Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Smik_3.171.8ON97974938e-66
YCL057C-A (MOS1)1.8ON97974755e-63
Suva_3.1551.8ON97974442e-58
Skud_3.61.8ON97974442e-58
TPHA0E039801.8ON86973097e-38
TBLA0A049601.8ON96973081e-37
CAGL0B00396g1.8ON88822992e-36
NCAS0B090801.8ON93852993e-36
SAKL0C00528g1.8ON110942977e-36
ZYRO0F18414g1.8ON87692959e-36
Kpol_2002.111.8ON86972932e-35
AFR743W1.8ON82692922e-35
KLTH0F00550g1.8ON82962862e-34
Ecym_10101.8ON82692852e-34
KLLA0C00550g1.8ON82932801e-33
Kwal_33.130161.8ON82792671e-31
KAFR0D001701.8ON90972542e-29
TDEL0C069401.8ON86962542e-29
NDAI0A001701.8ON96982464e-28
KNAG0C002501.8ON94932431e-27
NCAS0A100803.37ON42451589.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Smik_3.17
         (97 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Smik_3.17 Chr3 complement(25487..25777) [291 bp, 97 aa] {ON} YCL...   194   8e-66
YCL057C-A Chr3 complement(24032..24325) [294 bp, 97 aa] {ON}  MO...   187   5e-63
Suva_3.155 Chr3 complement(233792..234085) [294 bp, 97 aa] {ON} ...   175   2e-58
Skud_3.6 Chr3 complement(12034..12324) [291 bp, 97 aa] {ON} YCL0...   175   2e-58
TPHA0E03980 Chr5 (837161..837421) [261 bp, 86 aa] {ON} Anc_1.8 Y...   123   7e-38
TBLA0A04960 Chr1 complement(1220183..1220473) [291 bp, 96 aa] {O...   123   1e-37
CAGL0B00396g Chr2 complement(24498..24764) [267 bp, 88 aa] {ON} ...   119   2e-36
NCAS0B09080 Chr2 (1744147..1744428) [282 bp, 93 aa] {ON} Anc_1.8...   119   3e-36
SAKL0C00528g Chr3 complement(47403..47735) [333 bp, 110 aa] {ON}...   119   7e-36
ZYRO0F18414g Chr6 (1521776..1522039) [264 bp, 87 aa] {ON} simila...   118   9e-36
Kpol_2002.11 s2002 complement(19864..20124) [261 bp, 86 aa] {ON}...   117   2e-35
AFR743W Chr6 (1800868..1801116) [249 bp, 82 aa] {ON} Syntenic ho...   117   2e-35
KLTH0F00550g Chr6 complement(42092..42340) [249 bp, 82 aa] {ON} ...   114   2e-34
Ecym_1010 Chr1 complement(19126..19374) [249 bp, 82 aa] {ON} sim...   114   2e-34
KLLA0C00550g Chr3 complement(40901..41149) [249 bp, 82 aa] {ON} ...   112   1e-33
Kwal_33.13016 s33 complement(41816..42064) [249 bp, 82 aa] {ON} ...   107   1e-31
KAFR0D00170 Chr4 complement(18220..18492) [273 bp, 90 aa] {ON} A...   102   2e-29
TDEL0C06940 Chr3 (1261913..1262173) [261 bp, 86 aa] {ON} Anc_1.8...   102   2e-29
NDAI0A00170 Chr1 complement(13975..14265) [291 bp, 96 aa] {ON} A...    99   4e-28
KNAG0C00250 Chr3 complement(38677..38961) [285 bp, 94 aa] {ON} A...    98   1e-27
NCAS0A10080 Chr1 complement(2016171..2017445) [1275 bp, 424 aa] ...    27   9.3  

>Smik_3.17 Chr3 complement(25487..25777) [291 bp, 97 aa] {ON}
          YCL057C-A (REAL)
          Length = 97

 Score =  194 bits (493), Expect = 8e-66,   Method: Compositional matrix adjust.
 Identities = 97/97 (100%), Positives = 97/97 (100%)

Query: 1  MSEQAQAQQPAKVTPSKDSSKNGSGVSTVLDTKWDIVLSNMLVKTAMGFGVGVFTSVLFF 60
          MSEQAQAQQPAKVTPSKDSSKNGSGVSTVLDTKWDIVLSNMLVKTAMGFGVGVFTSVLFF
Sbjct: 1  MSEQAQAQQPAKVTPSKDSSKNGSGVSTVLDTKWDIVLSNMLVKTAMGFGVGVFTSVLFF 60

