLLDNSYNIKIADFGMAALQTDAGMLETSCGSPHYAAPEIVSGLPYE 204
              I++RDLKPEN+LLD + +IKI DFG A  +    +  T CG+P Y APE+++  PY 
Sbjct: 167 FHNIIYRDLKPENILLDRNGHIKITDFGFA--KEVETVTWTLCGTPDYIAPEVIATKPYN 224

Query: 205 GFASDVWSCGVILFALLTGRLPFDEENGNVRDLLLKVQKGQFEMPNNAEISGDAQDLIRR 264
             + D WS GV+++ +L G  PF   +        K+  G+   P     + D  DL+ +
Sbjct: 225 K-SVDWWSLGVLIYEMLAGYTPF--YDTTPMKTYEKILHGKVVYPQF--FNSDVIDLLSK 279

Query: 265 ILVVDPTQRI-----KIRDILSHPLL 285
           +L  D T+RI       +DI SHP  
Sbjct: 280 LLTADLTRRIGNLQKGAQDIKSHPWF 305

>Suva_16.104 Chr16 (176201..177352) [1152 bp, 383 aa] {ON} YPL203W
           (REAL)
          Length = 383

 Score =  146 bits (368), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 93/272 (34%), Positives = 147/272 (54%), Gaps = 24/272 (8%)

Query: 21  WKLGETLGFGSTGKVQLARHERTGQKTAVKVIPKS-IFKSEGSHGNNDSVLPFNIEREIV 79
           +++  TLG GS G+V L R    G+  A+KV+ K  I K +     ND       ER + 
Sbjct: 73  FQIMRTLGTGSFGRVHLVRSVHNGRYYAIKVLKKQQIVKMKQVEHTND-------ERRM- 124

Query: 80  IMKLLSHPNVLSLYDVWETDNNLYLILEYAEKGELFNLLVDRGPLPEREAIKCFKQIIIA 139
            +KL+ HP ++ ++  ++   N++++++Y E GELF+LL      P   A     ++I+A
Sbjct: 125 -LKLVEHPFLIRMWGTFQDARNIFMVMDYIEGGELFSLLRKSQRFPNPVAKFYAAEVILA 183

Query: 140 ISYCHALGIVHRDLKPENLLLDNSYNIKIADFGMAA-LQTDAGMLETSCGSPHYAAPEIV 198
           + Y H   I++RDLKPEN+LLD + +IKI DFG A  +QT   +  T CG+P Y APE++
Sbjct: 184 LEYLHGHNIIYRDLKPENILLDRNGHIKITDFGFAKEVQT---VTWTLCGTPDYIAPEVI 240

Query: 199 SGLPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRDLLLKVQKGQFEMPNNAEISGDA 258
           +  PY   + D WS GV+++ +L G  PF   +        K+ +G+   P       D 
Sbjct: 241 TTKPYNK-SVDWWSLGVLIYEMLAGYTPF--YDTTPMKTYEKILQGKVIYP--PYFHPDV 295

Query: 259 QDLIRRILVVDPTQRI-----KIRDILSHPLL 285
            DL+ +++  D T+RI       RDI +HP  
Sbjct: 296 VDLLSKLITADLTRRIGNLQSGSRDIKAHPWF 327

>KAFR0G02690 Chr7 complement(555573..557714) [2142 bp, 713 aa] {ON}
           Anc_6.31 YMR001C
          Length = 713

 Score =  152 bits (383), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 94/264 (35%), Positives = 141/264 (53%), Gaps = 19/264 (7%)

Query: 24  GETLGFGSTGKVQLARHERTGQKTAVKVIPKSIFKSEGSHGNNDSVLPFNIEREIVIMKL 83
           G  LG G   +    R + +G+  A K + K   KSE +           +  EI I K 
Sbjct: 98  GHFLGEGGFARCFQIRDD-SGKIFAAKTVAKISIKSEKTRKK--------LLSEIQIHKS 148

Query: 84  LSHPNVLSLYDVWETDNNLYLILEYAEKGELFNLLVDRGPLPEREAIKCFKQIIIAISYC 143
           + H N++   D +E D N+Y++LE    G L +LL  R  L E E      QI  AI Y 
Sbjct: 149 MKHVNIVQFIDCFEDDTNVYILLEICPNGSLMDLLKKRKSLTEPEVRFFTTQICGAIKYM 208

Query: 144 HALGIVHRDLKPENLLLDNSYNIKIADFGMAA-LQTDAGMLETSCGSPHYAAPEIV---- 198
           H+  ++HRDLK  N+  D  YN+KI DFG+AA L  D     T CG+P+Y APE++    
Sbjct: 209 HSRKVIHRDLKLGNIFFDRKYNLKIGDFGLAATLANDRERKYTVCGTPNYIAPEVLMGKH 268

Query: 199 SGLPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRDLLLKVQKGQFEMPNNAEISGDA 258
           SG  YE    D+WS GV+++AL+ GR PF  ++ +V  +  +++   F  P +  IS +A
Sbjct: 269 SGHSYE---VDIWSIGVMIYALIIGRPPF--QSKDVNTIYERIKCRDFSFPKDKLISSEA 323

Query: 259 QDLIRRILVVDPTQRIKIRDILSH 282
           + LI+ IL +DP +R  + +I+ +
Sbjct: 324 KILIQDILSLDPLERPSVNEIMDY 347

>KAFR0I02010 Chr9 complement(411589..412887) [1299 bp, 432 aa] {ON}
           Anc_1.374 YFR014C
          Length = 432

