Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Smik_3.141.5ON1113111350110.0
YCL061C (MRC1)1.5ON1096112531820.0
Skud_3.31.5ON1152112329300.0
Suva_3.1521.5ON1140113427790.0
KAFR0D001401.5ON1041113810211e-120
SAKL0C00462g1.5ON11773857972e-88
NCAS0B091101.5ON10204757877e-88
NDAI0A001401.5ON10914887671e-84
KNAG0C002201.5ON11614737391e-80
Kpol_2002.81.5ON9854787109e-78
TPHA0E040101.5ON9654786453e-69
TBLA0A075701.5ON12524776194e-65
ZYRO0F18480g1.5ON9603625903e-62
KLLA0C00484g1.5ON9254515796e-61
Ecym_10081.5ON11183805783e-60
TDEL0C069701.5ON9413485718e-60
CAGL0B00330g1.5ON11363465669e-59
KLTH0F00484g1.5ON9934255151e-52
AFR745W1.5ON10183514642e-46
Kwal_33.130051.5ON9705144508e-45
NDAI0G034208.144ON48495744.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Smik_3.14
         (1113 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Smik_3.14 Chr3 complement(20226..23567) [3342 bp, 1113 aa] {ON} ...  1934   0.0  
YCL061C Chr3 complement(18816..22106) [3291 bp, 1096 aa] {ON}  M...  1230   0.0  
Skud_3.3 Chr3 complement(6855..10313) [3459 bp, 1152 aa] {ON} YC...  1133   0.0  
Suva_3.152 Chr3 complement(228665..232087) [3423 bp, 1140 aa] {O...  1075   0.0  
KAFR0D00140 Chr4 complement(13233..16358) [3126 bp, 1041 aa] {ON...   397   e-120
SAKL0C00462g Chr3 complement(41257..44790) [3534 bp, 1177 aa] {O...   311   2e-88
NCAS0B09110 Chr2 (1746358..1749420) [3063 bp, 1020 aa] {ON} Anc_...   307   7e-88
NDAI0A00140 Chr1 complement(8373..11648) [3276 bp, 1091 aa] {ON}...   300   1e-84
KNAG0C00220 Chr3 complement(33011..36496) [3486 bp, 1161 aa] {ON...   289   1e-80
Kpol_2002.8 s2002 complement(11914..14871) [2958 bp, 985 aa] {ON...   278   9e-78
TPHA0E04010 Chr5 (839903..842800) [2898 bp, 965 aa] {ON} Anc_1.5...   253   3e-69
TBLA0A07570 Chr1 (1874419..1878177) [3759 bp, 1252 aa] {ON} Anc_...   243   4e-65
ZYRO0F18480g Chr6 (1524051..1526933) [2883 bp, 960 aa] {ON} weak...   231   3e-62
KLLA0C00484g Chr3 complement(35397..38174) [2778 bp, 925 aa] {ON...   227   6e-61
Ecym_1008 Chr1 complement(13340..16696) [3357 bp, 1118 aa] {ON} ...   227   3e-60
TDEL0C06970 Chr3 (1264155..1266980) [2826 bp, 941 aa] {ON} Anc_1...   224   8e-60
CAGL0B00330g Chr2 complement(18031..21441) [3411 bp, 1136 aa] {O...   222   9e-59
KLTH0F00484g Chr6 complement(37017..39998) [2982 bp, 993 aa] {ON...   202   1e-52
AFR745W Chr6 (1803046..1806102) [3057 bp, 1018 aa] {ON} Syntenic...   183   2e-46
Kwal_33.13005 s33 complement(36797..39709) [2913 bp, 970 aa] {ON...   177   8e-45
NDAI0G03420 Chr7 (817362..818816) [1455 bp, 484 aa] {ON} Anc_8.1...    33   4.3  

>Smik_3.14 Chr3 complement(20226..23567) [3342 bp, 1113 aa] {ON}
            YCL061C (REAL)
          Length = 1113

 Score = 1934 bits (5011), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 969/1113 (87%), Positives = 969/1113 (87%)

Query: 1    MDDALNALSSLRSKKRVTTYKKVAIHIPDDNDNTDGNLYTNDIVAPPALTGNGFLFANAT 60
            MDDALNALSSLRSKKRVTTYKKVAIHIPDDNDNTDGNLYTNDIVAPPALTGNGFLFANAT
Sbjct: 1    MDDALNALSSLRSKKRVTTYKKVAIHIPDDNDNTDGNLYTNDIVAPPALTGNGFLFANAT 60

Query: 61   LNRVKNRLEGGKAPEQEHDNKDDEDEDVSSSQLIANLYEGGEDLEETKSNENDCTGKNCM 120
            LNRVKNRLEGGKAPEQEHDNKDDEDEDVSSSQLIANLYEGGEDLEETKSNENDCTGKNCM
Sbjct: 61   LNRVKNRLEGGKAPEQEHDNKDDEDEDVSSSQLIANLYEGGEDLEETKSNENDCTGKNCM 120

Query: 121  PTFTQTQRIPVSIQQDKVVDVPIHSVNEEKPTQIIKDDCFVNKIPQAQKLSTTTIKPVAT 180
            PTFTQTQRIPVSIQQDKVVDVPIHSVNEEKPTQIIKDDCFVNKIPQAQKLSTTTIKPVAT
Sbjct: 121  PTFTQTQRIPVSIQQDKVVDVPIHSVNEEKPTQIIKDDCFVNKIPQAQKLSTTTIKPVAT 180

Query: 181  QRIDSDDIITQSQQALPIKPIESPSQGKTATSNDLDVQSSKPPVLTIGKSPLFQPLLTRG 240
            QRIDSDDIITQSQQALPIKPIESPSQGKTATSNDLDVQSSKPPVLTIGKSPLFQPLLTRG
Sbjct: 181  QRIDSDDIITQSQQALPIKPIESPSQGKTATSNDLDVQSSKPPVLTIGKSPLFQPLLTRG 240

Query: 241  PVNQMDTPLESSPNNDETQLDVMPQNTQSDNKTQIDTIPQTTHYEDKTQMDTMSQTLQDG 300
            PVNQMDTPLESSPNNDETQLDVMPQNTQSDNKTQIDTIPQTTHYEDKTQMDTMSQTLQDG
Sbjct: 241  PVNQMDTPLESSPNNDETQLDVMPQNTQSDNKTQIDTIPQTTHYEDKTQMDTMSQTLQDG 300

Query: 301  VPHTLKIREIQNELALEDSRRERASNVEYTKPQKTIATKLKFSKESFLADFDDSSSNEDA 360
            VPHTLKIREIQNELALEDSRRERASNVEYTKPQKTIATKLKFSKESFLADFDDSSSNEDA
Sbjct: 301  VPHTLKIREIQNELALEDSRRERASNVEYTKPQKTIATKLKFSKESFLADFDDSSSNEDA 360

Query: 361  EIKVESAHPKPLGNEEELHEDKNIEPSINEVTKKTDKRVPLLSSYANNLKREIDSSKCIT 420
            EIKVESAHPKPLGNEEELHEDKNIEPSINEVTKKTDKRVPLLSSYANNLKREIDSSKCIT
Sbjct: 361  EIKVESAHPKPLGNEEELHEDKNIEPSINEVTKKTDKRVPLLSSYANNLKREIDSSKCIT 420

Query: 421  XXXXXXXXXXXXXXXXXRKLIKDEGALPISQLSKATILNLKARLSKQNQDISQRPLEGRD 480
                             RKLIKDEGALPISQLSKATILNLKARLSKQNQDISQRPLEGRD
Sbjct: 421  LDLDSGSDDDDNIVVDDRKLIKDEGALPISQLSKATILNLKARLSKQNQDISQRPLEGRD 480

Query: 481  ARLDHNKLFNTLRKASRKQILDHQREVIETKGFKLEDMXXXXXXXXXXXXXXXXXXXXXX 540
            ARLDHNKLFNTLRKASRKQILDHQREVIETKGFKLEDM                      
Sbjct: 481  ARLDHNKLFNTLRKASRKQILDHQREVIETKGFKLEDMVKEKELVENLLEQEIIRNKKIR 540

Query: 541  XXXXXXXXXXXSEFKLSPHXXXXXXXXXXXKFALSGNEVTDYELSGSXXXXXXXXXXXXX 600
                       SEFKLSPH           KFALSGNEVTDYELSGS             
Sbjct: 541  QKEKRREKLENSEFKLSPHDSGSDSGSESSKFALSGNEVTDYELSGSEDEIREEPDNEEE 600

