Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Smik_3.181.9ON71271238000.0
YCL057W (PRD1)1.9ON71271235170.0
Suva_3.1561.9ON71271234960.0
Skud_3.71.9ON71271234150.0
NCAS0B090701.9ON73071424370.0
TPHA0E039701.9ON74770524210.0
Kpol_2002.121.9ON73970924180.0
KNAG0C002601.9ON74467823880.0
ZYRO0F18392g1.9ON72568923850.0
SAKL0C00550g1.9ON73269523530.0
TBLA0A075601.9ON74168123450.0
KAFR0D001801.9ON72370323430.0
NDAI0A001801.9ON74068823120.0
KLLA0C00572g1.9ON71270922950.0
CAGL0B00418g1.9ON74367921870.0
Ecym_1011na 1ON71669320680.0
AGR406C1.9ON68368117930.0
AGR405Cna 1ON71768117400.0
ABR185WsingletonON4574149571e-122
KAFR0D029502.432ON7776725079e-54
NDAI0E020102.432ON7786474991e-52
ZYRO0G20130g2.432ON7867074938e-52
SAKL0E03938g2.432ON7676924883e-51
Skud_11.932.432ON7726784804e-50
TBLA0I007102.432ON7736734761e-49
Smik_11.1022.432ON7726354742e-49
Suva_11.912.432ON7756784724e-49
CAGL0D02112g2.432ON7616744672e-48
NCAS0A042802.432ON7736834663e-48
YKL134C (OCT1)2.432ON7726714627e-48
TDEL0A020802.432ON7875534611e-47
Ecym_60992.432ON7735534611e-47
AFR198W2.432ON7766254566e-47
KLTH0D04730g2.432ON7726584531e-46
Kwal_26.76162.432ON7705514521e-46
Kpol_297.82.432ON7876634495e-46
KNAG0A062002.432ON7896764487e-46
TPHA0G023902.432ON7956014292e-43
KLLA0B12397g2.432ON7796813841e-37
Kwal_23.43705.59ON69280790.79
ZYRO0C15884g3.339ON1422246733.9
Kpol_1048.598.544ON850182734.0
KNAG0A068502.513ON448163715.3
Ecym_26653.286ON179112695.3
KLTH0B08580g5.59ON63480725.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Smik_3.18
         (712 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Smik_3.18 Chr3 (26213..28351) [2139 bp, 712 aa] {ON} YCL057W (REAL)  1468   0.0  
YCL057W Chr3 (24768..26906) [2139 bp, 712 aa] {ON}  PRD1Zinc met...  1359   0.0  
Suva_3.156 Chr3 (234520..236658) [2139 bp, 712 aa] {ON} YCL057W ...  1351   0.0  
Skud_3.7 Chr3 (12763..14901) [2139 bp, 712 aa] {ON} YCL057W (REAL)   1320   0.0  
NCAS0B09070 Chr2 complement(1741718..1743910) [2193 bp, 730 aa] ...   943   0.0  
TPHA0E03970 Chr5 complement(834023..836266) [2244 bp, 747 aa] {O...   937   0.0  
Kpol_2002.12 s2002 (21544..23763) [2220 bp, 739 aa] {ON} (21544....   936   0.0  
KNAG0C00260 Chr3 (39428..41662) [2235 bp, 744 aa] {ON} Anc_1.9 Y...   924   0.0  
ZYRO0F18392g Chr6 complement(1518902..1521079) [2178 bp, 725 aa]...   923   0.0  
SAKL0C00550g Chr3 (48410..50608) [2199 bp, 732 aa] {ON} highly s...   910   0.0  
TBLA0A07560 Chr1 complement(1871629..1873854) [2226 bp, 741 aa] ...   907   0.0  
KAFR0D00180 Chr4 (18900..21071) [2172 bp, 723 aa] {ON} Anc_1.9 Y...   907   0.0  
NDAI0A00180 Chr1 (14692..16914) [2223 bp, 740 aa] {ON} Anc_1.9        895   0.0  
KLLA0C00572g Chr3 (42069..44207) [2139 bp, 712 aa] {ON} similar ...   888   0.0  
CAGL0B00418g Chr2 (26584..28815) [2232 bp, 743 aa] {ON} similar ...   847   0.0  
Ecym_1011 Chr1 (19924..22074) [2151 bp, 716 aa] {ON} similar to ...   801   0.0  
AGR406C Chr7 complement(1472496..1474547) [2052 bp, 683 aa] {ON}...   695   0.0  
AGR405C Chr7 complement(1469769..1471922) [2154 bp, 717 aa] {ON}...   674   0.0  
ABR185W Chr2 (758126..758380,758380..758709,758709..759029,75903...   373   e-122
KAFR0D02950 Chr4 complement(581305..583638) [2334 bp, 777 aa] {O...   199   9e-54
NDAI0E02010 Chr5 complement(404579..406915) [2337 bp, 778 aa] {O...   196   1e-52
ZYRO0G20130g Chr7 (1666665..1669025) [2361 bp, 786 aa] {ON} simi...   194   8e-52
SAKL0E03938g Chr5 (317017..319320) [2304 bp, 767 aa] {ON} simila...   192   3e-51
Skud_11.93 Chr11 complement(175243..177561) [2319 bp, 772 aa] {O...   189   4e-50
TBLA0I00710 Chr9 (128272..130593) [2322 bp, 773 aa] {ON} Anc_2.4...   187   1e-49
Smik_11.102 Chr11 complement(175013..177331) [2319 bp, 772 aa] {...   187   2e-49
Suva_11.91 Chr11 complement(175327..177654) [2328 bp, 775 aa] {O...   186   4e-49
CAGL0D02112g Chr4 complement(216204..218489) [2286 bp, 761 aa] {...   184   2e-48
NCAS0A04280 Chr1 complement(864327..866648) [2322 bp, 773 aa] {O...   184   3e-48
YKL134C Chr11 complement(189124..191442) [2319 bp, 772 aa] {ON} ...   182   7e-48
TDEL0A02080 Chr1 complement(373425..375788) [2364 bp, 787 aa] {O...   182   1e-47
Ecym_6099 Chr6 complement(186647..188968) [2322 bp, 773 aa] {ON}...   182   1e-47
AFR198W Chr6 (797448..799778) [2331 bp, 776 aa] {ON} Syntenic ho...   180   6e-47
KLTH0D04730g Chr4 (432572..434890) [2319 bp, 772 aa] {ON} simila...   179   1e-46
Kwal_26.7616 s26 (444266..446578) [2313 bp, 770 aa] {ON} YKL134C...   178   1e-46
Kpol_297.8 s297 complement(11648..14011) [2364 bp, 787 aa] {ON} ...   177   5e-46
KNAG0A06200 Chr1 complement(937577..939946) [2370 bp, 789 aa] {O...   177   7e-46
TPHA0G02390 Chr7 complement(486025..488412) [2388 bp, 795 aa] {O...   169   2e-43
KLLA0B12397g Chr2 complement(1084129..1086468) [2340 bp, 779 aa]...   152   1e-37
Kwal_23.4370 s23 complement(689686..691764) [2079 bp, 692 aa] {O...    35   0.79 
ZYRO0C15884g Chr3 (1241605..1245873) [4269 bp, 1422 aa] {ON} sim...    33   3.9  
Kpol_1048.59 s1048 complement(166721..169273) [2553 bp, 850 aa] ...    33   4.0  
KNAG0A06850 Chr1 (1068342..1069688) [1347 bp, 448 aa] {ON} Anc_2...    32   5.3  
Ecym_2665 Chr2 complement(1283498..1284037) [540 bp, 179 aa] {ON...    31   5.3  
KLTH0B08580g Chr2 (697066..698970) [1905 bp, 634 aa] {ON} simila...    32   5.4  

>Smik_3.18 Chr3 (26213..28351) [2139 bp, 712 aa] {ON} YCL057W (REAL)
          Length = 712

 Score = 1468 bits (3800), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 712/712 (100%), Positives = 712/712 (100%)

Query: 1   MRLLLCKNWFTSPIISPLLYTRSLYSMSNATSFPIAPQAPPNWTFTPNDINGKTKEIIDK 60
           MRLLLCKNWFTSPIISPLLYTRSLYSMSNATSFPIAPQAPPNWTFTPNDINGKTKEIIDK
Sbjct: 1   MRLLLCKNWFTSPIISPLLYTRSLYSMSNATSFPIAPQAPPNWTFTPNDINGKTKEIIDK 60

Query: 61  SNNFYESMSNVETPTVTNFVEPFMKFENELGPIINQLTFLQHVSSDKEIRDASVNSSMKL 120
           SNNFYESMSNVETPTVTNFVEPFMKFENELGPIINQLTFLQHVSSDKEIRDASVNSSMKL
Sbjct: 61  SNNFYESMSNVETPTVTNFVEPFMKFENELGPIINQLTFLQHVSSDKEIRDASVNSSMKL 120

Query: 121 DELNIDLSLRHDIYLQFARVWQDAQSKSDSIERETFKYIEKSYKDYIHSGLELDESNRLK 180
           DELNIDLSLRHDIYLQFARVWQDAQSKSDSIERETFKYIEKSYKDYIHSGLELDESNRLK
Sbjct: 121 DELNIDLSLRHDIYLQFARVWQDAQSKSDSIERETFKYIEKSYKDYIHSGLELDESNRLK 180

Query: 181 IKDIKKKISVNSINFSKNLGEQKEYITFTKEQLEGVPDSVLAQFETIKSDKDRNETLYKV 240
           IKDIKKKISVNSINFSKNLGEQKEYITFTKEQLEGVPDSVLAQFETIKSDKDRNETLYKV
Sbjct: 181 IKDIKKKISVNSINFSKNLGEQKEYITFTKEQLEGVPDSVLAQFETIKSDKDRNETLYKV 240

Query: 241 TFKYPDIFPVMKLASSAQTRKEAFLADQNKVPENEAILLDTLELRDKLASLLGYDTYANY 300
           TFKYPDIFPVMKLASSAQTRKEAFLADQNKVPENEAILLDTLELRDKLASLLGYDTYANY
Sbjct: 241 TFKYPDIFPVMKLASSAQTRKEAFLADQNKVPENEAILLDTLELRDKLASLLGYDTYANY 300

Query: 301 NLYDKMAKDSTTVMDFLNDLKDKLIPLGKKELELLQEMKSKDVKKLNQDEDPNYYIWDHR 360
           NLYDKMAKDSTTVMDFLNDLKDKLIPLGKKELELLQEMKSKDVKKLNQDEDPNYYIWDHR
Sbjct: 301 NLYDKMAKDSTTVMDFLNDLKDKLIPLGKKELELLQEMKSKDVKKLNQDEDPNYYIWDHR 360

Query: 361 YYDNKYLLENFNVDLEKISEYFPLETTITGMLQIYETLFNLKFIEIKDGQSKSVWHDDVK 420
           YYDNKYLLENFNVDLEKISEYFPLETTITGMLQIYETLFNLKFIEIKDGQSKSVWHDDVK
Sbjct: 361 YYDNKYLLENFNVDLEKISEYFPLETTITGMLQIYETLFNLKFIEIKDGQSKSVWHDDVK 420

Query: 421 QLAVWNMDDPKSPKFVGWIYFDLHPRDGKYGHAANFGLSSSFMTNDSVRSYPVTALVCNF 480
           QLAVWNMDDPKSPKFVGWIYFDLHPRDGKYGHAANFGLSSSFMTNDSVRSYPVTALVCNF
Sbjct: 421 QLAVWNMDDPKSPKFVGWIYFDLHPRDGKYGHAANFGLSSSFMTNDSVRSYPVTALVCNF 480

Query: 481 SKSTKDKPSLLKHNEIVTFFHELGHGIHDLVGQNKESRFNGPGSVPWDFVEAPSQMLEFW 540
           SKSTKDKPSLLKHNEIVTFFHELGHGIHDLVGQNKESRFNGPGSVPWDFVEAPSQMLEFW
Sbjct: 481 SKSTKDKPSLLKHNEIVTFFHELGHGIHDLVGQNKESRFNGPGSVPWDFVEAPSQMLEFW 540

Query: 541 TWNKNELIDLSSHYETGEKIPESLIDSLIKTKHVNGALFTLRQLHFGLFDMKVHTCKDLQ 600
           TWNKNELIDLSSHYETGEKIPESLIDSLIKTKHVNGALFTLRQLHFGLFDMKVHTCKDLQ
Sbjct: 541 TWNKNELIDLSSHYETGEKIPESLIDSLIKTKHVNGALFTLRQLHFGLFDMKVHTCKDLQ 600

Query: 601 NLSICETWNQLRQDISLISNGGTLSKGYDSFGHIMSDSYSAGYYGYLWAEVFATDMYHTK 660
           NLSICETWNQLRQDISLISNGGTLSKGYDSFGHIMSDSYSAGYYGYLWAEVFATDMYHTK
Sbjct: 601 NLSICETWNQLRQDISLISNGGTLSKGYDSFGHIMSDSYSAGYYGYLWAEVFATDMYHTK 660

Query: 661 FAKDPLNTKNGIQYRDIVLARGGLNDIGDDLKKFLGREPSKDAFLKELGLQN 712
           FAKDPLNTKNGIQYRDIVLARGGLNDIGDDLKKFLGREPSKDAFLKELGLQN
Sbjct: 661 FAKDPLNTKNGIQYRDIVLARGGLNDIGDDLKKFLGREPSKDAFLKELGLQN 712

>YCL057W Chr3 (24768..26906) [2139 bp, 712 aa] {ON}  PRD1Zinc
           metalloendopeptidase, found in the cytoplasm and
           intermembrane space of mitochondria; with Cym1p,
           involved in degradation of mitochondrial proteins and of
           presequence peptides cleaved from imported proteins
          Length = 712

 Score = 1359 bits (3517), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 654/712 (91%), Positives = 692/712 (97%)

Query: 1   MRLLLCKNWFTSPIISPLLYTRSLYSMSNATSFPIAPQAPPNWTFTPNDINGKTKEIIDK 60
           MRLLLCKNWF SP+ISPLLYTRSLYSM+N TSFPIAPQAPPNW+FTP+DI+GKT EII+ 
Sbjct: 1   MRLLLCKNWFASPVISPLLYTRSLYSMANTTSFPIAPQAPPNWSFTPSDISGKTNEIINN 60

Query: 61  SNNFYESMSNVETPTVTNFVEPFMKFENELGPIINQLTFLQHVSSDKEIRDASVNSSMKL 120
           SNNFY+SMS VE+P+V+NFVEPFMKFENELGPIINQLTFLQHVSSDKEIRDASVNSSMKL
Sbjct: 61  SNNFYDSMSKVESPSVSNFVEPFMKFENELGPIINQLTFLQHVSSDKEIRDASVNSSMKL 120

Query: 121 DELNIDLSLRHDIYLQFARVWQDAQSKSDSIERETFKYIEKSYKDYIHSGLELDESNRLK 180
           DELNIDLSLRHDI+LQFARVWQD QSK+DS+ERETFKY+EKSYKDYIHSGLELDE NRLK
Sbjct: 121 DELNIDLSLRHDIFLQFARVWQDVQSKADSVERETFKYVEKSYKDYIHSGLELDEGNRLK 180

Query: 181 IKDIKKKISVNSINFSKNLGEQKEYITFTKEQLEGVPDSVLAQFETIKSDKDRNETLYKV 240
           IK+IKKKISVNSINFSKNLGEQKEYITFTKEQLEGVPDS+L QFETIKSDKD NETLYKV
Sbjct: 181 IKEIKKKISVNSINFSKNLGEQKEYITFTKEQLEGVPDSILTQFETIKSDKDSNETLYKV 240

Query: 241 TFKYPDIFPVMKLASSAQTRKEAFLADQNKVPENEAILLDTLELRDKLASLLGYDTYANY 300
           TFKYPDIFPVMKLASSAQTRK+AFLADQNKVPENEAILLDTL+LRD+LASLLGYDTYANY
Sbjct: 241 TFKYPDIFPVMKLASSAQTRKQAFLADQNKVPENEAILLDTLKLRDELASLLGYDTYANY 300

Query: 301 NLYDKMAKDSTTVMDFLNDLKDKLIPLGKKELELLQEMKSKDVKKLNQDEDPNYYIWDHR 360
           NLYDKMA+DSTTVM+FLNDLKDKLIPLG+KEL++LQ+MK++DVKKLNQ  DPNYYIWDHR
Sbjct: 301 NLYDKMAEDSTTVMNFLNDLKDKLIPLGRKELQVLQDMKAEDVKKLNQGADPNYYIWDHR 360

Query: 361 YYDNKYLLENFNVDLEKISEYFPLETTITGMLQIYETLFNLKFIEIKDGQSKSVWHDDVK 420
           YYDNKYLLENFNVDLEKISEYFPLE TITGML+IYETLFNLKFIE KD Q+KSVWHDDVK
Sbjct: 361 YYDNKYLLENFNVDLEKISEYFPLEATITGMLEIYETLFNLKFIETKDSQNKSVWHDDVK 420

Query: 421 QLAVWNMDDPKSPKFVGWIYFDLHPRDGKYGHAANFGLSSSFMTNDSVRSYPVTALVCNF 480
           Q+AVWNMDDPKSP FVGWIYFDLHPRDGKYGHAANFGLSSSFM +D+ RSYPVTALVCNF
Sbjct: 421 QIAVWNMDDPKSPNFVGWIYFDLHPRDGKYGHAANFGLSSSFMIDDTTRSYPVTALVCNF 480

Query: 481 SKSTKDKPSLLKHNEIVTFFHELGHGIHDLVGQNKESRFNGPGSVPWDFVEAPSQMLEFW 540
           SKSTKDKPSLLKHNEIVTFFHELGHGIHDLVGQNKESRFNGPGSVPWDFVEAPSQMLEFW
Sbjct: 481 SKSTKDKPSLLKHNEIVTFFHELGHGIHDLVGQNKESRFNGPGSVPWDFVEAPSQMLEFW 540

Query: 541 TWNKNELIDLSSHYETGEKIPESLIDSLIKTKHVNGALFTLRQLHFGLFDMKVHTCKDLQ 600
           TWNKNELI+LSSHY+TGEKIPESLI+SLIKTKHVNGALFTLRQLHFGLFDMKVHTCKDLQ
Sbjct: 541 TWNKNELINLSSHYKTGEKIPESLINSLIKTKHVNGALFTLRQLHFGLFDMKVHTCKDLQ 600

Query: 601 NLSICETWNQLRQDISLISNGGTLSKGYDSFGHIMSDSYSAGYYGYLWAEVFATDMYHTK 660
           NLSIC+TWNQLRQDISLISNGGTLSKGYDSFGHIMSDSYSAGYYGYLWAEVFATDMYHTK
Sbjct: 601 NLSICDTWNQLRQDISLISNGGTLSKGYDSFGHIMSDSYSAGYYGYLWAEVFATDMYHTK 660

Query: 661 FAKDPLNTKNGIQYRDIVLARGGLNDIGDDLKKFLGREPSKDAFLKELGLQN 712
           FAKDPLN KNGIQYRDIVLARGGL DI D+LK+FLGREPSKDAFLKELGLQN
Sbjct: 661 FAKDPLNAKNGIQYRDIVLARGGLYDINDNLKEFLGREPSKDAFLKELGLQN 712

>Suva_3.156 Chr3 (234520..236658) [2139 bp, 712 aa] {ON} YCL057W
           (REAL)
          Length = 712

 Score = 1351 bits (3496), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 640/712 (89%), Positives = 684/712 (96%)

Query: 1   MRLLLCKNWFTSPIISPLLYTRSLYSMSNATSFPIAPQAPPNWTFTPNDINGKTKEIIDK 60
           MRLLLCKNWF SP+I+PLLYTR L SM+   SFP APQ PP+W+FTPNDI+G+TKEII+K
Sbjct: 1   MRLLLCKNWFASPVITPLLYTRFLSSMTTTASFPTAPQTPPSWSFTPNDISGRTKEIIEK 60

Query: 61  SNNFYESMSNVETPTVTNFVEPFMKFENELGPIINQLTFLQHVSSDKEIRDASVNSSMKL 120
           SN FY+SMS VE+P VTNFVEPFMKFENELGPIINQLTFLQHVSSDKEIRDASV+SSMKL
Sbjct: 61  SNKFYDSMSQVESPAVTNFVEPFMKFENELGPIINQLTFLQHVSSDKEIRDASVDSSMKL 120

Query: 121 DELNIDLSLRHDIYLQFARVWQDAQSKSDSIERETFKYIEKSYKDYIHSGLELDESNRLK 180
           DELNIDLSLRHD++LQFARVWQDAQS++DSIERETF+YIEKSYKDYIHSGLELDE +RLK
Sbjct: 121 DELNIDLSLRHDVFLQFARVWQDAQSQADSIERETFRYIEKSYKDYIHSGLELDEPDRLK 180

Query: 181 IKDIKKKISVNSINFSKNLGEQKEYITFTKEQLEGVPDSVLAQFETIKSDKDRNETLYKV 240
           +K+IKKKISVNSINFSKNLGEQKE+ITFTKEQLEGVPDS+LAQFETI+S KD NETLYKV
Sbjct: 181 VKEIKKKISVNSINFSKNLGEQKEFITFTKEQLEGVPDSILAQFETIESGKDSNETLYKV 240

Query: 241 TFKYPDIFPVMKLASSAQTRKEAFLADQNKVPENEAILLDTLELRDKLASLLGYDTYANY 300
           TFKYPDIFPVMKLASS+QTRK+AFLADQNKV ENEAILLDTL+LRD++ASLLGYDTYANY
Sbjct: 241 TFKYPDIFPVMKLASSSQTRKQAFLADQNKVSENEAILLDTLKLRDEVASLLGYDTYANY 300

Query: 301 NLYDKMAKDSTTVMDFLNDLKDKLIPLGKKELELLQEMKSKDVKKLNQDEDPNYYIWDHR 360
           NLYDKMAKDSTTVMDFLNDLK KLIPLG+KEL++LQ+MK+KDVKK NQDEDPNYYIWDHR
Sbjct: 301 NLYDKMAKDSTTVMDFLNDLKKKLIPLGEKELQILQDMKAKDVKKRNQDEDPNYYIWDHR 360

Query: 361 YYDNKYLLENFNVDLEKISEYFPLETTITGMLQIYETLFNLKFIEIKDGQSKSVWHDDVK 420
           YYDNKYLLENFNVDLEKISE+FPLETTITGMLQIYETLFNLKFIE K+ Q KSVWH+DVK
Sbjct: 361 YYDNKYLLENFNVDLEKISEFFPLETTITGMLQIYETLFNLKFIETKNPQEKSVWHEDVK 420

Query: 421 QLAVWNMDDPKSPKFVGWIYFDLHPRDGKYGHAANFGLSSSFMTNDSVRSYPVTALVCNF 480
           QLAVWNMDDPKSP+F+GWIYFDLHPRDGKYGHAANFGLSSSFM ND+ RSYPVTALVCNF
Sbjct: 421 QLAVWNMDDPKSPRFIGWIYFDLHPRDGKYGHAANFGLSSSFMVNDTTRSYPVTALVCNF 480

Query: 481 SKSTKDKPSLLKHNEIVTFFHELGHGIHDLVGQNKESRFNGPGSVPWDFVEAPSQMLEFW 540
           SKSTKDKPSLLKHNEIVTFFHELGHGIHDLVGQNKESRFNGPGSVPWDFVEAPSQMLEFW
Sbjct: 481 SKSTKDKPSLLKHNEIVTFFHELGHGIHDLVGQNKESRFNGPGSVPWDFVEAPSQMLEFW 540

Query: 541 TWNKNELIDLSSHYETGEKIPESLIDSLIKTKHVNGALFTLRQLHFGLFDMKVHTCKDLQ 600
           TWNKNEL+ LSSHY+TGEKIPE LIDSLIKTKHVNGALFTLRQLHFGLFDMKVH+CKDLQ
Sbjct: 541 TWNKNELMHLSSHYKTGEKIPEPLIDSLIKTKHVNGALFTLRQLHFGLFDMKVHSCKDLQ 600

Query: 601 NLSICETWNQLRQDISLISNGGTLSKGYDSFGHIMSDSYSAGYYGYLWAEVFATDMYHTK 660
           NLSIC+TWNQLRQDISL+SNGGTLSKGY SFGHIMSDSYSAGYYGYLWAEVFATDMYHTK
Sbjct: 601 NLSICDTWNQLRQDISLMSNGGTLSKGYASFGHIMSDSYSAGYYGYLWAEVFATDMYHTK 660

Query: 661 FAKDPLNTKNGIQYRDIVLARGGLNDIGDDLKKFLGREPSKDAFLKELGLQN 712
           FAKDPLNTKNGIQYRDIVLARGGL DI D LK+FLGREPSKDAFLKELGLQN
Sbjct: 661 FAKDPLNTKNGIQYRDIVLARGGLRDINDSLKEFLGREPSKDAFLKELGLQN 712

>Skud_3.7 Chr3 (12763..14901) [2139 bp, 712 aa] {ON} YCL057W (REAL)
          Length = 712

 Score = 1320 bits (3415), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 635/712 (89%), Positives = 683/712 (95%)

Query: 1   MRLLLCKNWFTSPIISPLLYTRSLYSMSNATSFPIAPQAPPNWTFTPNDINGKTKEIIDK 60
           MRLLLCKNWFTSP+ISPLLYTR L +M+NA SFPIAPQAPP W+FTP DI GKT EIIDK
Sbjct: 1   MRLLLCKNWFTSPVISPLLYTRCLSAMTNAASFPIAPQAPPTWSFTPTDIGGKTTEIIDK 60

Query: 61  SNNFYESMSNVETPTVTNFVEPFMKFENELGPIINQLTFLQHVSSDKEIRDASVNSSMKL 120
           SN FYE MS VE+P+VTNF+EPFMKFENELGPIIN+LTFLQHVSSDKEIRDASV+SSMKL
Sbjct: 61  SNKFYELMSQVESPSVTNFIEPFMKFENELGPIINRLTFLQHVSSDKEIRDASVDSSMKL 120

Query: 121 DELNIDLSLRHDIYLQFARVWQDAQSKSDSIERETFKYIEKSYKDYIHSGLELDESNRLK 180
           DELNIDLSLRHDI+LQFARVWQDAQ K+DS+++ETFKYIEKSYKD+IHSGLELDE+NRLK
Sbjct: 121 DELNIDLSLRHDIFLQFARVWQDAQPKADSLKKETFKYIEKSYKDFIHSGLELDEANRLK 180

Query: 181 IKDIKKKISVNSINFSKNLGEQKEYITFTKEQLEGVPDSVLAQFETIKSDKDRNETLYKV 240
           IK+IKKKIS+NSINFSKNLGEQKEYITFTKEQLEGVPDS+LAQFET KS+K   +TLYKV
Sbjct: 181 IKEIKKKISMNSINFSKNLGEQKEYITFTKEQLEGVPDSILAQFETTKSEKGGEDTLYKV 240