 Score =  147 bits (371), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 98/275 (35%), Positives = 152/275 (55%), Gaps = 18/275 (6%)

Query: 19  GPWKLGETLGFGSTGKVQLARHERTGQKTAVKVIPKSIFKSEGSHGNNDSVLPFNIEREI 78
           G +  G+TLG G+ G V+ AR   T +  AVK+I K   K       ND  L   +  E+
Sbjct: 37  GNYTFGKTLGAGTFGVVRQARKVSTDEDVAVKIILKKALKG------NDIQLQM-LYDEL 89

Query: 79  VIMKLLSHPNVLSLYDVWETDNNLYLILEYAEKGELFNLLVDRGPLPEREAIKCFKQIII 138
            I++ LSHPN++   D +E+ +  Y++ + A  GELF+ ++ +G   E +A+K   QI+ 
Sbjct: 90  SILQHLSHPNIVEFKDWFESRDKFYIVTQLAIGGELFDRILSKGKFTELDAVKIVVQILG 149

Query: 139 AISYCHALGIVHRDLKPENLL-LDNSYN--IKIADFGMA-ALQTDAGMLETSCGSPHYAA 194
           AI Y H+  +VHRDLKPEN+L +DNS +  I IADFG+A  L+    ++  + GS  Y A
Sbjct: 150 AIEYMHSQDVVHRDLKPENVLYVDNSDSSPIVIADFGIAKKLKNKNDLIFKAAGSLGYVA 209

Query: 195 PEIVSGLPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRDLLLKVQKGQFEM----PN 250
           PE+++   + G   D+WS GVI + LL G   F  E   V   L +  + +F +    P 
Sbjct: 210 PEVLTEGGH-GKPCDIWSLGVITYTLLCGYSAFIAE--TVEGFLEECTRSKFPVKFHKPY 266

Query: 251 NAEISGDAQDLIRRILVVDPTQRIKIRDILSHPLL 285
              IS +A++ I R L ++P +R    ++L  P +
Sbjct: 267 WDNISDEAKNFILRSLTLNPDERPTATELLEDPWI 301

>Kpol_1037.20 s1037 (41658..43772) [2115 bp, 704 aa] {ON}
           (41658..43772) [2115 nt, 705 aa]
          Length = 704

 Score =  151 bits (382), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 95/268 (35%), Positives = 142/268 (52%), Gaps = 19/268 (7%)

Query: 24  GETLGFGSTGKVQLARHERTGQKTAVKVIPKSIFKSEGSHGNNDSVLPFNIEREIVIMKL 83
           G  LG G   +    + + +G+  A K + K   KSE +           +  EI I K 
Sbjct: 85  GHFLGEGGFARCFQIKDD-SGKIFAAKTVAKLSIKSEKTRKK--------LLSEIQIHKS 135

Query: 84  LSHPNVLSLYDVWETDNNLYLILEYAEKGELFNLLVDRGPLPEREAIKCFKQIIIAISYC 143
           + H NV+   D +E D N+Y++LE    G L +LL  R  L E E      QI  AI Y 
Sbjct: 136 MKHQNVVQFIDCFEDDTNVYILLEICPNGSLMDLLKKRKLLTEPEVRFFTTQICGAIKYM 195

Query: 144 HALGIVHRDLKPENLLLDNSYNIKIADFGMAA-LQTDAGMLETSCGSPHYAAPEIV---- 198
           H+  ++HRDLK  N+  D +YN+KI DFG+AA L  D     T CG+P+Y APE++    
Sbjct: 196 HSRRVIHRDLKLGNIFFDRNYNLKIGDFGLAAVLANDRERKYTVCGTPNYIAPEVLMGKH 255

Query: 199 SGLPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRDLLLKVQKGQFEMPNNAEISGDA 258
           SG  YE    D+WS GV+L+ALL G+ PF  ++ +V  +  +++   F  P    IS +A
Sbjct: 256 SGHSYE---VDIWSIGVMLYALLIGKPPF--QSKDVNTIYERIKCCDFSFPKEKHISNEA 310

Query: 259 QDLIRRILVVDPTQRIKIRDILSHPLLK 286
           + LI+ +L +DP +R  I +I+ +   +
Sbjct: 311 KVLIQDLLSLDPLERPSISEIMDYVWFR 338

>Kpol_1033.50 s1033 complement(126043..127197) [1155 bp, 384 aa]
           {ON} complement(126043..127197) [1155 nt, 385 aa]
          Length = 384

 Score =  145 bits (366), Expect = 5e-37,   Method: Compositional matrix adjust.
 Identities = 86/255 (33%), Positives = 142/255 (55%), Gaps = 17/255 (6%)

Query: 21  WKLGETLGFGSTGKVQLARHERTGQKTAVKVIPKS-IFKSEGSHGNNDSVLPFNIEREIV 79
           +++  TLG GS G+V L R     +  A+KV+ K  IFK +     ND       ER+I 
Sbjct: 74  FQIMRTLGTGSFGRVHLVRSVHNKRYYAIKVLKKQQIFKMKQIEHTND-------ERKI- 125

