Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Smik_3.191.10ON1441447321e-101
YCL056C (PEX34)1.10ON1441446234e-84
Skud_3.81.10ON1441446218e-84
Suva_3.1571.10ON1441446095e-82
KLLA0C00594g1.10ON1941341102e-06
KAFR0D001901.10ON185170952e-04
TDEL0C069301.10ON184149820.010
KLTH0F00572g1.10ON195162730.18
SAKL0C00572g1.10ON338130730.24
KNAG0C002701.10ON174166700.43
Kwal_33.130231.10ON19365700.45
NCAS0B090601.10ON167155671.0
AAL027W1.392ON59263661.9
KLLA0F12232g1.392ON63957643.7
KAFR0C014103.97ON43961635.2
NOTE: 6 genes in the same pillar as Smik_3.19 were not hit in these BLAST results
LIST: Kpol_2002.13 ZYRO0F18370g TBLA0A04970 Ecym_1012 TPHA0E03960 NDAI0A00190

BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Smik_3.19
         (144 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Smik_3.19 Chr3 complement(28371..28805) [435 bp, 144 aa] {ON} YC...   286   e-101
YCL056C Chr3 complement(26925..27359) [435 bp, 144 aa] {ON}  PEX...   244   4e-84
Skud_3.8 Chr3 complement(14921..15355) [435 bp, 144 aa] {ON} YCL...   243   8e-84
Suva_3.157 Chr3 complement(236677..237111) [435 bp, 144 aa] {ON}...   239   5e-82
KLLA0C00594g Chr3 complement(44220..44804) [585 bp, 194 aa] {ON}...    47   2e-06
KAFR0D00190 Chr4 complement(21149..21706) [558 bp, 185 aa] {ON} ...    41   2e-04
TDEL0C06930 Chr3 (1260938..1261492) [555 bp, 184 aa] {ON} Anc_1....    36   0.010
KLTH0F00572g Chr6 complement(42946..43533) [588 bp, 195 aa] {ON}...    33   0.18 
SAKL0C00572g Chr3 complement(51031..52047) [1017 bp, 338 aa] {ON...    33   0.24 
KNAG0C00270 Chr3 complement(41823..42347) [525 bp, 174 aa] {ON} ...    32   0.43 
Kwal_33.13023 s33 complement(43697..44278) [582 bp, 193 aa] {ON}...    32   0.45 
NCAS0B09060 Chr2 (1741161..1741664) [504 bp, 167 aa] {ON} Anc_1....    30   1.0  
AAL027W Chr1 (295617..297395) [1779 bp, 592 aa] {ON} Syntenic ho...    30   1.9  
KLLA0F12232g Chr6 (1129199..1129312,1129532..1131337) [1920 bp, ...    29   3.7  
KAFR0C01410 Chr3 (288872..290191) [1320 bp, 439 aa] {ON} Anc_3.9...    29   5.2  

>Smik_3.19 Chr3 complement(28371..28805) [435 bp, 144 aa] {ON}
           YCL056C (REAL)
          Length = 144

 Score =  286 bits (732), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 144/144 (100%), Positives = 144/144 (100%)

Query: 1   MVSEKKSAEVSGKNLWINVWNGVSSLLDFFAVLENLGVVDDKLYVSGVLRKVWLCYSWIS 60
           MVSEKKSAEVSGKNLWINVWNGVSSLLDFFAVLENLGVVDDKLYVSGVLRKVWLCYSWIS
Sbjct: 1   MVSEKKSAEVSGKNLWINVWNGVSSLLDFFAVLENLGVVDDKLYVSGVLRKVWLCYSWIS 60

Query: 61  VIKCVWKLINLCKVKFKIDQRLNGPGNGLVKEKLMNFKKRYRDQIRQITATLLQDLSYLM 120
           VIKCVWKLINLCKVKFKIDQRLNGPGNGLVKEKLMNFKKRYRDQIRQITATLLQDLSYLM
Sbjct: 61  VIKCVWKLINLCKVKFKIDQRLNGPGNGLVKEKLMNFKKRYRDQIRQITATLLQDLSYLM 120

Query: 121 VLIYPGTRLFKRLSNIITLCRIII 144
           VLIYPGTRLFKRLSNIITLCRIII
Sbjct: 121 VLIYPGTRLFKRLSNIITLCRIII 144

>YCL056C Chr3 complement(26925..27359) [435 bp, 144 aa] {ON}
           PEX34Peroxisomal integral membrane protein that
           regulates peroxisome populations; interacts with Pex11p,
           Pex25p, and Pex27p to control both constitutive
           peroxisome division and peroxisome morphology and
           abundance during peroxisome proliferation
          Length = 144