Query: 61 KRRAFPVWLGIGFGVGRGYAEGDAIFRSSAGLRSSKV 97
          KRRAFPVWLGIGFGVGRGYAEGDAIFRSSAGLRSSKV
Sbjct: 61 KRRAFPVWLGIGFGVGRGYAEGDAIFRSSAGLRSSKV 97

>YCL057C-A Chr3 complement(24032..24325) [294 bp, 97 aa] {ON}
          MOS1Mitochondrial protein essential for proper inner
          membrane organization; conserved component of the
          mitochondrial inner membrane organizing system (MICOS,
          MINOS, or MitOS), a scaffold-like structure on the
          intermembrane space side of the inner membrane which
          has a role in the maintenance of crista junctions and
          inner membrane architecture; ortholog of human MINOS1
          Length = 97

 Score =  187 bits (475), Expect = 5e-63,   Method: Compositional matrix adjust.
 Identities = 92/97 (94%), Positives = 94/97 (96%)

Query: 1  MSEQAQAQQPAKVTPSKDSSKNGSGVSTVLDTKWDIVLSNMLVKTAMGFGVGVFTSVLFF 60
          MSEQAQ QQPAK TPSKDS+KNGS VST+LDTKWDIVLSNMLVKTAMGFGVGVFTSVLFF
Sbjct: 1  MSEQAQTQQPAKSTPSKDSNKNGSSVSTILDTKWDIVLSNMLVKTAMGFGVGVFTSVLFF 60

Query: 61 KRRAFPVWLGIGFGVGRGYAEGDAIFRSSAGLRSSKV 97
          KRRAFPVWLGIGFGVGRGYAEGDAIFRSSAGLRSSKV
Sbjct: 61 KRRAFPVWLGIGFGVGRGYAEGDAIFRSSAGLRSSKV 97

>Suva_3.155 Chr3 complement(233792..234085) [294 bp, 97 aa] {ON}
          YCL057C-A (REAL)
          Length = 97

 Score =  175 bits (444), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 86/97 (88%), Positives = 90/97 (92%)

Query: 1  MSEQAQAQQPAKVTPSKDSSKNGSGVSTVLDTKWDIVLSNMLVKTAMGFGVGVFTSVLFF 60
          MSEQAQA  PAK TPS +S++NGS VSTVLD KWDIVLSNMLVKTAMGFG+GVFTSVLFF
Sbjct: 1  MSEQAQAPAPAKSTPSTNSNENGSAVSTVLDAKWDIVLSNMLVKTAMGFGIGVFTSVLFF 60

Query: 61 KRRAFPVWLGIGFGVGRGYAEGDAIFRSSAGLRSSKV 97
          KRRAFP WLGIGFGVGRGYAEGDAIFRSSAGLRSSKV
Sbjct: 61 KRRAFPAWLGIGFGVGRGYAEGDAIFRSSAGLRSSKV 97

>Skud_3.6 Chr3 complement(12034..12324) [291 bp, 97 aa] {ON}
          YCL057C-A (REAL)
          Length = 97

 Score =  175 bits (444), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 86/97 (88%), Positives = 90/97 (92%)

Query: 1  MSEQAQAQQPAKVTPSKDSSKNGSGVSTVLDTKWDIVLSNMLVKTAMGFGVGVFTSVLFF 60
          MSEQA+ Q+PAK T S DS KNGS VST+LD KWDIV+SNMLVKTAMGFGVGVFTSVLFF
Sbjct: 1  MSEQAKLQEPAKSTSSNDSIKNGSAVSTILDAKWDIVMSNMLVKTAMGFGVGVFTSVLFF 60

Query: 61 KRRAFPVWLGIGFGVGRGYAEGDAIFRSSAGLRSSKV 97
          KRRAFPVWLGIGFGVGRGYAEGDAIFRSSAGLRSSKV
Sbjct: 61 KRRAFPVWLGIGFGVGRGYAEGDAIFRSSAGLRSSKV 97

>TPHA0E03980 Chr5 (837161..837421) [261 bp, 86 aa] {ON} Anc_1.8
          YCL057C-A
          Length = 86

 Score =  123 bits (309), Expect = 7e-38,   Method: Compositional matrix adjust.
 Identities = 59/97 (60%), Positives = 72/97 (74%), Gaps = 11/97 (11%)