Query: 80  IMKLLSHPNVLSLYDVWETDNNLYLILEYAEKGELFNLLVDRGPLPEREAIKCFKQIIIA 139
            +K++ HP ++ ++  ++   NL+++++Y E GELF+LL      P   A     ++I+A
Sbjct: 126 -LKIVEHPFLIRMWGTFQDSRNLFMVMDYIEGGELFSLLRKSQRFPNPVAKFYAAEVILA 184

Query: 140 ISYCHALGIVHRDLKPENLLLDNSYNIKIADFGMAALQTDAGMLETSCGSPHYAAPEIVS 199
           + Y H+  I++RDLKPEN+LLD + +IKI DFG A  +  + +  T CG+P Y APE+++
Sbjct: 185 LDYLHSHNIIYRDLKPENILLDRNGHIKITDFGFA--KEVSTVTWTLCGTPDYIAPEVIA 242

Query: 200 GLPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRDLLLKVQKGQFEMPNNAEISGDAQ 259
             PY   + D WS G++++ +L G  PF   +        K+  G+   P  +    D  
Sbjct: 243 TKPYNK-SVDWWSLGILIYEMLAGYTPF--YDTTPMKTYEKILHGKVNYP--SFFHPDVI 297

Query: 260 DLIRRILVVDPTQRI 274
           DL+ R++  D T+R+
Sbjct: 298 DLLARLITADLTRRL 312

>TPHA0G01600 Chr7 complement(329313..331850) [2538 bp, 845 aa] {ON}
           Anc_8.676 YPL153C
          Length = 845

 Score =  152 bits (384), Expect = 5e-37,   Method: Compositional matrix adjust.
 Identities = 96/290 (33%), Positives = 155/290 (53%), Gaps = 30/290 (10%)

Query: 13  KPLNIIGPWKL-GETLGFGSTGKVQLARHERTGQKTAVKVIPKSIFKSEGSHGNNDSVLP 71
           KPL I   + +  E +G G+   V+ A    TG+  AVK+I K         GN D V  
Sbjct: 188 KPLGIFKDFTIKDEVVGQGAFAIVKKAVERSTGKTFAVKIISK-----RKVMGNMDGV-- 240

Query: 72  FNIEREIVIMKLLSHPNVLSLYDVWETDNNLYLILEYAEKGELFNLLVDRGPLPEREAIK 131
               RE+ +++ L HP ++ L   +E + + YL++E+   G+L + +   G + E    +
Sbjct: 241 ---TRELEVLRKLDHPRIVRLKGFYEDEESYYLLMEFVSGGDLMDFVAAHGSVGEDAGRE 297

Query: 132 CFKQIIIAISYCHALGIVHRDLKPENLLL--DNSYNIKIADFGMAALQTDAGMLETSCGS 189
             +QI+ A+ Y H+  I HRDLKP+N+L+  D+   +KI DFG+A +Q +   ++T CG+
Sbjct: 298 ITRQILEAVKYIHSKCISHRDLKPDNILIEQDDPVLVKITDFGLAKVQGNGTFMKTFCGT 357

Query: 190 PHYAAPEIVSG----------LPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRDLLL 239
             Y APEI+SG            Y     D+WS G +++ +LTG LPF   +G+ ++ L 
Sbjct: 358 LAYVAPEIISGSNNLEENEERNEYSSLV-DMWSIGCLVYVILTGHLPF---SGSTQEQLY 413

Query: 240 K-VQKGQF-EMP-NNAEISGDAQDLIRRILVVDPTQRIKIRDILSHPLLK 286
           K V+ G + E P  +  IS +A++ I  +L V+P  R+     L HP +K
Sbjct: 414 KQVRNGSYHEGPLKDFRISDEARNFIDSLLQVNPNDRLSAERALQHPWIK 463

>AAR009W Chr1 (358947..360308) [1362 bp, 453 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOL016C (CMK2) and
           YFR014C (CMK1)
          Length = 453

 Score =  147 bits (370), Expect = 6e-37,   Method: Compositional matrix adjust.
 Identities = 89/265 (33%), Positives = 146/265 (55%), Gaps = 16/265 (6%)

Query: 23  LGETLGFGSTGKVQLARHERTGQKTAVKVIPKSIFKSEGSHGNNDSVLPFNIEREIVIMK 82
            G+TLG G+ G V+ AR+ +  Q  A+K++ K   K     GN   +L      E+ I++
Sbjct: 58  FGKTLGAGAFGVVRQARNSKQNQNVAIKILLKRALK-----GNELQML----YDELSILQ 108

Query: 83  LLSHPNVLSLYDVWETDNNLYLILEYAEKGELFNLLVDRGPLPEREAIKCFKQIIIAISY 142
            L HPN++   D +E+    Y++ + A  GELF+ ++ +G   E +A+K   Q++ A+ Y
Sbjct: 109 KLDHPNIVKFKDWFESREKFYIVTQLATGGELFDRILKKGKFTETDAVKIVVQMLTAVEY 168

Query: 143 CHALGIVHRDLKPENLL-LDNS--YNIKIADFGMA-ALQTDAGMLETSCGSPHYAAPEIV 198
            H+  +VHRDLKPEN+L LD S    + I+DFG+A  L +++ ++  + GS  Y APE++
Sbjct: 169 MHSQNVVHRDLKPENVLYLDPSDESQLVISDFGIAKQLSSESQLIHRAAGSMGYVAPEVL 228