 Score =  244 bits (623), Expect = 4e-84,   Method: Compositional matrix adjust.
 Identities = 119/144 (82%), Positives = 134/144 (93%)

Query: 1   MVSEKKSAEVSGKNLWINVWNGVSSLLDFFAVLENLGVVDDKLYVSGVLRKVWLCYSWIS 60
           MVS+K +AE+S K++W N+W+GVSSLLDFFAVLENLGVV+DKLYVSG+LRKVWLCYS IS
Sbjct: 1   MVSKKNTAEISAKDIWENIWSGVSSLLDFFAVLENLGVVNDKLYVSGLLRKVWLCYSCIS 60

Query: 61  VIKCVWKLINLCKVKFKIDQRLNGPGNGLVKEKLMNFKKRYRDQIRQITATLLQDLSYLM 120
           VIKCVWKLI LCKVKFKIDQRL+G GNGLVK+KL+NFKK+Y + IR ITA LLQDLSYLM
Sbjct: 61  VIKCVWKLIKLCKVKFKIDQRLDGEGNGLVKDKLINFKKKYNEHIRHITAALLQDLSYLM 120

Query: 121 VLIYPGTRLFKRLSNIITLCRIII 144
           VLIYPGTRLFKRLSNIITLCRII+
Sbjct: 121 VLIYPGTRLFKRLSNIITLCRIIV 144

>Skud_3.8 Chr3 complement(14921..15355) [435 bp, 144 aa] {ON}
           YCL056C (REAL)
          Length = 144

 Score =  243 bits (621), Expect = 8e-84,   Method: Compositional matrix adjust.
 Identities = 114/144 (79%), Positives = 132/144 (91%)

Query: 1   MVSEKKSAEVSGKNLWINVWNGVSSLLDFFAVLENLGVVDDKLYVSGVLRKVWLCYSWIS 60
           MV +K +AE+ GK++W N+WN  SSLLDFFAVLENLGVVDDKLY+SG+LRKVWLCYSW+S
Sbjct: 1   MVPKKSTAEIGGKDIWTNIWNSASSLLDFFAVLENLGVVDDKLYLSGILRKVWLCYSWVS 60

Query: 61  VIKCVWKLINLCKVKFKIDQRLNGPGNGLVKEKLMNFKKRYRDQIRQITATLLQDLSYLM 120
           V++C+WKLI LCKVKFKID+RLNG GNGL+KEKL+NF+K Y DQIRQI A LLQDLSYLM
Sbjct: 61  VVRCIWKLIKLCKVKFKIDERLNGQGNGLIKEKLVNFRKMYNDQIRQIIANLLQDLSYLM 120

Query: 121 VLIYPGTRLFKRLSNIITLCRIII 144
           VLIYPGTRLF+RLSNI+TLCRIII
Sbjct: 121 VLIYPGTRLFRRLSNIMTLCRIII 144

>Suva_3.157 Chr3 complement(236677..237111) [435 bp, 144 aa] {ON}
           YCL056C (REAL)
          Length = 144

 Score =  239 bits (609), Expect = 5e-82,   Method: Compositional matrix adjust.
 Identities = 114/144 (79%), Positives = 131/144 (90%)

Query: 1   MVSEKKSAEVSGKNLWINVWNGVSSLLDFFAVLENLGVVDDKLYVSGVLRKVWLCYSWIS 60
           MV ++ + E+ G++ W  VWNGVSSLLDFFAVLENLGVVDDKLY+SG+LRKVWLCYSWIS
Sbjct: 1   MVPKENAGEIGGRDPWTKVWNGVSSLLDFFAVLENLGVVDDKLYLSGILRKVWLCYSWIS 60

Query: 61  VIKCVWKLINLCKVKFKIDQRLNGPGNGLVKEKLMNFKKRYRDQIRQITATLLQDLSYLM 120
           V++CVWKLI LC+VKFKI++RLNG GNGL+KEKL+NF K Y DQI+QITA LLQDLSYLM
Sbjct: 61  VVRCVWKLIKLCRVKFKINERLNGQGNGLIKEKLINFGKMYNDQIKQITANLLQDLSYLM 120