Query: 1  MSEQAQAQQPAKVTPSKDSSKNGSGVSTVLDTKWDIVLSNMLVKTAMGFGVGVFTSVLFF 60
          MSEQ         +P            ++L+ KWD+VLSNMLVKT +GFGVGV TS+L F
Sbjct: 1  MSEQKNNNNLELTSPK-----------SILNDKWDVVLSNMLVKTGLGFGVGVVTSILLF 49

Query: 61 KRRAFPVWLGIGFGVGRGYAEGDAIFRSSAGLRSSKV 97
          KRRAFPVWLGIGFGVGRGY++GDAIFRS+AGLRS+++
Sbjct: 50 KRRAFPVWLGIGFGVGRGYSDGDAIFRSAAGLRSTRI 86

>TBLA0A04960 Chr1 complement(1220183..1220473) [291 bp, 96 aa]
          {ON} Anc_1.8 YCL057C-A
          Length = 96

 Score =  123 bits (308), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 62/97 (63%), Positives = 76/97 (78%), Gaps = 1/97 (1%)

Query: 1  MSEQAQAQQPAKVTPSKDSSKNGSGVSTVLDTKWDIVLSNMLVKTAMGFGVGVFTSVLFF 60
          MSEQ  AQQ    T ++ +S   +   ++L+ KWDIV+SNMLVKT  GFG GV  SV+FF
Sbjct: 1  MSEQI-AQQTTTPTTTESASTAVTSNRSILNDKWDIVISNMLVKTTFGFGAGVLASVIFF 59

Query: 61 KRRAFPVWLGIGFGVGRGYAEGDAIFRSSAGLRSSKV 97
          KRRAFPVWLG+GFG+GRGY+EGDAIFRS+AGLRS +V
Sbjct: 60 KRRAFPVWLGVGFGLGRGYSEGDAIFRSTAGLRSFQV 96

>CAGL0B00396g Chr2 complement(24498..24764) [267 bp, 88 aa] {ON}
          highly similar to uniprot|Q96VH5 Saccharomyces
          cerevisiae YCL057ca
          Length = 88

 Score =  119 bits (299), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 56/82 (68%), Positives = 70/82 (85%)

Query: 16 SKDSSKNGSGVSTVLDTKWDIVLSNMLVKTAMGFGVGVFTSVLFFKRRAFPVWLGIGFGV 75
          +K  + + + V ++L+ KWD+VLSNM+VK  +GFGVGV TSVLFFKRR+FPVWLG+GFG 
Sbjct: 7  TKAKTVDYTPVRSILNDKWDVVLSNMIVKMGLGFGVGVVTSVLFFKRRSFPVWLGVGFGA 66

Query: 76 GRGYAEGDAIFRSSAGLRSSKV 97
          GRGY+EGDAIFRS+AGLRS KV
Sbjct: 67 GRGYSEGDAIFRSTAGLRSVKV 88

>NCAS0B09080 Chr2 (1744147..1744428) [282 bp, 93 aa] {ON} Anc_1.8
          YCL057C-A
          Length = 93

 Score =  119 bits (299), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 59/85 (69%), Positives = 67/85 (78%), Gaps = 8/85 (9%)

Query: 13 VTPSKDSSKNGSGVSTVLDTKWDIVLSNMLVKTAMGFGVGVFTSVLFFKRRAFPVWLGIG 72
          VTP+ D S        +L+ KWD+VLSNMLVK  +GF VGV  SV+FFKRR FPVWLGIG
Sbjct: 17 VTPTIDRS--------ILNDKWDVVLSNMLVKVGLGFSVGVVASVIFFKRRTFPVWLGIG 68

Query: 73 FGVGRGYAEGDAIFRSSAGLRSSKV 97
          FGVGRGYAEGDAIFRS AGLR++KV
Sbjct: 69 FGVGRGYAEGDAIFRSPAGLRTAKV 93

>SAKL0C00528g Chr3 complement(47403..47735) [333 bp, 110 aa] {ON}
           similar to uniprot|Q96VH5 Saccharomyces cerevisiae
           YCL057C-A
          Length = 110

 Score =  119 bits (297), Expect = 7e-36,   Method: Compositional matrix adjust.
 Identities = 57/94 (60%), Positives = 69/94 (73%), Gaps = 15/94 (15%)