Query: 601  XXXXXIVPKKKKAHHVKRMIDESDSENEAVPKEKVDASVPKRIAINLGHYGDNIEEEVNK 660
                 IVPKKKKAHHVKRMIDESDSENEAVPKEKVDASVPKRIAINLGHYGDNIEEEVNK
Sbjct: 601  EEEDDIVPKKKKAHHVKRMIDESDSENEAVPKEKVDASVPKRIAINLGHYGDNIEEEVNK 660

Query: 661  FQETNDMNTQQTDKITMERNIVENKAILEDTAXXXXXXXXXXXXXXXRRELIDKEKLQLR 720
            FQETNDMNTQQTDKITMERNIVENKAILEDTA               RRELIDKEKLQLR
Sbjct: 661  FQETNDMNTQQTDKITMERNIVENKAILEDTAVVDEDNINEEADEAIRRELIDKEKLQLR 720

Query: 721  QXXXXXXXXXXXXXXXGVTNFFEMEAEESDDEWHGIGGADGEGSDEYDSDVEKMIDDYSK 780
            Q               GVTNFFEMEAEESDDEWHGIGGADGEGSDEYDSDVEKMIDDYSK
Sbjct: 721  QKELEKAIKLKELKHKGVTNFFEMEAEESDDEWHGIGGADGEGSDEYDSDVEKMIDDYSK 780

Query: 781  NNFNSHEIREMLAAENKEMDVKMINKILYDIKNGGFRNKRAKNXXXXXXXXXXXXVLQQY 840
            NNFNSHEIREMLAAENKEMDVKMINKILYDIKNGGFRNKRAKN            VLQQY
Sbjct: 781  NNFNSHEIREMLAAENKEMDVKMINKILYDIKNGGFRNKRAKNSLELELSDDEDDVLQQY 840

Query: 841  XXXXXXXXXXXXXXIGDGTKLVKNPKSKAFFESMVEDIMEYKNPFRAEEESNQDITSTAT 900
                          IGDGTKLVKNPKSKAFFESMVEDIMEYKNPFRAEEESNQDITSTAT
Sbjct: 841  RLKRRELMRKRRLEIGDGTKLVKNPKSKAFFESMVEDIMEYKNPFRAEEESNQDITSTAT 900

Query: 901  DLDTLDNNSLNVRDSTRNNEKGPVDDKSKKIIISEDFVQKSLSFLKSNNYNEFEMDKELA 960
            DLDTLDNNSLNVRDSTRNNEKGPVDDKSKKIIISEDFVQKSLSFLKSNNYNEFEMDKELA
Sbjct: 901  DLDTLDNNSLNVRDSTRNNEKGPVDDKSKKIIISEDFVQKSLSFLKSNNYNEFEMDKELA 960

Query: 961  KMQHGNDDEPIEDLFTLKQHSSIKSFTNSQTDSFTSRTVTTMIDLEKRTEDEDEMENGDS 1020
            KMQHGNDDEPIEDLFTLKQHSSIKSFTNSQTDSFTSRTVTTMIDLEKRTEDEDEMENGDS
Sbjct: 961  KMQHGNDDEPIEDLFTLKQHSSIKSFTNSQTDSFTSRTVTTMIDLEKRTEDEDEMENGDS 1020

Query: 1021 SLVSGFKHPSIVKSFASRTDINDKFKEGNKTVKISKSYKMVGSSKASITYMGKTRKLMAP 1080
            SLVSGFKHPSIVKSFASRTDINDKFKEGNKTVKISKSYKMVGSSKASITYMGKTRKLMAP
Sbjct: 1021 SLVSGFKHPSIVKSFASRTDINDKFKEGNKTVKISKSYKMVGSSKASITYMGKTRKLMAP 1080

Query: 1081 KRKAGTDQNHHRHXXXXXXXXXLFESGQNSFDS 1113
            KRKAGTDQNHHRH         LFESGQNSFDS
Sbjct: 1081 KRKAGTDQNHHRHKKTKTKTSKLFESGQNSFDS 1113

>YCL061C Chr3 complement(18816..22106) [3291 bp, 1096 aa] {ON}
            MRC1S-phase checkpoint protein required for DNA
            replication; interacts with and stabilizes Pol2p at
            stalled replication forks during stress, where it forms a
            pausing complex with Tof1p and is phosphorylated by
            Mec1p; protects uncapped telomeres
          Length = 1096

 Score = 1230 bits (3182), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 693/1125 (61%), Positives = 800/1125 (71%), Gaps = 43/1125 (3%)

Query: 1    MDDALNALSSLRSKKRVTTYKKVAIHIPDDNDNTDGNLYTNDIVAPPALTGNGFLFANAT 60
            MDDAL+ALSSL +KKR TTYKKVA+ I D+NDNT+GN   NDI  PP LTGNGFLFANAT
Sbjct: 1    MDDALHALSSLTAKKRTTTYKKVAVPILDENDNTNGN-GPNDIDNPPELTGNGFLFANAT 59

Query: 61   LNRVKNRLEGGKAPEQEHDNKDDEDEDVSSSQLIANLYEGGEDLEETKSNENDCTGKNCM 120
            LNRVKNRLEG KAPEQ H+N  D  E+   +QLI+NLY+GGE+LE+++  +N  + KN  
Sbjct: 60   LNRVKNRLEGKKAPEQNHNNGKDRSENSLPTQLISNLYDGGEELEKSEVKDNSYSEKNVS 119

Query: 121  PTFTQTQRIPVSIQQDKVVDVPIHSVNEEKPTQIIKDDCFVNKIPQAQKLSTTTIKPVAT 180
             +FTQTQRIPVSIQQDKV +VPIHSVN+ KPTQ+IK+D  VN+  QA K   TT +P AT
Sbjct: 120  SSFTQTQRIPVSIQQDKVFNVPIHSVNDGKPTQLIKEDGLVNETSQALKTPLTTGRPGAT 179

Query: 181  QRIDSDDIITQSQQALPIKPIESPSQGKTATSNDLDVQSSKPPVL---TIGKSPLFQPLL 237
            QRIDS    +Q+Q   PIK IE  SQ  T +SN  +  S K P++    IG SPLFQ + 
Sbjct: 180  QRIDSSGATSQTQ---PIKSIEPQSQIITTSSNHSNALSPKIPIIPTELIGTSPLFQSIQ 236

Query: 238  TRGPVNQMDTPLESSPNNDETQLDVMPQNTQSDNKTQIDTIPQTTHYEDKTQMDTMSQTL 297
             RGP               +TQ+DV PQ    ++KTQ   IPQ TH E KTQ+DT++QTL
Sbjct: 237  NRGP---------------DTQMDVPPQTAHDEDKTQAIGIPQATHQEQKTQIDTVAQTL 281

Query: 298  QDGVPHTLKIREIQNELALEDSRRERASNVEYTKPQKTIATKLKFSKESFLADFDDSSSN 357
            QD VPHTLKIREIQ+ELA EDS+RE+A NVEY KPQK I TK  FSKESFLADFDDSSSN
Sbjct: 282  QDEVPHTLKIREIQSELASEDSKREKARNVEYKKPQKPIPTKKFFSKESFLADFDDSSSN 341

Query: 358  EDAEIKVESAHPKPLGNEEELHEDKNIEPSINEVTKKTDKRVPLLSSYANNLKREIDSSK 417
            ED +IK+E+AHPKP+ N++ELHE+K++E ++ + T+  +KRVPLLSSYANNLKREIDSSK
Sbjct: 342  EDDDIKLENAHPKPVQNDDELHENKSVELNLTDETRINEKRVPLLSSYANNLKREIDSSK 401

Query: 418  CITXXXXXXXXXXXXXXXXXRKLIKDEGALPISQLSKATILNLKARLSKQNQDISQRPLE 477
            CIT                  KL KDE  LPISQLSKATILNLKARLSKQNQ +SQRP +
Sbjct: 402  CITLDLDSDSDEYGDDDMDSIKLSKDESVLPISQLSKATILNLKARLSKQNQKLSQRPNK 461

Query: 478  GRDARLDHNKLFNTLRKASRKQILDHQREVIETKGFKLEDMXXXXXXXXXXXXXXXXXXX 537
             +D ++DHN L NTLRKASRKQILDHQ+EVIETKG KLEDM                   
Sbjct: 462  SKDPKVDHNVLLNTLRKASRKQILDHQKEVIETKGLKLEDMAKEKEIVENLLEQEILRNK 521

