Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Smik_3.161.7ON1131134561e-59
YCL058W-A (ADF1)1.7ON1131133571e-44
Skud_3.51.7ON1131133432e-42
Suva_3.1541.7ON1131133215e-39
CAGL0B00374g1.7ON121911662e-15
SAKL0C00506g1.7ON105871582e-14
TBLA0A049501.7ON113871531e-13
NDAI0A001601.7ON123921434e-12
NCAS0B090901.7ON119911426e-12
KAFR0D001601.7ON111871364e-11
KLTH0F00528g1.7ON104821312e-10
TPHA0E039901.7ON116881261e-09
Kwal_YGOB_YCL058W-A1.7ON105821224e-09
Kwal_33.13015singletonOFF105821224e-09
KNAG0C002401.7ON126961218e-09
TDEL0C069501.7ON111821182e-08
ZYRO0F18436g1.7ON112891163e-08
Kpol_2002.101.7ON111931138e-08
AFR743CA1.7ON10187991e-05
TDEL0C057001.130ON13850588.0
NOTE: 1 genes in the same pillar as Smik_3.16 were not hit in these BLAST results
LIST: KLLA0C00528g

BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Smik_3.16
         (113 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Smik_3.16 Chr3 (25034..25375) [342 bp, 113 aa] {ON} YCL058W-A (R...   180   1e-59
YCL058W-A Chr3 (23584..23925) [342 bp, 113 aa] {ON}  ADF1Transcr...   142   1e-44
Skud_3.5 Chr3 (11576..11917) [342 bp, 113 aa] {ON} YCL058W-A (REAL)   136   2e-42
Suva_3.154 Chr3 (233345..233686) [342 bp, 113 aa] {ON} YCL058W-A...   128   5e-39
CAGL0B00374g Chr2 (23693..24058) [366 bp, 121 aa] {ON} similar t...    69   2e-15
SAKL0C00506g Chr3 (46439..46756) [318 bp, 105 aa] {ON} weakly si...    65   2e-14
TBLA0A04950 Chr1 (1219399..1219740) [342 bp, 113 aa] {ON} Anc_1....    64   1e-13
NDAI0A00160 Chr1 (13398..13769) [372 bp, 123 aa] {ON} Anc_1.7 YC...    60   4e-12
NCAS0B09090 Chr2 complement(1744560..1744919) [360 bp, 119 aa] {...    59   6e-12
KAFR0D00160 Chr4 (17823..18158) [336 bp, 111 aa] {ON} Anc_1.7 YC...    57   4e-11
KLTH0F00528g Chr6 (41595..41909) [315 bp, 104 aa] {ON} conserved...    55   2e-10
TPHA0E03990 Chr5 complement(837690..838040) [351 bp, 116 aa] {ON...    53   1e-09
Kwal_YGOB_YCL058W-A s33 (41330..41647) [318 bp, 105 aa] {ON} ANN...    52   4e-09
Kwal_33.13015 s33 (41330..41647) [318 bp, 105 aa] {OFF} [contig ...    52   4e-09
KNAG0C00240 Chr3 (38093..38473) [381 bp, 126 aa] {ON} Anc_1.7 YC...    51   8e-09
TDEL0C06950 Chr3 complement(1262284..1262619) [336 bp, 111 aa] {...    50   2e-08
ZYRO0F18436g Chr6 complement(1522314..1522652) [339 bp, 112 aa] ...    49   3e-08
Kpol_2002.10 s2002 (19162..19497) [336 bp, 111 aa] {ON} (19162.....    48   8e-08
AFR743CA Chr6 complement(1801173..1801478) [306 bp, 101 aa] {ON}...    43   1e-05
TDEL0C05700 Chr3 (1024491..1024907) [417 bp, 138 aa] {ON} Anc_1....    27   8.0  

>Smik_3.16 Chr3 (25034..25375) [342 bp, 113 aa] {ON} YCL058W-A
           (REAL)
          Length = 113

 Score =  180 bits (456), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 94/113 (83%), Positives = 94/113 (83%)