Query: 121 VLIYPGTRLFKRLSNIITLCRIII 144
           VLIYPGTRLFKRLSN+ITLCRIII
Sbjct: 121 VLIYPGTRLFKRLSNVITLCRIII 144

>KLLA0C00594g Chr3 complement(44220..44804) [585 bp, 194 aa] {ON}
           conserved hypothetical protein
          Length = 194

 Score = 47.0 bits (110), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 37/134 (27%), Positives = 68/134 (50%), Gaps = 13/134 (9%)

Query: 1   MVSEKKSAEVSGKNLWINVWNGVSSLLDFFAVLENLGVVDD------KLYVSGVLRKVWL 54
           +++ + +   S ++L I+    VSS  D   +L + G++ D      KL    +  KVWL
Sbjct: 22  LIANEDAPSNSLEDLLIDSLTSVSSFFDDLYLLRSFGIISDTNFLYQKLNKGDIGSKVWL 81

Query: 55  CYSWISVIKCVWKLINLCKVKFKIDQR-LN-----GPG-NGLVKEKLMNFKKRYRDQIRQ 107
               +S+ + + +L  L ++K K+ +  +N      PG   LVKEK++    +   +IR 
Sbjct: 82  VSLLLSIRRSLTRLYTLIRLKLKLRKECMNIASTYSPGFKKLVKEKILAESNQLSLKIRS 141

Query: 108 ITATLLQDLSYLMV 121
           +   LLQDL Y+++
Sbjct: 142 LCMDLLQDLLYMII 155

>KAFR0D00190 Chr4 complement(21149..21706) [558 bp, 185 aa] {ON}
           Anc_1.10 YCL056C
          Length = 185

 Score = 41.2 bits (95), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 44/170 (25%), Positives = 78/170 (45%), Gaps = 30/170 (17%)

Query: 4   EKKSAEVSGKNLWINVWNGVSSLLDFFAVLENLGVVDD------KLYVSGVLRKVWLCYS 57
           E     ++ +++ I+   G+ ++ D    L+NLGV+ +      KL    +  K+WL   
Sbjct: 11  EFHRKSITLEDILIDKLEGICTVFDNIYFLKNLGVIKEDNFIYKKLNKGNLGSKIWLVSL 70

Query: 58  WISVIKCVWKLINLCKVKFKIDQRL------------NGPGNGLVKEKLMNFKKRYRDQI 105
            +S+ +C   L ++ + + K    L            NG  NG++K+KL+   ++    I
Sbjct: 71  ILSIRRCFKNLTHMYRTRRKYVTELSIVSKKRNQSSENGLVNGILKDKLLQSLQKCNSII 130

Query: 106 RQITATLLQDLSYLMVLIYP------------GTRLFKRLSNIITLCRII 143
           R +    LQ L YL+++I              G R  + LSN+IT+ RII
Sbjct: 131 RDLLLEFLQVLLYLIIVIIEVFKVKSLERYVKGIRNLEILSNLITVTRII 180

>TDEL0C06930 Chr3 (1260938..1261492) [555 bp, 184 aa] {ON} Anc_1.10
           YCL056C
          Length = 184

 Score = 36.2 bits (82), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 34/149 (22%), Positives = 71/149 (47%), Gaps = 25/149 (16%)

Query: 18  NVWNGVSSLLDFFA---VLENLGVVDD------KLYVSGVLRKVWLCYSWISVIKCVWKL 68
           N+  G+ S+  FF      ++LG++ +      +L   G   K+W     +SV KC+ ++
Sbjct: 25  NLIAGLESVCSFFDNVYFAKSLGIIGENNFLYRRLNKGGWGSKLWFVTLLLSVRKCLRQI 84

Query: 69  INLCKVKFKIDQRL-----NGPG--NGLVKEKLMNFKKRYRDQIRQITATLLQDLSYLMV 121
             + + + ++   +     NG G  N ++KEK++   ++    +R+    LLQ+  YLM+
Sbjct: 85  FQIVRNRIRLKTEIKGMDKNGKGLMNDVLKEKILLMLQKSNAMMRETLLDLLQNSVYLMI 144

Query: 122 LIYP---------GTRLFKRLSNIITLCR 141
           ++             ++ + LSN +T+ R
Sbjct: 145 VVIDVFKLNIPKRARQILEPLSNFVTIMR 173

>KLTH0F00572g Chr6 complement(42946..43533) [588 bp, 195 aa] {ON}
           conserved hypothetical protein
          Length = 195

 Score = 32.7 bits (73), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 43/162 (26%), Positives = 75/162 (46%), Gaps = 29/162 (17%)