Query: 538  XXXXXXXXXXXXXXSEFKLSPHXXXXXXXXXXXKFALSGNEVTDYELSGSXXXXXXXXXX 597
                          ++F+L+ H            FALSGNE+ DYE SGS          
Sbjct: 522  RIRQKEKRREKLEENDFQLNAHDSGSDSGSESSGFALSGNEIADYESSGS--ENDNRRES 579

Query: 598  XXXXXXXXIVPKKKKAHHVKRMIDESDS--ENEAVPKEKVDASVPKRIAINLGHYGDNIE 655
                    I+ K+KK+HHVK +I+ESDS  E EA PKEK D S+PKRIAINLGHYGDNI 
Sbjct: 580  DSEKEDDEIILKQKKSHHVKHIINESDSDTEVEAKPKEKADESLPKRIAINLGHYGDNIG 639

Query: 656  EEVNKFQETNDMNTQQTDKITMERNIVENKAILEDTAXXXXXXXXXXXXXXXRRELIDKE 715
            E+ +KFQETN ++TQ  +++  ERN +EN+                      RR+LIDKE
Sbjct: 640  EDTDKFQETNVLDTQNIEEVMAERNTIENEV-------KDDVYVNEEADEAIRRQLIDKE 692

Query: 716  KLQLRQXXXXXXXXXXXXXXXGVTNFFEMEAEESDDEWHGIGGADGEGSDEYDSDVEKMI 775
            KLQL+Q               GVTNFFEMEAEES+DEWHGIGGADGEGSD+YDSD+EKMI
Sbjct: 693  KLQLKQKEKEHEAKIKELKKRGVTNFFEMEAEESEDEWHGIGGADGEGSDDYDSDLEKMI 752

Query: 776  DDYSKNNFNSHEIREMLAAENKEMDVKMINKILYDIKNGGFRNKRAKN-XXXXXXXXXXX 834
            DDYSKNNFN HEIREMLAAENKEMD+KMINKILYDIKNGGFRNKRAKN            
Sbjct: 753  DDYSKNNFNPHEIREMLAAENKEMDIKMINKILYDIKNGGFRNKRAKNSLELELSDDDED 812

Query: 835  XVLQQYXXXXXXXXXXXXXXIGDGTKLVKNPKSKAFFESMVEDIMEYKNPFRAEEESNQD 894
             VLQQY              IGD  KLVKNPKS AFFESMVEDI+EYKNPF AEEE N D
Sbjct: 813  DVLQQYRLKRRELMRKRRLEIGDDAKLVKNPKSSAFFESMVEDIIEYKNPFGAEEEYNLD 872

Query: 895  ITSTATDLDTLDNNSLNVRDSTRNNEKGPVDDKSKKIIISEDFVQKSLSFLKSNNYNEFE 954
            ITSTATDLDT D NS+NV D+T NNE+ PVD K+KK+IISEDFVQKSLSFLKSNNY +FE
Sbjct: 873  ITSTATDLDTQD-NSINVGDNTGNNEQKPVDQKNKKVIISEDFVQKSLSFLKSNNYEDFE 931

Query: 955  MDKELAKMQHGNDDEPIEDLFTLKQHSSIKSFTNSQTDSFTSRTVTTMIDLEKRTEDEDE 1014
             DKEL+++QHGN DE IEDL+TLKQ+SSIKSFTNSQTDS TS+TV T+IDLEKR EDEDE
Sbjct: 932  TDKELSRIQHGN-DEAIEDLYTLKQNSSIKSFTNSQTDSTTSKTVNTIIDLEKRPEDEDE 990

Query: 1015 MENGDSSLVSGFKHPSIVKSFASRTDINDKFKEGNKTVKISKSYKMVGSSKASITYMGKT 1074
            +ENGD+SLV  FKHPSI+KSFASRTDINDKFKEGNKTVKI KSYK VGSSKASITYMGKT
Sbjct: 991  VENGDTSLVGVFKHPSIIKSFASRTDINDKFKEGNKTVKILKSYKTVGSSKASITYMGKT 1050

Query: 1075 RKLMAPKRKA-GTDQNHHRH------XXXXXXXXXLFESGQNSFD 1112
            RKL+APKRK  G+ + HH H               LFESGQ+SFD
Sbjct: 1051 RKLIAPKRKTEGSHRYHHDHHNKKMKMKTKTKSNKLFESGQDSFD 1095

>Skud_3.3 Chr3 complement(6855..10313) [3459 bp, 1152 aa] {ON} YCL061C
            (REAL)
          Length = 1152

 Score = 1133 bits (2930), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 642/1123 (57%), Positives = 764/1123 (68%), Gaps = 36/1123 (3%)

Query: 1    MDDALNALSSLRSKKRVTTYKKVAIHIPDDNDNTDGNLYTNDIVAPPALTGNGFLFANAT 60
            MD+ L  LSSL SKKRVTTYKK+A  IPD +D+ DG+L +N++ APPALTGNGFLF NAT
Sbjct: 56   MDNVLEVLSSLTSKKRVTTYKKIASPIPDGDDDVDGDLLSNNMGAPPALTGNGFLFGNAT 115

Query: 61   LNRVKNRLEGGKAPEQEHDNKDDEDEDVSSSQLIANLYEGGEDLEETKSNENDCTGKNCM 120
            LNRVKNRLEG   PE +   KD+E+ED  S+QLIANLY+GGEDLEETKS  ++ + K+ +
Sbjct: 116  LNRVKNRLEGIDVPEDDRQIKDNENEDAVSTQLIANLYDGGEDLEETKSMGDNASLKDGI 175

Query: 121  PTFTQTQRIPVSIQQDKVVDVPIHSVNEEKPTQIIKDDCFVNKIPQAQKL--STTTIKPV 178
              FTQTQRIPVSIQ + VVDVPIHS+N+ K  +II+DD F +   Q QK+  +T  I PV
Sbjct: 176  AAFTQTQRIPVSIQSENVVDVPIHSINQGKSARIIRDDGFFSTAAQTQKIIPATARIIPV 235

Query: 179  ATQRIDSDDIITQSQQALPIKPIESPSQGKTATSNDLDVQSSKPPVLTIGKSPLFQPLLT 238
            ATQRI S D  +Q+QQ    KPIE  +Q    T+ND D Q  + PVLT   S LFQ    
Sbjct: 236  ATQRIHSRDTASQTQQVPFTKPIEPQTQIIGTTANDSDTQPLRIPVLTAEASLLFQTTPD 295

Query: 239  RGPVNQMDTPLESSPNNDETQLDVMPQNTQSDNKTQIDTIPQTTHYEDKTQMDTMSQTLQ 298
              P  +MD P                Q      KTQ+DT+ QT H E KTQ+DTM QT+ 
Sbjct: 296  CVPTIRMDPP---------------SQIEHDKYKTQLDTMTQTAHDEGKTQVDTMPQTIH 340

Query: 299  DGVPHTLKIREIQNELALEDSRRERASNVEYTKPQKTIATKLKFSKESFLADFDDSSSNE 358
            D V HTLKIRE+Q+ELALEDS+RE+A NVEY K ++ I T + FSKESFLADFD+SSS+E
Sbjct: 341  DDVSHTLKIRELQSELALEDSKREKARNVEYKKSRRNIPTMINFSKESFLADFDNSSSDE 400

Query: 359  DAEIKVESAHPKPLGNEEELHEDKNIEPSINEVTKKTDKRVPLLSSYANNLKREIDSSKC 418
              ++++E +  K   ++ E+HE+K  EP+  + ++++ K VPLLSSYANNLKREIDSSKC
Sbjct: 401  GTDVQLEKSQLKQQQDDNEVHENKPSEPNSVKNSRESYKNVPLLSSYANNLKREIDSSKC 460

Query: 419  ITXXXXXXXXXXXXXXXXXRKLIKDEGALPISQLSKATILNLKARLSKQNQDISQRPLEG 478
            I                     IKDE ALPIS+LSKA ILNLKARLSKQ+Q+++Q P + 
Sbjct: 461  IILDLDSDSDDDGDDYMGGNMSIKDESALPISRLSKAAILNLKARLSKQSQNLTQMPNKN 520

Query: 479  RDARLDHNKLFNTLRKASRKQILDHQREVIETKGFKLEDMXXXXXXXXXXXXXXXXXXXX 538
            + A++DHNKLFN LRKASRKQILDHQREVIETKGFKLEDM                    
Sbjct: 521  KGAKVDHNKLFNILRKASRKQILDHQREVIETKGFKLEDMAKEKEIVENLLEQEILRNRR 580