Query: 1   MGKNSMXXXXXXXXXXXXXXXXXXXSISTAVKKRTKLQVEKLNKSSEMMIPTLLRETGAQ 60
           MGKNSM                   SISTAVKKRTKLQVEKLNKSSEMMIPTLLRETGAQ
Sbjct: 1   MGKNSMRRKSVGKNVGVGKKVQKRRSISTAVKKRTKLQVEKLNKSSEMMIPTLLRETGAQ 60

Query: 61  EPAKRKTESTLKAGDLIKDQEKDSKVREHIQMEKSKTNDNMLKQIEMISGFSL 113
           EPAKRKTESTLKAGDLIKDQEKDSKVREHIQMEKSKTNDNMLKQIEMISGFSL
Sbjct: 61  EPAKRKTESTLKAGDLIKDQEKDSKVREHIQMEKSKTNDNMLKQIEMISGFSL 113

>YCL058W-A Chr3 (23584..23925) [342 bp, 113 aa] {ON}
           ADF1Transcriptional repressor encoded by the antisense
           strand of the FYV5 gene; negatively regulates
           transcription of FYV5 by binding to the promoter on the
           sense strand
          Length = 113

 Score =  142 bits (357), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 78/113 (69%), Positives = 83/113 (73%)

Query: 1   MGKNSMXXXXXXXXXXXXXXXXXXXSISTAVKKRTKLQVEKLNKSSEMMIPTLLRETGAQ 60
           MGK SM                   SISTA +KRTKLQVEKLNKSSE MIPTLLRE   Q
Sbjct: 1   MGKCSMKKKGVGKNVGVGKKVQKKRSISTAERKRTKLQVEKLNKSSETMIPTLLREASTQ 60

Query: 61  EPAKRKTESTLKAGDLIKDQEKDSKVREHIQMEKSKTNDNMLKQIEMISGFSL 113
           EPAK K E+TLKA +LIKDQEKDSKVRE I+ EKSKTND+MLKQIEMISGFSL
Sbjct: 61  EPAKLKAETTLKAEELIKDQEKDSKVREQIRTEKSKTNDSMLKQIEMISGFSL 113

>Skud_3.5 Chr3 (11576..11917) [342 bp, 113 aa] {ON} YCL058W-A (REAL)
          Length = 113

 Score =  136 bits (343), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 72/113 (63%), Positives = 83/113 (73%)

Query: 1   MGKNSMXXXXXXXXXXXXXXXXXXXSISTAVKKRTKLQVEKLNKSSEMMIPTLLRETGAQ 60
           MGK+S+                    ISTA +KRTKLQVEKLNKSSE+MIPTLLRET  Q
Sbjct: 1   MGKSSLRMKTQGKNGGVGKKVQKKRPISTAERKRTKLQVEKLNKSSEIMIPTLLRETATQ 60

Query: 61  EPAKRKTESTLKAGDLIKDQEKDSKVREHIQMEKSKTNDNMLKQIEMISGFSL 113
           EP K++ +STLKA +L+KDQ KD KVRE IQ EKSKTND+ML+QIEMISGFSL
Sbjct: 61  EPTKKRAKSTLKAEELVKDQAKDCKVREQIQTEKSKTNDSMLEQIEMISGFSL 113

>Suva_3.154 Chr3 (233345..233686) [342 bp, 113 aa] {ON} YCL058W-A
           (REAL)
          Length = 113

 Score =  128 bits (321), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 70/113 (61%), Positives = 81/113 (71%)

Query: 1   MGKNSMXXXXXXXXXXXXXXXXXXXSISTAVKKRTKLQVEKLNKSSEMMIPTLLRETGAQ 60
           MGK+SM                    ISTA  KRTKLQVE+LNKSSE MIPTLL+E   Q
Sbjct: 1   MGKSSMRKKTQGKNGGVGKKQQKKRPISTAEMKRTKLQVERLNKSSETMIPTLLKEASKQ 60