Query: 241 TFKYPDIFPVMKLASSAQTRKEAFLADQNKVPENEAILLDTLELRDKLASLLGYDTYANY 300
           TFKYPDIFPVMKLASSAQTRK+AFLADQNKVPENEAILLDTL+LRD+LASLLGY+TYA+Y
Sbjct: 241 TFKYPDIFPVMKLASSAQTRKQAFLADQNKVPENEAILLDTLKLRDELASLLGYNTYADY 300

Query: 301 NLYDKMAKDSTTVMDFLNDLKDKLIPLGKKELELLQEMKSKDVKKLNQDEDPNYYIWDHR 360
           NLYDKMAKDS TVMDFLNDLK KLIPLGKKEL++LQ+MK KDV++  +DEDPNYYIWDHR
Sbjct: 301 NLYDKMAKDSRTVMDFLNDLKGKLIPLGKKELQVLQDMKVKDVERSKKDEDPNYYIWDHR 360

Query: 361 YYDNKYLLENFNVDLEKISEYFPLETTITGMLQIYETLFNLKFIEIKDGQSKSVWHDDVK 420
           YYDNK+LLENFNVDLEKISEYFPLETTITGMLQIYETLFNLKFIE K+ Q+KSVWH+DVK
Sbjct: 361 YYDNKHLLENFNVDLEKISEYFPLETTITGMLQIYETLFNLKFIETKEPQNKSVWHEDVK 420

Query: 421 QLAVWNMDDPKSPKFVGWIYFDLHPRDGKYGHAANFGLSSSFMTNDSVRSYPVTALVCNF 480
           QLAVWNMDDPKSP+F+GWIYFDLHPRDGKYGHAANFGLSSSFM NDS RSYPVTALVCNF
Sbjct: 421 QLAVWNMDDPKSPRFIGWIYFDLHPRDGKYGHAANFGLSSSFMINDSKRSYPVTALVCNF 480

Query: 481 SKSTKDKPSLLKHNEIVTFFHELGHGIHDLVGQNKESRFNGPGSVPWDFVEAPSQMLEFW 540
           SKSTKDKPSLLKHNEIVTFFHELGHGIHDLVGQNKESRFNGPGSVPWDFVEAPSQMLEFW
Sbjct: 481 SKSTKDKPSLLKHNEIVTFFHELGHGIHDLVGQNKESRFNGPGSVPWDFVEAPSQMLEFW 540

Query: 541 TWNKNELIDLSSHYETGEKIPESLIDSLIKTKHVNGALFTLRQLHFGLFDMKVHTCKDLQ 600
           TWNKNEL+ LSSHY+TGE+IPESLIDSLIKTKHVNGALFTLRQLHFGLFDMKVHTCKDL+
Sbjct: 541 TWNKNELVSLSSHYKTGERIPESLIDSLIKTKHVNGALFTLRQLHFGLFDMKVHTCKDLE 600

Query: 601 NLSICETWNQLRQDISLISNGGTLSKGYDSFGHIMSDSYSAGYYGYLWAEVFATDMYHTK 660
           NLSIC TWNQLRQ+ISL+ NGGTLSKGYDSFGHIMSDSYSAGYYGYLWAEVFATDMYHTK
Sbjct: 601 NLSICHTWNQLRQEISLMPNGGTLSKGYDSFGHIMSDSYSAGYYGYLWAEVFATDMYHTK 660

Query: 661 FAKDPLNTKNGIQYRDIVLARGGLNDIGDDLKKFLGREPSKDAFLKELGLQN 712
           FAKDPLNTKNG+QYRDIVLARGGL DI D+LK+FLGREPSKDAFLKELGLQ+
Sbjct: 661 FAKDPLNTKNGVQYRDIVLARGGLYDINDNLKEFLGREPSKDAFLKELGLQS 712

>NCAS0B09070 Chr2 complement(1741718..1743910) [2193 bp, 730 aa]
           {ON} Anc_1.9
          Length = 730

 Score =  943 bits (2437), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 452/714 (63%), Positives = 566/714 (79%), Gaps = 9/714 (1%)

Query: 7   KNWFTSPIISP---LLYTRSLYSMSNATS--FPIAPQA-PPNWTFTPNDINGKTKEIIDK 60
           K    S I+ P    + TR  + M+  T+    +AP    P W ++P  I  KTKE+ID 
Sbjct: 18  KKLLISAIVLPATAFILTRKSFYMTLPTNNKLLVAPTGTAPTWKWSPESILAKTKEVIDN 77

Query: 61  SNNFYESMSNVETPTVTNFVEPFMKFENELGPIINQLTFLQHVSSDKEIRDASVNSSMKL 120
           + N Y+S++ +E P+V + V+P+M +EN+ G I+NQLTFLQHVS+DK IRDASV ++  L
Sbjct: 78  ATNLYDSLAAIEEPSVESLVKPYMHYENDEGLIVNQLTFLQHVSADKLIRDASVEATELL 137

Query: 121 DELNIDLSLRHDIYLQFARVWQDAQSKSDSIER--ETFKYIEKSYKDYIHSGLELDESNR 178
            + +I+ S+R D++ QF ++W   +   D   +  ET+K+IEK +KDY+ +GL L E  R
Sbjct: 138 QDFSIEASMRLDLFQQFDKIWNQVKDDDDLKSKDFETYKFIEKVHKDYVRNGLNLPEEKR 197

Query: 179 LKIKDIKKKISVNSINFSKNLGEQKEYITFTKEQLEGVPDSVLAQFETIKSDKDRNETLY 238
            ++KDIKKKI+ NS+N+SKNLGEQKEY++FTKEQL+GV +SV+ QFE    D   NE  Y
Sbjct: 198 NQVKDIKKKIASNSLNYSKNLGEQKEYVSFTKEQLKGVSESVMEQFEKF-VDPKTNEEKY 256

Query: 239 KVTFKYPDIFPVMKLASSAQTRKEAFLADQNKVPENEAILLDTLELRDKLASLLGYDTYA 298
           KVTFKYPDIFPV+K A   +TRK A+++DQNKVP+NEA+ ++TL+LR++LA LLGY TYA
Sbjct: 257 KVTFKYPDIFPVLKTAQVPKTRKLAYISDQNKVPQNEALFVETLKLRNQLAQLLGYSTYA 316

Query: 299 NYNLYDKMAKDSTTVMDFLNDLKDKLIPLGKKELELLQEMKSKDVKKLNQDEDPNYYIWD 358
           NYNL  KMAK+  TV DF+N+LKDKL PLG+KE+E L+ +K KD ++L    D +YYIWD
Sbjct: 317 NYNLDIKMAKNQETVFDFVNNLKDKLKPLGQKEIETLKTLKKKDCEELGLAYDDHYYIWD 376

Query: 359 HRYYDNKYLLENFNVDLEKISEYFPLETTITGMLQIYETLFNLKFIEIKDGQSKSVWHDD 418
           HRYYDNK+L +N+NVDLE+ISEY+PLE+TI GML IYETL  LKF++  + + K VWH+D
Sbjct: 377 HRYYDNKFLKDNYNVDLEQISEYYPLESTIKGMLGIYETLLKLKFVDETNPKIKDVWHED 436

Query: 419 VKQLAVWNMDDPKSPKFVGWIYFDLHPRDGKYGHAANFGLSSSFMTNDSVRSYPVTALVC 478
           VKQLAVW MDD K+P+F+GWIYFDLHPRDGKY HAANFG+SSS++T D  RS+PVTALVC
Sbjct: 437 VKQLAVWKMDDEKNPEFIGWIYFDLHPRDGKYSHAANFGISSSYITQDGDRSFPVTALVC 496

Query: 479 NFSKSTKDKPSLLKHNEIVTFFHELGHGIHDLVGQNKESRFNGPGSVPWDFVEAPSQMLE 538
           NFSKST  KPSLLKHNEI TFFHELGHGIHDLVG+NK +RFNGPG+ PWDFVEAPSQMLE
Sbjct: 497 NFSKSTDKKPSLLKHNEITTFFHELGHGIHDLVGKNKCARFNGPGATPWDFVEAPSQMLE 556

Query: 539 FWTWNKNELIDLSSHYETGEKIPESLIDSLIKTKHVNGALFTLRQLHFGLFDMKVHTCKD 598
           FWTWNKNEL+ LS HY+TGEKI E L+DSLI TKHVNGALF LRQLHFGLFDM VHT K+
Sbjct: 557 FWTWNKNELLSLSGHYQTGEKISEDLLDSLIATKHVNGALFALRQLHFGLFDMTVHTTKN 616

Query: 599 LQNLSICETWNQLRQDISLISNGGTLSKGYDSFGHIMSDSYSAGYYGYLWAEVFATDMYH 658
           +++L++ + WN+LR+ I L+ NG  L+KGYDSFGHIMSDSYSAGYYGY+WAEVFA DMY+
Sbjct: 617 VEDLNLLKLWNELREKICLVENGNELTKGYDSFGHIMSDSYSAGYYGYMWAEVFAADMYY 676

Query: 659 TKFAKDPLNTKNGIQYRDIVLARGGLNDIGDDLKKFLGREPSKDAFLKELGLQN 712
           TKFA DPLN++ G+QYRDIVLA GGL +I D LK+FLGREP+ DAFLKELGL N
Sbjct: 677 TKFASDPLNSQAGVQYRDIVLANGGLYEIADKLKEFLGREPTNDAFLKELGLHN 730

>TPHA0E03970 Chr5 complement(834023..836266) [2244 bp, 747 aa] {ON}
           Anc_1.9 YCL057W
          Length = 747

 Score =  937 bits (2421), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 454/705 (64%), Positives = 552/705 (78%), Gaps = 15/705 (2%)

Query: 19  LYTRSLYSMSNATSFPIAPQAPPNWTFTPNDINGKTKEIIDKSNNFYESMSNVETPTVTN 78
            YT S   M+ A    IAPQ  P W F+P  I    K+IID SN+FY +M  +E P++ N
Sbjct: 46  FYTASQVKMNEAAF--IAPQLSPKWDFSPERILSDAKKIIDTSNDFYNAMVAIENPSIEN 103

Query: 79  FVEPFMKFENELGPIINQLTFLQHVSSDKEIRDASVNSSMKLDELNIDLSLRHDIYLQFA 138
           FV P + FENE    INQLTFLQHVS DK IRDAS+ ++  +   +I++SLR+D++ QF 
Sbjct: 104 FVIPSINFENENSLAINQLTFLQHVSKDKLIRDASLEATELITNFDIEISLRYDMFKQFD 163

Query: 139 RVWQDAQSK--------SDSIERETFKYIEKSYKDYIHSGLELDESNRLKIKDIKKKISV 190
           +++ D +          +   + E FKY+EK +KDY+ SGL L E  R +IK+IKK+I++
Sbjct: 164 KIFNDLKDNKKYNDLKTATPKDYEIFKYVEKCHKDYVRSGLNLSEEKRNEIKEIKKRIAL 223

Query: 191 NSINFSKNLGEQKEYITFTKEQLEGVPDSVLAQFETIKSDKDRNETLYKVTFKYPDIFPV 250
           NS+ FSKNLGEQ E++ FTKE+LEGV D V+ QFET  +D+   E  +KVTFKYPDIFPV
Sbjct: 224 NSLQFSKNLGEQNEFVAFTKEELEGVSDDVMKQFETY-TDEQTGEQKFKVTFKYPDIFPV 282

Query: 251 MKLASSAQTRKEAFLADQNKVPENEAILLDTLELRDKLASLLGYDTYANYNLYDKMAKDS 310
           +K A +  TRK AF ADQNKVPENE + +DTL+LR +L  +LGYDTYANYNL  KMAK+ 
Sbjct: 283 LKTAKNPNTRKIAFNADQNKVPENEKLFIDTLKLRYQLGKILGYDTYANYNLDIKMAKNQ 342

Query: 311 TTVMDFLNDLKDKLIPLGKKELELLQEMKSKDVKKLNQDEDPNYYIWDHRYYDNKYLLEN 370
            TVM+FL DLKDKL PL +KE+E+L+ +K  + ++LN   D +YYIWDHRYYDNKYL + 
Sbjct: 343 ETVMEFLVDLKDKLKPLAEKEIEVLKAIKKTEAQELNMAYDDHYYIWDHRYYDNKYLKDK 402

Query: 371 FNVDLEKISEYFPLETTITGMLQIYETLFNLKFIEIKDGQSKSVWH-DDVKQLAVWNMDD 429
           FNVDLEKISEY+P+E+TI GML+IYET+ NLKFIE  D   KS W  DDVKQLAVW MDD
Sbjct: 403 FNVDLEKISEYYPVESTIQGMLKIYETVMNLKFIEETDKDLKSTWAGDDVKQLAVWKMDD 462

Query: 430 PKSPKFVGWIYFDLHPRDGKYGHAANFGLSSSFMTNDSVRSYPVTALVCNFSKSTKDKPS 489
           P  P+FVGWIYFDLHPR+GKYGHAANFG++ S++  DS R YPVTALVCNFS +T DKP+
Sbjct: 463 PSKPEFVGWIYFDLHPREGKYGHAANFGMAPSYIDKDSKRIYPVTALVCNFSAATADKPA 522

Query: 490 LLKHNEIVTFFHELGHGIHDLVGQNKESRFNGPGSVPWDFVEAPSQMLEFWTWNKNELID 549
           LLKHNEI TFFHELGHGIHDLVG N   RFNGPG+VPWDFVEAPSQMLEFWTWNKNEL+ 
Sbjct: 523 LLKHNEITTFFHELGHGIHDLVGNNGIGRFNGPGAVPWDFVEAPSQMLEFWTWNKNELLS 582

Query: 550 LSSHYETGEKIPESLIDSLIKTKHVNGALFTLRQLHFGLFDMKVHTCKD---LQNLSICE 606
           LS HY+TGEKIPESL++SLI TKHVNGALF LRQLHFGLFDMKVHT  D   + N+ + +
Sbjct: 583 LSKHYKTGEKIPESLLESLIATKHVNGALFALRQLHFGLFDMKVHTTTDDNQIDNMDLVQ 642

Query: 607 TWNQLRQDISLISNGGTLSKGYDSFGHIMSDSYSAGYYGYLWAEVFATDMYHTKFAKDPL 666
            WN LR++ISL+ NG  ++KGYDSFGHIMSDSYSAGYYGY+WAEVFATDMY++KFAKDPL
Sbjct: 643 LWNGLREEISLVENGDEMNKGYDSFGHIMSDSYSAGYYGYMWAEVFATDMYYSKFAKDPL 702

Query: 667 NTKNGIQYRDIVLARGGLNDIGDDLKKFLGREPSKDAFLKELGLQ 711
           NTK+GI+YRDI+LARGG+ +  D+LK+FLGREPSK+AFLKELGLQ
Sbjct: 703 NTKSGIEYRDIILARGGIRETNDNLKEFLGREPSKEAFLKELGLQ 747

>Kpol_2002.12 s2002 (21544..23763) [2220 bp, 739 aa] {ON}
           (21544..23763) [2220 nt, 740 aa]
          Length = 739

 Score =  936 bits (2418), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 439/709 (61%), Positives = 561/709 (79%), Gaps = 10/709 (1%)

Query: 8   NWFTSPIISPLLYTRSLYSMSNATSFPIAPQAPPNWTFTPNDINGKTKEIIDKSNNFYES 67
           ++F  P I+   +T   YS    +S  IAPQ  P W +TP  I    + +I  SN  +++
Sbjct: 34  SFFAVPAIA---FTILKYSTMTNSSLLIAPQPAPTWNWTPEGIVKDAESLIKDSNRIFDN 90

Query: 68  MSNVETPTVTNFVEPFMKFENELGPIINQLTFLQHVSSDKEIRDASVNSSMKLDELNIDL 127
           ++ + +PTV NF+ P+M  EN++ P+INQLTFLQHVS+DK+IRD+S+ ++  +    I+ 
Sbjct: 91  LAAISSPTVENFIVPYMNHENKVSPLINQLTFLQHVSADKDIRDSSMKATELIQNFEIEA 150

Query: 128 SLRHDIYLQFARVWQDAQ------SKSDSIERETFKYIEKSYKDYIHSGLELDESNRLKI 181
           SLR D+++QF ++W D +       KSDS   E++++IEK +KD+I SGL L +  R  +
Sbjct: 151 SLRKDLFIQFDKIWTDVKDNSEFNEKSDSKNYESYRFIEKCHKDFIRSGLNLSDEKREIV 210

Query: 182 KDIKKKISVNSINFSKNLGEQKEYITFTKEQLEGVPDSVLAQFETIKSDKDRNETLYKVT 241
           KDI+KKI+ NS+NFSKNLGEQKE+I FTKE+L+GV D+V+ QFE  K +K   E  +KVT
Sbjct: 211 KDIQKKIASNSLNFSKNLGEQKEFIAFTKEELDGVSDAVMEQFEKFKDEKTGEEK-FKVT 269

Query: 242 FKYPDIFPVMKLASSAQTRKEAFLADQNKVPENEAILLDTLELRDKLASLLGYDTYANYN 301
           FKYPDI PV+K A +  TRK AF ADQNKVPENEA+ +DTL+LR+ L+++L Y  YANYN
Sbjct: 270 FKYPDILPVLKSAKNPNTRKLAFNADQNKVPENEALFVDTLKLRNDLSTVLDYSNYANYN 329

Query: 302 LYDKMAKDSTTVMDFLNDLKDKLIPLGKKELELLQEMKSKDVKKLNQDEDPNYYIWDHRY 361
           L  KMAK+  TV +FL+DLK KL PLG KE+E+L+++K KD+K+LN   D +YYIWDHRY
Sbjct: 330 LEMKMAKNEETVFNFLDDLKTKLRPLGLKEIEILKQLKEKDMKELNLPYDNHYYIWDHRY 389

Query: 362 YDNKYLLENFNVDLEKISEYFPLETTITGMLQIYETLFNLKFIEIKDGQSKSVWHDDVKQ 421
           YDNKYL +NFNVDLEKISEY+P+E++I GML+IYET+  LKF+E  D   ++VWH+DVKQ
Sbjct: 390 YDNKYLKDNFNVDLEKISEYYPIESSIDGMLKIYETVMKLKFVEETDPAKRNVWHEDVKQ 449

Query: 422 LAVWNMDDPKSPKFVGWIYFDLHPRDGKYGHAANFGLSSSFMTNDSVRSYPVTALVCNFS 481
           L+VW MD+P +P+F+GWIYFDLHPRDGKYGHAANFG+SSS++  +  RSYPVTALVCNFS
Sbjct: 450 LSVWKMDNPDAPEFIGWIYFDLHPRDGKYGHAANFGISSSYVDENDKRSYPVTALVCNFS 509

Query: 482 KSTKDKPSLLKHNEIVTFFHELGHGIHDLVGQNKESRFNGPGSVPWDFVEAPSQMLEFWT 541
           K T DKPSLLKHNE+ TFFHELGHGIHDLVG N+ SR NGPGSVPWDFVEAPSQMLEFWT
Sbjct: 510 KPTSDKPSLLKHNELTTFFHELGHGIHDLVGANRCSRLNGPGSVPWDFVEAPSQMLEFWT 569

Query: 542 WNKNELIDLSSHYETGEKIPESLIDSLIKTKHVNGALFTLRQLHFGLFDMKVHTCKDLQN 601
           WNKNELI LS HY+TGEKIPESLI+SL+ TKHVNGALF LRQLHF  FDM+VHT +D+  
Sbjct: 570 WNKNELISLSKHYKTGEKIPESLIESLVSTKHVNGALFALRQLHFSTFDMEVHTAEDVSK 629

Query: 602 LSICETWNQLRQDISLISNGGTLSKGYDSFGHIMSDSYSAGYYGYLWAEVFATDMYHTKF 661
           L++ E WN LR+ I L+ NG  +SKGYDSFGHIMS +YSAGYYGY+WAEVFATDMY+TKF
Sbjct: 630 LNLLELWNGLREQICLVENGDEMSKGYDSFGHIMSGAYSAGYYGYMWAEVFATDMYYTKF 689

Query: 662 AKDPLNTKNGIQYRDIVLARGGLNDIGDDLKKFLGREPSKDAFLKELGL 710
           A DPLN+K+G++YRDI+L+RGG+ ++ D+L++FLGREP+  AFLKE+GL
Sbjct: 690 AADPLNSKSGVEYRDIILSRGGIYEVNDNLEEFLGREPNNSAFLKEMGL 738

>KNAG0C00260 Chr3 (39428..41662) [2235 bp, 744 aa] {ON} Anc_1.9
           YCL057W
          Length = 744

 Score =  924 bits (2388), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 433/678 (63%), Positives = 541/678 (79%), Gaps = 6/678 (0%)

Query: 39  APPNWTFTPNDINGKTKEIIDKSNNFYESMSNVETPTVTNFVEPFMKFENELGPIINQLT 98
           A P W F    I  +   II+ +N FY+ +  +  P++ N V+P+M  EN +G ++NQL 
Sbjct: 67  ALPRWEFPSAKIGEEATRIIESTNKFYDELVEISNPSIDNLVKPYMNHENSIGLMVNQLC 126

Query: 99  FLQHVSSDKEIRDASVNSSMKLDELNIDLSLRHDIYLQFARVWQDAQSKS-----DSIER 153
           FLQHVSSDKEIR+AS  ++  L    I+ SLRHD++LQF ++W++ + +      D  + 
Sbjct: 127 FLQHVSSDKEIREASNKATELLQNFEIETSLRHDLFLQFDKIWKELKPRKEEFSHDEEQF 186

Query: 154 ETFKYIEKSYKDYIHSGLELDESNRLKIKDIKKKISVNSINFSKNLGEQKEYITFTKEQL 213
           E +K++EK +KD++ +GL L E +R K+KDIK KI+ NS+ FSKNLGEQKE++ F+KEQL
Sbjct: 187 EIYKFVEKCHKDFVRAGLNLSEEDRNKVKDIKIKIASNSLEFSKNLGEQKEFLLFSKEQL 246

Query: 214 EGVPDSVLAQFETIKSDKDRNETLYKVTFKYPDIFPVMKLASSAQTRKEAFLADQNKVPE 273
           +GV D+V+ QFE +K D+  NET YKVTFKYPDIFPV+K+A +A+TRK AF  DQNKVP+
Sbjct: 247 DGVSDTVMEQFEQVK-DETTNETNYKVTFKYPDIFPVLKMAKNAETRKTAFCGDQNKVPQ 305

Query: 274 NEAILLDTLELRDKLASLLGYDTYANYNLYDKMAKDSTTVMDFLNDLKDKLIPLGKKELE 333
           NE + + TL+LRD+LA+LLGYDTYANYNL  KMAK  +TV  FLNDLKDKL PLG+KE+ 
Sbjct: 306 NEELFVATLKLRDELATLLGYDTYANYNLEIKMAKKQSTVFKFLNDLKDKLKPLGEKEIG 365

Query: 334 LLQEMKSKDVKKLNQDEDPNYYIWDHRYYDNKYLLENFNVDLEKISEYFPLETTITGMLQ 393
           +L+ +K  + K+L    D  YYIWDHRYYD KYL +NFNVD E I+EY+P+++TI GML+
Sbjct: 366 ILKSIKEAECKELGVPFDGRYYIWDHRYYDTKYLKDNFNVDHEAIAEYYPIDSTIEGMLK 425

Query: 394 IYETLFNLKFIEIKDGQSKSVWHDDVKQLAVWNMDDPKSPKFVGWIYFDLHPRDGKYGHA 453
           IYET+F LKF+E KD   K+VW++DVKQ+AVW MD+ K+P FVGWIYFDLHPRDGKYGHA
Sbjct: 426 IYETVFKLKFVEEKDTAKKNVWNEDVKQIAVWKMDNVKTPVFVGWIYFDLHPRDGKYGHA 485

Query: 454 ANFGLSSSFMTNDSVRSYPVTALVCNFSKSTKDKPSLLKHNEIVTFFHELGHGIHDLVGQ 513
           ANFG++SS++  D  RSYPVTALVCNFSKS+  KPSLLKHNEI TFFHELGHGIHDLVG+
Sbjct: 486 ANFGIASSYIREDGSRSYPVTALVCNFSKSSATKPSLLKHNEITTFFHELGHGIHDLVGK 545

Query: 514 NKESRFNGPGSVPWDFVEAPSQMLEFWTWNKNELIDLSSHYETGEKIPESLIDSLIKTKH 573
           N+ +RFNGPG+ PWDFVEAPSQMLEF+TW+KN L  LS HY+TGE+IPE L+DSLI TKH
Sbjct: 546 NRAARFNGPGATPWDFVEAPSQMLEFYTWDKNALQSLSKHYKTGEQIPEKLLDSLIATKH 605

Query: 574 VNGALFTLRQLHFGLFDMKVHTCKDLQNLSICETWNQLRQDISLISNGGTLSKGYDSFGH 633
           VNGALF LRQLHFGLFDM VHT KD+ +L + + W  LRQ+ISL+ NGG  +KGYDSFGH
Sbjct: 606 VNGALFALRQLHFGLFDMTVHTSKDVASLDLLKLWGDLRQEISLVENGGQYTKGYDSFGH 665

Query: 634 IMSDSYSAGYYGYLWAEVFATDMYHTKFAKDPLNTKNGIQYRDIVLARGGLNDIGDDLKK 693
           IMSDSYSAGYYGY+WAEVFATDMY TKFA +PL++  G++YRDIVLA GGL +I D+LK+
Sbjct: 666 IMSDSYSAGYYGYMWAEVFATDMYRTKFAPNPLDSSVGMKYRDIVLANGGLYEIDDNLKE 725

Query: 694 FLGREPSKDAFLKELGLQ 711
           FLGREPSKDAFLKELGLQ
Sbjct: 726 FLGREPSKDAFLKELGLQ 743

>ZYRO0F18392g Chr6 complement(1518902..1521079) [2178 bp, 725 aa]
           {ON} similar to uniprot|P25375 Saccharomyces cerevisiae
           YCL057W PRD1 Zinc metalloendopeptidase found in the
           cytoplasm and intermembrane space of mitochondria
          Length = 725

 Score =  923 bits (2385), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 433/689 (62%), Positives = 545/689 (79%), Gaps = 5/689 (0%)

Query: 25  YSMSNATSFPIAPQAPPNWTFTPNDINGKTKEIIDKSNNFYESMSNVETPTVTNFVEPFM 84
           YS  ++ +  IAPQ+ P+W FTP  +  +T  +I+ S  FY+S++ +  PTV N V+P+M
Sbjct: 38  YSTMSSPNLFIAPQSAPSWAFTPQSLLDETHRLIESSKQFYDSLAQLSNPTVENLVKPYM 97

Query: 85  KFENELGPIINQLTFLQHVSSDKEIRDASVNSSMKLDELNIDLSLRHDIYLQFARVWQDA 144
             EN +G I +QLTF Q VS+DKEIRDASV ++  L    I+ SLRHD++LQF ++W + 
Sbjct: 98  HHENGVGLIESQLTFPQQVSADKEIRDASVQATEFLQNFGIEQSLRHDLFLQFDKIWNEL 157