Query: 539  XXXXXXXXXXXXXSEFKLSPHXXXXXXXXXXXKFALSGNEVTDYELSGSXXXXXXXXXXX 598
                          +                 KF +S NE+ +YELS S           
Sbjct: 581  IRQKEKEKEKLENKD-------SGSDSGSESSKFEMSDNEIANYELSSSESEKNKNSDDE 633

Query: 599  XXXXXXX---IVPKKKKAHHVKRMIDESDSENEAVPKEKVDA---SVPKRIAINLGHYGD 652
                      IV  KKK++HVK +I+ESDSE E   K KV     + PKR AI+LGHYGD
Sbjct: 634  QEEEEEEEEDIVLNKKKSYHVKHVINESDSEIETEQKMKVSKKFDATPKRNAIDLGHYGD 693

Query: 653  NIEEEV-NKFQETNDMNTQQTDKITMERNIVENKAILEDTAXXXXXXXXXXXXXXXRREL 711
            NI+EE  N F+E   +NTQ+ D I ++ + +EN+                      RREL
Sbjct: 694  NIDEEASNSFEEATTLNTQKIDNIIIKTHTIENRE----EEEVENDSIDEEVSEAIRREL 749

Query: 712  IDKEKLQLRQXXXXXXXXXXXXXXXGVTNFFEMEAEESDDEWHGIGGADGEGSDEYDSDV 771
            IDK+K QLRQ               G+TNFFEMEAEES+DEWHG+GGADGEGS+EYDS+V
Sbjct: 750  IDKKKSQLRQKEKKHVAELKEFKSKGITNFFEMEAEESEDEWHGVGGADGEGSEEYDSEV 809

Query: 772  EKMIDDYSKNNFNSHEIREMLAAENKEMDVKMINKILYDIKNGGFRNKRAKNXXXXXXXX 831
            EKMIDDYSKN+FNSHEIREMLAAENKEMDVKMIN+ILYDIKNGGFRNKRAKN        
Sbjct: 810  EKMIDDYSKNSFNSHEIREMLAAENKEMDVKMINRILYDIKNGGFRNKRAKNSLELELSD 869

Query: 832  XXXXVLQQYXXXXXXXXXXXXXXIGDGTKLVKNPKSKAFFESMVEDIMEYKNPFRAEEES 891
                VLQQY              IGD TKLVKNPKSKAFFESMVEDIME+KNPF+AEEES
Sbjct: 870  DEDDVLQQYRLKRRELMRKRRLEIGDDTKLVKNPKSKAFFESMVEDIMEFKNPFKAEEES 929

Query: 892  NQDITSTATDLDTLDNNSLNVRDSTRNNEKGPVDDKSKKIIISEDFVQKSLSFLKSNNYN 951
            +QD+TSTATDLDT DN+S+ + DSTRNNE   VDD+SKK IISEDFVQKSLSFL+SNNY+
Sbjct: 930  HQDLTSTATDLDTQDNDSIQIGDSTRNNEHRRVDDRSKKTIISEDFVQKSLSFLRSNNYD 989

Query: 952  EFEMDKELAKMQHGNDDEPIEDLFTLKQHSSIKSFTNSQTDSFTSRTVTTMIDLEKRTED 1011
            EFEMDKE A++QH   DE +EDLFTLKQHSSIKSFTNS TDS +S+ V +MIDLE+ TED
Sbjct: 990  EFEMDKERARIQHDIGDEGVEDLFTLKQHSSIKSFTNSPTDSLSSKRVNSMIDLEQPTED 1049

Query: 1012 EDEMENGDSSLVSGFKHPSIVKSFASRTDINDKFKEGNKTVKISKSYKMVGSSKASITYM 1071
             +E+EN D SL+ GFKHPSI+KSFASRTDINDKFKEGNKTVKISK+YK VGSSKASITYM
Sbjct: 1050 NNEVENEDPSLIGGFKHPSIIKSFASRTDINDKFKEGNKTVKISKTYKTVGSSKASITYM 1109

Query: 1072 GKTRKLMAPKRKAGTDQNHHRHXXX-XXXXXXLFESGQNSFDS 1113
            GKTRKLMAPK+KA  D +H+ H          LFESGQ+SFDS
Sbjct: 1110 GKTRKLMAPKKKADRDHHHNHHSKAWKTQKSKLFESGQDSFDS 1152

>Suva_3.152 Chr3 complement(228665..232087) [3423 bp, 1140 aa] {ON}
            YCL061C (REAL)
          Length = 1140

 Score = 1075 bits (2779), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 631/1134 (55%), Positives = 745/1134 (65%), Gaps = 58/1134 (5%)

Query: 1    MDDALNALSSLRSKKRVTTYKKVAIHIPDDNDNTDGNLYTNDIVAPPALTGNGFLFANAT 60
            MDDALNALSSL SKKR TTYKKVA  I D+N +TDGNL  + + APPALTGNGFLF NAT
Sbjct: 44   MDDALNALSSLTSKKRATTYKKVASPILDENYDTDGNLPIDGMNAPPALTGNGFLFGNAT 103

Query: 61   LNRVKNRLEGGKAPEQEHDNKDDEDEDVSSSQLIANLYEGGEDLEETKSNENDCTGKNCM 120
            LNRVKNRLEG     Q+  +K++EDEDV S+QLIANLY+GGE+LE +KSN +    K  +
Sbjct: 104  LNRVKNRLEGRNELGQDGQDKENEDEDVFSTQLIANLYDGGEELE-SKSNGDKNNQKVNV 162

Query: 121  PTFTQTQRIPVSI-QQDKVVDVPIHSVNEEKPTQIIKDDCFVNKIPQAQKLSTTT--IKP 177
             +FTQTQRIPVSI QQ+  ++VPIHS+NE +PTQ  K+   V    Q Q +  TT  I  
Sbjct: 163  SSFTQTQRIPVSITQQNNEINVPIHSINEGEPTQKAKNRGSVITTSQTQAIPFTTAQITQ 222

Query: 178  VATQRIDSDDIITQSQQALPIKPIESPSQGKTATSNDLDVQSSKPPVLTIGKSPLFQPLL 237
              TQ +++    +Q+QQ  P KP E+ +Q   AT+ND D Q  K P+LT   SPLFQ + 
Sbjct: 223  KTTQCLNNHGATSQTQQIPPTKPSEAQTQADVATANDSDTQQ-KVPMLTTETSPLFQTVP 281

Query: 238  TRGPVNQMDTPLESSPNNDETQLDVMPQNTQSDNKTQIDTIPQTTHYEDKTQMDTMSQTL 297
             + P  QM+TP                              P T H +D+TQMDT++QT+
Sbjct: 282  DQSPSTQMNTP------------------------------PPTVH-DDRTQMDTVAQTM 310

Query: 298  QDGVPHTLKIREIQNELALEDSRRERASNVEYTKPQKTIATKLKFSKESFLADFDDSSSN 357
            QD VP TLKI E+Q+ELALED  R++A N EY K QKTI    +FSKESFLADFD+SSS+
Sbjct: 311  QDKVPPTLKIHELQSELALEDFNRKKAQNTEYRKLQKTIPIVKRFSKESFLADFDNSSSD 370

Query: 358  EDAEIKVESAHPKPLGNEEELHEDKNIEPSINEVTKKTDKRVPLLSSYANNLKREIDSSK 417
            ED   K+ES+ PK   N  E+ +     P   E   K DK+VPLLS+YANNLKREIDSSK
Sbjct: 371  EDTNFKLESSQPKQQQNGYEMIDISQSNPQPAEKENKKDKKVPLLSTYANNLKREIDSSK 430

Query: 418  CITXXXXXXXXXXXXXXXXXRKLIKDEGALPISQLSKATILNLKARLSKQNQDISQRPLE 477
            CIT                  KL +DE ALPISQLSKATI NLKARLSKQNQ ++Q   +
Sbjct: 431  CITLDLDSGSDKDNDNHMDTDKLNEDESALPISQLSKATIFNLKARLSKQNQKLAQGSNK 490

Query: 478  GRDARLDHNKLFNTLRKASRKQILDHQREVIETKGFKLEDMXXXXXXXXXXXXXXXXXXX 537
             +D + DHNKL NTLRKASRKQILDHQRE++ETKGFKLEDM                   
Sbjct: 491  NKDFKSDHNKLINTLRKASRKQILDHQREIVETKGFKLEDMVKEKEIVEDLLEQEILRNK 550