Query: 61  EPAKRKTESTLKAGDLIKDQEKDSKVREHIQMEKSKTNDNMLKQIEMISGFSL 113
           +  K+KT STL+A +L+KDQ +DSKVREHI+ EKSKTND+MLKQIEMISGFSL
Sbjct: 61  DLDKKKTRSTLEAEELVKDQARDSKVREHIETEKSKTNDSMLKQIEMISGFSL 113

>CAGL0B00374g Chr2 (23693..24058) [366 bp, 121 aa] {ON} similar to
           CA0039|IPF3998 Candida albicans and KLLA0C00528g
           Kluyveromyces lactis
          Length = 121

 Score = 68.6 bits (166), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 39/91 (42%), Positives = 62/91 (68%), Gaps = 6/91 (6%)

Query: 27  ISTAVKKRTKLQVEKLNKSSEMMIPTLLRETG----AQEPAKRKTESTLKAGDLIKDQEK 82
           IS + +K++K+   +LNK +++    +++E      A+EP KR+T   L    L+KDQ++
Sbjct: 33  ISASERKKSKILTARLNKDADVAELKIIQELNDNKIAEEPKKRQT--ALDMNCLVKDQKR 90

Query: 83  DSKVREHIQMEKSKTNDNMLKQIEMISGFSL 113
           D KVREHI+   S+TN +MLKQ+E++SGFSL
Sbjct: 91  DKKVREHIEKINSETNSDMLKQLELMSGFSL 121

>SAKL0C00506g Chr3 (46439..46756) [318 bp, 105 aa] {ON} weakly
           similar to uniprot|Q2V2Q1 Saccharomyces cerevisiae
           YCL058W-A
          Length = 105

 Score = 65.5 bits (158), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 38/87 (43%), Positives = 57/87 (65%), Gaps = 2/87 (2%)

Query: 27  ISTAVKKRTKLQVEKLNKSSEMMIPTLLRETGAQEPAKRKTESTLKAGDLIKDQEKDSKV 86
           I  + KKRT++QVE+LNK   ++  + L  T A     ++   TL+A  L +DQ+KD + 
Sbjct: 21  IKKSQKKRTRIQVEQLNKQEFLL--SDLNMTNAGSTKTKEKPKTLQAKALAQDQKKDKET 78

Query: 87  REHIQMEKSKTNDNMLKQIEMISGFSL 113
           R+ ++ ++  TNDNML Q+EMISGFSL
Sbjct: 79  RDKLEKQRKDTNDNMLAQLEMISGFSL 105

>TBLA0A04950 Chr1 (1219399..1219740) [342 bp, 113 aa] {ON} Anc_1.7
           YCL058W-A
          Length = 113

 Score = 63.5 bits (153), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 40/87 (45%), Positives = 55/87 (63%), Gaps = 2/87 (2%)

Query: 27  ISTAVKKRTKLQVEKLNKSSEMMIPTLLRETGAQEPAKRKTESTLKAGDLIKDQEKDSKV 86
           IS   KKR KLQVEK+NK   ++   +     ++E AK    +TL +  L KDQEKD  +
Sbjct: 29  ISVGDKKRAKLQVEKMNKQDSLLSDIINLNGKSKELAK--NVNTLSSKQLKKDQEKDRLL 86

Query: 87  REHIQMEKSKTNDNMLKQIEMISGFSL 113
              I+ +K +TND+++ QIEMISGFSL
Sbjct: 87  NVEIKNKKKQTNDDLIAQIEMISGFSL 113

>NDAI0A00160 Chr1 (13398..13769) [372 bp, 123 aa] {ON} Anc_1.7
           YCL058W-A
          Length = 123

 Score = 59.7 bits (143), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 35/92 (38%), Positives = 53/92 (57%), Gaps = 5/92 (5%)

Query: 27  ISTAVKKRTKLQVEKLNKSSEMMIPTLLRETGAQEPAKRKTES-----TLKAGDLIKDQE 81
           I  + +K+ K++V   NK S + +      + +  P K+K +S     +L A DL+ DQ+
Sbjct: 32  IKQSDRKKNKIKVAMFNKESSLHMNVSELNSQSMSPIKQKQDSLRKGSSLSAHDLLNDQK 91