Query: 199 SGLPYEGFASDVWSCGVILFALLTGRLPFDEEN--GNVRDLLLKVQKGQFEMPNNAEISG 256
           +   + G   D+WS GVI + LL G  PF  E+  G + ++        F  P    IS 
Sbjct: 229 TTSGH-GKPCDIWSLGVITYTLLCGYSPFIAESTEGFLEEVFSGSDPVTFHSPYWNNISK 287

Query: 257 DAQDLIRRILVVDPTQRIKIRDILS 281
           +A+  I R L + P +R    ++L+
Sbjct: 288 EAKQFILRALTLTPARRPTAAELLT 312

>Kpol_1004.19 s1004 (36090..36101,36217..37689) [1485 bp, 494 aa]
           {ON} (36090..36101,36217..37689) [1485 nt, 495 aa]
          Length = 494

 Score =  147 bits (372), Expect = 6e-37,   Method: Compositional matrix adjust.
 Identities = 91/293 (31%), Positives = 147/293 (50%), Gaps = 36/293 (12%)

Query: 16  NIIGPWKLGETLGFGSTGKVQLARHERTGQKTAVKVIPKSIFKSEGSHGNNDSVLPFNIE 75
           ++   + +G+ LG G    V+  R+++TGQ  A+K+    +        N+D        
Sbjct: 177 SVFDKYIIGKELGSGHYAIVKEGRNKKTGQSVAIKIFHPQL--------NDDQKKNHQFR 228

Query: 76  REIVIMKLLSHPNVLSLYDVW-----ETDNNLYLILEYAEKGELFNLLVDRGPLPEREAI 130
            E  I+  + HPN+++L D +     ++    YL+L+  + GELF+ +V +  L + E  
Sbjct: 229 EETDILMRVHHPNIVNLLDSYVEPLSKSQIQKYLVLDKIDDGELFDRIVRKTSLSQNETK 288

Query: 131 KCFKQIIIAISYCHALGIVHRDLKPENLLLDNS-------------------YNIKIADF 171
             FKQI+  I Y H   I+HRD+KPEN+LL+ +                     +KIADF
Sbjct: 289 ALFKQILSGIQYLHGQNIIHRDIKPENILLNITRRTSNDQIKTGPWDEDEIDIQVKIADF 348

Query: 172 GMAALQTDAGMLETSCGSPHYAAPEIVSGLPYEGFASDVWSCGVILFALLTGRLPFDEEN 231
           G+A    +     T CG+P Y APE++    Y     D+WS GV+L+  L G  PF ++ 
Sbjct: 349 GLAKFTGELQFTNTLCGTPSYVAPEVLRKTGYTS-KVDIWSTGVLLYVCLCGFPPFSDQL 407

Query: 232 G--NVRDLLLKVQKGQFEMPNNAEISGDAQDLIRRILVVDPTQRIKIRDILSH 282
           G   +++ +L+  K  F  P   EI+     LI  +LVV+P QR  I D+++H
Sbjct: 408 GPPTLKEQILQ-GKFAFFSPYWDEINDSVLHLISNLLVVNPAQRYSIEDMINH 459

>TDEL0D05320 Chr4 complement(965082..968255) [3174 bp, 1057 aa] {ON}
           Anc_3.92 YDR490C
          Length = 1057

 Score =  152 bits (385), Expect = 6e-37,   Method: Compositional matrix adjust.
 Identities = 106/311 (34%), Positives = 162/311 (52%), Gaps = 26/311 (8%)

Query: 3   VANMETYRITKPL--NIIGPWKLGETLGFGSTGKVQLARHERTGQKTAVKVIPKSIFKSE 60
           V N +T + T+ +    I  +K GETLG GS   V LA  + +G+K AVKV+ K     +
Sbjct: 147 VTNPDTGKTTRQVVKKGIKDFKFGETLGDGSYSTVMLATSKESGKKYAVKVLSKEYLIRQ 206

Query: 61  GSHGNNDSVLPFNIEREIVIMKLLSHPNVLSLYDVWETDNNLYLILEYAEKGELFNLLVD 120
                   V   NIE+   + +L +   ++ LY  ++ +++LY +LEYA  G+  +++  
Sbjct: 207 ------KKVKYVNIEKN-ALQRLNNSRGIVKLYFTFQDESSLYFLLEYAPNGDFLSIMKK 259

Query: 121 RGPLPEREAIKCFKQIIIAISYCHALGIVHRDLKPENLLLDNSYNIKIADFGMAAL---- 176
            G L E  A     QII AI + H+ GIVHRD+KPEN+LLD  + +K+ DFG A +    
Sbjct: 260 YGSLNEDCACYYSAQIIDAIDFLHSKGIVHRDIKPENILLDKDFKVKLTDFGTAKILEPK 319

Query: 177 --QTDAGML----ETSCGSPHYAAPEIVSGLPYEGFASDVWSCGVILFALLTGRLPFDEE 230
              TD+  L    ++  G+  Y +PE+++   Y  +  D+W+ G ILF ++ G+ PF   
Sbjct: 320 PNTTDSYDLLSRSKSFVGTAEYVSPELLND-NYVDYRCDIWAFGCILFQMIAGKPPFKAT 378

Query: 231 NGNVRDLLLKVQKGQFEMPNNAEISGDAQDLIRRILVVDPTQRIKIRDILSHPLLKKYQT 290
           N  +     KV K Q+     A      +DL++ IL+  P QR+ I  I SH   K  + 
Sbjct: 379 NEYL--TFQKVMKVQYAF--TAGFPLVVRDLVKGILIKQPAQRLTIPQIKSHHFFKD-KN 433