Query: 145 QSKS---DSIERETFKYIEKSYKDYIHSGLELDESNRLKIKDIKKKISVNSINFSKNLGE 201
           + KS    S E E +KY+EK ++DY   GL+L E  R K+K +K KI+ NS+ FSKNLGE
Sbjct: 158 KDKSFEQGSQEYEIYKYVEKIHRDYTRDGLQLPEDKRDKVKQLKIKIAANSLEFSKNLGE 217

Query: 202 QKEYITFTKEQLEGVPDSVLAQFETIKSDKDRNETLYKVTFKYPDIFPVMKLASSAQTRK 261
           QKE++ FTKE+L+GV +SV+ QFE  K +     T YKVTFKYPDIFPV+K A + +TRK
Sbjct: 218 QKEFVAFTKEELDGVSESVMDQFEQFKDE--NGTTKYKVTFKYPDIFPVLKTAKNPKTRK 275

Query: 262 EAFLADQNKVPENEAILLDTLELRDKLASLLGYDTYANYNLYDKMAKDSTTVMDFLNDLK 321
            AF  DQ+KVP+NE + ++TL+LR++LA +LGY TYANYNL  KMAK+   V  FLN+LK
Sbjct: 276 LAFARDQDKVPQNEKLFVETLQLRNELADILGYSTYANYNLELKMAKNQDNVWKFLNELK 335

Query: 322 DKLIPLGKKELELLQEMKSKDVKKLNQDEDPNYYIWDHRYYDNKYLLENFNVDLEKISEY 381
           DKL PLG KE E L+++K K+ + L    D +YY+WDHRYYDNKYL +N+NVDLEKISEY
Sbjct: 336 DKLKPLGLKEAENLKQIKQKECESLGLPYDGHYYVWDHRYYDNKYLKDNYNVDLEKISEY 395

Query: 382 FPLETTITGMLQIYETLFNLKFIEIKDGQSKSVWHDDVKQLAVWNMDDPKSPKFVGWIYF 441
           +P+E+TI+GML IYETL  LKF+E  D + +SVWH+DVKQLAVW MD+P  P+FVGWIYF
Sbjct: 396 YPIESTISGMLSIYETLLKLKFVEETDPEKRSVWHEDVKQLAVWKMDNPSKPEFVGWIYF 455

Query: 442 DLHPRDGKYGHAANFGLSSSFMTNDSVRSYPVTALVCNFSKSTKDKPSLLKHNEIVTFFH 501
           DLHPRDGKYGHAANFG+S+S++  D  RSYPVTALVCNFSK +  KPSLLKHNEI TFFH
Sbjct: 456 DLHPRDGKYGHAANFGISASYVKEDGTRSYPVTALVCNFSKPSAKKPSLLKHNEISTFFH 515

Query: 502 ELGHGIHDLVGQNKESRFNGPGSVPWDFVEAPSQMLEFWTWNKNELIDLSSHYETGEKIP 561
           ELGHGIHDLVG+N+ + FNGPG+VPWDFVEAPSQMLEFWTWN+ EL +LSSHYE+GEKIP
Sbjct: 516 ELGHGIHDLVGENRLTTFNGPGAVPWDFVEAPSQMLEFWTWNERELHELSSHYESGEKIP 575

Query: 562 ESLIDSLIKTKHVNGALFTLRQLHFGLFDMKVHTCKDLQNLSICETWNQLRQDISLISNG 621
           + L+ SLI TKHV+GALF LRQLHFGLFDM VHT K++  L + + WN+LR+++SL+ NG
Sbjct: 576 KDLLQSLISTKHVDGALFALRQLHFGLFDMYVHTSKNVAKLDLLKLWNELREEVSLVENG 635

Query: 622 GTLSKGYDSFGHIMSDSYSAGYYGYLWAEVFATDMYHTKFAKDPLNTKNGIQYRDIVLAR 681
            T +KGYDSFGHIMSDSYSAGYYGY+WAEVFA DMYHT+FA DPL++K G+QYRDIVL R
Sbjct: 636 DTFTKGYDSFGHIMSDSYSAGYYGYMWAEVFAADMYHTRFAADPLDSKAGVQYRDIVLGR 695

Query: 682 GGLNDIGDDLKKFLGREPSKDAFLKELGL 710
           GGL +  D+L++FLGREPS++AFLKELGL
Sbjct: 696 GGLYETNDNLREFLGREPSEEAFLKELGL 724

>SAKL0C00550g Chr3 (48410..50608) [2199 bp, 732 aa] {ON} highly
           similar to gnl|GLV|KLLA0C00572g Kluyveromyces lactis
           KLLA0C00572g and similar to YCL057W uniprot|P25375
           Saccharomyces cerevisiae YCL057W PRD1 Zinc
           metalloendopeptidase found in the cytoplasm and
           intermembrane space of mitochondria
          Length = 732

 Score =  910 bits (2353), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 437/695 (62%), Positives = 543/695 (78%), Gaps = 11/695 (1%)

Query: 22  RSLYSMSNAT--SFPIAPQAPPNWTFTPNDINGKTKEIIDKSNNFYESMSNVETPTVTNF 79
           +S YS  +AT  +  + PQA P+W ++P DI   T E I  ++  +++++ VE PTV + 
Sbjct: 42  KSNYSTMSATMSATLVPPQAAPSWKYSPEDILQLTNETIASTSALHDALAGVENPTVESL 101

Query: 80  VEPFMKFENELGPIINQLTFLQHVSSDKEIRDASVNSSMKLDELNIDLSLRHDIYLQFAR 139
           V+PF++ EN   P+INQLTFLQHVS+DKE+RDAS  ++  L +  I+ SLRHD+++QF +
Sbjct: 102 VKPFLEHENTTQPLINQLTFLQHVSADKEVRDASTKATELLQDFEIEASLRHDLFVQFDK 161

Query: 140 VWQ----DAQSKSDSIERETFKYIEKSYKDYIHSGLELDESNRLKIKDIKKKISVNSINF 195
           VWQ    DA+ K +  E   +K++EK +KDY+ +GL L E  R ++K+++KKIS NS+ F
Sbjct: 162 VWQACKDDAKFKKEHFE--LYKFVEKCHKDYVRAGLNLPEEKRNEVKELQKKISNNSLQF 219

Query: 196 SKNLGEQKEYITFTKEQLEGVPDSVLAQFETIKSDKDRNETLYKVTFKYPDIFPVMKLAS 255
           SKNLGEQKE++ FT E+L+GV  SV+ QFE   +D D  E  +KV+FKYPDI PV+K A 
Sbjct: 220 SKNLGEQKEFVAFTTEELDGVSASVMDQFEKF-TDTDGVEK-HKVSFKYPDILPVLKTAK 277

Query: 256 SAQTRKEAFLADQNKVPENEAILLDTLELRDKLASLLGYDTYANYNLYDKMAKDSTTVMD 315
           + +TRK AF  DQNKVP+NE + L+TL LRD+LA LLGY TYANYNL  KMAK   TV+ 
Sbjct: 278 NPETRKRAFGGDQNKVPQNEVLFLETLRLRDELAGLLGYSTYANYNLDIKMAKKQETVLA 337

Query: 316 FLNDLKDKLIPLGKKELELLQEMKSKDVKKLNQDEDPNYYIWDHRYYDNKYLLENFNVDL 375
           FL DLK+KL PLG KE+E L+ +K KD K+L    D +YYIWD+RYYDNKYL EN+NVD 
Sbjct: 338 FLEDLKNKLKPLGVKEIEALKSLKEKDCKELAIPFDNHYYIWDNRYYDNKYLKENYNVDE 397

Query: 376 EKISEYFPLETTITGMLQIYETLFNLKFIEIKDGQSKSVWHDDVKQLAVWNMDDPKSPKF 435
           EKISEYFPLE TI GML+IYET+  LKF+E  D + K VWH+DVKQLAVW +D  +SP+F
Sbjct: 398 EKISEYFPLEPTIGGMLKIYETVLKLKFVEETDAEKKQVWHEDVKQLAVWKVDKAESPEF 457

Query: 436 VGWIYFDLHPRDGKYGHAANFGLSSSFMTNDSVRSYPVTALVCNFSKSTKDKPSLLKHNE 495
           VGWIYFDLHPRDGKYGHAANFG++SS++  D  RS+PVTALVCNFSK +  KP+LLKH+E
Sbjct: 458 VGWIYFDLHPRDGKYGHAANFGIASSYV-RDGARSHPVTALVCNFSKPSAKKPALLKHSE 516

Query: 496 IVTFFHELGHGIHDLVGQNKESRFNGPGSVPWDFVEAPSQMLEFWTWNKNELIDLSSHYE 555
           I TFFHELGHGIHDLVG N   RFNGPG+ PWDFVEAPSQMLEFWTWNKNEL  LS HYE
Sbjct: 517 ITTFFHELGHGIHDLVGGNHIGRFNGPGATPWDFVEAPSQMLEFWTWNKNELSTLSQHYE 576

Query: 556 TGEKIPESLIDSLIKTKHVNGALFTLRQLHFGLFDMKVHTCKDLQNLSICETWNQLRQDI 615
           TGEKIPE L+DSLI TKHVNGALF LRQL FGLFDM VHTCKDL++L +   WN LRQ++
Sbjct: 577 TGEKIPEQLLDSLIATKHVNGALFALRQLTFGLFDMTVHTCKDLESLDVTSLWNDLRQEV 636

Query: 616 SLISNGGTLSKGYDSFGHIMSDSYSAGYYGYLWAEVFATDMYHTKFAKDPLNTKNGIQYR 675
           SL+ NG  ++KG++SFGHIMS +YSAGYYGY+WAEVFA DMYHTKFA DPLN   G++YR
Sbjct: 637 SLVENGDQVTKGFNSFGHIMSGAYSAGYYGYMWAEVFAADMYHTKFAADPLNGDVGVRYR 696

Query: 676 DIVLARGGLNDIGDDLKKFLGREPSKDAFLKELGL 710
           DIVL+RGGL +I D+L++FLGREP+ +AFLKELGL
Sbjct: 697 DIVLSRGGLYEIDDNLREFLGREPNNEAFLKELGL 731

>TBLA0A07560 Chr1 complement(1871629..1873854) [2226 bp, 741 aa]
           {ON} Anc_1.9 YCL057W
          Length = 741

 Score =  907 bits (2345), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 433/681 (63%), Positives = 550/681 (80%), Gaps = 7/681 (1%)

Query: 36  APQAPPNWTFTPNDINGKTKEIIDKSNNFYESMSNVETPTVTNFVEPFMKFENELGPIIN 95
           APQA P W +TP+ +    +++ID+SN+FY++++N+++P   NF+ P+M +EN++G +IN
Sbjct: 61  APQAAPTWNWTPSQLVKDAEDLIDQSNHFYDALTNLKSPDFNNFLVPYMNYENKVGSLIN 120

Query: 96  QLTFLQHVSSDKEIRDASVNSSMKLDELNIDLSLRHDIYLQFARVWQDAQSKSDSIER-- 153
           QLTFLQHVSS+K+IRDAS  ++  L    I+ SLR+ ++LQF ++W   +   D  E+  
Sbjct: 121 QLTFLQHVSSEKDIRDASFKATDLLQNFEIETSLRYGLFLQFDKIWNQIKDSKDKYEKDP 180

Query: 154 ---ETFKYIEKSYKDYIHSGLELDESNRLKIKDIKKKISVNSINFSKNLGEQKEYITFTK 210
              E ++++ K ++D++ +GL LDES R KIK+IKK I+ NS+ F+ NLGEQ E++ FTK
Sbjct: 181 KDLENYEFVRKVHRDFVRAGLNLDESKREKIKEIKKAIANNSLKFATNLGEQTEFVAFTK 240

Query: 211 EQLEGVPDSVLAQFETIKSDKDRNETLYKVTFKYPDIFPVMKLASSAQTRKEAFLADQNK 270
           E+L+GV DSV+ QFE    +K   E +YKVTFKYPDIFPV+K A + +TRK+AF  DQNK
Sbjct: 241 EELDGVSDSVMEQFEKFNDEKTGKE-MYKVTFKYPDIFPVLKTARNPETRKKAFAGDQNK 299

Query: 271 VPENEAILLDTLELRDKLASLLGYDTYANYNLYDKMAKDSTTVMDFLNDLKDKLIPLGKK 330
           V EN  +  +TL+LR++LA +LGY TYANYNL  KMAK   +V  FL DL D+L PLG K
Sbjct: 300 VSENTVLFTNTLKLRNQLADILGYSTYANYNLELKMAKAQDSVFKFLEDLIDRLKPLGSK 359

Query: 331 ELELLQEMKSKDVKKLNQDEDPNYYIWDHRYYDNKYLLENFNVDLEKISEYFPLETTITG 390
           E+E+L+ +K K+ K+LN   D +YY+WDHRYYDNKYL +N+NVDLEKISEY+PL++TI G
Sbjct: 360 EIEILKSIKEKEFKELNLPFDNHYYVWDHRYYDNKYLKDNYNVDLEKISEYYPLDSTIEG 419

Query: 391 MLQIYETLFNLKFIEIKD-GQSKSVWHDDVKQLAVWNMDDPKSPKFVGWIYFDLHPRDGK 449
           ML IYETL NLKFIE KD  ++K+VWH +VKQLAVW MD+P++P+FVGWIYFDLHPRDGK
Sbjct: 420 MLNIYETLLNLKFIEEKDDSKNKNVWHKEVKQLAVWKMDNPENPEFVGWIYFDLHPRDGK 479

Query: 450 YGHAANFGLSSSFMTNDSVRSYPVTALVCNFSKSTKDKPSLLKHNEIVTFFHELGHGIHD 509
           YGHAANFG+SSS++  ++ RSYPVTALVCNFSK T DKP+LLKHNEI TFFHELGHGIHD
Sbjct: 480 YGHAANFGISSSYIKPNNERSYPVTALVCNFSKVTADKPALLKHNEITTFFHELGHGIHD 539

Query: 510 LVGQNKESRFNGPGSVPWDFVEAPSQMLEFWTWNKNELIDLSSHYETGEKIPESLIDSLI 569
           LVG+N  SRFNGPG+VPWDFVEAPSQMLEFWTWNKNEL+ LS HY+TGEKIP  L++SL+
Sbjct: 540 LVGKNNNSRFNGPGAVPWDFVEAPSQMLEFWTWNKNELLSLSKHYKTGEKIPTELLNSLV 599

Query: 570 KTKHVNGALFTLRQLHFGLFDMKVHTCKDLQNLSICETWNQLRQDISLISNGGTLSKGYD 629
            TKHVNGALF LRQLHFGLFDMKVHT KDL+NL   + WN+LR+++SL+ NG   +KGYD
Sbjct: 600 ATKHVNGALFALRQLHFGLFDMKVHTSKDLENLDFLKLWNELREEVSLVENGDLFTKGYD 659

Query: 630 SFGHIMSDSYSAGYYGYLWAEVFATDMYHTKFAKDPLNTKNGIQYRDIVLARGGLNDIGD 689
           SFGHIMSDSYSAGYYGY+WAEVFATDMY+TKFA +PL TK G++YRD VLARGGL +I D
Sbjct: 660 SFGHIMSDSYSAGYYGYMWAEVFATDMYYTKFAANPLETKVGVEYRDWVLARGGLYEIED 719

Query: 690 DLKKFLGREPSKDAFLKELGL 710
           +L +FLGR+PS +AFLKELGL
Sbjct: 720 NLIQFLGRKPSNEAFLKELGL 740

>KAFR0D00180 Chr4 (18900..21071) [2172 bp, 723 aa] {ON} Anc_1.9
           YCL057W
          Length = 723

 Score =  907 bits (2343), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 444/703 (63%), Positives = 560/703 (79%), Gaps = 10/703 (1%)

Query: 13  PIISPLLYTRSLYSMSNATSFPIAPQAPPNWTFTPNDINGKTKEIIDKSNNFYESMSNVE 72
           P  S L+Y R LYS    ++F IAPQA P+W + P+ +    + +ID SN  Y+ +S+++
Sbjct: 23  PATSYLVYNR-LYSNMTISAF-IAPQAAPSWNWNPSRLLFDAECVIDNSNRLYDELSSLK 80

Query: 73  TPTVTNFVEPFMKFENELGPIINQLTFLQHVSSDKEIRDASVNSSMKLDELNIDLSLRHD 132
            PTV N V P+M  EN++ P+IN+L FLQHVS D +IR+AS+ ++  L +  I+ SLRHD
Sbjct: 81  KPTVENLVRPYMIHENKISPLINKLCFLQHVSEDPKIREASLKATELLQKFEIEASLRHD 140

Query: 133 IYLQFARVWQDAQSKSDSIERE----TFKYIEKSYKDYIHSGLELDESNRLKIKDIKKKI 188
           ++LQF ++WQ+   K D   +E    T+K+IEK +KDY+ SGL L E  R KIK+IK KI
Sbjct: 141 LFLQFDKIWQEISEKKDDFVKEYDFETWKFIEKVHKDYVRSGLNLPEDKREKIKEIKIKI 200

Query: 189 SVNSINFSKNLGEQKEYITFTKEQLEGVPDSVLAQFETIKSDKDRNETLYKVTFKYPDIF 248
             NS+ +SKNLGEQKE I FT+E+L+GV D+V  QFE    D++  E  +KVTFKYPDIF
Sbjct: 201 GNNSLQYSKNLGEQKELIAFTREELDGVSDAVFEQFEKF-IDEETGEEKFKVTFKYPDIF 259

Query: 249 PVMKLASSAQTRKEAFLADQNKVPENEAILLDTLELRDKLASLLGYDTYANYNLYDKMAK 308
           PV+K A + +TR++AFLADQNKVP+NE + ++TL+LR++LA+ L Y TYANYNL +KMAK
Sbjct: 260 PVLKTAKNPETRRKAFLADQNKVPQNEDLFVETLKLRNELATTLNYSTYANYNLEEKMAK 319

Query: 309 DSTTVMDFLNDLKDKLIPLGKKELELLQEMKSKDVKKLNQDEDPNYYIWDHRYYDNKYLL 368
              TV+DFLNDLK +L PL  KE+ +L+++K K+ K+LN++ D +YYI+DHRYYDNKYL 
Sbjct: 320 RQETVLDFLNDLKYRLKPLAMKEISILKDIKQKECKELNREYDSHYYIYDHRYYDNKYLK 379

Query: 369 ENFNVDLEKISEYFPLETTITGMLQIYETLFNLKFIEIKDGQSKSVWHDDVKQLAVWNMD 428
           +NFNVDLE ISEY+PLE TI GML+IYE LF LKF E  + ++KSVWH+DVKQLAVW MD
Sbjct: 380 DNFNVDLEAISEYYPLEHTINGMLKIYEELFKLKFNE--ETKNKSVWHEDVKQLAVWKMD 437

Query: 429 DPKSPKFVGWIYFDLHPRDGKYGHAANFGLSSSFMTNDS-VRSYPVTALVCNFSKSTKDK 487
           +P+ P+FVGWIYFDLHPRDGKYGHAANFG+SSS++  ++  RSYPVTALVCNFSKST  +
Sbjct: 438 NPEKPEFVGWIYFDLHPRDGKYGHAANFGISSSYVDIETGKRSYPVTALVCNFSKSTATR 497

Query: 488 PSLLKHNEIVTFFHELGHGIHDLVGQNKESRFNGPGSVPWDFVEAPSQMLEFWTWNKNEL 547
           PSLLKHNEI TFFHELGHGIHDLVG+NK SRFNGPG+ PWDFVEAPSQMLEFWTWN NEL
Sbjct: 498 PSLLKHNEITTFFHELGHGIHDLVGKNKLSRFNGPGATPWDFVEAPSQMLEFWTWNANEL 557

Query: 548 IDLSSHYETGEKIPESLIDSLIKTKHVNGALFTLRQLHFGLFDMKVHTCKDLQNLSICET 607
             LS HYE+ EKIP+ L+ SLIKTKHVNGALF LRQLHFGLFDM VHT  ++++L++ + 
Sbjct: 558 KSLSCHYESNEKIPDDLLTSLIKTKHVNGALFALRQLHFGLFDMTVHTTNNVESLNLLKL 617

Query: 608 WNQLRQDISLISNGGTLSKGYDSFGHIMSDSYSAGYYGYLWAEVFATDMYHTKFAKDPLN 667
           WN+LR++I L+  G  LSKGYDSFGHIMSDSYSAGYYGY+WAEVFA DMYHTKF+ +PL+
Sbjct: 618 WNELREEICLVETGHELSKGYDSFGHIMSDSYSAGYYGYMWAEVFAADMYHTKFSPNPLD 677

Query: 668 TKNGIQYRDIVLARGGLNDIGDDLKKFLGREPSKDAFLKELGL 710
           ++ G+QYRDIVLA GGL +I D+L+ FLGREPSK+AFLKELGL
Sbjct: 678 SEVGVQYRDIVLANGGLYEIADNLRDFLGREPSKNAFLKELGL 720

>NDAI0A00180 Chr1 (14692..16914) [2223 bp, 740 aa] {ON} Anc_1.9
          Length = 740

 Score =  895 bits (2312), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 432/688 (62%), Positives = 553/688 (80%), Gaps = 6/688 (0%)

Query: 26  SMSNATSFPIAPQAPPNWTFTPNDINGKTKEIIDKSNNFYESMSNVETPTVTNFVEPFMK 85
           +++N   F       P+WT+TP  I  +TK  I+K+N +Y S+S +E+P++ N + P+M 
Sbjct: 56  TVNNKHGFIAPANTVPDWTWTPKQILDETKSYIEKTNKYYNSISEIESPSIENLIIPYMN 115

Query: 86  FENELGPIINQLTFLQHVSSDKEIRDASVNSSMKLDELNIDLSLRHDIYLQFARVWQDAQ 145
           +EN++G +INQLTFLQHVS+DK+IRDAS+ ++  L++ +I  SLR +I+ QF +VW+  Q
Sbjct: 116 YENKMGLLINQLTFLQHVSADKKIRDASLEATRLLEDHDILTSLRWEIWEQFEKVWETVQ 175

Query: 146 SKSDSIER---ETFKYIEKSYKDYIHSGLELDESNRLKIKDIKKKISVNSINFSKNLGEQ 202
           +  D ++    ET+K+IEK +KD + +GL+ + + +LK   IK KIS +++ FS NLGEQ
Sbjct: 176 NDDDFLKNHQFETYKFIEKIHKDSLRNGLKSERNYQLKY--IKGKISADALTFSSNLGEQ 233

Query: 203 KEYITFTKEQLEGVPDSVLAQFETIKSDKDRNETLYKVTFKYPDIFPVMKLASSAQTRKE 262
            EY++FTKE+L+GV ++V+ QFE    D   NE  YKVTFKYPDIFPV+K A + +TRK 
Sbjct: 234 NEYVSFTKEELDGVSETVMDQFEKF-IDPKTNEKKYKVTFKYPDIFPVLKTAKNPKTRKI 292

Query: 263 AFLADQNKVPENEAILLDTLELRDKLASLLGYDTYANYNLYDKMAKDSTTVMDFLNDLKD 322
           AFL DQNKVPENE +L + L+LR +LA+ LGY TYANYNL  KMAK+  TV+ FLNDLK+
Sbjct: 293 AFLGDQNKVPENEKLLCNVLKLRKELANTLGYSTYANYNLDIKMAKNQETVLKFLNDLKE 352

Query: 323 KLIPLGKKELELLQEMKSKDVKKLNQDEDPNYYIWDHRYYDNKYLLENFNVDLEKISEYF 382
           KL PL +KE+++L+++K K+ ++L    D +YYIWDHRYYDNKYL +NFNVD+EKISEY+
Sbjct: 353 KLKPLAEKEIKILKDLKKKECEELGIPYDGHYYIWDHRYYDNKYLKDNFNVDIEKISEYY 412

Query: 383 PLETTITGMLQIYETLFNLKFIEIKDGQSKSVWHDDVKQLAVWNMDDPKSPKFVGWIYFD 442
           PLE+TI GML+IYET+ NLKFIE  D  +K+VWH DVKQL+VWNMDD  +P FVGWIYFD
Sbjct: 413 PLESTIDGMLKIYETVLNLKFIEETDPLAKNVWHPDVKQLSVWNMDDRANPAFVGWIYFD 472

Query: 443 LHPRDGKYGHAANFGLSSSFMTNDSVRSYPVTALVCNFSKSTKDKPSLLKHNEIVTFFHE 502
           L+PRDGKYGHAANFG++SS++T ++ RSYPVTALVCNFSK TK+KP+LLKH+EI TFFHE
Sbjct: 473 LYPRDGKYGHAANFGIASSYITEENKRSYPVTALVCNFSKPTKNKPALLKHSEITTFFHE 532

Query: 503 LGHGIHDLVGQNKESRFNGPGSVPWDFVEAPSQMLEFWTWNKNELIDLSSHYETGEKIPE 562
           LGHGIHDLVGQNK +RFNGPGSVPWDFVEAPSQMLEFWTWNKNEL+ LS HY+TGEKIPE
Sbjct: 533 LGHGIHDLVGQNKAARFNGPGSVPWDFVEAPSQMLEFWTWNKNELLSLSKHYKTGEKIPE 592

Query: 563 SLIDSLIKTKHVNGALFTLRQLHFGLFDMKVHTCKDLQNLSICETWNQLRQDISLISNGG 622
            L+DSLI TKHVNGALF LRQLHFGLFDM VHT KD++NL + + WN+ R++I L+ NG 
Sbjct: 593 DLLDSLISTKHVNGALFALRQLHFGLFDMTVHTTKDIENLDLLKLWNESREEICLVENGE 652

Query: 623 TLSKGYDSFGHIMSDSYSAGYYGYLWAEVFATDMYHTKFAKDPLNTKNGIQYRDIVLARG 682
             +KGY+SFGHI+SDSYSAGYYGY+WAEVFA DMYHTKFA +PL+   GI+YRD++LA+G
Sbjct: 653 NFTKGYNSFGHIISDSYSAGYYGYMWAEVFAADMYHTKFAPNPLDVSVGIKYRDLILAKG 712

Query: 683 GLNDIGDDLKKFLGREPSKDAFLKELGL 710
           GL +I D+L +FLGREPS   FLKELGL
Sbjct: 713 GLYEINDNLLEFLGREPSNKPFLKELGL 740

>KLLA0C00572g Chr3 (42069..44207) [2139 bp, 712 aa] {ON} similar to
           uniprot|P25375 Saccharomyces cerevisiae YCL057W PRD1
           Zinc metalloendopeptidase found in the cytoplasm and
           intermembrane space of mitochondria
          Length = 712

 Score =  888 bits (2295), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 435/709 (61%), Positives = 541/709 (76%), Gaps = 19/709 (2%)

Query: 11  TSPIISPLLYTRS-----LYSMSNATSFPIAPQAPPNWTFTPNDINGKTKEIIDKSNNFY 65
           TS ++ P L   S     + S+   T F + PQA P+W +T  ++  +T E ID SN   
Sbjct: 14  TSLVVIPTLAFASFQFNAIRSIMTKTDF-VVPQAAPSWNYTTEELLKQTHEAIDSSNELL 72