Query: 82  KDSKVREHIQMEKSKTNDNMLKQIEMISGFSL 113
           KD +    IQ EK + ND+ML+QIEMISGF  
Sbjct: 92  KDIEANNRIQTEKKQVNDDMLRQIEMISGFKF 123

>NCAS0B09090 Chr2 complement(1744560..1744919) [360 bp, 119 aa] {ON}
           Anc_1.7 YCL058W-A
          Length = 119

 Score = 59.3 bits (142), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 38/91 (41%), Positives = 59/91 (64%), Gaps = 4/91 (4%)

Query: 26  SISTAVKKRTKLQVEKLNKSSEMMIPTLLRETGAQEPAKRKTE---STLKAGDLIKDQEK 82
           SIS + +K+ K QVEKLNK  E ++P  + +   ++   +K E   S L A  L++DQ+K
Sbjct: 30  SISFSDRKKAKHQVEKLNKK-ENLLPMNVLDLQKKKNLSKKPEPLKSILHARSLLQDQKK 88

Query: 83  DSKVREHIQMEKSKTNDNMLKQIEMISGFSL 113
           D ++R  I+ E+  T+D++ KQIEMISGF+ 
Sbjct: 89  DKEIRNKIRAEQKATDDSIEKQIEMISGFTF 119

>KAFR0D00160 Chr4 (17823..18158) [336 bp, 111 aa] {ON} Anc_1.7
           YCL058W-A
          Length = 111

 Score = 57.0 bits (136), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 34/87 (39%), Positives = 56/87 (64%)

Query: 27  ISTAVKKRTKLQVEKLNKSSEMMIPTLLRETGAQEPAKRKTESTLKAGDLIKDQEKDSKV 86
           IS + +K+ KL VEK N+ +   +  L ++    +    KT++ L+   L+ DQ +D +V
Sbjct: 25  ISQSERKKNKLIVEKFNQQTITNVQELNKDLKKDKRRLSKTKNALETKKLLHDQARDHEV 84

Query: 87  REHIQMEKSKTNDNMLKQIEMISGFSL 113
           +++I+ +  +T D+MLKQIEMISGFSL
Sbjct: 85  KQNIETKLKETEDSMLKQIEMISGFSL 111

>KLTH0F00528g Chr6 (41595..41909) [315 bp, 104 aa] {ON} conserved
           hypothetical protein
          Length = 104

 Score = 55.1 bits (131), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 56/82 (68%), Gaps = 7/82 (8%)

Query: 34  RTKLQVEKLNKSSEMMIPTLLRETGAQEPAKRKTES--TLKAGDLIKDQEKDSKVREHIQ 91
           RTKL+VE+ NK S      L+ E   +E   ++T +  +LK  DLI+D+EKD  +++ ++
Sbjct: 28  RTKLKVEQANKES-----FLISELNEREHNTKRTPALESLKVSDLIEDREKDKSMQKKME 82

Query: 92  MEKSKTNDNMLKQIEMISGFSL 113
            +K  T++N+++Q+E+ISGFSL
Sbjct: 83  EQKQSTDNNIIEQLELISGFSL 104

>TPHA0E03990 Chr5 complement(837690..838040) [351 bp, 116 aa] {ON}
           Anc_1.7 YCL058W-A
          Length = 116

 Score = 53.1 bits (126), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 39/88 (44%), Positives = 56/88 (63%), Gaps = 2/88 (2%)

Query: 27  ISTAVKKRTKLQVEKLNKSSEMMIPTLLRETGAQEPAKR-KTESTLKAGDLIKDQEKDSK 85
           +S+ V+K TK +VEKLNK  E++    +    A    KR K  S L+A  L KD  KD +
Sbjct: 30  LSSQVRKSTKHKVEKLNKL-EVISSDDINALNALNGKKREKQTSVLEAKTLAKDNLKDRQ 88

Query: 86  VREHIQMEKSKTNDNMLKQIEMISGFSL 113
           + E I+ +K +TN ++L+QIEM+SGFSL
Sbjct: 89  LIEKIESKKKETNASLLQQIEMMSGFSL 116