Query: 291 IKDSKSIKDLP 301
            KD  SI D P
Sbjct: 434 FKDG-SIWDEP 443

>Kwal_33.13846 s33 complement(419630..420757) [1128 bp, 375 aa] {ON}
           YKL166C (TPK3) - cAMP-dependent protein kinase catalytic
           subunit [contig 108] FULL
          Length = 375

 Score =  144 bits (364), Expect = 8e-37,   Method: Compositional matrix adjust.
 Identities = 85/250 (34%), Positives = 136/250 (54%), Gaps = 17/250 (6%)

Query: 26  TLGFGSTGKVQLARHERTGQKTAVKVIPK-SIFKSEGSHGNNDSVLPFNIEREIVIMKLL 84
           TLG GS G+V L R    G+  A+KV+ K +I K +     ND       ER +  + ++
Sbjct: 70  TLGTGSFGRVHLVRSNHNGRFYAMKVLKKRTIVKLKQVEHTND-------ERRM--LSVV 120

Query: 85  SHPNVLSLYDVWETDNNLYLILEYAEKGELFNLLVDRGPLPEREAIKCFKQIIIAISYCH 144
           SHP ++ ++  ++   ++++I++Y E GELF+LL      P   A     ++ +A+ Y H
Sbjct: 121 SHPFIIRMWGTFQDAEHVFMIMDYIEGGELFSLLRKSQRFPNPVAKFYAAEVCLALEYLH 180

Query: 145 ALGIVHRDLKPENLLLDNSYNIKIADFGMAALQTDAGMLETSCGSPHYAAPEIVSGLPYE 204
           A  I++RDLKPEN+LLD + ++KI DFG A    D     T CG+P Y APE+VS  PY 
Sbjct: 181 AQDIIYRDLKPENVLLDKNGHVKITDFGFAKFVPDVTY--TLCGTPDYIAPEVVSTKPYN 238

Query: 205 GFASDVWSCGVILFALLTGRLPFDEENGNVRDLLLKVQKGQFEMPNNAEISGDAQDLIRR 264
             + D WS G+++F +L G  PF   + N       +   + + P       D QDL+ +
Sbjct: 239 K-SVDWWSFGILIFEMLAGYTPF--YDSNTMKTYENILNAELQFP--PFFHSDVQDLLSQ 293

Query: 265 ILVVDPTQRI 274
           ++  D ++R+
Sbjct: 294 LITRDLSKRL 303

>KAFR0C04480 Chr3 (894906..896213) [1308 bp, 435 aa] {ON} Anc_1.374
           YFR014C
          Length = 435

 Score =  146 bits (368), Expect = 8e-37,   Method: Compositional matrix adjust.
 Identities = 94/269 (34%), Positives = 146/269 (54%), Gaps = 14/269 (5%)

Query: 23  LGETLGFGSTGKVQLARHERTGQKTAVKVIPKSIFKSEGSHGNNDSVLPFNIEREIVIMK 82
            G+TLG G+ G V+ AR   T +  AVK++ K   +     GN  SV    +  E+ I++
Sbjct: 34  FGKTLGAGTFGVVRQARKLSTNEDVAVKILLKKALE-----GN--SVQLQMLYDELSILQ 86

Query: 83  LLSHPNVLSLYDVWETDNNLYLILEYAEKGELFNLLVDRGPLPEREAIKCFKQIIIAISY 142
            L+HPN++   D +ET    +++ + A  GELF+ +V +G   E +AIK   QI+ A+ Y
Sbjct: 87  RLNHPNIVEFKDWFETKEKFFIVTQLATGGELFDRIVKKGKFTEEDAIKILVQILGAVEY 146

Query: 143 CHALGIVHRDLKPENLLLDNSYN---IKIADFGMAA-LQTDAGMLETSCGSPHYAAPEIV 198
            H+  IVHRDLKPENLL  +  +   + +ADFG+A  L++   ++  + GS  Y APE++
Sbjct: 147 IHSRNIVHRDLKPENLLYIDEADTSPLVLADFGIAKELKSGDELIFKAAGSLGYVAPEVL 206

Query: 199 SGLPYEGFASDVWSCGVILFALLTGRLPFDEEN--GNVRDLLLKVQKGQFEMPNNAEISG 256
           +   + G   D+WS GVI + LL G   F  E+  G + +     +   F  P    +S 
Sbjct: 207 TSDGH-GKPCDIWSIGVITYTLLCGYSAFAAESVEGFLDECTQNDKPVVFHKPYWDNVSE 265

Query: 257 DAQDLIRRILVVDPTQRIKIRDILSHPLL 285
           DA+  I R L +DPT+R     +L  P +
Sbjct: 266 DARKFILRALTLDPTKRPTATALLEDPWI 294

>Kpol_1069.13 s1069 complement(27223..28506) [1284 bp, 427 aa] {ON}
           complement(27223..28506) [1284 nt, 428 aa]
          Length = 427

 Score =  145 bits (367), Expect = 9e-37,   Method: Compositional matrix adjust.
 Identities = 100/299 (33%), Positives = 161/299 (53%), Gaps = 28/299 (9%)

Query: 5   NMETYRITKPLNIIG----------PWKLGETLGFGSTGKVQLARHERTGQKTAVKVIPK 54
           ++E +++TK  N I            +  G+TLG GS G V+ AR   TG+  AVK++ K
Sbjct: 12  SVEGHKMTKFFNKISGQPASYVNKTDYVFGKTLGAGSFGVVRQARRISTGENVAVKILLK 71