Query: 9   EVSGKNLWINVWNG---VSSLLDFFAVLENLGVVDD------KLYVSGVLRKVWLCYSWI 59
           E  GKN+   + +G   ++ + D   +L + GV+ +      KL  SG   K WL    +
Sbjct: 27  EGQGKNIESALVSGLETIAGIFDDLQLLRSFGVIGENNVFYQKLNKSGFCSKAWLVSLTL 86

Query: 60  SVIKCVWKLINLC--KVKFKIDQR--LNGPGNGLVKEKLMNFKKRYR-DQIRQ----ITA 110
           S  +    +INL   + + K +Q   +  P N +   K++N K   R  +I Q    +  
Sbjct: 87  SSRRNASDIINLAISRSRLKREQAEFMRRPVNPV--RKVLNAKVTARIQEINQKLILVAL 144

Query: 111 TLLQDLSYLM-----VLIYPGT----RLFKRLSNIITLCRII 143
            L+Q++ YL      VL +  T    RL +R+S+I  + R++
Sbjct: 145 ELIQNIGYLTLVAADVLAFGLTEKWKRLLERVSSIFAIARLL 186

>SAKL0C00572g Chr3 complement(51031..52047) [1017 bp, 338 aa] {ON}
           conserved hypothetical protein
          Length = 338

 Score = 32.7 bits (73), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 27/130 (20%), Positives = 62/130 (47%), Gaps = 13/130 (10%)

Query: 6   KSAEVSGKNLWINVWNGVSSLLDFFAVLENLGVVDDKLYV------SGVLRKVWLCYSWI 59
           K    S +++ I     ++++ D   +L+N G++ +  +V       G+  K+WL    +
Sbjct: 170 KQQPASFEDILIGGLESLTNVFDDVYLLKNFGIIGETNFVYRHLNKGGLGSKLWLATLVL 229

Query: 60  SVIKCVWKLINLCKVKFKID-QRLNGPGN------GLVKEKLMNFKKRYRDQIRQITATL 112
           S+ K + +L  L + +  +  +R + P         ++ +K      +   QI+ +   +
Sbjct: 230 SLRKSLGQLFRLARARHMLQKERRSTPHKCSKTFAKIIADKFTQKIGQLDRQIKDVLLDV 289

Query: 113 LQDLSYLMVL 122
           LQ+L+YL+V+
Sbjct: 290 LQNLAYLLVV 299

>KNAG0C00270 Chr3 complement(41823..42347) [525 bp, 174 aa] {ON}
           Anc_1.10 YCL056C
          Length = 174

 Score = 31.6 bits (70), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 41/166 (24%), Positives = 77/166 (46%), Gaps = 26/166 (15%)

Query: 5   KKSAEVSGKNLWINVWNGVSSLLDFFAVLENLGVVDD------KLYVSGVLRKVWLCYSW 58
           K +A +S +++ +     + S+ D   +L++LG++        KL    V  KVW     
Sbjct: 2   KTAASLSWEDVLLGKLESICSIFDNIYLLKSLGIISKENFLYRKLNKGNVGSKVWFLTLI 61

Query: 59  ISVIKCVWKLINLCKVKFK----IDQRL------NGPGNGLVKEKLMNFKKRYRDQIRQI 108
           +S+ K + +L+ L + +FK    I+Q L      +   N +V  KL    ++    I   
Sbjct: 62  LSIRKNLKRLVRLVQTRFKLVFEIEQILRQKKLDDSLVNNVVLNKLSTNLRKCHFMIIDT 121

Query: 109 TATLLQDLSYLMVL------IYPGTRLFKR----LSNIITLCRIII 144
              L Q L YL ++      I P  + FK+    +SN++T+ R+++
Sbjct: 122 FLDLAQLLIYLFIVSGDCFNIPPRFKKFKKYLGPMSNVVTILRMLV 167

>Kwal_33.13023 s33 complement(43697..44278) [582 bp, 193 aa] {ON}
          [contig 123] FULL
          Length = 193

 Score = 31.6 bits (70), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 21/65 (32%), Positives = 32/65 (49%), Gaps = 6/65 (9%)

Query: 13 KNLWINVWNGVSSLLDFFAVLENLGVVDDKLYV------SGVLRKVWLCYSWISVIKCVW 66
          +N  I+    V+ L D   +L++ G++ +  YV      SG   KVWL    +S  KC+ 
Sbjct: 34 ENFCISGMESVAGLFDDIHLLKSFGIISESNYVYRKLNKSGFCSKVWLLSLVLSTRKCIR 93