>Kwal_YGOB_YCL058W-A s33 (41330..41647) [318 bp, 105 aa] {ON}
           ANNOTATED BY YGOB -
          Length = 105

 Score = 51.6 bits (122), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 32/82 (39%), Positives = 54/82 (65%), Gaps = 7/82 (8%)

Query: 34  RTKLQVEKLNKSSEMMIPTLLRETGAQEPAKRKTES--TLKAGDLIKDQEKDSKVREHIQ 91
           RTKL+VE+ NK  E+    L+ E   +E  KR++    +LK   L+KD +KD   ++ ++
Sbjct: 29  RTKLKVEQANK--EVF---LISELNKREDTKRQSSPLESLKPSRLVKDIKKDQNAQKQLE 83

Query: 92  MEKSKTNDNMLKQIEMISGFSL 113
            ++  T++N+L+Q+E+ISGFSL
Sbjct: 84  SQRKATDENVLRQLELISGFSL 105

>Kwal_33.13015 s33 (41330..41647) [318 bp, 105 aa] {OFF} [contig
           123] FULL
          Length = 105

 Score = 51.6 bits (122), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 32/82 (39%), Positives = 54/82 (65%), Gaps = 7/82 (8%)

Query: 34  RTKLQVEKLNKSSEMMIPTLLRETGAQEPAKRKTES--TLKAGDLIKDQEKDSKVREHIQ 91
           RTKL+VE+ NK  E+    L+ E   +E  KR++    +LK   L+KD +KD   ++ ++
Sbjct: 29  RTKLKVEQANK--EVF---LISELNKREDTKRQSSPLESLKPSRLVKDIKKDQNAQKQLE 83

Query: 92  MEKSKTNDNMLKQIEMISGFSL 113
            ++  T++N+L+Q+E+ISGFSL
Sbjct: 84  SQRKATDENVLRQLELISGFSL 105

>KNAG0C00240 Chr3 (38093..38473) [381 bp, 126 aa] {ON} Anc_1.7
           YCL058W-A
          Length = 126

 Score = 51.2 bits (121), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 34/96 (35%), Positives = 52/96 (54%), Gaps = 8/96 (8%)

Query: 26  SISTAVKKRTKLQVEKLNKSSEMMIPT--------LLRETGAQEPAKRKTESTLKAGDLI 77
           +I  + +KR KLQVEKLN+ +  MI          + +     E   R    +L    L 
Sbjct: 31  TIPLSERKRNKLQVEKLNRPTNGMIEGNAVDIRNEIDKHNQEVEGQNRTVHRSLDVEKLA 90

Query: 78  KDQEKDSKVREHIQMEKSKTNDNMLKQIEMISGFSL 113
           +D+ KD  ++E +  ++ +T+ +ML QIEMISGFSL
Sbjct: 91  QDKSKDRIIQEQVAKKQKETDQSMLAQIEMISGFSL 126

>TDEL0C06950 Chr3 complement(1262284..1262619) [336 bp, 111 aa] {ON}
           Anc_1.7 YCL058W-A
          Length = 111

 Score = 50.1 bits (118), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 51/82 (62%), Gaps = 2/82 (2%)

Query: 33  KRTKLQVEKLNKSSEMMIPTL-LRETGAQEPAKRKTESTLKAGDLIKDQEKDSKVREHIQ 91
           K+TK +VE LN+ +  +   + L  + A + + RK  +TL+   L KD +KD K+RE  +
Sbjct: 31  KKTKFRVENLNRDTASLSEIIKLNASTAVKGSARKA-NTLENRTLQKDWQKDQKIREKSK 89

Query: 92  MEKSKTNDNMLKQIEMISGFSL 113
            EK +  +N+ KQIE ISGFSL
Sbjct: 90  AEKEEMANNLEKQIEDISGFSL 111

>ZYRO0F18436g Chr6 complement(1522314..1522652) [339 bp, 112 aa]
           {ON} similar to uniprot|Q2V2Q1 Saccharomyces cerevisiae
           YCL058W-A
          Length = 112