Query: 66  ESMSNVETPTVTNFVEPFMKFENELGPIINQLTFLQHVSSDKEIRDASVNSSMKLDELNI 125
           +S+ ++  P+V NFV P++  EN + P+ NQLTFLQHVSSDKE+RD S   +  ++   I
Sbjct: 73  DSLESISNPSVENFVTPYLHHENTISPLFNQLTFLQHVSSDKELRDTSTKVTELIENFGI 132

Query: 126 DLSLRHDIYLQFARVWQ----DAQSKSDSIERETFKYIEKSYKDYIHSGLELDESNRLKI 181
           + SLR  ++ QF  VW     DAQ K D  E   +K++EK +KD++ SGL L E  R K+
Sbjct: 133 ESSLRFKLFRQFDIVWNQLKDDAQFKKDHFE--IYKFVEKCHKDFLRSGLNLPEEQRDKV 190

Query: 182 KDIKKKISVNSINFSKNLGEQKEYITFTKEQLEGVPDSVLAQFETIKSDKDRNETLYKVT 241
           K+IKKKIS NS+ FSKNLGEQ E+ITFTKE+L GV ++V+ QFET+  D     T YKVT
Sbjct: 191 KEIKKKISNNSLQFSKNLGEQNEFITFTKEELIGVSENVMKQFETVDED---GITKYKVT 247

Query: 242 FKYPDIFPVMKLASSAQTRKEAFLADQNKVPENEAILLDTLELRDKLASLLGYDTYANYN 301
           FKYPDIFPV+K A +A+TRK AF+ DQNKVP+NEA+ L+TL+LR+ LA LL YD+YA+YN
Sbjct: 248 FKYPDIFPVLKSAKNAETRKRAFIGDQNKVPQNEALFLETLQLRNDLAELLNYDSYADYN 307

Query: 302 LYDKMAKDSTTVMDFLNDLKDKLIPLGKKELELLQEMKSKDVKKLNQDEDPNYYIWDHRY 361
           L  KMAK    V+ FLNDLK+KL PLG+KEL  L+ +K ++ K+LN   D  YYIWD+RY
Sbjct: 308 LDIKMAKKEEAVLTFLNDLKNKLKPLGEKELTKLKNLKEEECKELNTPYDRRYYIWDNRY 367

Query: 362 YDNKYLLENFNVDLEKISEYFPLETTITGMLQIYETLFNLKFIEIKDGQSKSVWHDDVKQ 421
           YDN+YL +NF +D EKI+EYFPLE+TI GMLQIYET+  LKFIE  +G +   WH DVK+
Sbjct: 368 YDNQYLKKNFQIDEEKIAEYFPLESTIKGMLQIYETVLKLKFIEEDNGDT---WHPDVKK 424

Query: 422 LAVWNMDDPKSPKFVGWIYFDLHPRDGKYGHAANFGLSSSFMTNDSVRSYPVTALVCNFS 481
           L+VW MDD   P FVGWIYFDLHPR+GKYGHAANFG+SSSF+ +D  RSYPVTALVCNFS
Sbjct: 425 LSVWKMDD-NFPSFVGWIYFDLHPREGKYGHAANFGISSSFLKSDGSRSYPVTALVCNFS 483

Query: 482 KSTKDKPSLLKHNEIVTFFHELGHGIHDLVGQNKESRFNGPGSVPWDFVEAPSQMLEFWT 541
           K TKDKP+LLKH+E+ TFFHELGHGIHDLVG N   RFNGP + PWDFVEAPSQMLEFWT
Sbjct: 484 KPTKDKPALLKHSELTTFFHELGHGIHDLVGGNDIGRFNGPSATPWDFVEAPSQMLEFWT 543

Query: 542 WNKNELIDLSSHYETGEKIPESLIDSLIKTKHVNGALFTLRQLHFGLFDMKVHTCKDLQN 601
           WNK EL  LS HY+T EKIP+SL+DSL++TKH+NGALF LRQLHFGLFDMKVHT KD+  
Sbjct: 544 WNKKELKSLSKHYQTEEKIPDSLLDSLVRTKHINGALFALRQLHFGLFDMKVHTTKDISK 603

Query: 602 LSICETWNQLRQDISLISNGGTLSKGYDSFGHIMSDSYSAGYYGYLWAEVFATDMYHTKF 661
           L++ E WN LR++I LI NG   +KG++SFGHIMSDSYSAGYYGY+WA+VFA+DMY+TKF
Sbjct: 604 LNVTELWNSLREEICLIDNGDIQTKGFNSFGHIMSDSYSAGYYGYMWADVFASDMYYTKF 663

Query: 662 AKDPLNTKNGIQYRDIVLARGGLNDIGDDLKKFLGREPSKDAFLKELGL 710
            +DPLN+  G+QYRDI+LARGGL +I D+L +FLGR+P+  AFLKELGL
Sbjct: 664 LEDPLNSDVGVQYRDIILARGGLYEIEDNLTEFLGRKPNNKAFLKELGL 712

>CAGL0B00418g Chr2 (26584..28815) [2232 bp, 743 aa] {ON} similar to
           uniprot|P25375 Saccharomyces cerevisiae YCL057w PRD1
           proteinase yscD
          Length = 743

 Score =  847 bits (2187), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 419/679 (61%), Positives = 527/679 (77%), Gaps = 8/679 (1%)

Query: 37  PQAPPNWTFTPNDINGKTKEIIDKSNNFYESMSNVETPTVTNFVEPFMKFENELGPIINQ 96
           PQ PP+W F P DI  +TKE I  +  FY+ +  ++ PT+ N + P++  ENE   +INQ
Sbjct: 69  PQYPPSWEFKPEDILSQTKEFIANTKLFYDDLVAIDNPTIENLIVPYINHENENELLINQ 128

Query: 97  LTFLQHVSSDKEIRDASVNSSMKLDELNIDLSLRHDIYLQFARVWQDAQSKSDSIER-ET 155
           LTFLQHVS DK IRDAS+ ++M L +  I+   R D++ QF  +W   + K D  E  E 
Sbjct: 129 LTFLQHVSEDKTIRDASMEATMLLQDFEIESGSRVDLFKQFDLIWNQIKDKKDEFEDFEI 188

Query: 156 FKYIEKSYKDYIHSGLELDESNRLKIKDIKKKISVNSINFSKNLGEQKEYITFTKEQLEG 215
           ++++EK +KDY+ +GL L      K+K+IKKKI+ N + FSKNLGEQKEYI FT E+L+G
Sbjct: 189 WRFVEKCHKDYVRAGLNLPADKLEKVKEIKKKIADNCLKFSKNLGEQKEYILFTAEELKG 248

Query: 216 VPDSVLAQFETIKSDKDRNETLYKVTFKYPDIFPVMKLASSAQTRKEAFLADQNKVPENE 275
           VP+SV+ QFE +  +    +   KVT+KYPDIFPV+K A + +TR +AF+ DQNKVPENE
Sbjct: 249 VPESVIEQFEKVNDEFGIQKL--KVTYKYPDIFPVLKNAQNPETRMKAFMGDQNKVPENE 306

Query: 276 AILLDTLELRDKLASLLGYDTYANYNLYDKMAKDSTTVMDFLNDLKDKLIPLGKKELELL 335
            +  DTL+LR++LA +LGYDTYANYNL  KMAK++ TV+ F+NDL  KL    KKEL++L
Sbjct: 307 HLFKDTLKLRNELALVLGYDTYANYNLDIKMAKNADTVLSFVNDLIVKLQDPAKKELDIL 366

Query: 336 QEMKSKDVK-KLNQDEDPNYYIWDHRYYDNKYLLENFNVDLEKISEYFPLETTITGMLQI 394
           + +K ++ + + N   D +YYIWDHRYYDNKYL ENFNVD EKI+EY+PLE+TI GML+I
Sbjct: 367 KNLKKQEFENEFNMVYDGDYYIWDHRYYDNKYLKENFNVDEEKIAEYYPLESTIDGMLKI 426

Query: 395 YETLFNLKFIEIKDGQSKSVWHDDVKQLAVWNMDDPKSPKFVGWIYFDLHPRDGKYGHAA 454
           YETL  LKF+E+K  ++K  WHDDVKQLAVW +D P++P+FVGWI+FDLHPRDGKYGHAA
Sbjct: 427 YETLLKLKFVEVK--ENKKTWHDDVKQLAVWKLDTPENPEFVGWIFFDLHPRDGKYGHAA 484

Query: 455 NFGLSSSFMTNDSVRSYPVTALVCNFSKSTKDKPSLLKHNEIVTFFHELGHGIHDLVGQN 514
           NFGLSSS+++ +  RSYP+TALVCNFSKSTKDKPSLLKH+EI TFFHELGHGIHDLVG N
Sbjct: 485 NFGLSSSYISANGTRSYPITALVCNFSKSTKDKPSLLKHSEITTFFHELGHGIHDLVGNN 544

Query: 515 KESRFNGPGSVPWDFVEAPSQMLEFWTWNKNELIDLSSHYETGEKIPESLIDSLIKTKHV 574
           +  RFNGPG+VPWDFVEAPSQMLEFWTWN  EL+ LS +Y+   KI   L++SLIKTKHV
Sbjct: 545 RIGRFNGPGAVPWDFVEAPSQMLEFWTWNTKELLSLSQNYKDNAKIDTKLLESLIKTKHV 604

Query: 575 NGALFTLRQLHFGLFDMKVH--TCKDLQNLSICETWNQLRQDISLISNGGTLSKGYDSFG 632
           NGALF LRQLHFGLFDMKVH  + ++L  L I + WN LR+ I LISNG   + GY+SFG
Sbjct: 605 NGALFALRQLHFGLFDMKVHMMSAEELDKLDIKKLWNDLREKICLISNGDQPTTGYNSFG 664

Query: 633 HIMSDSYSAGYYGYLWAEVFATDMYHTKFAKDPLNTKNGIQYRDIVLARGGLNDIGDDLK 692
           HIMS SYSAGYYGY+WAEVFATDMY+TKF  DPLN + G++YRDIVLARGGL +I D+L+
Sbjct: 665 HIMSGSYSAGYYGYMWAEVFATDMYYTKFKADPLNPEVGVKYRDIVLARGGLYEIDDNLE 724

Query: 693 KFLGREPSKDAFLKELGLQ 711
           +FLGR+P+KDAFL+ELGL 
Sbjct: 725 EFLGRKPAKDAFLEELGLH 743

>Ecym_1011 Chr1 (19924..22074) [2151 bp, 716 aa] {ON} similar to
           Ashbya gossypii AGR406C/ AGR405C
          Length = 716

 Score =  801 bits (2068), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 389/693 (56%), Positives = 516/693 (74%), Gaps = 11/693 (1%)

Query: 22  RSLYSMSNATSFPIAPQAPPNWTFTPNDINGKTKEIIDKSNNFYESMSNVETPTVTNFVE 81
           RS+++     S  ++P+  P+W F  ++I    ++ ID+   FY+S++++ETP + NFV 
Sbjct: 31  RSVHNQERNMSSLLSPKLAPSWDFAADEIVSLAQKAIDEGTKFYDSVASLETPDLENFVV 90

Query: 82  PFMKFENELGPIINQLTFLQHVSSDKEIRDASVNSSMKLDELNIDLSLRHDIYLQFARVW 141
             +  E+E    ++QLTFLQHVS+DKE+RDAS+ ++  + E  I+ S R+D+Y QF++VW
Sbjct: 91  AVIDHEDETDGYMSQLTFLQHVSADKEVRDASIEATKLIQEWGIETSSRYDLYSQFSKVW 150

Query: 142 QDAQSKSDSIER----ETFKYIEKSYKDYIHSGLELDESNRLKIKDIKKKISVNSINFSK 197
           +  Q K D   +    E + Y+E   KDYIH+G+ L E +R KIK+IKKK++ NS+ FS 
Sbjct: 151 E--QYKDDENLKKNDPELYWYMENVNKDYIHAGMGLPEESRNKIKEIKKKLANNSLAFSN 208

Query: 198 NLGEQKEYITFTKEQLEGVPDSVLAQFETIKSDKDRNETLYKVTFKYPDIFPVMKLASSA 257
           NLGEQ +YI FTK++L GV ++ L QFE +  D       YK+TFKYPDI PV+  A + 
Sbjct: 209 NLGEQNDYIAFTKDELVGVSETTLGQFEKVIEDGVEK---YKMTFKYPDIHPVLNTAKNP 265

Query: 258 QTRKEAFLADQNKVPENEAILLDTLELRDKLASLLGYDTYANYNLYDKMAKDSTTVMDFL 317
           +TRK A++ DQNKVP+NE IL++TL+LR++LA + G+ TYA+Y L  KMAK   TV +FL
Sbjct: 266 ETRKRAYIGDQNKVPQNEQILIETLKLRNELAEIHGHPTYASYQLEMKMAKKQETVFNFL 325

Query: 318 NDLKDKLIPLGKKELELLQEMKSKDVKKLNQDEDPNYYIWDHRYYDNKYLLENFNVDLEK 377
            DLKDKL+P GKK+LE L+ +K ++ K+L    + ++  WD+RYYD+KYL ENF+VD E+
Sbjct: 326 YDLKDKLLPGGKKDLENLKSLKEQEYKELGLPYNGSFNSWDYRYYDDKYLKENFDVDEEE 385

Query: 378 ISEYFPLETTITGMLQIYETLFNLKFIEIKDGQSKSVWHDDVKQLAVWNMDDPKSPKFVG 437
           +++YFPL+ TI GML IY+ LFNLKF+E      K+VWH+DVKQ AVW++D   +P+FVG
Sbjct: 386 LAKYFPLQHTIDGMLNIYQKLFNLKFVEETRECGKNVWHEDVKQFAVWDLDKC-NPEFVG 444

Query: 438 WIYFDLHPRDGKYGHAANFGLSSSFMTNDSVRSYPVTALVCNFSKSTKDKPSLLKHNEIV 497
           WIYFDLHPR+GKYGHAANFGL S ++T +  R YPVT LVCNFSK +  +P+LLKH E+V
Sbjct: 445 WIYFDLHPREGKYGHAANFGLYSPYVTEEGTRHYPVTVLVCNFSKPSSTRPALLKHGEVV 504

Query: 498 TFFHELGHGIHDLVGQNKESRFNGPGSVPWDFVEAPSQMLEFWTWNKNELIDLSSHYETG 557
           TFFHELGHGIH LVG+++    NGP S+PWDFVEAPSQMLEFW WNK++++ LS HYETG
Sbjct: 505 TFFHELGHGIHALVGKSRIGHLNGPSSIPWDFVEAPSQMLEFWPWNKDQILKLSKHYETG 564

Query: 558 EKIPESLIDSLIKTKHVNGALFTLRQLHFGLFDMKVHTCKDLQNLSICETWNQLRQDISL 617
           E+IP+ L+DSLIKTKHVN  L  LRQLHF LFDM VHT K+L  L I   WN LR++++L
Sbjct: 565 EQIPDELVDSLIKTKHVNAGLSNLRQLHFSLFDMTVHTDKELDKLDIKSLWNNLREEVTL 624

Query: 618 ISNGGTLSKGYDSFGHIMSDSYSAGYYGYLWAEVFATDMYHTKFAKDPLNTKNGIQYRDI 677
           ISNG  L+KGYDSF HIMS  YSAGYYGY+W+EVFA DMYHT FA +PL+T  G +YRDI
Sbjct: 625 ISNGDVLTKGYDSFSHIMS-GYSAGYYGYMWSEVFAADMYHTMFAPNPLDTSVGTRYRDI 683

Query: 678 VLARGGLNDIGDDLKKFLGREPSKDAFLKELGL 710
           +LA+GGL DI D L++FLGREP+  AFLKELGL
Sbjct: 684 ILAKGGLRDIEDSLEEFLGREPNNKAFLKELGL 716

>AGR406C Chr7 complement(1472496..1474547) [2052 bp, 683 aa] {ON}
           Non-syntenic homolog of Saccharomyces cerevisiae YCL057W
           (PRD1); Tandem gene duplication in this genome
          Length = 683

 Score =  695 bits (1793), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 351/681 (51%), Positives = 471/681 (69%), Gaps = 11/681 (1%)

Query: 35  IAPQAPPNWTFTPNDINGKTKEIIDKSNNFYESMSNVETPTVTNFVEPFMKFENELGPII 94
           + PQA P+W F+  D+   + ++I+++   Y ++   + PT+ N++ P +  E E   + 
Sbjct: 8   VPPQAAPSWNFSAQDVISLSHQLINQTEAVYHNVLQEKPPTIDNYIMPLIYHEEETDLLW 67

Query: 95  NQLTFLQHVSSDKEIRDASVNSSMKLDELNIDLSLRHDIYLQFARVWQDAQSKSDSIER- 153
           NQL FL++VS D EIR+AS N++  LD+  I L+ ++D+Y  F  VW  AQ K D   + 
Sbjct: 68  NQLVFLRNVSPDPEIREASKNATSMLDDWIIGLTSKYDLYQHFDEVW--AQYKDDEKFKK 125

Query: 154 ---ETFKYIEKSYKDYIHSGLELDESNRLKIKDIKKKISVNSINFSKNLGEQKEYITFTK 210
              E ++Y+EK    Y  SG+++   NR ++ ++K KI+   + FS NLGE+ EYI FTK
Sbjct: 126 ENFELYRYMEKDADGYRRSGMKVPVENRKRLDEVKSKIAAAELEFSSNLGEEVEYIAFTK 185

Query: 211 EQLEGVPDSVLAQFETIKSDKDRNETLYKVTFKYPDIFPVMKLASSAQTRKEAFLADQNK 270
           E+LEGVPD+VL QFE I          +KVTFKYPDI PV++LAS+ +TR+ A +AD+N+
Sbjct: 186 EELEGVPDTVLNQFEKIIEGGVEK---FKVTFKYPDIGPVLRLASNPETRRRASMADENR 242

Query: 271 VPENEAILLDTLELRDKLASLLGYDTYANYNLYDKMAKDSTTVMDFLNDLKDKLIPLGKK 330
           V  NE +L +TLELR +LA LLG+  +A YNL DKMAK+  TV+ FLNDL +KL+P+GK 
Sbjct: 243 VAANEPLLFETLELRRELADLLGFKNFAAYNLDDKMAKNEETVLKFLNDLVEKLLPVGKN 302

Query: 331 ELELLQEMKSKDVKKLNQDEDPNYYIWDHRYYDNKYLLENFNVDLEKISEYFPLETTITG 390
           +LE+L++ K++D K  N   D  +Y WD  YY NK L E +NV+ + +++YFP+E+ I G
Sbjct: 303 DLEILKKKKAEDYKSKNLTFDGEFYSWDTGYYTNKILRERYNVNPDDLAQYFPVESAIEG 362

Query: 391 MLQIYETLFNLKFIEIKDGQSKSVWHDDVKQLAVWNMDDPKSPKFVGWIYFDLHPRDGKY 450
           ML IY TLF LKF+EI D   KSVWH+DVKQ AVWN+DD  +PKF GW+YFDLHPRDGKY
Sbjct: 363 MLNIYTTLFRLKFVEITDECEKSVWHEDVKQFAVWNIDDEDNPKFQGWLYFDLHPRDGKY 422

Query: 451 GHAANFGLSSSFMTNDSVRSYPVTALVCNFSKSTKDKPSLLKHNEIVTFFHELGHGIHDL 510
           GHAANFG+ S++   D  +SYPVT LV NFSK T  +P+LLK  E+ TFFHELGHGIHDL
Sbjct: 423 GHAANFGMVSAYRKRDGSKSYPVTILVTNFSKPTPTRPALLKLGELTTFFHELGHGIHDL 482

Query: 511 VGQNKESRFNGPGSVPWDFVEAPSQMLEFWTWNKNELIDLSSHYETGEKIPESLIDSLIK 570
           VG N     NGPGSVPWDFVEAPSQMLE+WT  ++ L  LS HYETGEKIP+SL+D+   
Sbjct: 483 VGSNDLESLNGPGSVPWDFVEAPSQMLEYWTARRDVLTMLSKHYETGEKIPKSLLDAWFS 542

Query: 571 TKHVNGALFTLRQLHFGLFDMKVHTCKDLQNLSICETWNQLRQDISLISNGGTLSKGYDS 630
              +N  L  L QL  GLFDM VHT +D +   + + WN L ++I L++     S GYDS
Sbjct: 543 VGGLNSGLANLGQLKLGLFDMYVHT-RDYKGAEVRKLWNDLTREIGLMNLKNYTSTGYDS 601

Query: 631 FGHIMSDSYSAGYYGYLWAEVFATDMYHTKFAKDPLNTKNGIQYRDIVLARGGLNDIGDD 690
           FGHIM+   +  YYGYLW++VFA DMY TKF  +P N   G++YRD +LA GGL D+ D+
Sbjct: 602 FGHIMAGYAAG-YYGYLWSQVFAADMYDTKFKPNPFNATVGVEYRDTILATGGLYDMTDN 660

Query: 691 LKKFLGREPSKDAFLKELGLQ 711
           L+KFLGR+P+  AFL+ LGL+
Sbjct: 661 LRKFLGRDPNNKAFLRGLGLK 681

>AGR405C Chr7 complement(1469769..1471922) [2154 bp, 717 aa] {ON}
           Non-syntenic homolog of Saccharomyces cerevisiae YCL057W
           (PRD1); Tandem gene duplication in this genome
          Length = 717

 Score =  674 bits (1740), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 332/681 (48%), Positives = 461/681 (67%), Gaps = 11/681 (1%)

Query: 35  IAPQAPPNWTFTPNDINGKTKEIIDKSNNFYESM-SNVETPTVTNFVEPFMKFENELGPI 93
           + PQ PP W +T  ++      +  KS+  YES+ S  +  T+ N++ P +  + E   +
Sbjct: 13  VPPQPPPVWNYTATEVIDLAYGLAQKSDAVYESVFSQKDEFTLDNYIWPLLYNDQETDLL 72

Query: 94  INQLTFLQHVSSDKEIRDASVNSSMKLDELNIDLSLRHDIYLQFARVWQDAQSKSDS--- 150
            NQL FL++VS D ++R+AS+++   LD+   ++S ++D+Y  F  +W   Q K D    
Sbjct: 73  WNQLIFLRNVSPDPKVREASLSTGKILDQWVANISSKYDLYTNFEHIW--TQYKDDEEFK 130

Query: 151 -IERETFKYIEKSYKDYIHSGLELDESNRLKIKDIKKKISVNSINFSKNLGEQKEYITFT 209
               E +KY+EK    Y  +   L  +  +++  + +KISV+++ FS NLGE+ EYITFT
Sbjct: 131 VTNYELYKYMEKDASYYNRNKRNLTNAESIELGQVTRKISVDTLQFSINLGEETEYITFT 190

Query: 210 KEQLEGVPDSVLAQFETIKSDKDRNETLYKVTFKYPDIFPVMKLASSAQTRKEAFLADQN 269
           +E+LEGV   VL QFE I     +     KVTFKYPDI PV++ A++ +TR++A++ADQN
Sbjct: 191 EEELEGVSPLVLDQFERIIEGGVKK---LKVTFKYPDIGPVLRTATNPETRRKAYVADQN 247

Query: 270 KVPENEAILLDTLELRDKLASLLGYDTYANYNLYDKMAKDSTTVMDFLNDLKDKLIPLGK 329
           +V  NE +L +TL+LR ++A L GY  YA YNL DKMAK+  TV+ FL DL ++L+P+G+
Sbjct: 248 RVAANEQLLFETLDLRRRMAQLRGYKNYAEYNLRDKMAKNEETVIPFLTDLVERLLPVGE 307

Query: 330 KELELLQEMKSKDVKKLNQDEDPNYYIWDHRYYDNKYLLENFNVDLEKISEYFPLETTIT 389
           K+ E+L+  K++D K  N   D   Y WD+ YY+NK L E + +D E +++YFP+E+ I 
Sbjct: 308 KDREILKSKKAEDYKSKNLTFDGEIYAWDNAYYNNKILQEKYQIDPEDMAQYFPIESVIE 367

Query: 390 GMLQIYETLFNLKFIEIKDGQSKSVWHDDVKQLAVWNMDDPKSPKFVGWIYFDLHPRDGK 449
           GML  Y+TLF LKF+E+ D   K+VWH+DVKQ AVWN+DD   P+F GWIYFDL+PRDGK
Sbjct: 368 GMLDTYQTLFRLKFVEVTDPSQKNVWHEDVKQFAVWNIDDEDCPEFQGWIYFDLYPRDGK 427

Query: 450 YGHAANFGLSSSFMTNDSVRSYPVTALVCNFSKSTKDKPSLLKHNEIVTFFHELGHGIHD 509
           Y HAANFG++S+F   D  +SYPVT LVCN +K T  + ++L+  EI T FHELGHGIH 
Sbjct: 428 YSHAANFGMASAFRKKDGSQSYPVTVLVCNLTKPTPTRTAILRPGEITTLFHELGHGIHH 487

Query: 510 LVGQNKESRFNGPGSVPWDFVEAPSQMLEFWTWNKNELIDLSSHYETGEKIPESLIDSLI 569
           LV  NK +  N  GSVPWDFVEAPSQMLE+WT  ++ L  LS HYETGEKIP SL+D+  
Sbjct: 488 LVANNKLAAHNSLGSVPWDFVEAPSQMLEYWTGRRDVLTMLSKHYETGEKIPPSLLDAWF 547

Query: 570 KTKHVNGALFTLRQLHFGLFDMKVHTCKDLQNLSICETWNQLRQDISLISNGGTLSKGYD 629
            +  +   L+ L QL  GLFDM VHT ++   L + + WN +R++ISLI++    S GY+
Sbjct: 548 NSSGLGSGLYYLGQLRLGLFDMYVHT-REYHGLEVRKLWNDMRREISLINSQNYTSTGYN 606

Query: 630 SFGHIMSDSYSAGYYGYLWAEVFATDMYHTKFAKDPLNTKNGIQYRDIVLARGGLNDIGD 689
           +FGHIM+ SYSAGYYGYLW++VFA DMY TKF  +P N+  G QYRD +LA GGL D+ D
Sbjct: 607 TFGHIMTGSYSAGYYGYLWSQVFAADMYQTKFKSNPFNSTVGRQYRDTILAPGGLYDMND 666

Query: 690 DLKKFLGREPSKDAFLKELGL 710
           +L+KFLGREP+  AFL+ LG 
Sbjct: 667 NLRKFLGREPNNRAFLRGLGF 687

>ABR185W Chr2
           (758126..758380,758380..758709,758709..759029,
           759033..759122,759122..759499) [1374 bp, 457 aa] {ON}
           Non-syntenic homolog of Saccharomyces cerevisiae YCL057W
           (PRD1); 3-intron; artificial frameshift
          Length = 457

 Score =  373 bits (957), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 194/414 (46%), Positives = 266/414 (64%), Gaps = 7/414 (1%)

Query: 298 ANYNLYDKMAKDSTTVMDFLNDLKDKLIPLGKKELELLQEMKSKDVKKLNQDEDPNYYIW 357
           A Y L  K AK+   V  FLNDL++KL P        L+++K ++ K+L    D   Y  
Sbjct: 49  AAYVLEVKTAKNVDNVNSFLNDLREKLKPASADNWRPLKKLKEQECKELGNFYDGELYSQ 108