Query: 67 KLINL 71
           L NL
Sbjct: 94 DLNNL 98

>NCAS0B09060 Chr2 (1741161..1741664) [504 bp, 167 aa] {ON} Anc_1.10
           YCL056C
          Length = 167

 Score = 30.4 bits (67), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 40/155 (25%), Positives = 67/155 (43%), Gaps = 28/155 (18%)

Query: 18  NVWNGVSSLLDFFA---VLENLGVVDDKLYVSGVLRK------VWLCYSWISVIKCVWKL 68
           NV N + S+ + F      +++GV+ +K  +   L K      +W     +S  K + +L
Sbjct: 7   NVLNALESICNIFDNVYFFKSIGVLSEKNILYRTLNKGDFGSKLWFLTLLLSSKKLITRL 66

Query: 69  INLCKVKFKIDQRLNGPG----------NGLVKEKLMNFKKRYRDQIRQITATLLQDLSY 118
               K++ KI + ++             N L++EKL     +  D IR     LLQ + Y
Sbjct: 67  TKSLKIRAKIKKEIDESPKENDEDKSLVNSLLREKLELSLAKCMDIIRNNVLELLQTMMY 126

Query: 119 LMVLI-------YPG--TRLFKRLSNIITLCRIII 144
           L +          P     L ++LSNIIT+ R+ I
Sbjct: 127 LSIAFINVFKVKVPQKWKHLLEQLSNIITIIRVFI 161

>AAL027W Chr1 (295617..297395) [1779 bp, 592 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YNL012W (SPO1)
          Length = 592

 Score = 30.0 bits (66), Expect = 1.9,   Method: Composition-based stats.
 Identities = 20/63 (31%), Positives = 32/63 (50%), Gaps = 1/63 (1%)

Query: 50  RKVWLCYSWISVIKC-VWKLINLCKVKFKIDQRLNGPGNGLVKEKLMNFKKRYRDQIRQI 108
           R ++ C S+I+ I    W L+ L    F I++      N  + E + NF+ + RD I+Q 
Sbjct: 14  RGLFNCASYIASISGGSWTLMRLLLTNFNIEELKEWNINSSLLEGVPNFEIKNRDIIQQF 73

Query: 109 TAT 111
            AT
Sbjct: 74  EAT 76

>KLLA0F12232g Chr6 (1129199..1129312,1129532..1131337) [1920 bp, 639
           aa] {ON} similar to uniprot|P53541 Saccharomyces
           cerevisiae YNL012W
          Length = 639

 Score = 29.3 bits (64), Expect = 3.7,   Method: Composition-based stats.
 Identities = 17/57 (29%), Positives = 27/57 (47%), Gaps = 1/57 (1%)

Query: 52  VWLCYSWISVIKC-VWKLINLCKVKFKIDQRLNGPGNGLVKEKLMNFKKRYRDQIRQ 107
           +W C S+++ I    W L+ L   +F +D         L+ E + NF  +  D IRQ
Sbjct: 69  LWECTSYVAGISGGSWTLLKLVLAEFNVDTLTKFDIERLMLEGIPNFDVKNHDMIRQ 125

>KAFR0C01410 Chr3 (288872..290191) [1320 bp, 439 aa] {ON} Anc_3.97
           YOL097C
          Length = 439

 Score = 28.9 bits (63), Expect = 5.2,   Method: Composition-based stats.
 Identities = 16/61 (26%), Positives = 31/61 (50%)

Query: 54  LCYSWISVIKCVWKLINLCKVKFKIDQRLNGPGNGLVKEKLMNFKKRYRDQIRQITATLL 113
           + Y +++  K   + +  C  K+K  + L+G    L  E L  F K ++D+ +Q+   LL
Sbjct: 348 VAYQYLAFFKDDDEFLKECYDKYKSGELLSGEMKKLCIEVLQEFVKAFQDRRKQVDEELL 407

Query: 114 Q 114
           +
Sbjct: 408 E 408

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.326    0.142    0.439 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 15,174,772
Number of extensions: 601257
Number of successful extensions: 2145
Number of sequences better than 10.0: 29
Number of HSP's gapped: 2138
Number of HSP's successfully gapped: 29
Length of query: 144
Length of database: 53,481,399
Length adjustment: 99
Effective length of query: 45
Effective length of database: 42,129,465
Effective search space: 1895825925
Effective search space used: 1895825925
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 60 (27.7 bits)