Query: 1   MSEQAQAQQPAKVTPSKDSSKNGSGVSTVLDTKWDIVLSNMLVKTAMGFGVGVFTSVLFF 60
           MSEQ Q  +P K               ++L+ KWD+VLSN++VKT +GFG G+  SVL F
Sbjct: 29  MSEQLQVSKPNK---------------SILNDKWDVVLSNVVVKTGLGFGAGIVASVLLF 73

Query: 61  KRRAFPVWLGIGFGVGRGYAEGDAIFRSSAGLRS 94
           KRRAFPVWLG+GFG+GRGYAEGDAIFRSSAGLR+
Sbjct: 74  KRRAFPVWLGVGFGLGRGYAEGDAIFRSSAGLRT 107

>ZYRO0F18414g Chr6 (1521776..1522039) [264 bp, 87 aa] {ON} similar
          to uniprot|Q96VH5 Saccharomyces cerevisiae YCL057C-A
          Length = 87

 Score =  118 bits (295), Expect = 9e-36,   Method: Compositional matrix adjust.
 Identities = 54/69 (78%), Positives = 64/69 (92%)

Query: 28 TVLDTKWDIVLSNMLVKTAMGFGVGVFTSVLFFKRRAFPVWLGIGFGVGRGYAEGDAIFR 87
          ++L+ KWD+VLSN+LVK+ +GFGVGV  SVL FKRRAFPVWLGIGFG+GRGYAEGDAIFR
Sbjct: 18 SILNDKWDVVLSNLLVKSGLGFGVGVVASVLIFKRRAFPVWLGIGFGLGRGYAEGDAIFR 77

Query: 88 SSAGLRSSK 96
          S+AGLR+SK
Sbjct: 78 SAAGLRTSK 86

>Kpol_2002.11 s2002 complement(19864..20124) [261 bp, 86 aa] {ON}
          complement(19864..20124) [261 nt, 87 aa]
          Length = 86

 Score =  117 bits (293), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 58/97 (59%), Positives = 72/97 (74%), Gaps = 11/97 (11%)

Query: 1  MSEQAQAQQPAKVTPSKDSSKNGSGVSTVLDTKWDIVLSNMLVKTAMGFGVGVFTSVLFF 60
          MS+Q+Q  Q     P++          ++L+ KWD+VLSN LVKT++GFG GV  SV+ F
Sbjct: 1  MSQQSQELQITS-APTR----------SILNDKWDVVLSNFLVKTSLGFGAGVLASVILF 49

Query: 61 KRRAFPVWLGIGFGVGRGYAEGDAIFRSSAGLRSSKV 97
          KRRAFPVWLGIGFG+GRGY+EGDAIFRS+AGLR S V
Sbjct: 50 KRRAFPVWLGIGFGIGRGYSEGDAIFRSAAGLRKSTV 86

>AFR743W Chr6 (1800868..1801116) [249 bp, 82 aa] {ON} Syntenic
          homolog of Saccharomyces cerevisiae YCL057C-A
          Length = 82

 Score =  117 bits (292), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 52/69 (75%), Positives = 63/69 (91%)

Query: 28 TVLDTKWDIVLSNMLVKTAMGFGVGVFTSVLFFKRRAFPVWLGIGFGVGRGYAEGDAIFR 87
          ++L+ KWD+VLSN++VKT +GFG GVF SVLFFKRRAFPVWLG+GFG+GRGYAEGDAIFR
Sbjct: 13 SILNDKWDVVLSNLVVKTGLGFGAGVFASVLFFKRRAFPVWLGVGFGLGRGYAEGDAIFR 72

Query: 88 SSAGLRSSK 96
          S AGLR+ +
Sbjct: 73 SHAGLRAVR 81

>KLTH0F00550g Chr6 complement(42092..42340) [249 bp, 82 aa] {ON}
          similar to uniprot|Q96VH5 Saccharomyces cerevisiae
          YCL057C-A
          Length = 82

 Score =  114 bits (286), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 59/96 (61%), Positives = 71/96 (73%), Gaps = 15/96 (15%)

Query: 1  MSEQAQAQQPAKVTPSKDSSKNGSGVSTVLDTKWDIVLSNMLVKTAMGFGVGVFTSVLFF 60
          MSEQ       KV+P+  S         +L+ KWD+VLSN++VKT +GFG GV  SVL F
Sbjct: 1  MSEQL------KVSPTSRS---------LLNDKWDVVLSNLVVKTGLGFGAGVVASVLLF 45