Query: 358 DHRYYDNKYLLENFNVDLEKISEYFPLETTITGMLQIYETLFNLKFIEIKDGQSKSVWHD 417
           D  YY+ K L +NF+VD E+ ++YFPLE TI  ML  Y TLF   F+E  +  +++VWH+
Sbjct: 109 DLCYYEQKLLRDNFSVDEEETAQYFPLEHTIKFMLDTYNTLFRHNFVEETEPATRNVWHE 168

Query: 418 DVKQLAVWNMDDPKSPKFVGWIYFDLHPRDGKYGHAANFGLSSSFMTNDSVRSYPVTALV 477
           D KQ +VW MDD  +P+F GW+YFDLHPRDGK+GH A F    + M+ +  R YPVT+LV
Sbjct: 169 DDKQYSVWKMDDWDAPQFTGWLYFDLHPRDGKFGHLACFDNVYTDMSEEGSRVYPVTSLV 228

Query: 478 CNFSKSTKDKPSLLKHNEIVTFFHELGHGIHDLVGQNKESRFNGPGSVPWDFVEAPSQML 537
           CNFS  +K+KP+LLKH E+  FFHELGHG H L+   +         VP DF+EAPSQML
Sbjct: 229 CNFSNPSKEKPALLKHYEVQAFFHELGHGSHKLLCAPELC--CSSSWVPRDFIEAPSQML 286

Query: 538 EFWTWNKNELIDLSSHYETGEKIPESLIDSLIKTKHVNGALFTLRQLHFGLFDMKVHT-C 596
           E+W W K+ + DLS H ETGE+IPESL+D ++K+K  N A+  L Q+   L DM VH   
Sbjct: 287 EYWIWRKDVITDLSKH-ETGERIPESLVDCMVKSKRANAAIDNLIQV-LALLDMAVHKHV 344

Query: 597 KDLQNLSICETWNQLRQDISLISNGGTLSKGYDSFGHIMSDSYSAGYYGYLWAEVFATDM 656
              + L +   WN L +D+ LI N    ++ Y SF HI+ + Y+AGYYGY W++VFA DM
Sbjct: 345 GSYETLDLNALWNNLCEDVILIKNPEP-TRAYCSFSHIV-EGYAAGYYGYQWSKVFAADM 402

Query: 657 YHTKFAKDPLNTKNGIQYRDIVLARGGLNDIGDDLKKFLGREPSKDAFLKELGL 710
           Y ++F K  L+   G  Y D ++ARGGL ++ D+L +FL REP+ +A+L++ GL
Sbjct: 403 YFSRFEKAHLDPTLGKLYGDTIIARGGLYEMEDNLGEFLDREPNNEAYLRDQGL 456

 Score = 37.0 bits (84), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 13/40 (32%), Positives = 23/40 (57%)

Query: 37 PQAPPNWTFTPNDINGKTKEIIDKSNNFYESMSNVETPTV 76
          PQ  P+W  +P  IN K +  ++ +   +  ++NV+ PTV
Sbjct: 7  PQPAPSWDLSPAQINDKVQTALESAARMFAELANVKLPTV 46

>KAFR0D02950 Chr4 complement(581305..583638) [2334 bp, 777 aa] {ON}
           Anc_2.432 YKL134C
          Length = 777

 Score =  199 bits (507), Expect = 9e-54,   Method: Compositional matrix adjust.
 Identities = 176/672 (26%), Positives = 307/672 (45%), Gaps = 45/672 (6%)

Query: 46  TPNDINGKTKEIIDKSNNFYESMSNVETPT-VTNFVEPFMKFENELGPIINQLTFLQHVS 104
           TP  +   +K  + K+N   + M N  T   +  ++    +  + L  +I+   F++ V 
Sbjct: 89  TPEGLLTFSKASLWKANELVKIMKNDNTKQGLLKYIVRLDQLSDTLCRVIDLCEFIRSVH 148

Query: 105 SDKEIRDASVNSSMKLDELNIDLSLRHDIYLQFARVWQDAQSKSDSIERETFKYIEKSYK 164
            DKE   A+     ++ E    L+   ++  +   +  D +  S  +  E  K      +
Sbjct: 149 PDKEFLSAAQQCHEEMFEFMNTLNTDVELCDKLKTLLHDNEILS-KLSEEEIKVGRILLE 207

Query: 165 DYIHSGLELDESNRLKIKDIKKKISVNSINFSKNLGEQK-EYITFTKEQLEGVPDSVLAQ 223
           D+  SG+ ++   R +  ++ ++IS+   +F  N  + K  YI     +LE    + L  
Sbjct: 208 DFEKSGIYMNPRIREQFIELSQEISLIGQDFINNANQPKTNYIKVNASKLESAGLNRLL- 266

Query: 224 FETIKSDKDRNETLYKVTFKYPDIFPVMKLASSAQTRKEAFLADQNKVPENEAILLDTLE 283
             ++K D  R    YK+    P  + V+K   + + R + + A  +   E    L   ++
Sbjct: 267 LNSLKKDAIREN--YKIPTYGPTPYAVLKDCKNEEVRADIWTALHSCSSEQILRLSHLVK 324

Query: 284 LRDKLASLLGYDTYANYNLYDKMAKDSTTVMDFLNDLKDKLIPLGKKELELLQEMKSKDV 343
           LR  LA+L+G ++++ Y L  K+AK    V +F+  L   + P  +KEL+ + ++K +D 
Sbjct: 325 LRAMLANLMGAESFSQYQLKGKLAKAPKDVKNFIETLIKYVRPNTEKELKFIADLKREDQ 384

Query: 344 KKLNQDED----PNYYIWDHRYYDNKYLLENFNVD---LEKISEYFPLETTITGMLQIYE 396
            K+N  E          WD  YY + Y       +    E +S YF L     G+  +  
Sbjct: 385 GKINCGEMDGVLSTVRPWDRDYYSSIYFKGKEKTEHEFTEPLSSYFTLGGVFEGLSDLLT 444

Query: 397 TLFNLKFIEIKDGQSKSVWHDDVKQLAVWNMDDPKSPKFVGWIYFDLHPRDGKYGHAANF 456
            ++ +K +E     S   W +DV+++ V + ++      +G IYFDL  R GK  + A+F
Sbjct: 445 QIYGIK-LEPAIPVSGETWFNDVRKINVISEEE----GIIGIIYFDLFERYGKTSNPAHF 499

Query: 457 GLSSSF----------------MTNDSVRSYPVTALVCNFSKST--KDKP-SLLKHNEIV 497
            +  S                   + ++   P+ +LVCNFS+ T   DK   LL  +EI 
Sbjct: 500 TVCCSREMYPEENADSIIQLGSKKDGTIFQLPIISLVCNFSRRTFQSDKTICLLTLSEIE 559

Query: 498 TFFHELGHGIHDLVGQNKESRFNGPGSVPWDFVEAPSQMLEFWTWNKNELIDLSSHYETG 557
           T FHE+GH IH ++G+      +G      DFVE PS ++E +  +   L  +S HYETG
Sbjct: 560 TLFHEMGHAIHSMLGRTTLQNVSGTRCAT-DFVELPSILMEHFASDTRVLKKMSCHYETG 618

Query: 558 EKIPESLIDSLIKTKHVNGALFTLRQLHFGLFDMKVHTCK---DLQNLSICETWNQLRQD 614
           EKI E  +   +K      +  T  Q    + D ++H+ K   +L NL++ E +  L + 
Sbjct: 619 EKIAEKKLQFHLKEGEFLRSCETFSQAKMAMLDQELHSDKIIHNLDNLNVVEIYQNLERR 678

Query: 615 ISLISNGGTLSKGYDSFGHIMSDSYSAGYYGYLWAEVFATDMYHTKFAKDPLNTKNGIQY 674
           + ++ +    S     FGH+    Y A YY YL+    A  +++  FA DP N  NG ++
Sbjct: 679 LQVLVDDR--SNWCGKFGHLF--GYGATYYSYLFDRAIARKVWNHLFANDPFNKTNGEKF 734

Query: 675 RDIVLARGGLND 686
           ++ +L  GG  D
Sbjct: 735 KESLLKWGGSKD 746

>NDAI0E02010 Chr5 complement(404579..406915) [2337 bp, 778 aa] {ON}
           Anc_1.9 YCL057W
          Length = 778

 Score =  196 bits (499), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 165/647 (25%), Positives = 302/647 (46%), Gaps = 59/647 (9%)

Query: 77  TNFVEPFMKFENELGPIINQLTFLQHVSSDKEIRDASVNSSMKLDELNIDLSLRHDIYLQ 136
            NFV    +  + L  +I+   F++    ++   +A+ +   KL E    L+   ++   
Sbjct: 123 VNFVIELDRLSDTLCRVIDLCEFIRSAHPEEGFIEAAQDCHEKLFEFMNVLNTDRELCEL 182

Query: 137 FARVWQDAQSKSD-SIERETFKYIEKSYKDYIHSGLELDESNRLKIKDIKKKISVNSINF 195
                QD Q  S  S E +   YI    +D+I SG+ +D   + +   + + ISV    +
Sbjct: 183 LNETLQDEQVLSKLSEEEKKVGYI--LLQDFIKSGIYMDSGKKDQFITLSQDISVIGQEY 240

Query: 196 SKNLGE-QKEYITFTKEQLE--GVPDSVLAQFETIKSDKDRNETLYKVTFKYPDIFPVMK 252
             N+ +  + +I   + +L+  G+   V  Q       KD     YK+       F ++K
Sbjct: 241 INNINQLARNHIKVKRSELDNAGIEFDVACQL-----GKDITGKYYKIPTYGHLPFLILK 295

Query: 253 LASSAQTRKEAFLADQNKVPENEAILLDTLELRDKLASLLGYDTYANYNLYDKMAKDSTT 312
             +  + RK+ ++A  +   +    L + +++R  LA  +G + YA Y +  KMAK+   
Sbjct: 296 ACTDPEIRKKIWVAMHDCSKQQIERLTNLVKIRAFLAHTMGRECYAAYAIDGKMAKNPKD 355

Query: 313 VMDFLNDLKDKLIPLGKKELELLQEM--------KSKDVKKLNQDEDP---NYYIWDHRY 361
           V +FL  L D L P   KEL+ + ++         S DV ++     P    YY   HR 
Sbjct: 356 VDEFLKSLMDFLKPKAAKELKFISDLIHNEKGEKPSDDVDEILTAVRPWDREYYTAIHRN 415

Query: 362 YDNKYLLENFNVDLEKISEYFPLETTITGMLQIYETLFNLKFIEIKDGQSKSVWHDDVKQ 421
                LL+++ +D+     Y+PL   I G+  I+E+++ ++F     G+ ++ W  DV++
Sbjct: 416 KQKHLLLDDYALDV-----YYPLGNVIQGLSDIFESIYGIRFEPAVAGKGET-WSSDVRR 469

Query: 422 LAVWNMDDPKSPKFVGWIYFDLHPRDGKYGHAANFGLSSS--------------FMTN-D 466
           L V +    +    +G IY DL  R GK  +AA+F +  S                TN D
Sbjct: 470 LNVVS----EKEGLIGIIYCDLFRRQGKTNNAAHFTICCSRQIYPHEDDFSTIQLGTNVD 525

Query: 467 SVR-SYPVTALVCNFSK---STKDKPSLLKHNEIVTFFHELGHGIHDLVGQNKESRFNGP 522
             +   P+ +L+CNF+    ++ +   LL  NEI T FHE+GH IH ++G+ +    +G 
Sbjct: 526 GTKFQLPIISLLCNFNTRCLNSGETICLLALNEIETLFHEMGHAIHSMLGRTRLQNVSGT 585

Query: 523 GSVPWDFVEAPSQMLEFWTWNKNELIDLSSHYETGEKIPESLIDSLIKTKHVNGALFTLR 582
                DFVE PS ++E +  +   L  +  HY+TG+++P +L++  ++         T  
Sbjct: 586 -RCSTDFVELPSVLMEHFARDTRVLKRIGHHYKTGDRVPATLLNRYLEKARFLKDCETFS 644

Query: 583 QLHFGLFDMKVHTCKDLQNL---SICETWNQLRQDISLISNGGTLSKGYDSFGHIMSDSY 639
           Q    + D +++    +QN+    + + +++L +++ ++ +    S     FGH+    Y
Sbjct: 645 QAKMAMLDQRLYDKNIVQNIDSVDVVKIYHELEKELEVLVDDE--SNWCAKFGHLF--GY 700

Query: 640 SAGYYGYLWAEVFATDMYHTKFAKDPLNTKNGIQYRDIVLARGGLND 686
            A YY YL+    A+ ++   F KDP +   G ++++ VL  GGL +
Sbjct: 701 GATYYCYLFDRAIASKVWKKLFEKDPYSRSGGEKFKNDVLKWGGLRE 747

>ZYRO0G20130g Chr7 (1666665..1669025) [2361 bp, 786 aa] {ON} similar
           to uniprot|P35999 Saccharomyces cerevisiae YKL134C OCT1
           Mitochondrial intermediate peptidase cleaves N-terminal
           residues of a subset of proteins upon import after their
           cleavage by mitochondrial processing peptidase
           (Mas1p-Mas2p) may contribute to mitochondrial iron
           homeostasis
          Length = 786

 Score =  194 bits (493), Expect = 8e-52,   Method: Compositional matrix adjust.
 Identities = 171/707 (24%), Positives = 313/707 (44%), Gaps = 76/707 (10%)

Query: 46  TPNDINGKTKEIIDKSNNFYESMSNVETPT-VTNFVEPFMKFENELGPIINQLTFLQHVS 104
           +P+ +   +++ ++++    E M N ETP  + N++    +  + L  +I+   F++   
Sbjct: 97  SPDGLRKFSRQSLNQAYELLEDMKNDETPQGLQNYILRLDQLSDTLCRVIDLCEFIRSSH 156

Query: 105 SDKEIRDASVNSSMKLDE----LNIDLSLRHDIYLQFARVWQDAQSKSDSIERETFKYIE 160
            D    DA+ +   ++ E    LN D++L + +     R   +       +  E  K  +
Sbjct: 157 PDSHFVDAAQDCHEEMFEFMNVLNTDVNLCNKL-----RTVLNTPEVVCKLSSEEVKVGK 211

Query: 161 KSYKDYIHSGLELDESNRLKIKDIKKKISVNSINFSKNLG-EQKEYITFTKEQLE--GVP 217
              +D+  SG+ ++   R +   + ++IS+   +F  N    +  YIT   E +   G+ 
Sbjct: 212 ILLEDFEKSGIYMNPEIREQFIALSQEISIVGQDFINNTDFVRTNYITVDCETIHNSGIN 271

Query: 218 DSVLAQFETIKSDKDRNETLYKVTFKYPDIFPVMKLASSAQTRKEAFLADQNKVPENEAI 277
             +L+Q       KD     YK+       + V++       RK+ + A  +  P+ + +
Sbjct: 272 QLILSQLS-----KDIKGKHYKIPTHGYIAYSVLRACPDEIVRKKLWTA-MHSCPDKQIV 325

Query: 278 LLDTL-ELRDKLASLLGYDTYANYNLYDKMAKDSTTVMDFLNDLKDKLIPLGKKELELLQ 336
            LD L  LR  LA L+G  +YA Y L  KMAK    V DF++ L     P  K+EL  + 
Sbjct: 326 RLDQLVRLRAVLAFLMGKKSYAEYQLEGKMAKSPEEVTDFIDSLIKVTQPKAKQELGFIS 385

Query: 337 EMKSKDV-----KKLNQDEDPNYYIWDHRYYDNKYLLENFN---VDLEKISEYFPLETTI 388
           ++K K +     +  N D       WD  +Y   Y ++      +D ++IS YF L   +
Sbjct: 386 DLKRKHMDLPPSETSNLDTLDIVRPWDRDFYHTIYSIQQRRQSPIDDQQISMYFTLGNVM 445

Query: 389 TGMLQIYETLFNLKFIEIKDGQSKSVWHDDVKQLAVWNMDDPKSPKFVGWIYFDLHPRDG 448
            G+  ++  ++ ++ +E    Q    W  +V++L V + ++      +G +Y DL  RDG
Sbjct: 446 QGLSDLFHQIYGIR-LEPVIAQKGETWSPEVRRLNVVSDEE----GVIGVVYCDLFERDG 500

Query: 449 KYGHAANFGLSSS--------------FMTNDSVRSY--PVTALVCNFSKST---KDKPS 489
           K  + ++F +  S                TN     +  P+ +LVCNF+ S         
Sbjct: 501 KTSNPSHFTVCCSRQIYPKENDLSTIQIGTNKDGTKFQLPIISLVCNFASSVVSFGQSLC 560

Query: 490 LLKHNEIVTFFHELGHGIHDLVGQNKESRFNGPGSVPWDFVEAPSQMLEFWTWNKNELID 549
           LL  +EI T FHE+GH +H ++G+ +    +G      DFVE PS ++E +  +   L  
Sbjct: 561 LLHISEIETLFHEMGHAMHSMLGRTRLQNLSGT-RCATDFVELPSILMEHFARDTRVLRQ 619

Query: 550 LSSHYETGEKIPESLIDSLIKTKHVNGALFTLRQLHFGLFDMKVH---TCKDLQNLSICE 606
           +  H  TGE +PESL+ + ++         T  Q    + D ++H       +  L +  
Sbjct: 620 IGKHCNTGEPVPESLLTNYLQDLQYMQYCETFSQAKMAMLDQRLHGKEIITGMDTLDVVA 679

Query: 607 TWNQLRQDISLISNGGTLSKGYDSFGHIMSDSYSAGYYGYLWAEVFATDMYHTKFAKDPL 666
            +  L +++ ++ +  +   G   FGH+    Y A YY YL+    A+ ++ + F +DP 
Sbjct: 680 LYQNLERELRVLVDDQSTWCG--RFGHLF--GYGATYYSYLFDRAIASKVWESLFQEDPF 735

Query: 667 NTKNGIQYRDIVLARGGLNDI----------------GDDLKKFLGR 697
           +   G ++++ VL  GG  D                 G D  +F+GR
Sbjct: 736 SRAGGQRFKEYVLKWGGAKDPWQCIADVLDQPELSQGGTDAMQFIGR 782

>SAKL0E03938g Chr5 (317017..319320) [2304 bp, 767 aa] {ON} similar
           to uniprot|P35999 Saccharomyces cerevisiae YKL134C OCT1
           Mitochondrial intermediate peptidase cleaves N-terminal
           residues of a subset of proteins upon import after their
           cleavage by mitochondrial processing peptidase
           (Mas1p-Mas2p) may contribute to mitochondrial iron
           homeostasis
          Length = 767

 Score =  192 bits (488), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 180/692 (26%), Positives = 316/692 (45%), Gaps = 68/692 (9%)

Query: 46  TPNDINGKTKEIIDKSNNFYESMSNVETPT-VTNFVEPFMKFENELGPIINQLTFLQHVS 104
           +P  +    +  + ++N   E+M +  +P    N++    +  + L  +I+   F++   
Sbjct: 80  SPQGLRKFCRHSLTQANELVETMRHDRSPKGYANYIANLDRLSDILCRVIDLAEFIRASH 139

Query: 105 SDKEIRDASVNSSMKLDE----LNIDLSLRHDIYLQFARVWQDAQSKSDSIERETFKYIE 160
            D     A+ +   ++ E    LN D++L  DI      V  D    S+ +  E  K  +
Sbjct: 140 PDPHFVQAAQDCHEEMFEIMNVLNTDVAL-CDI---LKHVLTDPTILSE-LSPEEIKVGK 194

Query: 161 KSYKDYIHSGLELDESNRLKIKDIKKKISVNSINFSKNLG-EQKEYITFTKEQL--EGVP 217
              +D+  SG+ ++   R +   + ++ISV   +F  N    +  YI    E+L   G+ 
Sbjct: 195 ILLEDFEKSGIHMNPEVREQFIALSQQISVVGQDFINNTEYVRSNYIKVEVEELNKSGIN 254

Query: 218 DSVLAQFETIKSDKDRNETLYKV-TFKYPDIFPVMKLASSAQTRKEAFLADQNKVPENEA 276
             VL Q       KD     YK+ TF Y   + +++       R + + A  +   +  A
Sbjct: 255 KIVLNQL-----SKDIKGRHYKIPTFGYIP-YSILRSCPDDNIRMKVWSALHSCSEKQIA 308

Query: 277 ILLDTLELRDKLASLLGYDTYANYNLYDKMAKDSTTVMDFLNDLKDKLIPLGKKELELLQ 336
            L   ++LR  LA+++G  ++A+Y L  KMAK    V  F+  L D   P   +EL+ + 
Sbjct: 309 RLDQLIKLRSVLANIMGKKSFAHYQLEGKMAKTPEYVRGFMQSLIDATKPKAAEELKFIA 368

Query: 337 EMKSKDVKKLNQDEDPNYYI------WDHRYYDNKYLLEN---FNVDLEKISEYFPLETT 387
           ++K+K V   N+  +  + I      WD  +Y + + L+    FN   E+IS YF L   
Sbjct: 369 DLKAKHVPG-NKPAESMHEILEMVKPWDRDFYGSVHALQQRRPFNN--EQISSYFSLGVV 425

Query: 388 ITGMLQIYETLFNLKFIEIKDGQSKSVWHDDVKQLAVWNMDDPKSPKFVGWIYFDLHPRD 447
           I G+  +++ ++ + ++E    ++   W  +V+++ V +    +    +G +Y DL  R 
Sbjct: 426 IQGLSNLFKQIYGI-YLEPVVPKTGETWSPEVRRINVVS----EKEGVIGVVYCDLFERQ 480

Query: 448 GKYGHAANFGLSSSFMTNDSVR----------------SYPVTALVCNFSKST---KDKP 488
           GK  + A+F +  S    D                     PV +LVCNFS +T   +   
Sbjct: 481 GKTANPAHFTVCCSRQIYDGETDLSTIQVGQNSKGEQFQLPVISLVCNFSPTTISQEQSI 540

Query: 489 SLLKHNEIVTFFHELGHGIHDLVGQNKESRFNGPGSVPWDFVEAPSQMLEFWTWNKNELI 548
            LL+ +EI T FHE+GH +H ++G+ K    +G      DFVE PS ++E +  +   L 
Sbjct: 541 CLLQLSEIETLFHEMGHAMHSMLGRTKLQNISGTRCAT-DFVELPSILMEHFARDHRVLQ 599

Query: 549 DLSSHYETGEKIPESLIDSLIKTKHVNGALFTLRQLHFGLFDMKVH---TCKDLQNLSIC 605
            ++SHY TGE IPE L+ S               Q    + D ++H     K++Q L I 
Sbjct: 600 RMASHYSTGESIPEQLLFSYQSEVKFLQHAEAFSQAKMAILDQELHGESIMKEMQYLDIV 659

Query: 606 ETWNQLRQDISLISNGGTLSKGYDSFGHIMSDSYSAGYYGYLWAEVFATDMYHTKFAKDP 665
           + ++ L + + ++S+  +   G   FGH+    Y A YY YL+    A+ ++   FA DP
Sbjct: 660 KLYHNLERQLEVLSDDKSNWCG--RFGHLF--GYGATYYSYLFDRAIASKIWQHLFANDP 715

Query: 666 LNTKNGIQYRDIVLARGGLND----IGDDLKK 693
              ++G ++++ VL  GG  D    I D L K
Sbjct: 716 FCRRSGEKFKNSVLKWGGSRDPWECIADALDK 747

>Skud_11.93 Chr11 complement(175243..177561) [2319 bp, 772 aa] {ON}
           YKL134C (REAL)
          Length = 772

 Score =  189 bits (480), Expect = 4e-50,   Method: Compositional matrix adjust.
 Identities = 173/678 (25%), Positives = 312/678 (46%), Gaps = 58/678 (8%)

Query: 46  TPNDINGKTKEIIDKSNNFYESMSNVETPTVT-NFVEPFMKFENELGPIINQLTFLQHVS 104
           +P+ +   ++  + ++    E M N  T +   +++    +  + L  +I+   F++   
Sbjct: 85  SPDGLRKFSQVSLKQAQTLLEKMRNDSTESGKLSYIINLDRLSDTLCRVIDLCEFIRSTH 144

Query: 105 SDKEIRDASVNSSMKLDE----LNIDLSLRHDIYLQFARVWQDAQSKSDSIERETFKYIE 160
            D +   A+ +   ++ E    LN D+SL         +   ++   S  +  E  K  +
Sbjct: 145 PDDKFVKAAQDCHEQMFEFMNVLNTDVSL-----CNILKSVLNSPEVSSKLSDEELKVGK 199

Query: 161 KSYKDYIHSGLELDESNRLKIKDIKKKISVNS---INFSKNLGEQKEYITFTKEQLEGVP 217
               D+  SG+ ++   R K  ++ ++IS+     IN +   G         K   + + 
Sbjct: 200 ILLDDFEKSGIYMNPDVREKFIELSQEISLIGQEFINHTDYPGSNS-----VKIPCKDLD 254

Query: 218 DSVLAQFETIKSDKDRNETLYKV-TFKYPDIFPVMKLASSAQTRKEAFLADQNKVPENEA 276
           +  ++ F   + +KD     YK+ TF Y   + ++K     + RK+ + A  +   +   
Sbjct: 255 NGNVSAFLLKQLNKDVKGQNYKIPTFGYA-AYALLKSCEKEEVRKKLWTALHSCSDKQIK 313

Query: 277 ILLDTLELRDKLASLLGYDTYANYNLYDKMAKDSTTVMDFLNDLKDKLIPLGKKELELLQ 336
            L   ++LR  LA+L+  ++YA Y L  KMAK+   V DF+  L +  I     EL+ + 
Sbjct: 314 RLSHLIKLRAILANLMNKESYAEYQLEGKMAKNPKDVQDFILTLMNGTIDKTANELKFIA 373

Query: 337 EMKSKDVKK-LNQDEDPNYYI---WDHRYYDNKYLLENFN--VDLEKISEYFPLETTITG 390
           E+K+KD+KK L    D    +   WD  YY  KYL  N +   + ++IS YF L   I G
Sbjct: 374 ELKTKDLKKPLATKTDDILRLVRPWDRDYYTGKYLQLNPSDAPNAKEISYYFTLGNVIEG 433

Query: 391 MLQIYETLFNLKFIEIKDGQSKSVWHDDVKQLAVWNMDDPKSPKFVGWIYFDLHPRDGKY 450
           +  +++ ++ ++ +E +       W  DV++L V + ++      +G IY DL  R+GK 
Sbjct: 434 LSDLFQHIYGIR-LEPEIADEGETWSPDVRRLNVISEEE----GIIGIIYCDLFERNGKT 488

Query: 451 GHAANFGLSSS---------FMT-------NDSVRSYPVTALVCNFSK---STKDKPSLL 491
            + A+F +  S         F T       + S    PV +LVCNF+    ++K     L
Sbjct: 489 SNPAHFTVCCSRQIYPNETDFSTIQVGENPDGSYFQLPVISLVCNFAPIPIASKKTLCFL 548