Query: 55  SIFKSEGSHGNNDSVLPFNIEREIVIMKLLSHPNVLSLYDVWETDNNLYLILEYAEKGEL 114
              K     GN   V    +  E+ I++ L HPN++     +E+ +  Y+  + A  GEL
Sbjct: 72  KALK-----GN--CVQIEMLYDELSILQKLHHPNIVDFKAWFESKDKFYIATQLATGGEL 124

Query: 115 FNLLVDRGPLPEREAIKCFKQIIIAISYCHALGIVHRDLKPENLL-LDNSYN--IKIADF 171
           F+ ++ RG   E +A++   Q++  I Y H+  IVHRDLKPEN+L +D S +  + IADF
Sbjct: 125 FDRILARGKFTEVDAVRIIVQLLQGIKYIHSKDIVHRDLKPENVLYIDKSDDSPLVIADF 184

Query: 172 GMA-ALQTDAGMLETSCGSPHYAAPEIVSGLPYEGFASDVWSCGVILFALLTGRLPFDEE 230
           G+A  L++   ++  + GS  Y APE+++ +   G   D+WS GVI + LL G  PF  E
Sbjct: 185 GIAKQLKSGDDLIFKAAGSLGYVAPEVLT-VNGHGKPCDIWSLGVITYTLLCGYSPFIAE 243

Query: 231 NGNVRDLLLKVQKG----QFEMPNNAEISGDAQDLIRRILVVDPTQRIKIRDILSHPLL 285
             +V   L +   G    +F  P    IS +A++ I R L+++P++R    ++L  P +
Sbjct: 244 --SVEGFLDECTSGKYPVKFHRPYWDTISDEAKEFILRALILEPSKRPTASELLEDPWI 300

>KNAG0C02440 Chr3 complement(475652..476857) [1206 bp, 401 aa] {ON}
           Anc_1.182 YJL164C
          Length = 401

 Score =  145 bits (365), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 85/255 (33%), Positives = 139/255 (54%), Gaps = 17/255 (6%)

Query: 21  WKLGETLGFGSTGKVQLARHERTGQKTAVKVIPK-SIFKSEGSHGNNDSVLPFNIEREIV 79
           +K+  TLG GS G+V L R    G+  A+KV+ K +I K +     ND         E +
Sbjct: 91  FKILRTLGTGSFGRVHLIRSNHNGRFYALKVLKKQTIVKLKQVEHTND---------ERL 141

Query: 80  IMKLLSHPNVLSLYDVWETDNNLYLILEYAEKGELFNLLVDRGPLPEREAIKCFKQIIIA 139
           ++ ++SHP ++ ++  ++    ++++++Y E GELF+LL      P   A     ++ +A
Sbjct: 142 MLSVVSHPFLVRMWGTFQDSQQVFMVMDYIEGGELFSLLRKSQRFPTPVAKFYAAEVCLA 201

Query: 140 ISYCHALGIVHRDLKPENLLLDNSYNIKIADFGMAALQTDAGMLETSCGSPHYAAPEIVS 199
           + Y H L I++RDLKPEN+LLD + +IKI DFG A    D     T CG+P Y APE++S
Sbjct: 202 LEYLHNLDIIYRDLKPENILLDKNGHIKITDFGFAKYVPDVTY--TLCGTPDYIAPEVMS 259

Query: 200 GLPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRDLLLKVQKGQFEMPNNAEISGDAQ 259
             PY   + D WS GV+++ +L G  PF   + N       +   + + P  +    D +
Sbjct: 260 TKPYNK-SVDWWSFGVLIYEMLAGHTPF--YDSNAMKTYENILNAKLKFP--SFFHDDVK 314

Query: 260 DLIRRILVVDPTQRI 274
           DL+ R++  D +QR+
Sbjct: 315 DLLTRLINRDLSQRL 329

>Kwal_56.24059 s56 complement(829673..830734) [1062 bp, 353 aa] {ON}
           YPL203W (TPK2) - cAMP-dependent protein kinase catalytic
           subunit [contig 166] FULL
          Length = 353

 Score =  144 bits (362), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 89/266 (33%), Positives = 144/266 (54%), Gaps = 22/266 (8%)

Query: 26  TLGFGSTGKVQLARHERTGQKTAVKVIPK-SIFKSEGSHGNNDSVLPFNIEREIVIMKLL 84
           TLG GS G+V L R    G+  A+KV+ K  + + +     ND       ER +  +KL+
Sbjct: 48  TLGTGSFGRVHLVRSVHNGRYYAIKVLKKEQVIRMKQIEHTND-------ERRM--LKLV 98

Query: 85  SHPNVLSLYDVWETDNNLYLILEYAEKGELFNLLVDRGPLPEREAIKCFKQIIIAISYCH 144
            HP ++ ++  ++   NL+++++Y E GELF+LL      P   A     ++I+A+ Y H
Sbjct: 99  DHPFLIRMWGTFQDSRNLFMVMDYIEGGELFSLLRKSQRFPNPVAKFYAAEVILALEYLH 158

Query: 145 ALGIVHRDLKPENLLLDNSYNIKIADFGMAALQTDAGMLETSCGSPHYAAPEIVSGLPYE 204
           +  I++RDLKPEN+LLD + +IKI DFG A  + D  +  T CG+P Y APE+++  PY 
Sbjct: 159 SHDIIYRDLKPENILLDRNGHIKITDFGFAK-EVDT-VTWTLCGTPDYIAPEVIATKPYN 216