Query: 61 KRRAFPVWLGIGFGVGRGYAEGDAIFRSSAGLRSSK 96
          KRRAFPVW+G+GFG+GRGYAEGDAIFRSSAGLR+ K
Sbjct: 46 KRRAFPVWIGVGFGLGRGYAEGDAIFRSSAGLRTVK 81

>Ecym_1010 Chr1 complement(19126..19374) [249 bp, 82 aa] {ON}
          similar to Ashbya gossypii AFR743W
          Length = 82

 Score =  114 bits (285), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 52/69 (75%), Positives = 61/69 (88%)

Query: 28 TVLDTKWDIVLSNMLVKTAMGFGVGVFTSVLFFKRRAFPVWLGIGFGVGRGYAEGDAIFR 87
          ++L+ KWD+VLSN++VK  +GF VGV  SVLFFKRRAFPVWLGIGFG+GRGYAEGDAIFR
Sbjct: 13 SILNDKWDVVLSNLVVKAGLGFSVGVLASVLFFKRRAFPVWLGIGFGLGRGYAEGDAIFR 72

Query: 88 SSAGLRSSK 96
          S AGLR+ K
Sbjct: 73 SHAGLRTMK 81

>KLLA0C00550g Chr3 complement(40901..41149) [249 bp, 82 aa] {ON}
          similar to uniprot|Q96VH5 Saccharomyces cerevisiae
          YCL057C-A
          Length = 82

 Score =  112 bits (280), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 56/93 (60%), Positives = 68/93 (73%), Gaps = 15/93 (16%)

Query: 1  MSEQAQAQQPAKVTPSKDSSKNGSGVSTVLDTKWDIVLSNMLVKTAMGFGVGVFTSVLFF 60
          MSEQ Q     K  PS            +LD +WD+VLSN++ KTA+G GVG+  SVLFF
Sbjct: 1  MSEQVQT---TKAVPS------------ILDKRWDVVLSNVVAKTALGAGVGIVASVLFF 45

Query: 61 KRRAFPVWLGIGFGVGRGYAEGDAIFRSSAGLR 93
          KRRAFPVW+G+GFG+GRGYAEGDAIFR++AGLR
Sbjct: 46 KRRAFPVWVGVGFGLGRGYAEGDAIFRTNAGLR 78

>Kwal_33.13016 s33 complement(41816..42064) [249 bp, 82 aa] {ON}
          YCL057C-A - Hypothetical ORF, has similarity to
          proteins in S. pombe, C. elegans, D. melanogaster.
          [contig 123] FULL
          Length = 82

 Score =  107 bits (267), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 50/79 (63%), Positives = 63/79 (79%)

Query: 18 DSSKNGSGVSTVLDTKWDIVLSNMLVKTAMGFGVGVFTSVLFFKRRAFPVWLGIGFGVGR 77
          D +K      ++L+ KWD+VLSN++VK  +GFG GV  SVL FKRRA PVW+G+GFG+GR
Sbjct: 3  DQAKIAPVSRSLLNDKWDVVLSNLVVKVGLGFGAGVVASVLLFKRRAAPVWIGVGFGLGR 62

Query: 78 GYAEGDAIFRSSAGLRSSK 96
          GY+EGDAIFRSSAGLR+ K
Sbjct: 63 GYSEGDAIFRSSAGLRTVK 81

>KAFR0D00170 Chr4 complement(18220..18492) [273 bp, 90 aa] {ON}
          Anc_1.8 YCL057C-A
          Length = 90

 Score =  102 bits (254), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 59/97 (60%), Positives = 75/97 (77%), Gaps = 7/97 (7%)

Query: 1  MSEQAQAQQPAKVTPSKDSSKNGSGVSTVLDTKWDIVLSNMLVKTAMGFGVGVFTSVLFF 60
          MSE+ +  +PA+ +       N S   ++L+ KWD+VLSNMLVK  +GFGVGV TSV+FF
Sbjct: 1  MSEEDKVGKPAEYS-------NNSIDRSILNDKWDLVLSNMLVKVGLGFGVGVVTSVIFF 53

Query: 61 KRRAFPVWLGIGFGVGRGYAEGDAIFRSSAGLRSSKV 97
          KRRAFPVWLGIG+G GR Y+EGDAIFRS+AGLRS ++
Sbjct: 54 KRRAFPVWLGIGYGFGRAYSEGDAIFRSNAGLRSVQI 90