 Score = 49.3 bits (116), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 34/89 (38%), Positives = 57/89 (64%), Gaps = 3/89 (3%)

Query: 26  SISTAVKKRTKLQVEKLNKSSEMMIPT-LLRETGAQEPAKRKTESTLKAGDLIKDQEKDS 84
           SIS + KKRTK +VEKL+  ++ ++P+ + +   +         S+L A +L +D++ D 
Sbjct: 26  SISHSDKKRTKSKVEKLD--AKGLLPSEIFKLNRSASSKTSNGSSSLLARNLEQDRKMDQ 83

Query: 85  KVREHIQMEKSKTNDNMLKQIEMISGFSL 113
             R+    +K +T++N+L+QIEMISGFSL
Sbjct: 84  DTRDKANAKKKETDNNILQQIEMISGFSL 112

>Kpol_2002.10 s2002 (19162..19497) [336 bp, 111 aa] {ON}
           (19162..19497) [336 nt, 112 aa]
          Length = 111

 Score = 48.1 bits (113), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 38/93 (40%), Positives = 57/93 (61%), Gaps = 11/93 (11%)

Query: 27  ISTAVKKRTKLQVEKLNKSSEMMIPT----LLRET--GAQEPAKRKTESTLKAGDLIKDQ 80
           IS + KKR K+++EK+NK  E ++P+    L  ET  G  E  K   E  L++  L +D 
Sbjct: 24  ISQSEKKRNKIKMEKINK--EGILPSDILQLNNETRNGQSEGNK---ERALESQKLQQDN 78

Query: 81  EKDSKVREHIQMEKSKTNDNMLKQIEMISGFSL 113
            KD +    I+  K +T+D+MLKQIE+++GFSL
Sbjct: 79  VKDRETIAKIEASKKETDDSMLKQIELMTGFSL 111

>AFR743CA Chr6 complement(1801173..1801478) [306 bp, 101 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YCL058W-A
          Length = 101

 Score = 42.7 bits (99), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 32/87 (36%), Positives = 47/87 (54%), Gaps = 7/87 (8%)

Query: 27  ISTAVKKRTKLQVEKLNKSSEMMIPTLLRETGAQEPAKRKTESTLKAGDLIKDQEKDSKV 86
           IS A KKR KLQVEKL+K        +L           KT   L+A  L +DQ  D++ 
Sbjct: 22  ISKADKKRAKLQVEKLDKRG------VLLAELTAAAPAAKT-GVLQAASLAQDQRSDAQA 74

Query: 87  REHIQMEKSKTNDNMLKQIEMISGFSL 113
           ++    E+S  +  +++Q+E I+GFSL
Sbjct: 75  QQQRAQERSNVDKKVVQQLEAIAGFSL 101

>TDEL0C05700 Chr3 (1024491..1024907) [417 bp, 138 aa] {ON}
          Anc_1.130 YLR154C
          Length = 138

 Score = 26.9 bits (58), Expect = 8.0,   Method: Compositional matrix adjust.
 Identities = 15/50 (30%), Positives = 24/50 (48%)

Query: 36 KLQVEKLNKSSEMMIPTLLRETGAQEPAKRKTESTLKAGDLIKDQEKDSK 85
          K+    L   +  ++P  +R TGA E  K   +  L  G+ +K  E DS+
Sbjct: 5  KVDCSSLPTYTAHLVPCKVRYTGATEEFKDNFQMDLSHGESLKKVEPDSQ 54

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.306    0.121    0.300 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 8,673,109
Number of extensions: 292654
Number of successful extensions: 1762
Number of sequences better than 10.0: 80
Number of HSP's gapped: 1748
Number of HSP's successfully gapped: 80
Length of query: 113
Length of database: 53,481,399
Length adjustment: 83
Effective length of query: 30
Effective length of database: 43,964,121
Effective search space: 1318923630
Effective search space used: 1318923630
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.6 bits)
S2: 59 (27.3 bits)