Query: 205 GFASDVWSCGVILFALLTGRLPFDEENGNVRDLLLKVQKGQFEMPNNAEISGDAQDLIRR 264
             + D WS G+++F +L G  PF   +        K+ +G+   P       D  DL+ +
Sbjct: 217 K-SVDWWSLGILIFEMLAGYTPF--YDATPMKTYEKILQGKVAYP--PFFHPDVVDLLCK 271

Query: 265 ILVVDPTQRI-----KIRDILSHPLL 285
           ++  D T+R+       +D+ SHP  
Sbjct: 272 LITSDLTRRLGNLQSGPQDVKSHPWF 297

>NDAI0C02680 Chr3 complement(621951..624203) [2253 bp, 750 aa] {ON}
           Anc_6.31
          Length = 750

 Score =  150 bits (379), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 94/261 (36%), Positives = 142/261 (54%), Gaps = 19/261 (7%)

Query: 23  LGETLGFGSTGKVQLARHERTGQKTAVKVIPKSIFKSEGSHGNNDSVLPFNIEREIVIMK 82
           LGE  GF    +++    + +G+  A K + K   KSE +           +  EI I K
Sbjct: 101 LGEG-GFARCFQIK----DESGKIFAAKTVAKISIKSEKTKRK--------LLSEIQIHK 147

Query: 83  LLSHPNVLSLYDVWETDNNLYLILEYAEKGELFNLLVDRGPLPEREAIKCFKQIIIAISY 142
            + H N++   D +E D N+Y++LE    G L +LL  R  L E E      QI  AI Y
Sbjct: 148 SMKHSNIVQFIDCFEDDANVYILLEICPNGSLMDLLKKRKSLTEPEVRFFTTQICGAIKY 207

Query: 143 CHALGIVHRDLKPENLLLDNSYNIKIADFGMAA-LQTDAGMLETSCGSPHYAAPEIVSGL 201
            H+  I+HRDLK  N+  D  YN+K+ DFG+AA L  D     T CG+P+Y APE++ G 
Sbjct: 208 LHSRRIIHRDLKLGNIFFDKDYNLKVGDFGLAAVLANDRERKYTVCGTPNYIAPEVLMG- 266

Query: 202 PYEG--FASDVWSCGVILFALLTGRLPFDEENGNVRDLLLKVQKGQFEMPNNAEISGDAQ 259
            + G  F  D+WS GV+++ALL G+ PF  ++ NV  +  +++  ++  P +  +S +A+
Sbjct: 267 KHSGHSFEVDIWSIGVMIYALLVGKPPFQAKDVNV--IYERIKLCKYGYPKDKYVSKEAE 324

Query: 260 DLIRRILVVDPTQRIKIRDIL 280
            LI  IL ++P QR  I DI+
Sbjct: 325 ILIHDILSLNPLQRPTIIDII 345

>KAFR0B05410 Chr2 complement(1111152..1112771) [1620 bp, 539 aa]
           {ON} Anc_8.279 YLR096W
          Length = 539

 Score =  147 bits (372), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 104/329 (31%), Positives = 165/329 (50%), Gaps = 33/329 (10%)

Query: 18  IGPWKLGETLGFGSTGKVQLARHERTGQKTAVKVIPK--SIFKSEGSHGNNDSV-----L 70
           +G W    TLG G+ G V+LA+H  +GQ  AVK+  +  S+  ++ +  N + V      
Sbjct: 52  LGEWIFSRTLGKGAKGTVKLAKHRASGQICAVKITIRYQSVILNKCNTQNIEDVKCSKEF 111

Query: 71  PFNIE------REIVIMKLLSHPNVLSLYDVWETDNNLYLILEYAEKGELFNLLVDRGP- 123
              I+      +E  + ++L HP++   Y + E   + Y+ LEY +   L   +  +   
Sbjct: 112 KTAIQHDRRTMQEFQLSRVLRHPHICKFYKMEEMRYHYYMFLEYIQGCTLLEYVSSQNAK 171

Query: 124 -LPEREAIKCFKQIIIAISYCHALGIVHRDLKPENLLLDN-SYNIKIADFGMAALQTDAG 181
            L E  A     QI+ A++Y H+  IVHRDLK EN+++ N    IK+ DFG+        
Sbjct: 172 KLNEEIARDFAGQILNALAYLHSNNIVHRDLKMENIMVTNEDKTIKLIDFGLGCFYDQNS 231

Query: 182 MLETSCGSPHYAAPEIVSGLPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRDLLLK- 240
            L   CGS +YAAPE++    Y G   D+WS GV+L+ ++TG+LPF    G  +  L+K 
Sbjct: 232 TLNDYCGSLYYAAPEVLKRDYYIGPEVDIWSFGVVLYIMVTGKLPF---KGRSKGRLMKH 288

Query: 241 VQKGQFEMPNNAEISGDAQDLIRRILVVDPTQRIKIRDILSHPLLKKYQTIKDSKSIKDL 300
           +  GQ + PN   +S D   L+ RIL +D + R  + DI+ H    ++  I D K  +  
Sbjct: 289 ILSGQVKFPNF--LSMDVISLLSRILEIDLSFRFSLSDIIKH----QWFWICDIKYWE-- 340