>TDEL0C06940 Chr3 (1261913..1262173) [261 bp, 86 aa] {ON} Anc_1.8
          YCL057C-A
          Length = 86

 Score =  102 bits (254), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 65/96 (67%), Positives = 75/96 (78%), Gaps = 11/96 (11%)

Query: 1  MSEQAQAQQPAKVTPSKDSSKNGSGVSTVLDTKWDIVLSNMLVKTAMGFGVGVFTSVLFF 60
          MSE++QAQ      PS+          ++L+ KWD+VLSNMLVKT +GFGVGV  SVLFF
Sbjct: 1  MSEKSQAQLQV-AAPSR----------SILNDKWDVVLSNMLVKTGLGFGVGVVGSVLFF 49

Query: 61 KRRAFPVWLGIGFGVGRGYAEGDAIFRSSAGLRSSK 96
          KRRAFPVWLGIGFG+GRGYAEGDAIFRS+AGLRS K
Sbjct: 50 KRRAFPVWLGIGFGLGRGYAEGDAIFRSAAGLRSVK 85

>NDAI0A00170 Chr1 complement(13975..14265) [291 bp, 96 aa] {ON}
          Anc_1.8 YCL057C-A
          Length = 96

 Score = 99.4 bits (246), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 61/98 (62%), Positives = 72/98 (73%), Gaps = 3/98 (3%)

Query: 1  MSEQA-QAQQPAKVTPSKDSSKNGSGVSTVLDTKWDIVLSNMLVKTAMGFGVGVFTSVLF 59
          MSEQ  + +    V P +   +  +   ++L+ KWDIVLSN LVK  +GFGVGV TSV+F
Sbjct: 1  MSEQVNKTEHQNAVAPPQ--QQLATIDKSILNDKWDIVLSNTLVKVGLGFGVGVVTSVIF 58

Query: 60 FKRRAFPVWLGIGFGVGRGYAEGDAIFRSSAGLRSSKV 97
          FKRR FPVWLGIGFG GRGYAEGDAIFRSSAG+RS  V
Sbjct: 59 FKRRTFPVWLGIGFGAGRGYAEGDAIFRSSAGIRSVNV 96

>KNAG0C00250 Chr3 complement(38677..38961) [285 bp, 94 aa] {ON}
          Anc_1.8 YCL057C-A
          Length = 94

 Score = 98.2 bits (243), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 57/93 (61%), Positives = 74/93 (79%), Gaps = 6/93 (6%)

Query: 11 AKVTPSKDSSKNGSGV------STVLDTKWDIVLSNMLVKTAMGFGVGVFTSVLFFKRRA 64
          ++ T +  +++N +G        ++L+ KWD+VLSNMLVK  MGFGVGV TSVL F+RRA
Sbjct: 2  SETTATDGATQNNNGQLATKIDRSLLNDKWDVVLSNMLVKVGMGFGVGVVTSVLLFRRRA 61

Query: 65 FPVWLGIGFGVGRGYAEGDAIFRSSAGLRSSKV 97
          FPVWLGIGFGVGRGY+EGDAIFRS++G+R+ KV
Sbjct: 62 FPVWLGIGFGVGRGYSEGDAIFRSTSGIRTVKV 94

>NCAS0A10080 Chr1 complement(2016171..2017445) [1275 bp, 424 aa]
           {ON} Anc_3.37 YNL309W
          Length = 424

 Score = 26.9 bits (58), Expect = 9.3,   Method: Composition-based stats.
 Identities = 18/51 (35%), Positives = 26/51 (50%), Gaps = 7/51 (13%)

Query: 9   QPAKVTPSKDSSKNGSGVSTVLDTKWDIVLSNMLVKTAMGFGVGVFTSVLF 59
           Q    TPS+D++ NGSG  T       I  ++ L+KT   F +G +   LF
Sbjct: 323 QQVPTTPSRDNNNNGSGTQT------GITSNHTLLKTP-NFNMGDYIHNLF 366

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.133    0.387 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 8,703,917
Number of extensions: 284379
Number of successful extensions: 864
Number of sequences better than 10.0: 24
Number of HSP's gapped: 864
Number of HSP's successfully gapped: 24
Length of query: 97
Length of database: 53,481,399
Length adjustment: 68
Effective length of query: 29
Effective length of database: 45,684,111
Effective search space: 1324839219
Effective search space used: 1324839219
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 59 (27.3 bits)