Query: 492 KHNEIVTFFHELGHGIHDLVGQNKESRFNGPGSVPWDFVEAPSQMLEFWTWNKNELIDLS 551
           + +E+ T FHE+GH +H ++G+      +G      DFVE PS ++E +  +   L  +S
Sbjct: 549 QLSEVETLFHEMGHAMHSMLGRTHMQNISGTRCAT-DFVELPSILMEHFAKDIRILTKIS 607

Query: 552 SHYETGEKIPESLIDSLIKTKHVNGALFTLRQLHFGLFDMKVH---TCKDLQNLSICETW 608
            HYETGE I   ++ S ++T +      T  Q    + D   H      D+ N  I + +
Sbjct: 608 KHYETGETIQAGMLQSFMRTTNFLQNCETYSQAKMAMLDQSFHDEEIISDIDNFDIVKNY 667

Query: 609 NQLRQDISLISNGGTLSKGYDSFGHIMSDSYSAGYYGYLWAEVFATDMYHTKFAKDPLNT 668
             L + + ++ +  +   G   FGH+    Y A YY YL+    A+ +++  F  DP + 
Sbjct: 668 QALERRLKVLVDDQSNWCG--RFGHLF--GYGATYYSYLFDRTIASKIWYALFEDDPYSR 723

Query: 669 KNGIQYRDIVLARGGLND 686
           KNG +++  +L  GGL D
Sbjct: 724 KNGDKFKKHLLKWGGLKD 741

>TBLA0I00710 Chr9 (128272..130593) [2322 bp, 773 aa] {ON} Anc_2.432
           YKL134C
          Length = 773

 Score =  187 bits (476), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 170/673 (25%), Positives = 307/673 (45%), Gaps = 56/673 (8%)

Query: 61  SNNFYESMSNVET-PTVTNFVEPFMKFENELGPIINQLTFLQHVSSDKEIRDASVNSSMK 119
           ++N  + + N +T   + N++    +  + L  +I+   F++    +K    A+      
Sbjct: 104 ASNILQQLKNDDTFNGLANYIIRLDQLSDTLCRVIDLCEFIRSCHPEKSFVQAAQECHEH 163

Query: 120 L----DELNIDLSLRHDIYLQFARVWQDAQSKSDSIERETFKYIEKSYKDYIHSGLELDE 175
           +    + LN D++L   +     R   D +     +  E  K  +   +D+  SG+++  
Sbjct: 164 MYAFMNTLNTDIALCDRL-----RTVLDNKEVLKRLTDEEIKVGKLLLEDFEKSGIQMSP 218

Query: 176 SNRLKIKDIKKKISVNSINFSKNLG-EQKEYITFTKEQLEGVPDSVLAQFETIKSDKDRN 234
             R +   + + IS+   +F  N    +K+YI    ++ +   D    ++   K  KD +
Sbjct: 219 EIRDRFISLSQDISLAGQDFLNNTSYTEKDYIKIKCDEFDKACDYPALKY---KLSKDLS 275

Query: 235 ETLYKVTFKYPDIFPVMKLASSAQTRKEAFLADQNKVPENEAILLDTLELRDKLASLLGY 294
              YK+       +  +      + RK+ ++A  +   +    L   ++ R +LA LL  
Sbjct: 276 GKYYKIPTYGKIPYTALLKCKDEELRKKLWVAFHSCSNKQIERLTKIIKHRIELAKLLSK 335

Query: 295 DTYANYNLYDKMAKDSTTVMDFLNDLKDKLIPLGKKELELLQEMKSKD----VKKLNQDE 350
            +Y+ Y L  KMAK    V +FLN L   ++P   KELE +   K       ++   Q  
Sbjct: 336 SSYSEYTLEGKMAKGPKEVNNFLNALLKSILPEVTKELEPISNKKCLSEGFSLETSEQSI 395

Query: 351 DPNYYIWDHRYYDNKYLLENFNVDLEKISEYFPLETTITGMLQIYETLFNLKF--IEIKD 408
             N   WD  YY N     +       I EYF L   I G+  ++ +++ ++F   +I+D
Sbjct: 396 LNNIKPWDRDYY-NPIQATSEGAYQMLIMEYFTLGNIIHGLSNLFNSIYGIRFEPGKIED 454

Query: 409 GQSKSVWHDDVKQLAVWNMDDPKSPKFVGWIYFDLHPRDGKYGHAANFGLSSSF------ 462
           G++   W  DV++L V + D+      +G IY DL  R+GK    +++ +  S       
Sbjct: 455 GET---WSKDVRKLNVISEDE----GLIGVIYCDLFEREGKSESPSHYTICCSREIYSEE 507

Query: 463 ---------MTNDSVRSY--PVTALVCNFSKSTKD---KPSLLKHNEIVTFFHELGHGIH 508
                    + N + +++  P+ +LVCNF  +      +   L+H+EI T FHE+GH +H
Sbjct: 508 HDLSTIQTGVNNKTGKNFQLPIVSLVCNFQVTNAKESRRICFLQHHEIETLFHEMGHAMH 567

Query: 509 DLVGQNKESRFNGPGSVPWDFVEAPSQMLEFWTWNKNELIDLSSHYETGEKIPESLIDSL 568
            ++G+ +    +G   V  DFVE PS ++EF+  N   LID+S HY++GE I   +++  
Sbjct: 568 SMLGRTRFQTISGTRCVS-DFVEIPSILMEFFANNPKVLIDISRHYDSGESIDIEVLNKY 626

Query: 569 IKTKHVNGALFTLRQLHFGLFDMKVHT--CKDLQNLSICETWNQLRQDISLISNGGTLSK 626
           ++      A  T  Q    L D ++H      L N+ + E ++ L +++S++ +  T S 
Sbjct: 627 LENTKQFKACETYSQGKMALLDQRLHAENANSLDNIDVVEIYHNLEKELSVLPD--TESN 684

Query: 627 GYDSFGHIMSDSYSAGYYGYLWAEVFATDMYHTKFAKDPLNTKNGIQYRDIVLARGGLND 686
               FGH+    Y A YY YL+    AT ++ + F  DP + K G  +++ +L  GG  D
Sbjct: 685 WCGRFGHLY--GYGALYYCYLFDRAIATKIWESLFQNDPFSRKGGNIFKEQLLKWGGSKD 742

Query: 687 IGDDLKKFLGREP 699
               +   LG EP
Sbjct: 743 PWKCVADVLG-EP 754

>Smik_11.102 Chr11 complement(175013..177331) [2319 bp, 772 aa] {ON}
           YKL134C (REAL)
          Length = 772

 Score =  187 bits (474), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 171/635 (26%), Positives = 289/635 (45%), Gaps = 51/635 (8%)

Query: 85  KFENELGPIINQLTFLQHVSSDKEIRDASVNSSMKLDE----LNIDLSLRHDIYLQFARV 140
           +  + L  +I+   F++    + E   A+ +   ++ E    LN D+SL         + 
Sbjct: 125 RLSDTLCRVIDLCEFIRSTHPEDEFVKAAQDCHEQMFEFMNVLNTDVSL-----CNMLKS 179

Query: 141 WQDAQSKSDSIERETFKYIEKSYKDYIHSGLELDESNRLKIKDIKKKISVNSINFSKNLG 200
             +    +  +  E  K  +    D+  SG+ ++   R K   + ++IS+    F  ++ 
Sbjct: 180 VLNNPEIAPKLSEEELKVGKILLDDFEKSGIYMNPGVREKFIQLSQEISLVGQEFINHID 239

Query: 201 EQKEYITFTKEQLEGVPDSVLAQFETIKSDKDRNETLYKV-TFKYPDIFPVMKLASSAQT 259
                    K   + +  S ++ F   + +KD     YKV TF Y   F ++K       
Sbjct: 240 YPGS--NSVKIPCKDLDSSKVSTFLLKQLNKDVKGQNYKVPTFGYA-AFALLKSCEIEVV 296

Query: 260 RKEAFLADQNKVPENEAILLDTLELRDKLASLLGYDTYANYNLYDKMAKDSTTVMDFLND 319
           RK+ + A  +   +    L   ++LR  LA+L+   +YA Y L  KMAK+   V DF+  
Sbjct: 297 RKKIWTALHSCSDKQIKRLDRLIKLRAVLANLMHKGSYAEYQLEGKMAKNPKDVQDFILT 356

Query: 320 LKDKLIPLGKKELELLQEMKSKDVKK---LNQDEDPNYYI-WDHRYYDNKYL-LENFNVD 374
           L +  I     EL+ + ++K+KD+KK    N DE       WD  YY  KY+ L   NV 
Sbjct: 357 LMNNTIDKTANELKFIADLKAKDLKKPLTTNTDEILKLVRPWDRDYYTGKYIQLNPSNVP 416

Query: 375 LEK-ISEYFPLETTITGMLQIYETLFNLKFIEIKDGQSKSVWHDDVKQLAVWNMDDPKSP 433
             K IS YF L   I G+  +++ ++ ++ +E         W  DV++L V + ++    
Sbjct: 417 SAKEISYYFTLGNVIQGLSDLFQQIYGIR-LEPAIADEGETWSPDVRRLNVISEEE---- 471

Query: 434 KFVGWIYFDLHPRDGKYGHAANFGLSSS---------FMT-------NDSVRSYPVTALV 477
             +G IY DL  R+GK  + A+F +  S         F T       N S    PV +LV
Sbjct: 472 GIIGIIYCDLFERNGKTSNPAHFTVCCSRQIYPHETDFSTIQVGENPNGSYFQLPVISLV 531

Query: 478 CNFSK---STKDKPSLLKHNEIVTFFHELGHGIHDLVGQNKESRFNGPGSVPWDFVEAPS 534
           CNFS    ++K     L+ +E+ T FHE+GH +H ++G+      +G      DFVE PS
Sbjct: 532 CNFSPVPIASKKSLCFLQLSEVETLFHEMGHAMHSMLGRTHMQNISGTRCAT-DFVELPS 590

Query: 535 QMLEFWTWNKNELIDLSSHYETGEKIPESLIDSLIKTKHVNGALFTLRQLHFGLFDMKVH 594
            ++E +  +   L  +  HYETGE I + ++   +KT +      T  Q    + D   H
Sbjct: 591 ILMEHFAKDIRVLTRIGKHYETGETIQKGMLQCFMKTTNFLQNCETYSQAKMAMLDQSFH 650

Query: 595 TCK---DLQNLSICETWNQLRQDISLISNGGTLSKGYDSFGHIMSDSYSAGYYGYLWAEV 651
             K   D+ N ++ + +  L + + ++ +  +   G   FGH+    Y A YY YL+   
Sbjct: 651 DEKIMSDIDNFNVVDNYQALERHLKVLVDDQSNWCG--RFGHLF--GYGATYYSYLFDRT 706

Query: 652 FATDMYHTKFAKDPLNTKNGIQYRDIVLARGGLND 686
            A+ +++T F  DP +  NG +++  +L  GGL D
Sbjct: 707 IASKIWYTLFDDDPYSRNNGDKFKKHLLKWGGLKD 741

>Suva_11.91 Chr11 complement(175327..177654) [2328 bp, 775 aa] {ON}
           YKL134C (REAL)
          Length = 775

 Score =  186 bits (472), Expect = 4e-49,   Method: Compositional matrix adjust.
 Identities = 174/678 (25%), Positives = 301/678 (44%), Gaps = 58/678 (8%)

Query: 46  TPNDINGKTKEIIDKSNNFYESMSNVETPTVT-NFVEPFMKFENELGPIINQLTFLQHVS 104
           +P+ +   ++  + ++    E M N  T      ++    +  + L  +I+   F++   
Sbjct: 88  SPDGLRQFSQVSLRQAQELLERMRNDSTENGKLTYIMNLDRLSDTLCRVIDLCEFIRSTH 147

Query: 105 SDKEIRDASVNSSMKLDE----LNIDLSLRHDIYLQFARVWQDAQSKSDSIERETFKYIE 160
            D     A+ +   ++ E    LN D+SL         +   ++   S  +  E  K  +
Sbjct: 148 PDDAFVKAAQDCHEQMFEFMNVLNTDVSL-----CNMLKTVLNSPKISSKLSEEELKVGK 202

Query: 161 KSYKDYIHSGLELDESNRLKIKDIKKKISVNS---INFSKNLGEQKEYITFTKEQLEGVP 217
               D+  SG+ ++   R K   + ++IS+     IN +   G     I+  +     V 
Sbjct: 203 ILLDDFEKSGIYMNPDVREKFIQLSQEISLVGQEFINHTDYPGSNSVKISCRELDNSNVS 262

Query: 218 DSVLAQFETIKSDKDRNETLYKV-TFKYPDIFPVMKLASSAQTRKEAFLADQNKVPENEA 276
             +L Q      +KD     YKV TF Y   + ++K     Q RK+ + A  +   +   
Sbjct: 263 AFLLKQL-----NKDVKGQNYKVPTFGYA-AYALLKSCEKEQVRKKIWTALHSCSDKQIK 316

Query: 277 ILLDTLELRDKLASLLGYDTYANYNLYDKMAKDSTTVMDFLNDLKDKLIPLGKKELELLQ 336
            L   ++LR  LA L+   +YA Y L  KMAK+   V DF+  L +  I     EL+ + 
Sbjct: 317 RLNHLIKLRANLADLMHKGSYAEYQLEGKMAKNPKDVQDFILTLMNDTIDKTATELKFIA 376

Query: 337 EMKSKDVKK-LNQDEDPNYYI---WDHRYYDNKYLLENFN--VDLEKISEYFPLETTITG 390
           E+K+KD+KK L    D    +   WD  YY  KYL  N +     ++IS YF L   I G
Sbjct: 377 ELKAKDLKKPLATKTDEILKLVRPWDRDYYTGKYLQLNPSNAPSAKEISSYFTLGNVIQG 436

Query: 391 MLQIYETLFNLKFIEIKDGQSKSVWHDDVKQLAVWNMDDPKSPKFVGWIYFDLHPRDGKY 450
           +  +++ ++ +K +E         W  DV++L V + ++      +G IY DL  R GK 
Sbjct: 437 LSDLFQHIYGIK-LEPAIADEGETWSPDVRRLNVISEEE----GIIGIIYCDLFERSGKT 491

Query: 451 GHAANFGLSSS---------FMT-------NDSVRSYPVTALVCNFSK---STKDKPSLL 491
            + A+F +  S         F T       + S    PV +LVCNF+    ++K     L
Sbjct: 492 SNPAHFTVCCSRQIYPNETDFSTIQLGENADGSFFQLPVISLVCNFAPIPIASKKSLCFL 551

Query: 492 KHNEIVTFFHELGHGIHDLVGQNKESRFNGPGSVPWDFVEAPSQMLEFWTWNKNELIDLS 551
           + +E+ T FHE+GH +H ++G+      +G      DFVE PS ++E +  +   L  + 
Sbjct: 552 QLSEVETLFHEMGHAMHSMLGRTHMQNISGTRCAT-DFVELPSILMEHFAKDIRILTRIG 610

Query: 552 SHYETGEKIPESLIDSLIKTKHVNGALFTLRQLHFGLFDMKVH---TCKDLQNLSICETW 608
            HYETGE +   ++ S ++T +      T  Q    + D   H      ++ N  + + +
Sbjct: 611 KHYETGETVEPDMLQSFMRTTNFLQNCETYSQAKMAMLDQSFHDEEVISNIDNYDVVKNY 670

Query: 609 NQLRQDISLISNGGTLSKGYDSFGHIMSDSYSAGYYGYLWAEVFATDMYHTKFAKDPLNT 668
             L + + ++ +  +   G   FGH+    Y A YY YL+    A+ +++  F  DP + 
Sbjct: 671 QALERRLKVLVDDQSNWCG--RFGHLF--GYGATYYSYLFDRTIASKIWYALFEDDPYSR 726

Query: 669 KNGIQYRDIVLARGGLND 686
           KNG +++  +L  GGL D
Sbjct: 727 KNGDKFKKHLLKWGGLKD 744

>CAGL0D02112g Chr4 complement(216204..218489) [2286 bp, 761 aa] {ON}
           similar to uniprot|P35999 Saccharomyces cerevisiae
           YKL134c MIP1
          Length = 761

 Score =  184 bits (467), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 170/674 (25%), Positives = 311/674 (46%), Gaps = 57/674 (8%)

Query: 58  IDKSNNFYESMSN-VETPTVTNFVEPFMKFENELGPIINQLTFLQHVSSDKEIRDASVNS 116
           + K++   E + N V      +++    +  + L  +I+   FL+    D+   +A+   
Sbjct: 87  LHKAHKLAEILRNSVSKEEKVHYIMNLDQLSDTLCRVIDLCEFLRSAHPDQSYVEAAQMC 146

Query: 117 SMKLDE----LNIDLSLRHDIYLQFARVWQDAQSKSDSIERETFKYIEKSYKDYIHSGLE 172
             ++ E    LN D+ L +    +   V +D +     +  E  K  E    D+  SG+ 
Sbjct: 147 HEEMFEFMNVLNTDVVLCN----KLKEVLEDPEILK-VLSEEERKVGEILLDDFEKSGIY 201

Query: 173 LDESNRLKIKDIKKKISVNSINFSKNLG-EQKEYITFTKEQLEGVPDSVLAQFETIKSDK 231
           +    R +  ++ ++ISV    F  N     KE+I   +++++    S ++   T + ++
Sbjct: 202 MKAGIREQFIELSQQISVIGQEFINNTDYVAKEFIKVKRDEMD---KSGISPLLTARLNR 258

Query: 232 DRNETLYKVTFKYPDIFPVMKLASSAQTRKEAFLADQNKVPENEAILLDTL-ELRDKLAS 290
           D     YK+         ++K       RKE + A  N  P+ +   L+ L  LR  L++
Sbjct: 259 DLTGKYYKIPTYGQIPLQILKSCPDEDIRKEVWAALHN-CPKAQIQRLNQLVRLRVILSN 317

Query: 291 LLGYDTYANYNLYDKMAKDSTTVMDFLNDLKDKLIPLGKKELELLQ--EMKSKDVKKLNQ 348
           LLG  +Y++Y L +KMA     V  F+  L +   PL  +ELE +   ++ + D + ++ 
Sbjct: 318 LLGKQSYSDYQLDNKMAGSPENVKGFIKTLMNVTKPLAARELEFIARDKLNAPDSRHMSD 377

Query: 349 DEDPNYY-IWDHRYYDNKYLLENFNVDL--EKISEYFPLETTITGMLQIYETLFNLKFIE 405
           +E  +    WD  Y+ +KY  +N    +  E++  YF L   I G+ ++++ ++ +  ++
Sbjct: 378 NEILSIVKPWDKNYFSSKYDSDNEMAMIRDEQLRYYFSLGNVINGLSELFKRIYGIT-LQ 436

Query: 406 IKDGQSKSVWHDDVKQLAVWNMDDPKSPKFVGWIYFDLHPRDGKYGHAANFGLSSS---- 461
               ++   W  DV++L V + ++      VG IY DL  R GK  + A+F +  S    
Sbjct: 437 PSRTENGETWSPDVRRLDVISEEE----GLVGVIYCDLFERVGKISNPAHFTVCCSRQVY 492

Query: 462 -----FMT-------NDSVRSYPVTALVCNFSKST---KDKPSLLKHNEIVTFFHELGHG 506
                F T       + +V   PV +LVCNFS       ++   L  NEI T FHE+GH 
Sbjct: 493 PDENDFTTIQTGQNSDGTVFQLPVISLVCNFSTVALPNGNRTCFLHMNEIETLFHEMGHA 552

Query: 507 IHDLVGQNKESRFNGPGSVPWDFVEAPSQMLEFWTWNKNELIDLSSHYETGEKIPESLID 566
           +H ++G+ +    +G      DFVE PS ++E +  +   L  + SHYET E  PE+L++
Sbjct: 553 MHSMLGRTRLQNISGTRCAT-DFVELPSILMEHFARDIRVLRTIGSHYETSEPAPEALLN 611

Query: 567 SLIKTKHVNGALFTLRQLHFGLFDMKVH---TCKDLQNLSICETWNQLRQDISLISNGGT 623
             +          T  Q    + D K+H   +  D++ +   + + +L   + ++++  +
Sbjct: 612 DYLDKTQFLQHCETYSQAKMAMLDQKLHGSFSLSDIERIDSAKIYQKLETRLQVLADDES 671

Query: 624 LSKGYDSFGHIMSDSYSAGYYGYLWAEVFATDMYHTKFAKDPLNTKNGIQYRDIVLARGG 683
              G   FGH+    Y A YY YL+    A+ ++ + F  DP N   G ++++ VL  GG
Sbjct: 672 NWCG--RFGHLF--GYGATYYSYLFDRAIASKVWDSLFKDDPFNRTGGEKFKERVLKWGG 727

Query: 684 LND----IGDDLKK 693
           L +    I D L+K
Sbjct: 728 LKNPWSCIADVLEK 741

>NCAS0A04280 Chr1 complement(864327..866648) [2322 bp, 773 aa] {ON}
           Anc_2.432
          Length = 773

 Score =  184 bits (466), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 171/683 (25%), Positives = 311/683 (45%), Gaps = 68/683 (9%)

Query: 46  TPNDINGKTKEIIDKSNNFYESMSNVET-PTVTNFVEPFMKFENELGPIINQLTFLQHVS 104
           +P  +   + + ++K+ +  ++M N  +      F+    +  + L  +I+   F++   
Sbjct: 86  SPKGLKEFSNKSLEKARSLVDTMKNDRSFKGEMGFIMNLDRLSDTLCRVIDLCEFIRSTH 145

Query: 105 SDKEIRDASVNSSMKLDE----LNIDLSLRHDIYLQFARVWQDAQSKSDSIERETFKYIE 160
            D+    A+ +   ++ E    LN D+ L  DI      V  D    S  +  E  K  +
Sbjct: 146 PDEAFVKAAQDCHEQMFEFMNVLNTDVVL-CDI---LKHVLNDPNINS-KLTPEEIKVGK 200

Query: 161 KSYKDYIHSGLELDESNRLKIKDIKKKISVNSINFSKNLGEQKE---YITFTKEQLEGVP 217
              +D+  SG+ +D + R +   + ++IS+   +F  N+   K     I  ++    GV 
Sbjct: 201 LLLEDFEKSGIYMDPNIRKQFISLSQEISLTGQDFINNIDLIKSNHVKIKCSELNKSGVN 260

Query: 218 DSVLAQFETIKSDKDRNETLYKVTFKYPDIFPVMKLASSAQTRKEAFLADQNKVPENEAI 277
             +L Q       KD     YK+         +++    A  R + + A  +  P ++  
Sbjct: 261 SLLLKQLP-----KDITGKYYKIPTSGYIPISLIRSCPDATIRAKVW-ASLHSCPNDQIR 314

Query: 278 LLDTL-ELRDKLASLLGYDTYANYNLYDKMAKDSTTVMDFLNDLKDKLIPLGKKELELLQ 336
            L  L +LR  LA LL   ++A Y L  KMAK    V DF+  L D + P   +EL+ + 
Sbjct: 315 RLTHLVKLRAILAHLLNKCSFAKYQLEGKMAKTPQNVRDFIKTLMDYMRPKAAQELKFMA 374

Query: 337 EMKSKDVKKLNQDE-----------DPNYYIWDHRYYDNKYLLENFNVDLEKISEYFPLE 385
           ++K K++     D            D  YY   H    +  L EN  +++     YF + 
Sbjct: 375 DLKCKELNIPTSDSTTAILDLISPWDREYYTTIHSKAKDVNLYENHPINM-----YFTMG 429

Query: 386 TTITGMLQIYETLFNLKFIEIKDGQSKSVWHDDVKQLAVWNMDDPKSPKFVGWIYFDLHP 445
             + G+  I++ ++ ++ +E    +    W  +V++L V +    ++   +G +Y DL  
Sbjct: 430 NIMKGLSHIFQRIYGIR-LEAVVPEEGETWSPEVRRLNVIS----ETEGLIGVVYCDLFE 484

Query: 446 RDGKYGHAANFGLSSS--------------FMTNDSVRSY--PVTALVCNFSK--STKDK 487
           R GK  + A+F +  S                TN    ++  PV +LVCNFS   ++ DK
Sbjct: 485 RAGKTSNPAHFTVCCSRQIYPDENDLSTIQIGTNPDGTAFQLPVISLVCNFSSTLTSNDK 544

Query: 488 P-SLLKHNEIVTFFHELGHGIHDLVGQNKESRFNGPGSVPWDFVEAPSQMLEFWTWNKNE 546
              LL+ NEI T FHE+GH +H ++G+++    +G      DFVE PS ++E +  +K  
Sbjct: 545 MICLLQLNEIETLFHEMGHAMHSMLGRSRLQNVSGTRCAT-DFVELPSILMEHFARDKRV 603

Query: 547 LIDLSSHYETGEKIPESLIDSLIKTKHVNGALFTLRQLHFGLFDMKVHT---CKDLQNLS 603
           L ++  HYET E++ E +I++ +K         T  Q    + D ++++    KDL ++ 
Sbjct: 604 LHEIGFHYETNERVSEYVIEAHLKKMKFLQDCETFSQGKMAMLDQELYSENIIKDLDHVD 663

Query: 604 ICETWNQLRQDISLISNGGTLSKGYDSFGHIMSDSYSAGYYGYLWAEVFATDMYHTKFAK 663
           + + +  L +D+ ++ +    S     FGH+    Y A YY YL+    A+ ++   FAK
Sbjct: 664 VVKIYQTLEEDLKVLVDNK--SNWCGKFGHLF--GYGASYYSYLFDRAIASKVWDQLFAK 719

Query: 664 DPLNTKNGIQYRDIVLARGGLND 686
           DP + + G ++++ VL  GGL D
Sbjct: 720 DPFSREGGEKFKNCVLKWGGLRD 742

>YKL134C Chr11 complement(189124..191442) [2319 bp, 772 aa] {ON}
           OCT1Mitochondrial intermediate peptidase, cleaves
           destabilizing N-terminal residues of a subset of
           proteins upon import, after their cleavage by
           mitochondrial processing peptidase (Mas1p-Mas2p); may
           contribute to mitochondrial iron homeostasis
          Length = 772

 Score =  182 bits (462), Expect = 7e-48,   Method: Compositional matrix adjust.
 Identities = 174/671 (25%), Positives = 300/671 (44%), Gaps = 65/671 (9%)

Query: 53  KTKEIIDK-SNNFYESMSNVETPTVTNFVEPFMKFENELGPIINQLTFLQHVSSDKEIRD 111
           + +E++DK  N+F ES           ++    +  + L  +I+   F++    D     
Sbjct: 99  QAQELLDKMRNDFSESGK-------LTYIMNLDRLSDTLCRVIDLCEFIRSTHPDDAFVR 151

Query: 112 ASVNSSMKLDE----LNIDLSLRHDIYLQFARVWQDAQSKSDSIERETFKYIEKSYKDYI 167
           A+ +   ++ E    LN D+SL         +   +    S  +  E  K  +    D+ 
Sbjct: 152 AAQDCHEQMFEFMNVLNTDVSL-----CNILKSVLNNPEVSSKLSAEELKVGKILLDDFE 206