Query: 538  XXXXXXXXXXXXXXSEFKLSPHXXXXXXXXXXXKFALSGNEVTDYELSGSXXXXXXXXXX 597
                          + FKL+ H           KFALS NE+ DYELSGS          
Sbjct: 551  KIRQKEKKKEELENNGFKLNSHDSDSDSGSESSKFALSDNEIADYELSGSENEKGGDTDD 610

Query: 598  XXXXXXXXIVPKKKKAHHVKRMIDESDSENEAVPKEKVDASV---PKRIAINLGHYGDNI 654
                     +  KKK +  K ++DESDSE E   K +V+ +V   PKR AI+LGHYG+NI
Sbjct: 611  GEEEDDN--ITNKKKPYRTKHILDESDSEVEDEQKMEVEKNVENVPKRNAIDLGHYGNNI 668

Query: 655  E-EEVNKFQETNDMNTQQTDKITMERNIVENKAILEDTAXXXXXXXXXXX---------- 703
            + +  N FQ    ++TQQ  +IT +    E++    +                       
Sbjct: 669  DVDGSNSFQAAIVLDTQQVGEITTQTKTTEHEDDEGEEEKEETDDNDDDDDNDDDDNDDE 728

Query: 704  -XXXXRRELIDKEKLQLRQXXXXXXXXXXXXXXXGVTNFFEMEAEESDDEWHGIGGADGE 762
                 RRELID+EK + RQ               GVTNFFEMEAEES+DEWHG+GGADGE
Sbjct: 729  VSEAIRRELIDREKSERRQKEKEQATKLKELKSKGVTNFFEMEAEESEDEWHGVGGADGE 788

Query: 763  GSDEYDSDVEKMIDDYSKNNFNSHEIREMLAAENKEMDVKMINKILYDIKNGGFRNKRAK 822
            GSDEYDS+VEKMIDDYSKN FNSHEIREMLAAENKEMDVKMINKILYDIKNGGFRNKRAK
Sbjct: 789  GSDEYDSEVEKMIDDYSKNKFNSHEIREMLAAENKEMDVKMINKILYDIKNGGFRNKRAK 848

Query: 823  NXXXXXXXXXXXXVLQQYXXXXXXXXXXXXXXIGDGTKLVKNPKSKAFFESMVEDIMEYK 882
            N            VLQQY              IGD TKLVKNPKSKAFFESMVEDIME+K
Sbjct: 849  NSLELELSDDEDDVLQQYRLKRRELMRKRRLEIGDDTKLVKNPKSKAFFESMVEDIMEFK 908

Query: 883  NPFRAEEESNQDITSTATDLDTLDNNSLNVRDSTRNNEKGP-VDDKSKKIIISEDFVQKS 941
            NPF AE+ES+QD+TSTATDLDT DN++    D+T NNE    V DKSKK+IISEDFVQKS
Sbjct: 909  NPFGAEKESDQDVTSTATDLDTQDNDNTKPGDNTSNNEHNKHVGDKSKKLIISEDFVQKS 968

Query: 942  LSFLKSNNYNEFEMDKELAKMQHGNDDEPIEDLFTLKQHSSIKSFTNSQTDSFTSRTVTT 1001
            LSFLKSNNY+EFEMD+ELA++QHGN +  + DLFTLKQHSSIKSFTNSQT+S +SRT+ T
Sbjct: 969  LSFLKSNNYDEFEMDRELARIQHGNGEGDVVDLFTLKQHSSIKSFTNSQTNSLSSRTMNT 1028

Query: 1002 MIDLEKRTEDEDEMENGDSSLVSGFKHPSIVKSFASRTDINDKFKEGNKTVKISKSYKMV 1061
            +I+LE+ TE  DE ENGD SL+ GFKHPS++KSFASRTDINDKFKEGNKTVKISKSYK V
Sbjct: 1029 VINLEEHTEGNDEGENGDQSLIGGFKHPSVIKSFASRTDINDKFKEGNKTVKISKSYKTV 1088

Query: 1062 GSSKASITYMGKTRKLMAPKRKAGTDQNHHRH--XXXXXXXXXLFESGQNSFDS 1113
            GSSKASITYMGKTRKLMAPKRK  T++NHH +           LFE+GQ+SFDS
Sbjct: 1089 GSSKASITYMGKTRKLMAPKRK--TEENHHPNHIKKSKTQKSKLFENGQDSFDS 1140

>KAFR0D00140 Chr4 complement(13233..16358) [3126 bp, 1041 aa] {ON}
            Anc_1.5 YCL061C
          Length = 1041

 Score =  397 bits (1021), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 380/1138 (33%), Positives = 548/1138 (48%), Gaps = 177/1138 (15%)

Query: 1    MDDALNALSSLRSKKRVTTYKKVAIHIPDDNDNTDGNLYTNDIVAPPALTGNGFLFANAT 60
            MD     L +L+ KKR TTYKK++  +  +ND ++ N   ND   PPALTG GFLF N T
Sbjct: 1    MDGIFGNLQALKPKKR-TTYKKISDDL--ENDTSESN---ND---PPALTGEGFLFDNPT 51

Query: 61   LNRVKNRLEGGKAPEQEHDNKDDEDEDV-------SSSQLIANLYEGGEDLE--ETKSNE 111
            LNR+K RL+G             E++DV       S +QLI+NLY GGEDL+  E +  E
Sbjct: 52   LNRIKKRLDG-------------EEKDVVQYTMNFSQTQLISNLYGGGEDLDAPEVERRE 98

Query: 112  NDCTGKNCMPTFTQTQRIPVSIQQDKVVDVPIHSVNEEKPTQIIKDD-----------CF 160
                 +  +   T+ +     +         I+ +   +PTQ+I               +
Sbjct: 99   KQQLHEQQLE-LTKKRASKGQLHAFTKSSGNINDLRLMQPTQVIGSTQLAKEFSPVSRTY 157

Query: 161  VNKIPQAQKLSTTTIKPVA---TQRIDSDDIITQSQQALPIKPIESPSQGKTATSNDLDV 217
               +P   + ST  I       TQ + + +  TQ+ Q   +  + + +QG   T     +
Sbjct: 158  FKYVPDVNQ-STQVIHSATQDDTQVVSAREADTQATQMTQV--LSASTQGIYNTQETQSI 214

Query: 218  QSSKPPVLTIGKSPLFQP-LLTRGPVNQMDTPLESSPNNDETQLDVMPQN--TQSDN--- 271
              S  P+     +  ++     R P  + DT +     +D+     +P+   TQ D    
Sbjct: 215  TDSTQPISYSSSTQDYKTNKFNRHPTPE-DTQIIPREFDDDASTLPIPEGDKTQKDTSAV 273

Query: 272  -KTQIDTIPQTTHYEDKTQMDTMSQTLQDGVPHTLKIREIQNELALEDSRRERASNVEYT 330
             KTQID+  + T Y         S T+ D    TLKI EIQ EL  E+S++ + +  EY 
Sbjct: 274  LKTQIDSTTEGTSY---------SATVSD----TLKIHEIQREL--EESQKTK-TIPEYK 317

Query: 331  KPQKTIATKLKFSKESFLADFDDSSSNEDAEIKVESAHPKPLGNEEELHEDKNIEPS--I 388
            +  +T    + F+KES+  +FD       ++ + +  + +  G+ +++   KN  PS   
Sbjct: 318  QHVRTPKNVIVFTKESYFDEFD-------SDDEEKEENLESEGDSQKVQLLKNTSPSDKS 370

Query: 389  NEVTKKTDK---------RVPLLSSYANNLKREIDSSKCITXXXXXXXXXXXXXXXXXRK 439
            N+  +  DK         ++  L++Y   LKR+++S + I                    
Sbjct: 371  NDGKRLPDKTRTSPSFKPKLHGLNNYELKLKRQLNSDQQIDLNLDSDDEDGIDR------ 424

Query: 440  LIKDEGALPISQLSKATILNLKARLSKQNQDISQRPLE--GRDARLDHNKLFNTLRKASR 497
             + ++G  PISQ+SKAT+ ++KARLSK+      RP+     D++   + LFN L+KASR
Sbjct: 425  -MGEKG--PISQMSKATVFDIKARLSKK------RPIVKISNDSKTTLHTLFNKLQKASR 475

Query: 498  KQILDHQREVIETKGFKLEDMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSEFKLS 557
            +QI++HQ+EVIE KG  LED+                                  E +  
Sbjct: 476  QQIIEHQKEVIEKKGLNLEDIEKEKKIVENLLEQEINRNKKIRQR----------EKERE 525