Query: 301 PRENTYLYPLADADNHTSVTIDDSILQNL 329
                 +YP+   +  T  TI  S+L  +
Sbjct: 341 -----LIYPMCKREKITEYTISFSVLSEM 364

>NCAS0D00630 Chr4 complement(107310..108593) [1284 bp, 427 aa] {ON}
           Anc_1.374
          Length = 427

 Score =  145 bits (366), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 94/292 (32%), Positives = 156/292 (53%), Gaps = 18/292 (6%)

Query: 2   AVANMETYRITKPLNIIGPWKLGETLGFGSTGKVQLARHERTGQKTAVKVIPKSIFKSEG 61
           +V ++E++ +         ++ G+TLG GS G V+ A  +   ++ A+K++ K   +   
Sbjct: 8   SVVSLESFSLFPSKVTKSDYEFGKTLGAGSFGVVREATKKSNNEEVAIKILLKKALE--- 64

Query: 62  SHGNNDSVLPFNIEREIVIMKLLSHPNVLSLYDVWETDNNLYLILEYAEKGELFNLLVDR 121
             GN   V    +  E+ I+K L HPN++   + +ETD+ +Y++ + A  GELF+ ++ +
Sbjct: 65  --GNQ--VQLQMLYDELTILKKLHHPNIVEFKNWFETDDKIYIVTQLATGGELFDRIIKK 120

Query: 122 GPLPEREAIKCFKQIIIAISYCHALGIVHRDLKPENLLL---DNSYNIKIADFGMAA-LQ 177
           G   E +A+K   QI+ A+ Y H+  IVHRDLKPENLL         + IADFG+A  L+
Sbjct: 121 GRFSEDDAVKILIQILSAVEYIHSRDIVHRDLKPENLLYLTEKEDSELVIADFGIAKELK 180

Query: 178 TDAGMLETSCGSPHYAAPEIVSGLPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRDL 237
               ++  + GS  Y APE+++ +   G   D+WS GVI + LL+G   F  E   V   
Sbjct: 181 KGEQLIFKAAGSLGYVAPEVLT-VDGHGKPCDIWSIGVITYTLLSGYAAFVAE--TVEGF 237

Query: 238 LLKVQKG----QFEMPNNAEISGDAQDLIRRILVVDPTQRIKIRDILSHPLL 285
           L +   G    +F  P    IS DA++ I + L ++P +R    ++L  P +
Sbjct: 238 LDECTSGDYPVKFHKPYWDNISDDAKNFILKALDLNPQKRPTATELLDDPWI 289

>SAKL0C05368g Chr3 complement(510576..511832) [1257 bp, 418 aa] {ON}
           similar to uniprot|P05986 Saccharomyces cerevisiae
           YKL166C TPK3 Involved in nutrient control of cell growth
           and division cAMP-dependent protein kinase catalytic
           subunit
          Length = 418

 Score =  145 bits (365), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 89/266 (33%), Positives = 142/266 (53%), Gaps = 22/266 (8%)

Query: 26  TLGFGSTGKVQLARHERTGQKTAVKVIPK-SIFKSEGSHGNNDSVLPFNIEREIVIMKLL 84
           TLG GS G+V L R    G+  A+KV+ K +I K +     ND       ER +  + ++
Sbjct: 113 TLGTGSFGRVHLVRSNHNGRFYAMKVLKKRTIVKLKQVEHTND-------ERRM--LSVV 163

Query: 85  SHPNVLSLYDVWETDNNLYLILEYAEKGELFNLLVDRGPLPEREAIKCFKQIIIAISYCH 144
           SHP  + ++  ++    +++I++Y E GELF+LL      P   A     ++ +A+ Y H
Sbjct: 164 SHPFTIRMWGTFQDAQQVFMIMDYIEGGELFSLLRKSQRFPNPVAKFYAAEVCLALEYLH 223

Query: 145 ALGIVHRDLKPENLLLDNSYNIKIADFGMAALQTDAGMLETSCGSPHYAAPEIVSGLPYE 204
           ++ I++RDLKPEN+LLD + +IK+ DFG A    D  +  T CG+P Y APE+VS  PY 
Sbjct: 224 SMDIIYRDLKPENILLDKNGHIKLTDFGFAKYVPD--VTYTLCGTPDYIAPEVVSTKPYN 281

Query: 205 GFASDVWSCGVILFALLTGRLPFDEENGNVRDLLLKVQKGQFEMPNNAEISGDAQDLIRR 264
             + D WS G+++F +L G  PF   + N       +   + + P  +    DAQDL+ R
Sbjct: 282 K-SVDWWSFGILIFEMLAGYTPF--YDSNTMKTYENILNAELQFP--SIFHPDAQDLLCR 336

Query: 265 ILVVDPTQRI-----KIRDILSHPLL 285
           ++  D ++R+        D+  HP  
Sbjct: 337 LITRDLSKRLGNLQNGSEDVKRHPWF 362

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.313    0.132    0.367 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 100,083,295
Number of extensions: 4347191
Number of successful extensions: 21723
Number of sequences better than 10.0: 2128
Number of HSP's gapped: 18202
Number of HSP's successfully gapped: 2442
Length of query: 1032
Length of database: 53,481,399
Length adjustment: 120
Effective length of query: 912
Effective length of database: 39,721,479
Effective search space: 36225988848
Effective search space used: 36225988848
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 71 (32.0 bits)