Query: 168 HSGLELDESNRLKIKDIKKKISVNS---INFSKNLGEQKEYITFTKEQLEGVPDSVLAQF 224
            SG+ ++   R K   + ++IS+     IN +   G         K   + + +S ++ F
Sbjct: 207 KSGIYMNPDVREKFIQLSQEISLVGQEFINHTDYPGSNS-----VKIPCKDLDNSKVSTF 261

Query: 225 ETIKSDKDRNETLYKV-TFKYPDIFPVMKLASSAQTRKEAFLADQNKVPENEAILLDTLE 283
              + +KD     YKV TF Y   + ++K   +   RK+ + A  +   +    L   ++
Sbjct: 262 LLKQLNKDVKGQNYKVPTFGYA-AYALLKSCENEMVRKKLWTALHSCSDKQVKRLSHLIK 320

Query: 284 LRDKLASLLGYDTYANYNLYDKMAKDSTTVMDFLNDLKDKLIPLGKKELELLQEMKSKDV 343
           LR  LA+L+   +YA Y L  KMAK+   V DF+  L +  I     EL+ + E+K+KD+
Sbjct: 321 LRAILANLMHKTSYAEYQLEGKMAKNPKDVQDFILTLMNNTIEKTANELKFIAELKAKDL 380

Query: 344 KK---LNQDEDPNYYI-WDHRYYDNKYLLEN--FNVDLEKISEYFPLETTITGMLQIYET 397
           KK    N DE       WD  YY  KY   N   + + ++IS YF L   I G+  +++ 
Sbjct: 381 KKPLTTNTDEILKLVRPWDRDYYTGKYFQLNPSNSPNAKEISYYFTLGNVIQGLSDLFQQ 440

Query: 398 LFNLKFIEIKDGQSKSVWHDDVKQLAVWNMDDPKSPKFVGWIYFDLHPRDGKYGHAANFG 457
           ++ ++ +E         W  DV++L V + ++      +G IY DL  R+GK  + A+F 
Sbjct: 441 IYGIR-LEPAITDEGETWSPDVRRLNVISEEE----GIIGIIYCDLFERNGKTSNPAHFT 495

Query: 458 LSSSFMTNDSVRSY----------------PVTALVCNFSK---STKDKPSLLKHNEIVT 498
           +  S     S   +                PV +LVCNFS    ++K     L+ +E+ T
Sbjct: 496 VCCSRQIYPSETDFSTIQVGENPDGTYFQLPVISLVCNFSPILIASKKSLCFLQLSEVET 555

Query: 499 FFHELGHGIHDLVGQNKESRFNGPGSVPWDFVEAPSQMLEFWTWNKNELIDLSSHYETGE 558
            FHE+GH +H ++G+      +G      DFVE PS ++E +  +   L  +  HY TGE
Sbjct: 556 LFHEMGHAMHSMLGRTHMQNISGTRCAT-DFVELPSILMEHFAKDIRILTKIGKHYGTGE 614

Query: 559 KIPESLIDSLIKTKHVNGALFTLRQLHFGLFDMKVHTCK---DLQNLSICETWNQLRQDI 615
            I   ++   +K+ +      T  Q    + D   H  K   D+ N  + E +  L + +
Sbjct: 615 TIQADMLQRFMKSTNFLQNCETYSQAKMAMLDQSFHDEKIISDIDNFDVVENYQALERRL 674

Query: 616 SLISNGGTLSKGYDSFGHIMSDSYSAGYYGYLWAEVFATDMYHTKFAKDPLNTKNGIQYR 675
            ++ +  +   G   FGH+    Y A YY YL+    A+ +++  F  DP + KNG +++
Sbjct: 675 KVLVDDQSNWCG--RFGHLF--GYGATYYSYLFDRTIASKIWYALFEDDPYSRKNGDKFK 730

Query: 676 DIVLARGGLND 686
             +L  GGL D
Sbjct: 731 KHLLKWGGLKD 741

>TDEL0A02080 Chr1 complement(373425..375788) [2364 bp, 787 aa] {ON}
           Anc_2.432 YKL134C
          Length = 787

 Score =  182 bits (461), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 145/553 (26%), Positives = 258/553 (46%), Gaps = 48/553 (8%)

Query: 164 KDYIHSGLELDESNRLKIKDIKKKISVNSINFSKNLGEQKEYI--TFTKEQLEGVPDSVL 221
           +D+  SG+ ++   R +   + ++IS+    F  N     +Y+   + K + E V +S +
Sbjct: 216 EDFEKSGIYMNPEVRDQFIALSQEISLVGQEFINN----TDYVRSNYIKIKCEEVDNSGI 271

Query: 222 AQFETIKSDKDRNETLYKVTFKYPDIFPVMKLASSAQTRKEAFLADQNKVPENEAILLDT 281
            +    +  KD     YK+       + +++     + R   + A  ++  + +   LD 
Sbjct: 272 NKLLISQLPKDVRGKYYKIPTHGYIAYSILRSCPDEEIRMNLWTA-MHRCSDKQINRLDQ 330

Query: 282 L-ELRDKLASLLGYDTYANYNLYDKMAKDSTTVMDFLNDLKDKLIPLGKKELELLQEMKS 340
           L  LR  LA L+G +++A Y L  KMA+    V DF+  L + + P   +EL+ + E+KS
Sbjct: 331 LLRLRAILAKLMGKESFAQYQLEGKMAQTPQQVRDFIGTLVNYMRPKTIEELKFIYELKS 390

Query: 341 KDVKK------LNQDEDPNYYIWDHRYYDNKYLLENFN--VDLEKISEYFPLETTITGML 392
           K  K+        QD       WD  YY + Y L+     +D E+IS YF L   I G+ 
Sbjct: 391 KQEKREIQPSPSEQDIASMVRPWDREYYTSMYSLQQRRDAIDDEQISSYFTLGNVIQGLS 450

Query: 393 QIYETLFNLKFIEIKDGQSKSVWHDDVKQLAVWNMDDPKSPKFVGWIYFDLHPRDGKYGH 452
            ++E+++ ++ +E    ++   +  +V++L V      +    +G +Y DL  R GK  +
Sbjct: 451 DLFESIYGIR-LEPVVPKTGETFSPEVRRLNVV----CEQEGVIGVVYCDLFERAGKTSN 505

Query: 453 AANFGLSSS----------------FMTNDSVRSYPVTALVCNFSKSTKDKP---SLLKH 493
            ++F +  S                F +   +   PV ALVCNFS ST  +     LL+ 
Sbjct: 506 PSHFTVCCSRQIYPKETEFSTIQTGFNSEGLMFQLPVIALVCNFSSSTDSEGKSICLLQL 565

Query: 494 NEIVTFFHELGHGIHDLVGQNKESRFNGPGSVPWDFVEAPSQMLEFWTWNKNELIDLSSH 553
           NE+ T FHE+GH +H ++G+ +    +G      DFVE PS ++E +  +   L  +  H
Sbjct: 566 NEVETLFHEMGHAMHSMLGRTRLQNISGT-RCATDFVELPSILMEHFARDVRVLERIGKH 624

Query: 554 YETGEKIPESLIDSLIKTKHVNGALFTLRQLHFGLFDMKVH---TCKDLQNLSICETWNQ 610
           + TG  I E L+ + ++         T  Q    + D  +H     KD  +  +   + Q
Sbjct: 625 HRTGAPISEKLLLNYLEETKFMQHCETFSQAKMAMLDQDLHGEKVIKDFDHFDVTAAYQQ 684

Query: 611 LRQDISLISNGGTLSKGYDSFGHIMSDSYSAGYYGYLWAEVFATDMYHTKFAKDPLNTKN 670
           L +D+ ++ +  +   G   FGH+    Y A YY YL+    A+ ++ + F+ DP +  N
Sbjct: 685 LERDMKVLVDDKSNWCG--KFGHLF--GYGATYYSYLFDRAIASKVWDSLFSSDPYSRVN 740

Query: 671 GIQYRDIVLARGG 683
           G ++++ VL  GG
Sbjct: 741 GEKFKECVLKWGG 753

>Ecym_6099 Chr6 complement(186647..188968) [2322 bp, 773 aa] {ON}
           similar to Ashbya gossypii AFR198W
          Length = 773

 Score =  182 bits (461), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 145/553 (26%), Positives = 263/553 (47%), Gaps = 51/553 (9%)

Query: 164 KDYIHSGLELDESNRLKIKDIKKKISVNSINFSKNLGEQKEYI--TFTKEQLEGVPDSVL 221
           +D+  SG+ ++   R +  ++ + IS+    F  N     EY+  +F + + + +  S +
Sbjct: 211 EDFEKSGIYMNPKVRERFIELSQVISIVGQEFITN----TEYVGTSFVEIETDVLEASGV 266

Query: 222 AQFETIKSDKDRNETLYKV-TFKYPDIFPVMKLASSAQTRKEAFLADQNKVPENEAILLD 280
           +Q    +  KD +   YK+ T+ Y   + +++   S   RK+ + A     PE +   L 
Sbjct: 267 SQMVLQQLSKDLSGKFYKIPTYGYLP-YSIIRTCPSEYIRKKVWTA-MYSCPEKQIKRLK 324

Query: 281 TL-ELRDKLASLLGYDTYANYNLYDKMAKDSTTVMDFLNDLKDKLIPLGKKELELLQEMK 339
            L  LR +LA ++G   YA Y L  KMAK    V +F+N L +   PL  +EL+ L +MK
Sbjct: 325 KLVRLRQQLAHIMGKPDYATYQLEGKMAKSPKNVKNFMNTLIEYTKPLAMEELKPLADMK 384

Query: 340 ----SKDVKKLNQDEDPNYYIWDHRYYDNKYLLEN----FNVDLEKISEYFPLETTITGM 391
                KD  ++     P    WD  Y+ +  LL        +  + ++ YF L   I G+
Sbjct: 385 HDNHCKDASEILSSVRP----WDRDYFGSMSLLAQPRSVKTMSFQSLNCYFSLGVVIQGL 440

Query: 392 LQIYETLFNLKFIEIKDGQSKSVWHDDVKQLAVWNMDDPKSPKFVGWIYFDLHPRDGKYG 451
             ++++++ ++ +E    ++   W  +V+++ V +    ++   +G IY DL  R GK  
Sbjct: 441 SDLFQSIYGIR-LEPVVAKTGETWDPEVRKIQVIS----EANGVIGVIYCDLFERQGKTP 495

Query: 452 HAANFGLSSSFMTNDSVRSY----------------PVTALVCNFSKSTKDKPS--LLKH 493
           + A+F +  S     +   Y                PV +LVCNFS +  D  S  LL+ 
Sbjct: 496 NPAHFTVCCSRQIYPNETDYSTIQVGSHPDKSKFQMPVISLVCNFSHTQADDDSICLLQL 555

Query: 494 NEIVTFFHELGHGIHDLVGQNKESRFNGPGSVPWDFVEAPSQMLEFWTWNKNELIDLSSH 553
           +E+ T FHE+GH +H ++G+ +    +G      DFVE PS ++E +  +   L  +SSH
Sbjct: 556 SEVETLFHEMGHAMHSMLGRTQLQNISGTRCAT-DFVELPSILMEHFAKDLRVLSRISSH 614

Query: 554 YETGEKIPESLIDSLIKTKHVNGALFTLRQLHFGLFDMKVHTCKDLQNLSICETWNQLRQ 613
           Y TGE++P+ ++ +  +         T  Q+   + D ++H+  D  +  I   ++ L +
Sbjct: 615 YATGERVPKEMLVNYQQENRFLEHTETFSQIKMAMLDQRLHSLTD-NSEDIVTVYHGLEK 673

Query: 614 DISLISNGGTLSKGYDSFGHIMSDSYSAGYYGYLWAEVFATDMYHTKFAKDPLNTKNGIQ 673
           ++ ++ +  +   G   FGH+    Y A YY YL     A  +++  F  DP +   G +
Sbjct: 674 ELQVLVDDRSNWCG--RFGHLF--GYGASYYSYLMDRAIAAKVWNHLFQHDPFSRAGGEK 729

Query: 674 YRDIVLARGGLND 686
           +++ VL  GG  D
Sbjct: 730 FKNSVLKWGGSRD 742

>AFR198W Chr6 (797448..799778) [2331 bp, 776 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YKL134C (OCT1)
          Length = 776

 Score =  180 bits (456), Expect = 6e-47,   Method: Compositional matrix adjust.
 Identities = 163/625 (26%), Positives = 282/625 (45%), Gaps = 48/625 (7%)

Query: 90  LGPIINQLTFLQHVSSDKEIRDASVNSSMKLDE-LNIDLSLRHDIYL--QFARVWQDAQS 146
           L  +I+   FL+    D++   A+     ++ E +NI   L  D+ L  +  +V  D ++
Sbjct: 141 LCRVIDLCEFLRAAHPDEQFVAAAQECHEQMFEIMNI---LNTDVVLCKRLKQVLSD-EN 196

Query: 147 KSDSIERETFKYIEKSYKDYIHSGLELDESNRLKIKDIKKKISVNSINFSKNLGE-QKEY 205
            S  +  E  +      +D+  +G       R +   + + IS+   +F  N       Y
Sbjct: 197 ISSKLSSEEIRVGHILLEDFEKAGAYASPEVRKQFIQLSQNISIIGQDFINNTESLSSSY 256

Query: 206 ITFTKEQLEGVPDSVLAQFETIKSDKDRNETLYKVTFKYPDIFPVMKLASSAQTRKEAFL 265
           I    + LE    S L   +  K     N   YK+       + ++    S   R++ + 
Sbjct: 257 IKIPCKDLESSGTSHLVLRQLTKDTMGNN---YKIPTSGYAPYTLLNACPSEAIRRQVWT 313

Query: 266 ADQNKVPENEAILLDTLELRDKLASLLGYDTYANYNLYDKMAKDSTTVMDFLNDLKDKLI 325
           A  +   +    L   L+LR KLA+++G   Y +Y L  KMAK    V +FLN L D   
Sbjct: 314 AMFSCSEKQVKRLKSLLQLRRKLANIMGATDYVSYQLEGKMAKSPENVKNFLNTLVDHTK 373

Query: 326 PLGKKELELLQEMKSKDVKKLNQDEDPNYYI-WDHRYYDN---KYLLENFNVD-LEKISE 380
           PL   ELE L ++K ++V+ L++         WD  YY +    +   N  VD    I+ 
Sbjct: 374 PLAAGELEELAKLK-RNVENLSETNTLKLMRPWDRDYYSSLSPNFTRPNHRVDGFTSINT 432

Query: 381 YFPLETTITGMLQIYETLFNLKFIEIKDGQSKSVWHDDVKQLAVWNMDDPKSPKFVGWIY 440
           YF L   + G+  ++  ++ +    +   Q+   W  DV++L V +    ++   +G IY
Sbjct: 433 YFSLGVVMQGISDLFRDIYGISLKPVV-AQAGETWAPDVRKLQVIS----ETEGIIGLIY 487

Query: 441 FDLHPRDGKYGHAANFGLSSS---------FMT-------NDSVRSYPVTALVCNFSKST 484
            DL  R GK    ++F +  S         F T       + S    PV +L+CNF  + 
Sbjct: 488 CDLLERPGKTTSPSHFTVCCSRQIYPEENDFSTIQVGENPDGSRFQMPVISLICNFRATR 547

Query: 485 KDKP---SLLKHNEIVTFFHELGHGIHDLVGQNKESRFNGPGSVPWDFVEAPSQMLEFWT 541
             K     LL+ +++ T FHE+GH +H ++G+ +    +G   V  DFVE PS ++E + 
Sbjct: 548 HGKNKSLCLLELSDVETLFHEMGHALHSMLGRTQLQNLSGTRCVT-DFVELPSILMEHFA 606

Query: 542 WNKNELIDLSSHYETGEKIPESLIDSLIKTKHVNGALFTLRQLHFGLFDMKVHTCKDLQN 601
            ++  L+ +SS+Y TGE IPE L+ +  +  +      T  Q+   + D ++H+  D  +
Sbjct: 607 KDRRVLLRISSNYATGEPIPEELLSAFQEQNNFLKNTETFSQIKMSMLDQRLHSITDQDD 666

Query: 602 LSICETWNQLRQDISLISNGGTLSKGYDSFGHIMSDSYSAGYYGYLWAEVFATDMYHTKF 661
             I   ++ L +++ ++ +  T   G   FGH+    Y A YY YL     A  ++   F
Sbjct: 667 --IIAVYHGLEREMEVLVDDQTNWCG--RFGHLF--GYGASYYSYLMDRAIAAKIWDHLF 720

Query: 662 AKDPLNTKNGIQYRDIVLARGGLND 686
            KDP +  +G ++++ VL  GG  D
Sbjct: 721 KKDPFSRSSGEKFKEGVLKWGGSRD 745

>KLTH0D04730g Chr4 (432572..434890) [2319 bp, 772 aa] {ON} similar
           to uniprot|P35999 Saccharomyces cerevisiae YKL134C OCT1
           Mitochondrial intermediate peptidase cleaves N-terminal
           residues of a subset of proteins upon import after their
           cleavage by mitochondrial processing peptidase
           (Mas1p-Mas2p) may contribute to mitochondrial iron
           homeostasis
          Length = 772

 Score =  179 bits (453), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 164/658 (24%), Positives = 302/658 (45%), Gaps = 66/658 (10%)

Query: 78  NFVEPFMKFENELGPIINQLTFLQHVSSDKE-IRDASVNSSMKLDELNIDLSLRHDIYLQ 136
           N++    +  + L  +I+   F++    D + +R A +      + +N+ L+    +   
Sbjct: 119 NYIRNLDRLSDMLCRVIDLCEFIRASHPDSQFVRAAQLCHEEMFEFMNV-LNTDSTLCEI 177

Query: 137 FARVWQDAQSKSDSIERETFKYIEKSYKDYIHSGLELDESNRLKIKDIKKKISVNSINFS 196
             RV  D    S  +  E  K  +   +D+  SG+++      +  ++ ++IS+    F 
Sbjct: 178 LKRVLSDDLIAS-KLSEEELKVGKILLEDFEKSGIDMAPEVGEQFINLSQQISIVGQEFI 236

Query: 197 KNLG-EQKEYITFTKEQLEGVPDSVLAQFETIKSDKDRNETLYKV-TFKYPDIFPVMKLA 254
            N    + EY+  +  +LE    S L      +  K +N   YKV T+ Y   F +++  
Sbjct: 237 SNTDFPKSEYVKVSCNELETSGISPLLLNHLSRDTKGQN---YKVPTYGYI-AFSILRSC 292

Query: 255 SSAQTRKEAFLADQNKVPENEAILLDTL-ELRDKLASLLGYDTYANYNLYDKMAKDSTTV 313
            S   R + + A  +  PE +   L  L +LR  LA ++G ++Y++Y L  KMAK    V
Sbjct: 293 PSENIRMKVWTA-VHSCPEKQITRLKHLVKLRGLLAQIMGKNSYSDYQLEGKMAKSPVYV 351

Query: 314 MDFLNDLKDKLIPLGKKELELLQEMKSK--DVKKLNQDEDPNYYI--WDHRYYDNKYLLE 369
             F+  L + + PL  +EL  L  +KS   D+     DE+   ++  WD  +Y     L+
Sbjct: 352 RGFVESLAEAIKPLAMRELRALANLKSSHLDLPIPKTDEEVLKFVRPWDRDFYSTLISLQ 411

Query: 370 NFNVDL--EKISEYFPLETTITGMLQIYETLFNLKFIEIKDGQSKSVWHDDVKQLAVWNM 427
                L  E+I+ YF L T + G+  + E ++ ++ +E    +    W  +V+++ V + 
Sbjct: 412 QQRKTLENEQINSYFSLGTVMQGLSSLLEDIYGIR-LEPAVAKVGETWSPEVRRINVVSD 470

Query: 428 DDPKSPKFVGWIYFDLHPRDGKYGHAANFGLSSSFM-----------------TNDSVRS 470
            +      +G +Y DL  R GK  + A+F +  S                   ++  +  
Sbjct: 471 QE----GVIGVVYCDLFERQGKTSNPAHFTVCCSRQIYPEETDLSTIQVGQQPSSGQIFQ 526

Query: 471 YPVTALVCNFSKSTKDKP--SLLKHNEIVTFFHELGHGIHDLVGQNKESRFNGPGSVPWD 528
            PV +LVC+FS+++  K    LL+ +E+ T FHE+GH IH ++G+      +G      D
Sbjct: 527 LPVISLVCSFSQNSGSKKDVCLLQLSEVDTLFHEMGHAIHSMLGRTSLQNISGT-RCATD 585

Query: 529 FVEAPSQMLEFWTWNKNELIDLSSHYETGEKIPESLIDSLIKTKHVNGALF-------TL 581
           FVE PS ++E +  +   L  +  HY T E +P+ L+       H+N           T 
Sbjct: 586 FVELPSILMEHFAHDSRVLSRIGKHYITNEPVPDELL-------HLNQNELKYLQNTETF 638

Query: 582 RQLHFGLFDMKVHTCKDLQN--LSICETWNQLRQDISLISNGGTLSKGYDSFGHIMSDSY 639
            Q    + D ++H+ + L +  + + E ++++ + + ++++    S     FGH++   Y
Sbjct: 639 SQAKMAMLDQEMHSPRMLTDGPVDVVEIYHEVEKQMGVLTDDK--SNWCGRFGHLL--GY 694

Query: 640 SAGYYGYLWAEVFATDMYHTKFAKDPLNTKNGIQYRDIVLARGGLND----IGDDLKK 693
            A YY YL+    A+ ++   FA DP + K+G ++++ VL  GG  D    I D L K
Sbjct: 695 GASYYSYLFDRAIASKVWQHLFANDPFSRKSGEKFKNSVLRWGGSRDPWNCIADALDK 752

>Kwal_26.7616 s26 (444266..446578) [2313 bp, 770 aa] {ON} YKL134C
           (OCT1) - 1:1 [contig 55] FULL
          Length = 770

 Score =  178 bits (452), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 142/551 (25%), Positives = 261/551 (47%), Gaps = 42/551 (7%)

Query: 164 KDYIHSGLELDESNRLKIKDIKKKISVNSINFSKNLG-EQKEYITFTKEQLEGVPDSVLA 222
           +D+  SG++++     +  +I ++IS+    F  N    + +Y+    ++L+    S L 
Sbjct: 203 EDFEKSGIDMEPKVGEQFINISQQISIVGQEFINNTDFPRSDYVKIPCKELDSSGVSTLL 262

Query: 223 QFETIKSDKDRNETLYKVTFKYPDIFPVMKLASSAQTRKEAFLADQNKVPENEAILLDTL 282
             +  +  K++N   YKV       F +++   +   R + + A  +  PE +   L  L
Sbjct: 263 LNQLSRDLKNQN---YKVPAYGYAAFSILRSCPNENVRMKIWTA-MHSCPEKQISRLKQL 318

Query: 283 -ELRDKLASLLGYDTYANYNLYDKMAKDSTTVMDFLNDLKDKLIPLGKKELELLQEMKSK 341
             LR  LAS++G  +YA Y L  KMAK    V  F+  L D   PL  +EL +L ++KS 
Sbjct: 319 VMLRGLLASIMGKKSYAEYQLSGKMAKSPVYVRGFVQSLVDVTKPLAAEELRVLAKLKSG 378

Query: 342 --DVKKLNQDEDPNYYI--WDHRYYDNKYLLENFNVDLEK--ISEYFPLETTITGMLQIY 395
              V     D D   ++  WD  +Y     L+     LE   IS YF L T + G+ +++
Sbjct: 379 HLGVNVPQSDADVLRFVRPWDRDFYSTLNALQQQRKTLENEHISSYFSLGTVMQGLSRLF 438

Query: 396 ETLFNLKFIEIKDGQSKSVWHDDVKQLAVWNMDDPKSPKFVGWIYFDLHPRDGKYGHAAN 455
           E ++ ++ +E    ++   W  +V+++ V +    +    +G +Y DL  R GK  + A+
Sbjct: 439 EDIYGIR-LEPVVAKAGETWSPEVRRINVVS----EKEGIIGVVYCDLFERQGKTSNPAH 493

Query: 456 FGLSSSF----------------MTNDSVRSYPVTALVCNFSK--STKDKPSLLKHNEIV 497
           F +  S                 + +      PV +LVC+F++  +++    LL+ +++ 
Sbjct: 494 FTVCCSRTIYPGETDLSTIQVGQLPSGEKFQLPVISLVCSFAQNSASRQGVCLLQLSDVD 553

Query: 498 TFFHELGHGIHDLVGQNKESRFNGPGSVPWDFVEAPSQMLEFWTWNKNELIDLSSHYETG 557
           T FHE+GH +H ++G+      +G      DFVE PS ++E +  +   L  +  HY T 
Sbjct: 554 TLFHEMGHAMHSMLGRTSLQNISGT-RCATDFVELPSILMEHFARDSRVLSRIGRHYATD 612

Query: 558 EKIPESLIDSLIKTKHVNGALFTLRQLHFGLFDMKVHTCKDLQN--LSICETWNQLRQDI 615
           + IP  L+       +      T  Q    + D ++H+ K L +  L + + ++ + +D+
Sbjct: 613 QPIPTELLKLNQTEMNYLQHTETFSQAKMAMLDQELHSSKALTDGKLDVVKLYHGVEKDM 672

Query: 616 SLISNGGTLSKGYDSFGHIMSDSYSAGYYGYLWAEVFATDMYHTKFAKDPLNTKNGIQYR 675
            ++++    S     FGH++   Y A YY YL+    A+ ++   FA+DP N +NG +++
Sbjct: 673 EVLADDQ--SNWCGRFGHLL--GYGASYYSYLFDRAIASKIWQHLFAEDPFNRENGEKFK 728

Query: 676 DIVLARGGLND 686
           + VL  GG  D
Sbjct: 729 ESVLKWGGSKD 739

>Kpol_297.8 s297 complement(11648..14011) [2364 bp, 787 aa] {ON}
           complement(11648..14011) [2364 nt, 788 aa]
          Length = 787

 Score =  177 bits (449), Expect = 5e-46,   Method: Compositional matrix adjust.
 Identities = 166/663 (25%), Positives = 299/663 (45%), Gaps = 51/663 (7%)

Query: 58  IDKSNNFYESMSNVETPT-VTNFVEPFMKFENELGPIINQLTFLQHVSSDKEIRDASVNS 116
           ++KS    + + +  TP  +  +V+      + L  +I+   F++    D +  +A+ + 
Sbjct: 111 LEKSQKIVDKLRSDRTPEGLRLYVQNLDLLSDTLCRVIDLCEFIRSSHPDYKFVEAAQDC 170

Query: 117 SMKLDELNIDLSLRHDIYLQFARVWQDAQSKSDSIERETFKYIEKSYKDYIHSGLELDES 176
             ++ E    L+   ++      V ++ +  S  +  E  +      +D+  SG+ +   
Sbjct: 171 YEEMFEFMNMLNTDVNLCFTLKHVLENKEIAS-KLSEEELRVGRILLEDFEKSGIYMKPE 229