Query: 558  PHXXXXXXXXXXXKFALSGNEVTDYELSGSXXXXXXXXXXXXXXXXXXIVPKKKKAHHVK 617
                          F  S NE+ + ELSG                      +K K    K
Sbjct: 526  KQLADAQDDENDLDFDHSANELDESELSG------EESAIDSDNDYDDFSLEKTKRSKKK 579

Query: 618  RMIDESDSE--------NEAVPKEKVDASVPKRIAINLGHYGDNIEEEVNKFQETNDMNT 669
             ++++SD+E        N  + +EK D+    R AINLG YGDN+   +   + T +  +
Sbjct: 580  VIVEDSDTEIEDEKMSHNAQIREEKDDSLFQNRNAINLGPYGDNL--SLAPIRITTEKQS 637

Query: 670  QQTDKITMERNIVENKAILEDTAXXXXXXXXXXXXXXXRRELIDKEKLQLRQXXXXXXXX 729
             +  K++ E     ++ I E                  R  LI+++K    +        
Sbjct: 638  GKNFKVSRESGDERDEEIPE----------------KDRIRLIEEKKQHELERQRKQMKK 681

Query: 730  XXXXXXXGVTNFFEMEAEESDDEWHGIGGADGEGSDEYDSDVEKMIDDYSKNNFNSHEIR 789
                   G+TNF E EAEES+DEWHGIGG DGE SDEYDS+VEKMIDDYSK NFN  EIR
Sbjct: 682  RKEMKAKGITNFLEEEAEESEDEWHGIGGIDGEMSDEYDSEVEKMIDDYSKANFNPDEIR 741

Query: 790  EMLAAENKEMDVKMINKILYDIKNGGFRNKRAKNXXXXXXXXXXXXVLQQYXXXXXXXXX 849
            +MLA ENKE D+KM+ KILYDIKNGGFR KR K              L+QY         
Sbjct: 742  QMLADENKETDIKMVEKILYDIKNGGFR-KRRKGAMDLELSDEEDDELKQYRLKRRELMR 800

Query: 850  XXXXXIGDGTKLVKNPKSKAFFESMVEDIMEYKNPFRAEEESNQDITSTATDLDTLDNNS 909
                 +G+   LVKNPKSKAFFESMV+DI+E KNPF   E   Q   +  TD  T +N  
Sbjct: 801  QKRLEVGEAETLVKNPKSKAFFESMVDDIVEVKNPFAVFEP--QRSGTITTDDGTQEN-- 856

Query: 910  LNVRDSTRNNEKGPVDDKSKKIIISEDFVQKSLSFLKSNNYNEFEMDK--ELAKMQHGND 967
                    +NE     + SKK+++SE+FVQ++LSFL S+     +MD+      M+   +
Sbjct: 857  ------ANSNEGAASQNPSKKVMLSEEFVQRTLSFLNSSK----DMDQFAPARSMRAEAN 906

Query: 968  DEPIEDLFTLKQHSSIKSFTNSQTDSFTSRTVTTMIDLEKRTEDEDEMENGDSSLVSGFK 1027
            DE IEDL  LK+ SSIKSF          +T    +  E    D++  ++ D  L S   
Sbjct: 907  DELIEDLTALKKQSSIKSF----------KTTRASVSQEPTDFDKENDDSFDDLLNSRVG 956

Query: 1028 HPSIVKSFASRTDINDKFKEGNKTVKISKSYKMVGSSKASITYMGKTRKLMAPKRKAG 1085
              SI+K+F++  DINDKF+EG KTVK+SK+YK V SSKASITYMGK RKL+AP++K  
Sbjct: 957  TSSIMKTFSATVDINDKFQEGVKTVKVSKAYKSVSSSKASITYMGKMRKLVAPQKKVA 1014

>SAKL0C00462g Chr3 complement(41257..44790) [3534 bp, 1177 aa] {ON}
            some similarities with uniprot|P25588 Saccharomyces
            cerevisiae YCL061C MRC1 S-phase checkpoint protein found
            at replication forks required for DNA replication also
            required for Rad53p activation during DNA replication
            stress where it forms a replication-pausing complex with
            Tof1p and is phosphorylated by Mec1p protein involved in
            replication checkpoint
          Length = 1177

 Score =  311 bits (797), Expect = 2e-88,   Method: Compositional matrix adjust.
 Identities = 189/385 (49%), Positives = 249/385 (64%), Gaps = 29/385 (7%)

Query: 737  GVTNFFEMEAEESDDEWHGIGGADGEGSDEYDSDVEKMIDDYSKNNFNSHEIREMLAAEN 796
            GV+  FEMEAEES+DEWHG+GGADGE SDEYDS++EKM+DDY+K  F+  EIR+MLAAE+
Sbjct: 814  GVSKMFEMEAEESEDEWHGVGGADGELSDEYDSELEKMVDDYTKTTFDPAEIRQMLAAED 873

Query: 797  KEMDVKMINKILYDIKNGGFRNKRAKNXXXXXXXXXXXXVLQQYXXXXXXXXXXXXXXIG 856
            KE D K++NKIL+DIKNGGFR +R K              LQ+Y               G
Sbjct: 874  KEYDEKIVNKILHDIKNGGFR-RRGKGALDIELSDDEDDELQRYHAKRRELLRQKVLENG 932

Query: 857  DGTKLVKNPKSKAFFESMVEDIMEYKNPFRAEEESNQDITSTATDLDTLDNNSLNVRDST 916
            + +KLV NPKS AFFESMVED++E KNPF   E ++ D +   ++ D +DN S +    T
Sbjct: 933  EASKLVSNPKSHAFFESMVEDLVESKNPFSIGETADPD-SGAISENDKVDNASEH---GT 988

Query: 917  RNNEKG-PVDDKSKKIIISEDFVQKSLSFLKSNNY--NEFEMDKELAKMQH---GNDDEP 970
            + +  G PV  + K+I IS++FVQ+SLSFL S +   NEFE+D+ LAK QH   G+D++ 
Sbjct: 989  QPDAGGQPVRTERKRIKISQEFVQRSLSFLNSKDELDNEFELDRRLAKHQHSTLGDDNDD 1048

Query: 971  IEDLFTLKQHSSIKSFTNSQTDSFTSRTVTTMIDLEKRTEDEDEMENGDSSLVSGFKHPS 1030
            +EDLFTLKQ+S IK+          +RT +  +DLE          +G+S   +GFK PS
Sbjct: 1049 LEDLFTLKQNSCIKTLHT------PARTSSRTVDLEV---------DGNSP-ANGFKLPS 1092

Query: 1031 IVKSFASRTDINDKFKEGNKTVKISKSYKMVGSSKASITYMGKTRKLMAPKRKAGTDQN- 1089
            ++ SF+SR DIN+KFKEG KTVK+SKSYK +G S+ASITY+GK RKL APKRK    +  
Sbjct: 1093 VISSFSSRIDINEKFKEGTKTVKVSKSYKTIGGSRASITYLGKVRKLNAPKRKESGRKPV 1152

Query: 1090 -HHRHXXXXXXXXXLFESGQNSFDS 1113
              HRH         LF    +SF++
Sbjct: 1153 FGHRHPEAAPKRAGLFADNDDSFEA 1177

 Score = 76.6 bits (187), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 88/288 (30%), Positives = 130/288 (45%), Gaps = 69/288 (23%)

Query: 273 TQIDT-IPQTTHYEDKTQMDTMSQTLQDGVPHT----LKIREIQNELALEDSRRERASNV 327
           TQ+DT +P T+   D      +  T  D   H     L I EI+ +L   D+  ER   +
Sbjct: 253 TQLDTCVPDTSALGD------VQPTAPDQSAHRNSQRLLIHEIEKDL---DAEEEREKRI 303

Query: 328 EYTKPQKTI-ATKLKFSKESFLADFDDSSSNED----------AEIKVESAHPK------ 370
              KP   +   K KF KE+FL +FD SSS  +            ++ E A  +      
Sbjct: 304 TEAKPHDVVLVVKKKFDKEAFLNNFDCSSSEGEEQEQEEQEEQTHLESEPASKRRKLFTS 363

Query: 371 ----PLGNEE-ELHEDKNIEPSINEVTKKT---------DKR----VPLLSSYANNLKRE 412
               PL +++ E     N   +I      T         DK     VPL +SY N LK  
Sbjct: 364 VPGNPLDSKDSEAGGSGNFASAIAATIGTTTDEGRSTRKDKEEAGWVPL-NSYKNQLKAR 422