Query: 177 NRLKIKDIKKKISVNSINFSKNLGEQKEY-ITFTKEQLE--GVPDSVLAQFETIKSDKDR 233
            R +   + + ISV    F  N    K+  +  +  QL+  G+   +L+Q E     KD 
Sbjct: 230 VREQFITLSQSISVIGQEFISNTDFVKDNNVVVSCNQLDSLGIDPELLSQIE-----KDI 284

Query: 234 NETLYKV-TFKYPDIFPVMKLASSAQTRKEAFLADQNKVPENEAILLDTLELRDKLASLL 292
               YK+ T+ Y   F ++K   S + R++ ++A  N   E    L D ++LR  L+ LL
Sbjct: 285 AGKNYKIPTYGYIP-FALLKSCPSEEIREKIWVAVHNCSNEQIKRLTDLVKLRAVLSQLL 343

Query: 293 GYDTYANYNLYDKMAKDSTTVMDFLNDLKDKLIPLGKKELELLQE----MKSKDVKKLNQ 348
           G  +YA Y L  KMAK+   V++F+  L D   P+  KEL+ + E    +KS        
Sbjct: 344 GKKSYAEYQLEGKMAKNPKEVIEFIKTLMDFTKPMAAKELDGIAEKKLTIKSNGSNLSVC 403

Query: 349 DEDPNYYIWDHRYYDNKYLLENFNVDL---EKISEYFPLETTITGMLQIYETLFNLKFIE 405
           D       WD  YY      +    +L   E++ +YF L   + G+  +++ ++ +K +E
Sbjct: 404 DILKTVRPWDRDYYSAIEREQTSAKNLYGSEEVLKYFTLGNVMQGLSNLFQKIYGIK-LE 462

Query: 406 IKDGQSKSVWHDDVKQLAVWNMDDPKSPKFVGWIYFDLHPRDGKYGHAANFGLSSS---- 461
           +   +    W  +V+++ V + D+      +G IY DL  R GK  +AA+F +  S    
Sbjct: 463 LDVPKIGETWSPEVRKINVISEDE----GLIGIIYCDLFERSGKTSNAAHFTICCSRDIS 518

Query: 462 -FMTNDSVR-----------SYPVTALVCNFSK---STKDKPSLLKHNEIVTFFHELGHG 506
            + T DS               P+ +LVCNFSK   S  D    L   E+ T FHE+GH 
Sbjct: 519 PYETEDSTTQIAIDSKGTRFQLPIISLVCNFSKTMISETDSVCFLHLPEVETLFHEMGHA 578

Query: 507 IHDLVGQNKESRFNGPGSVPWDFVEAPSQMLEFWTWNKNELIDLSSHYETGEKIPESLID 566
           +H ++G+ K    +G      DFVE PS ++E++  +   L  +  HY T E +   +++
Sbjct: 579 MHSMLGRTKLQNISGTRCAT-DFVELPSILMEYFARDPRVLETIGKHYLTKETVKREMLE 637

Query: 567 SLIKTKHVNGALFTLRQLHFGLFDMKVH---TCKDLQNLSICETWNQLRQDISLISNGGT 623
             ++         T  Q    + D  +H       L +L + + +  L + + ++ +  +
Sbjct: 638 PHLQDLKYLQHCETYSQAKMAMLDQTLHGETISSHLDHLDVVKLYQDLERQLGVLVDDKS 697

Query: 624 LSKGYDSFGHIMSDSYSAGYYGYLWAEVFATDMYHTKFAKDPLNTKNGIQYRDIVLARGG 683
              G   FGH+    YSA YY YL+    A+ ++   F ++P +  +G +YR+ VL  GG
Sbjct: 698 NWCG--KFGHLF--GYSAVYYSYLFDRAIASKIWGALFERNPFSRASGDKYRNSVLQWGG 753

Query: 684 LND 686
             D
Sbjct: 754 SRD 756

>KNAG0A06200 Chr1 complement(937577..939946) [2370 bp, 789 aa] {ON}
           Anc_2.432 YKL134C
          Length = 789

 Score =  177 bits (448), Expect = 7e-46,   Method: Compositional matrix adjust.
 Identities = 160/676 (23%), Positives = 305/676 (45%), Gaps = 55/676 (8%)

Query: 46  TPNDINGKTKEIIDKSNNFYESMSNVETP-TVTNFVEPFMKFENELGPIINQLTFLQHVS 104
           +P  +   TK  +  +N+  E++   +TP  +  F+    +  + L  +I+   F++   
Sbjct: 103 SPKGLKQFTKRSLSIANSLVETLRTDKTPDGLLKFIVRLDQLSDTLCRVIDLCEFIRSAH 162

Query: 105 SDKEIRDASVNSSMKLDE----LNIDLSLRHDIYLQFARVWQDAQSKSDSIERETFKYIE 160
             +     +     ++ E    LN D++L +   L+     ++  SK   + +E  K  +
Sbjct: 163 PSEAYISVAQECHEEMFEFMNILNTDVNLCNT--LKQVLSTKEIVSK---LTQEELKVGK 217

Query: 161 KSYKDYIHSGLELDESNRLKIKDIKKKISVNSINFSKNLG-EQKEYITFTKEQLE--GVP 217
              +D+  SG+ +    R +  ++ + IS+   +F  N    + E+I    E+L+  GV 
Sbjct: 218 ILLEDFEKSGIYMSTDTRDRFIEMSQDISLVGQDFINNTNWLRSEFIEIASEELDNSGVS 277

Query: 218 DSVLAQFETIKSDKDRNETLYKVTFKYPDIFPVMKLASSAQTRKEAFLADQNKVPENEAI 277
             +L Q  T         T YKV       + +++   +   RK  + A  +   +    
Sbjct: 278 PILLRQLTTTVRG-----THYKVPAYGTAPYIILRSCKNENARKAVWTALHSCPDKQINR 332

Query: 278 LLDTLELRDKLASLLGYDTYANYNLYDKMAKDSTTVMDFLNDLKDKLIPLGKKELELLQE 337
           L   +++R  L++++G   +A Y L  KMAK    V++F+  L +   P+  +EL+LL  
Sbjct: 333 LTHMVKMRSVLSNIMGKVGFAVYQLQGKMAKSPENVLNFITRLMEHTKPMAAEELKLLAN 392

Query: 338 MKSKDVK--KLNQDED--PNYYIWDHRYYDNKYL----LENFNVDLEKISEYFPLETTIT 389
           MK  D+   + N +++       WD  YY  K       +N   + E I+ YF L + + 
Sbjct: 393 MKLNDLGLPEANSEKEILETVRPWDRDYYVAKSQQTRKAKNQLTNHEPINAYFTLGSVLE 452

Query: 390 GMLQIYETLFNLKFIEIKDGQSKSVWHDDVKQLAVWNMDDPKSPKFVGWIYFDLHPRDGK 449
           G+  ++++++ +  +E+        W  +V+++ V   ++      +G +Y DL  R  K
Sbjct: 453 GLSNLFKSIYGIS-LEVVASIPGETWSSEVRRVNVKTENN----NIIGVVYCDLFERKAK 507

Query: 450 YGHAANFGLSSSF----------MTNDSVRS------YPVTALVCNFSKSTKDKPSLLKH 493
               A+F +  S           +    V S       P+ +LVCNF++++ ++  LL+ 
Sbjct: 508 TSSPAHFTVCCSRELYAEENDPSILQSGVNSRGEKFQLPIISLVCNFARTSDNELCLLQL 567

Query: 494 NEIVTFFHELGHGIHDLVGQNKESRFNGPGSVPWDFVEAPSQMLEFWTWNKNELIDLSSH 553
           +EI T FHE+GH +H ++GQ K    +G      DFVE PS ++E +  +   L  +  H
Sbjct: 568 SEIETLFHEMGHAMHSMLGQTKLQNISGTRCTT-DFVELPSIIMEHFARDPRVLKGIGRH 626

Query: 554 YETGEKIPESLIDSLIKTKHVNGALFTLRQLHFGLFDMKVH---TCKDLQNLSICETWNQ 610
           Y T EK+PE L+   + +        T  Q    + D +++       +++L + E ++ 
Sbjct: 627 YITKEKVPEDLLAEELNSTRYLQNCETFAQAKMAMLDQRLYDNNIIFHVRDLDVVELYHD 686

Query: 611 LRQDISLISNGGTLSKGYDSFGHIMSDSYSAGYYGYLWAEVFATDMYHTKFAKDPLNTKN 670
           L +++ ++ +  T   G   FGH+    Y A YY YL     A  ++   F  DP +   
Sbjct: 687 LERNLEVLVDDQTNWCG--KFGHLF--GYGATYYSYLLDRAIAAKIWDCLFVNDPFSRTG 742

Query: 671 GIQYRDIVLARGGLND 686
           G  +++ VL  GGL D
Sbjct: 743 GENFKNAVLKWGGLRD 758

>TPHA0G02390 Chr7 complement(486025..488412) [2388 bp, 795 aa] {ON}
           Anc_2.432 YKL134C
          Length = 795

 Score =  169 bits (429), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 162/601 (26%), Positives = 288/601 (47%), Gaps = 58/601 (9%)

Query: 120 LDELNIDLSLRHDIYLQFARVWQDAQSKSDSIERETFKYIEKSYKDYIHSGLELDESNRL 179
           ++ LN D+ L + +      + +D +  S  +  E +K  +   +D+  SG+ ++ + R 
Sbjct: 185 MNTLNTDVQLCYTL----KHILEDEKICS-KLTDEEYKVGKILLEDFEKSGIYMEPNTRE 239

Query: 180 KIKDIKKKISVNSINFSKNLG-EQKEYITFTKEQLEGVPDSVLAQFE---TIKSDKDRNE 235
           K  ++ ++IS+    F  N     K  I   +E L       L++ E   T +   D   
Sbjct: 240 KFIELSQEISLVGQEFISNTDYVTKNNILIDRESLN------LSELELPFTYQLKTDITG 293

Query: 236 TLYKVTFKYPDIFPVMKLASSAQTRKEAFLADQNKVPENEAILLDTLELRDKLASLLGYD 295
             YK+    P  + ++   S+   RK+ +    +   E    L   + LR KLA LL   
Sbjct: 294 KHYKIPTTGPIPYSILTNCSNETIRKKIWTELHSCSQEQIERLKKMVTLRYKLAKLLKKK 353

Query: 296 TYANYNLYDKMAKDSTTVMDFLNDLKDKLIPLGKKELELLQEMKSKDVKKLNQDEDPNYY 355
           ++A Y L  KMAK+   V  F++ L D   PL  KEL  L E+K+ D+  L    D N+ 
Sbjct: 354 SFAEYQLQGKMAKNPEEVKKFISTLLDFTKPLAIKELTSLAEVKAADL-GLAFKNDSNFI 412

Query: 356 I-----WDHRYYD--NKYLLENFNVDLEKISEYFPLETTITGMLQIYETLFNLKFIEIKD 408
           +     WD  YY   N+Y  +    DL ++  YF L   I G+  ++  ++ ++F E+  
Sbjct: 413 VNLIRPWDRNYYSKINRYENKQTMEDLNELPYYFSLGNVIAGLSNLFHNIYGIRF-ELAV 471

Query: 409 GQSKSVWHDDVKQLAVWNMDDPKSPKFVGWIYFDLHPRDGKYGHAANFGLSSS------- 461
            + +  W  +V++L V +    +S   +G +Y DL  R  K  +AA+F +  S       
Sbjct: 472 PKLEETWLPEVRKLNVIS----ESEGLIGIVYCDLFERPSKKTNAAHFTICCSREIGKGE 527

Query: 462 --------FMTNDSVRSYPVTALVCNFSKS---TKDKPSLLKHNEIVTFFHELGHGIHDL 510
                     +  ++   P+ +L+CNFSKS    ++ P  L+ +EI T FHE+GH +H +
Sbjct: 528 DISTMQVGMNSKGNMFQLPIISLICNFSKSHLFEENGPCFLQLHEIETLFHEMGHAMHSV 587

Query: 511 VGQNKESRFNGPGSVPWDFVEAPSQMLEFWTWNKNELIDLSSHYETGEKI-PESLIDSLI 569
           +G+ +    +G      DFVE PS ++E +  +   +  +SSHY + E   PE L   L 
Sbjct: 588 LGRTRLQNTSGTRCAT-DFVELPSILMEHFAKDVRVMESISSHYISQEPASPELLQTWLH 646

Query: 570 KTKHV-NGALFTLRQLHFGLFDMKVHT---CKDLQNLSICETWNQLRQDISLISNGGTLS 625
            T ++ N  L+T  Q    + D  +H+    +D +++++ +++N L + + L S+  +  
Sbjct: 647 STDNLQNLELYT--QAKMSMLDQILHSNEIFEDQKDINVVKSYNDLEKKLELFSDDQSNW 704

Query: 626 KGYDSFGHIMSDSYSAGYYGYLWAEVFATDMYHTKFAKDPLNTKNGIQYRDIVLARGGLN 685
            G   FGH+    Y A YY YL+    A+ ++ + F ++P +  +G++++D VL  GG  
Sbjct: 705 CG--KFGHLF--GYGASYYSYLFDRAIASKVWESLFKQNPFSRTSGLKFKDSVLRWGGSR 760

Query: 686 D 686
           D
Sbjct: 761 D 761

>KLLA0B12397g Chr2 complement(1084129..1086468) [2340 bp, 779 aa]
           {ON} similar to uniprot|P35999 Saccharomyces cerevisiae
           YKL134C OCT1 Mitochondrial intermediate peptidase
           cleaves N-terminal residues of a subset of proteins upon
           import after their cleavage by mitochondrial processing
           peptidase (Mas1p-Mas2p) may contribute to mitochondrial
           iron homeostasis
          Length = 779

 Score =  152 bits (384), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 167/681 (24%), Positives = 298/681 (43%), Gaps = 77/681 (11%)

Query: 54  TKEIIDKSNNFYESMSNVETP-TVTNFVEPFMKFENELGPIINQLTFLQHVSSDKEIRDA 112
           T+   +K+    + + ++ET   +  +++   +  + L  +I+   F++    DK+    
Sbjct: 96  TQHSFEKAKELVQKIHSIETQDEMKYYIKDLDQLSDVLCRVIDLCEFIRATHPDKKFVQT 155

Query: 113 SVNSSMKLDE----LNIDLSLRHDIYLQFARVWQDAQSKSDSIERETFKYIEKSYKDYIH 168
           +     K+ E    LN D+ L  D+  Q  R     +S    ++ E  +  +   +D+  
Sbjct: 156 AQQCHEKMFEIMNILNTDVRL-CDLLTQCLR-----ESDVLGLDSEEIRTGKILLEDFEK 209

Query: 169 SGLELDESNRLKIKDIKKKISVNSINFSKNLG-EQKEYITFTKEQLEG-VPDSVLAQFET 226
           SG+ +    R K   + ++ISV   +F  N    +  YI  + E ++  V   V +Q + 
Sbjct: 210 SGIYMKPEIREKFIQLSQEISVIGQDFINNTEYVRSNYIKISCELMDAHVNKMVCSQMK- 268

Query: 227 IKSDKDRNETLYKV-TFKYPDIFPVMKLASSAQTRKEAFLADQNKVPENEAILLDTLELR 285
               KD     YKV T+ Y     +++  S    R + +    +        L   + LR
Sbjct: 269 ----KDITGEYYKVPTYGYIP-HTLLRTCSDEVIRMKIWTEMHSCSDAQIERLTKLISLR 323

Query: 286 DKLASLLGYDTYANYNLYDKMAKDSTTVMDFLNDLKDKLIPLGKKELELLQEMKSKDVKK 345
            +LA LLG   +A Y L+ KMAK    V  FL  L          EL+ L  +KS+    
Sbjct: 324 VELAKLLGSQNFAQYQLHGKMAKTPENVSGFLESLVHSTRIKAASELKPLAVLKSE---- 379

Query: 346 LNQDEDPN--------YYIWDHRYYDN-KYLLENFNVDL---EKISEYFPLETTITGMLQ 393
           L   + P+           WD  YY + + L +  +  L   E IS  F L   + G+  
Sbjct: 380 LTGTQTPHTSEEVLELMKPWDRDYYGSIQALAQRRSSSLDNGESISSSFSLGVVMQGLSD 439

Query: 394 IYETLFNLKFIEI--KDGQSKSVWHDDVKQLAVWNMDDPKSPKFVGWIYFDLHPRDGKYG 451
           ++E ++ +K +    K G++   W  DV+++ V +  D      +G +Y DL  R+GK  
Sbjct: 440 LFEKIYGIKLVPATPKTGET---WSPDVRRIDVVDEHDG----LIGVMYCDLFEREGKTP 492

Query: 452 HAANFGLSSS----------------FMTNDSVRSYPVTALVCNF-------SKSTKDKP 488
           + A+F +  S                  +N      PV +LVC+F             + 
Sbjct: 493 NPAHFTVCCSRNMYLNEADTSTIQVGVNSNGQKFQLPVISLVCDFRWVEVNMGDGKHQQM 552

Query: 489 SLLKHNEIVTFFHELGHGIHDLVGQNKESRFNGPGSVPWDFVEAPSQMLEFWTWNKNELI 548
            LL+ NEI T FHE+GH +H ++G+ +    +G      DFVE PS ++E +  +   L 
Sbjct: 553 CLLQLNEIETLFHEMGHAMHSMLGRTQLQNVSGTRCAT-DFVELPSILMEHFARDTRVLS 611

Query: 549 DLSSHYETGEKI-PESLIDSLIKTKHVNGALFTLRQLHFGLFDMKVHTCKDLQNLSI--C 605
            +SSHY+TG+ +  E L +  ++ + +     T  Q+     D ++H      + SI   
Sbjct: 612 SISSHYKTGKSLDVEVLKNHQLENQFLQNCE-TFSQIKMSFLDQELHNLDHTTDGSIDVI 670

Query: 606 ETWNQLRQDISLISNGGTLSKGYDSFGHIMSDSYSAGYYGYLWAEVFATDMYHTKFAKDP 665
             +++L + ++++ +  +   G   FGH+    Y A YY YL+    A+ ++   F +DP
Sbjct: 671 AIYHRLERRLAVLPDDQSNWCG--KFGHLFG--YGASYYSYLFDRAIASKIWDHLFEQDP 726

Query: 666 LNTKNGIQYRDIVLARGGLND 686
            N  NG ++++ +L  GG  D
Sbjct: 727 FNRTNGTKFKEGLLQWGGSRD 747

>Kwal_23.4370 s23 complement(689686..691764) [2079 bp, 692 aa] {ON}
           YHR178W (STB5) - Zinc finger (6-Cys) [contig 1] FULL
          Length = 692

 Score = 35.0 bits (79), Expect = 0.79,   Method: Compositional matrix adjust.
 Identities = 21/80 (26%), Positives = 36/80 (45%), Gaps = 4/80 (5%)

Query: 32  SFPIAPQAPPNWTFTPNDINGKTKEIIDKSNNFYESMSNVETPTVTNFVEPFMKFENELG 91
           S PI   A    T T     G+T  ++    NF     ++E P    F+  + K  +   
Sbjct: 214 SIPIRASAIQIETVTSVFKGGRTTSMLTPEGNF----KHIERPLYDRFIAAYFKHNHRSY 269

Query: 92  PIINQLTFLQHVSSDKEIRD 111
           P+IN++ FL  VS+ ++  +
Sbjct: 270 PLINKIEFLNKVSTIRQFEE 289

>ZYRO0C15884g Chr3 (1241605..1245873) [4269 bp, 1422 aa] {ON}
           similar to uniprot|P22219 Saccharomyces cerevisiae
           YBR097W VPS15 Myristoylated Serine/threonine protein
           kinase involved in vacuolar protein sorting
          Length = 1422

 Score = 32.7 bits (73), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 58/246 (23%), Positives = 106/246 (43%), Gaps = 30/246 (12%)

Query: 121 DELNIDLSLRHDIYLQFARVWQDAQSKSDSIERETFKYIEKSYKDYIHSGLELDESNRLK 180
           D+L +       +YL F ++ +    K D+  +E     + S++ +  S + L +   LK
Sbjct: 335 DQLTVIDKCCEKVYLDFGKICESLGYKLDTHIKENKVKEQDSWELFFSSSVHLSDCGTLK 394

Query: 181 IKDIKKKISVNSINFSKNLGEQK--EYITFTKEQLEGVPDS--------VLAQFETIKSD 230
           +KD++        N S  + E+    +I++    L  +  S        +LA F    SD
Sbjct: 395 LKDME--------NVSPAVKEESILLFISYISHGLRHIASSTTKLRCIEMLAAFSQFLSD 446

Query: 231 KDRNETL--YKVTFKYPDIFPVMKLASSAQTRKEAFLADQNKVPENEAILLDTLELR-DK 287
           +++ + +  Y VT  + D +P ++ A + Q   +     +   P NE   LD L  R  +
Sbjct: 447 ENKIDRVIPYLVTC-FEDDYPNVQ-ALALQAVSQILYTIKRVNPINENFFLDYLLPRLKR 504

Query: 288 LASLLGYDTYANYNLYDKMAKDSTTVMDFLNDLKDKLIPLGKKE-----LELLQEMKSKD 342
           L  L   +TY    L + +  D  TV +   +L       G ++     +E L E+ +K 
Sbjct: 505 LLQLSKQNTYMRMVLANCLG-DFVTVANRFEELSYFTSSFGHQDGLTHGMENL-EITNKQ 562

Query: 343 VKKLNQ 348
           +KKL Q
Sbjct: 563 IKKLVQ 568

>Kpol_1048.59 s1048 complement(166721..169273) [2553 bp, 850 aa]
           {ON} complement(166721..169273) [2553 nt, 851 aa]
          Length = 850

 Score = 32.7 bits (73), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 43/182 (23%), Positives = 80/182 (43%), Gaps = 30/182 (16%)

Query: 194 NFSKNLGEQKEYITFTKEQLEGVPD----SVLAQFETIKSDKDRNETLYKVTFKYPDIFP 249
           N S +L +QK+      EQ   + +    ++   +  +KS  DRN ++Y+   K   +FP
Sbjct: 200 NSSGDLIQQKQQQPNEHEQKRSIVEINERTLTRSYALLKSWIDRNLSIYQEHLKNIILFP 259

Query: 250 V-----------MKLASSAQTRKEAFLADQNKVPENEAILLDTLELRDKLASLLGYDTYA 298
           +           +K  + + +R EAF +  N+   N     DT+E   KL S +  + + 
Sbjct: 260 IFIHTYIKMKKLVKTNTISSSRCEAFYSKYNEFTSN-GTNKDTIEALHKLVSDIDEEDFK 318

Query: 299 N---------YNLYDKMAKDSTTVMDFLNDLKDKLIPLGKKELELLQEMKSKDVKKLNQD 349
                     Y L   + ++     + L D+ DK I       +++ +++S  +KKL +D
Sbjct: 319 YVVIVSGRLFYPLLTHILENEMIGGNLLMDIIDKFIAF-----KIVPDLESNSIKKLEKD 373

Query: 350 ED 351
           ED
Sbjct: 374 ED 375

>KNAG0A06850 Chr1 (1068342..1069688) [1347 bp, 448 aa] {ON}
           Anc_2.513 YHR001W
          Length = 448

 Score = 32.0 bits (71), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 44/163 (26%), Positives = 65/163 (39%), Gaps = 22/163 (13%)

Query: 209 TKEQLEGVPDSVLAQFETIKSDKDRNETLYKVTFKYPDIFPVMKLASSAQTRKEAFLADQ 268
           TK  + G  D++     T+K DK  NE  Y +T K+ D+     L S +  +KE      
Sbjct: 261 TKGFISGTYDAIHG---TVKDDKG-NEC-YDITGKWNDVMYYKDLRSKS-AKKEVLFDTH 314

Query: 269 NKVPENEAILLDTLELRDKLASLLGYDTYANYNLYDKM-----AKDSTTVMDFLNDLKDK 323
           N  P           LR K+  L     Y +  L+ K+      +D     D    ++D 
Sbjct: 315 NDHP-----------LRPKVRPLSEQGQYESRKLWKKVTDALAVRDHKVATDEKFQIEDS 363

Query: 324 LIPLGKKELELLQEMKSKDVKKLNQDEDPNYYIWDHRYYDNKY 366
              L KK +E   E   K  +K+    D +YYI+ H    N Y
Sbjct: 364 QRQLAKKRVEDGVEWYPKLFRKVGPGHDLDYYIYKHVPTGNNY 406

>Ecym_2665 Chr2 complement(1283498..1284037) [540 bp, 179 aa] {ON}
           similar to Ashbya gossypii AGR041C
          Length = 179

 Score = 31.2 bits (69), Expect = 5.3,   Method: Composition-based stats.
 Identities = 28/112 (25%), Positives = 48/112 (42%), Gaps = 19/112 (16%)

Query: 5   LCKNWFTSPIISPLLYTRSLYSMSNATSFPIAPQAPPNWTFTPNDINGKTKEIIDKSNNF 64
            CK+W     +S LLY  +  S   A+S+  A    PN  F P   NG+  E++  SN  
Sbjct: 29  FCKSW-----LSKLLYPPA--SKPGASSYREANSNGPNQCFLPVRTNGELNEVLMFSN-- 79

Query: 65  YESMSNVETPTVTNFVEPFMKFENELGPIINQLTFLQHVSSDKEIRDASVNS 116
                    P + NF    +   + L   +N++  L+   ++K +  A + +
Sbjct: 80  -------RVPLILNFTFRGLPQADALTGALNRIVLLE---TEKRVNVADIET 121

>KLTH0B08580g Chr2 (697066..698970) [1905 bp, 634 aa] {ON} similar
           to uniprot|P38699 Saccharomyces cerevisiae YHR178W STB5
           binds Sin3p in two-hybrid assay Zinc finger (6-Cys)
          Length = 634

 Score = 32.3 bits (72), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 18/80 (22%), Positives = 39/80 (48%), Gaps = 4/80 (5%)

Query: 32  SFPIAPQAPPNWTFTPNDINGKTKEIIDKSNNFYESMSNVETPTVTNFVEPFMKFENELG 91
           S PI   +    T T     G+T  +++ + +F     ++E P    F+  + K  +   
Sbjct: 156 SIPIKASSIQIETVTAVFKGGRTTPMVEPNGSF----KHIERPLYDRFIAAYFKHNHRSY 211

Query: 92  PIINQLTFLQHVSSDKEIRD 111
           P++N++ FL  VS+ ++ ++
Sbjct: 212 PLLNKIEFLNKVSTIRDFKE 231

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.135    0.397 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 84,613,261
Number of extensions: 4183738
Number of successful extensions: 16540
Number of sequences better than 10.0: 234
Number of HSP's gapped: 17165
Number of HSP's successfully gapped: 254
Length of query: 712
Length of database: 53,481,399
Length adjustment: 117
Effective length of query: 595
Effective length of database: 40,065,477
Effective search space: 23838958815
Effective search space used: 23838958815
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 69 (31.2 bits)