Query: 413 IDSSKCITXXXXXXXXXXXXXXXXXRKLIKDEGALPISQLSKATILNLKARLSKQN--QD 470
           +DS + I                      +DE ++P S++SKA +L +KAR SK+   + 
Sbjct: 423 LDSKEHIDLDSSSD---------------EDENSVPASKMSKAAVLEIKARTSKRQGIKK 467

Query: 471 ISQRPLEGRDARLDHNKLFNTLRKASRKQILDHQREVIETKGFKLEDM 518
             Q+P   R   L   +LF++L+KA++KQILDH+RE+ E +G  LED+
Sbjct: 468 TRQQPSTPRAPSL--KELFSSLKKANKKQILDHRREITEKRGLNLEDI 513

>NCAS0B09110 Chr2 (1746358..1749420) [3063 bp, 1020 aa] {ON} Anc_1.5
            YCL061C
          Length = 1020

 Score =  307 bits (787), Expect = 7e-88,   Method: Compositional matrix adjust.
 Identities = 222/475 (46%), Positives = 278/475 (58%), Gaps = 66/475 (13%)

Query: 611  KKAHHVKRMIDESDSENEAVPKEKVDASVPKRIAINLGHYGDNIEEEVNKFQETNDMNTQ 670
            +K  H  R+I ESD ENE          + K   I+LG YG N++   N      + N  
Sbjct: 580  RKEKHPVRIIQESDDENE----------INKINTIDLGVYGGNLDNP-NPLSSQTEPNED 628

Query: 671  QTDKITMERNIVENKAILEDTAXXXXXXXXXXXXXXXRRELIDKEKLQLRQXXXXXXXXX 730
              D    E++  ENK I E+                 R  LI  EK +++          
Sbjct: 629  DED----EKSTYENKEITEE----------------ERHALILAEKKRIQLIEKKNAART 668

Query: 731  XXXXXXGVTNFFEMEAEESDDEWHGIGGADGEGSDEYDSDVEKMIDDYSKNNFNSHEIRE 790
                  GV   FEMEAEES+DEWHGIGGADGE SDEYDS+VEKMIDDYSK+NFN  EIR+
Sbjct: 669  KEMKKKGVNKLFEMEAEESEDEWHGIGGADGEVSDEYDSEVEKMIDDYSKSNFNPDEIRQ 728

Query: 791  MLAAENKEMDVKMINKILYDIKN-GGFRNKRAKNXXXXXXXXXXXXVLQQYXXXXXXXXX 849
            MLA ENKEMD+ MI KILYDIKN G  + +R                L++Y         
Sbjct: 729  MLALENKEMDLNMITKILYDIKNGGFRKRRRGGLDLELSDDDEDDEELREYHKRKRELMK 788

Query: 850  XXXXXIGDGTKLVKNPKSKAFFESMVEDIMEYKNPFRAEEESNQDITSTATDLDTLDNNS 909
                 IGD  KL+KNPKSKAFFESMVEDI++ KN F   E     I  ++T+LDT +   
Sbjct: 789  KRMLEIGDDKKLIKNPKSKAFFESMVEDIVDEKNAFGDIE----SIEKSSTELDTQEEKE 844

Query: 910  LNVRDSTRNNEKGPVDDKSKKIIISEDFVQKSLSFLKSN-NYNEFEMDKELAKMQHGNDD 968
             +V          P  DK KK +ISE+FVQK+LSFL+S  +  EF ++++LAK QHG   
Sbjct: 845  QDV---------TPGVDK-KKNVISEEFVQKTLSFLRSGRDLEEFNIEEDLAKEQHG--- 891

Query: 969  EPIEDLFTLKQHSSIKSFTN-SQTDSFTSRTVTTMIDLEKRTEDEDEMENGDSSLVSGFK 1027
            E +EDLF+LKQ S+IK F N SQT++         IDL       + +EN +SS + GFK
Sbjct: 892  ENVEDLFSLKQRSTIKEFRNPSQTNT---------IDL------INNVENVESSPLGGFK 936

Query: 1028 HPSIVKSFASRTDINDKFKEGNKTVKISKSYKMVGSSKASITYMGKTRKLMAPKR 1082
             PS++KSF+SRTDIN+KFK+GNKTV ISK YK VGSSKASITY+GK+RKLM PK+
Sbjct: 937  PPSVIKSFSSRTDINEKFKDGNKTVTISKVYKTVGSSKASITYLGKSRKLMPPKK 991

 Score =  120 bits (302), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 167/526 (31%), Positives = 252/526 (47%), Gaps = 90/526 (17%)

Query: 10  SLRSKKRVTTYKKVAIHIPDDNDNTDGNLYTNDIVAPPALTGNGFLFANATLNRVKNRLE 69
           SL  K+R TTYKK  IH   +ND  +      D++APP + GNGF+F NA +++++NRL+
Sbjct: 9   SLPKKQRKTTYKK--IHEEPNNDE-EALTEAVDVMAPPVI-GNGFIFGNALIDKIRNRLD 64

Query: 70  GGKAPEQEHDNKDDEDEDV-SSSQLIANLYEGGEDLEETKSNENDCTGKNCMPTFTQTQR 128
           G        +NK  ED  V + +Q+I NLY+  E+  E ++ E +    N      QTQ 
Sbjct: 65  G-------KENK--EDTPVPTQTQMIDNLYKDAEE-LEEETIEYEKEAINKEQEVVQTQL 114

Query: 129 IPVSIQQDKVVDVPIHSVNEEKPTQIIKDDCFV---NKIPQAQKLSTTTIKPVATQRIDS 185
           I    ++ + +  P  +  +E  TQ I++  F+   NK  + Q+  T  I PV ++   S
Sbjct: 115 IAKEKEEIENIKNPSDAYLQE--TQPIEEKSFLLGTNKELETQE--TQVINPVLSESQPS 170

Query: 186 DDIITQSQQALPI---KPIESPSQGKTATSNDLDVQSSKPPVLTIGKSPLFQPLLTRGPV 242
           ++    S + +P    + I+   +     S DL +  SK   +TI             P 
Sbjct: 171 EN--RSSNEKIPFTFTQKIQDFVETVENYSTDLSL--SKDETITIN-----------LPN 215

Query: 243 NQMD--TPLESSPNNDETQLDVMPQNTQSDNKTQIDTIPQTTHYEDKTQMDTMSQTLQDG 300
           +  D  T   +   + E Q  +   +TQ  N T +D I  T    D   ++    T+ D 
Sbjct: 216 HATDNSTSKRAHRISQELQRTMTDMDTQVINNTNLDVIEATMA--DLPNLNEPQSTVAD- 272

Query: 301 VPHT-LKIREIQNELALEDSRRERASNVEYTKPQKTI-ATKLKFSKESFLADFDDSSSNE 358
           +P T LKI EIQ EL  E + +E     EY KP K I    +KFSK S L  FD+SSS+ 
Sbjct: 273 IPSTGLKIHEIQKELERERNSKELK---EYKKPSKEIKVIPIKFSKTSLLDGFDNSSSD- 328

Query: 359 DAEIKVESAHPKPLGNEEELHEDKNI-----EPSINEVTKKTDKRVPLLSSYANNLKREI 413
                          +E E+ +D  I     +P  +   K   K++  L++Y N LK+++
Sbjct: 329 ---------------DELEVQKDMKITRTKEKPESSIKPKIKPKKLTGLNTYENKLKKKL 373

Query: 414 DSSKCITXXXXXXXXXXXXXXXXXRKLIKDEGALPISQLSKATILNLKARLSKQNQDISQ 473
              K I                            PIS+ SKAT+LNLKARLSK+      
Sbjct: 374 LEKKHIQLDSDSDNDSDIAKR------------FPISRTSKATLLNLKARLSKK------ 415

Query: 474 RPLEG-RDARLDHNKLFNTLRKASRKQILDHQREVIETKGFKLEDM 518
           +P++  +      + LF  L++ASRKQILDHQRE++E +GFKLED+
Sbjct: 416 KPVKSNKSTNTSLDVLFQNLKQASRKQILDHQRELVENRGFKLEDI 461

>NDAI0A00140 Chr1 complement(8373..11648) [3276 bp, 1091 aa] {ON}
            Anc_1.5 YCL061C
          Length = 1091

 Score =  300 bits (767), Expect = 1e-84,   Method: Compositional matrix adjust.
 Identities = 218/488 (44%), Positives = 279/488 (57%), Gaps = 54/488 (11%)

Query: 638  SVPKRIAINLGHYGDNIEEEVNKFQETNDMNTQQTDKITMERNIVENKAILEDTAXXXXX 697
            ++ KR AI+LG YGDN+     K Q+ +D+         ++   +E              
Sbjct: 644  TISKRNAIDLGAYGDNLTTANVKSQDDDDLEVDDDKNENLDTQPLE-------------- 689

Query: 698  XXXXXXXXXXRRELIDKEKLQLRQXXXXXXXXXXXXXXXGVTNFFEMEAEESDDEWHGIG 757
                      R ++I+ EK +++                GVT FFEMEAEES+DEWHGIG
Sbjct: 690  -----LTEQERIDIIEAEKTKIKMQQEKMRHKEKEMMKKGVTKFFEMEAEESEDEWHGIG 744

Query: 758  GADGEGSDEYDSDVEKMIDDYSKNNFNSHEIREMLAAENKEMDVKMINKILYDIKNGGFR 817
            G DGE SDEYDSDVEKMIDDYSK NF+ +EIREMLAAENKEMD+ MINKILYDIKNGGFR
Sbjct: 745  GIDGEMSDEYDSDVEKMIDDYSKANFDPNEIREMLAAENKEMDLNMINKILYDIKNGGFR 804

Query: 818  NKRAKNXXXXXXXXXXXXVLQQYXXXXXXXXXXXXXXIGDG-TKLVKNPKSKAFFESMVE 876
             ++                L++Y              +GD   KLVKNPKSKAFFESMVE
Sbjct: 805  KRKRGGLELELSEDEDDDALREYHLKRKELMRKRRLELGDDEKKLVKNPKSKAFFESMVE 864

Query: 877  DIMEYKNPFRAE---EESNQDITSTATDLDTLDNNSLNVRDSTRNNEKG-PVDDKSKKII 932
            DI + KN F  E   E S Q+I +T  D+           D+    E G     K KK I
Sbjct: 865  DITDDKNAFNDEPLGETSTQEINNTQDDMKE--------EDAAVVKENGDSKRIKKKKTI 916

Query: 933  ISEDFVQKSLSFLKSNNYN-EFEMDKELAKMQHGNDDEPIEDLFTLKQHSSIKSFTNSQT 991
            ISE+FVQ++LSFLKS+  + EF M++ LAK QHG     +E+L +LKQ SSIK F   Q+
Sbjct: 917  ISEEFVQRTLSFLKSSREDEEFAMNENLAKEQHGT---KVENLLSLKQQSSIKVF---QS 970

Query: 992  DSFTSRTVTTMIDLEKRTEDEDEMENGDSSLVSGFKHPSIVKSFASRTDINDKFKEGNKT 1051
             S  S  V       K  +  ++ ++ + S ++ FK PSI+KSF S+TDIN+KF++GNKT
Sbjct: 971  PSNNSSKVI------KLDDINNDDDDDEDSPIALFKVPSILKSFGSKTDINEKFQDGNKT 1024

Query: 1052 VKISKSYKMVGSSKASITYMGKTRKLMAPK-------RKAGTDQNHHRHXXXXXXXXXLF 1104
            V ISKSY+ VGSSKASITY+GK+RKLMAP        R   TD N  +          LF
Sbjct: 1025 VTISKSYRTVGSSKASITYLGKSRKLMAPTHSKMKPLRSRVTDNN--KITKGERNIGSLF 1082

Query: 1105 ESGQNSFD 1112
             +G +SF+
Sbjct: 1083 STGDDSFE 1090

 Score = 71.6 bits (174), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 40/77 (51%), Positives = 57/77 (74%), Gaps = 6/77 (7%)

Query: 444 EGALPISQLSKATILNLKARLSKQNQDISQRPLEGRDARLDHN--KLFNTLRKASRKQIL 501
           E +LP+S+ SKATIL +KARLSKQ    S++ ++ +D  ++ N  KLF  L+K+SRKQIL
Sbjct: 441 ENSLPVSRTSKATILTIKARLSKQK---SKKNVQ-KDGTVNTNLNKLFENLKKSSRKQIL 496

Query: 502 DHQREVIETKGFKLEDM 518
           ++QRE+IE KG   ED+
Sbjct: 497 ENQRELIENKGLNFEDI 513

>KNAG0C00220 Chr3 complement(33011..36496) [3486 bp, 1161 aa] {ON}
            Anc_1.5 YCL061C
          Length = 1161

 Score =  289 bits (739), Expect = 1e-80,   Method: Compositional matrix adjust.
 Identities = 195/473 (41%), Positives = 259/473 (54%), Gaps = 69/473 (14%)

Query: 622  ESDSENEAVPKEKVDASVPKRI----------AINLGHYGDNIE--EEVNKFQETNDMNT 669
            ESDSE E V       + P             AI+LG YG+N+E   E+N        NT
Sbjct: 715  ESDSEEETVNSNDKRVNAPSESKPIHPVNNINAIDLGDYGNNLEIRAELN--------NT 766

Query: 670  QQTDKITMERNIVENKAILEDTAXXXXXXXXXXXXXXXRRELIDKEKLQLRQXXXXXXXX 729
            ++ D           K +L++                     +DKE+L+           
Sbjct: 767  EKLD----------TKCMLDE---------------KEHARAVDKERLKTIMKEKKLMLK 801

Query: 730  XXXXXXXGVTNFFEMEAEESDDEWHGIGGADGEGSDEYDSDVEKMIDDYSKNNFNSHEIR 789
                   GV+NFFE EAEES+DEWHGIGG DGE SDEYDS+VEKMIDDYS+ + +  EIR
Sbjct: 802  RAELKEKGVSNFFEEEAEESEDEWHGIGGIDGEVSDEYDSEVEKMIDDYSRADMDPEEIR 861

Query: 790  EMLAAENKEMDVKMINKILYDIKNGGFRNKRAKNXXXXXXXXXXXXVLQQYXXXXXXXXX 849
            ++L +ENKEMDVKM+NKIL+DIKNG FR KR ++             L+QY         
Sbjct: 862  KLLVSENKEMDVKMVNKILFDIKNGNFR-KRGRDTLELELSDEEDDDLRQYRQKRNELMK 920

Query: 850  XXXXXIGDGTKLVKNPKSKAFFESMVEDIMEYKNPFRAEEESNQDITSTATDLDTLDNNS 909
                 +GD  KLVKN K+KAFF+S+VEDI+E KNPF    ++    T   T         
Sbjct: 921  QRLLDLGDDKKLVKNVKTKAFFDSLVEDIVEVKNPFGVMSDNETQDTDETT------TID 974

Query: 910  LNVRDSTRNNEKGPVDDKSKKIIISEDFVQKSLSFLKSN-NYNEFEMDKELAKMQHGNDD 968
               R+S  N E+ P  +K KK ++SE+FVQ+SLSFL SN N  EFE +++LA++QH +D 
Sbjct: 975  TQTRESVSNKEEKPTQEKGKKTVLSEEFVQRSLSFLNSNRNLTEFEQNQDLARLQHDDD- 1033

Query: 969  EPIEDLFTLKQHSSIKSFTNSQTDSFTSRTVTTMIDLEKRTEDEDEMENGDSSLVSGFKH 1028
              + DL+TLK+ SS+KSF      S  S+     +D    +        G +   + F+ 
Sbjct: 1034 --VSDLYTLKKQSSVKSFK-----SVGSKNEIINVDANDNS--------GTAVATATFRP 1078

Query: 1029 PSIVKSFASRTDINDKFKEGNKTVKISKSYKMVGSSKASITYMGKTRKLMAPK 1081
            PSI+KSF S+ +++DKF+ G KTVK  KSYK VG SK S+TYM K RKL APK
Sbjct: 1079 PSIIKSFNSKLNVDDKFRNGKKTVKTFKSYKAVGGSKTSVTYMNKVRKLTAPK 1131

 Score = 77.4 bits (189), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 47/108 (43%), Positives = 61/108 (56%), Gaps = 11/108 (10%)

Query: 1   MDDALNALSSLRSKKRVTTYKKVAIHIPDDNDNTDGNLYTNDIVAPPALTGNGFLFANAT 60
           MDD L   +S++ K+R TTYKKV         N+      +D   P +L GNGFLF NAT
Sbjct: 1   MDDLLERFNSVKVKRR-TTYKKV-------QQNSTDEAAGDDDCVPTSLAGNGFLFGNAT 52

Query: 61  LNRVKNRLEGGKAPEQEHDNKDDEDED---VSSSQLIANLYEGGEDLE 105
           ++++KNRL     P    D      ED   VS SQL++ LY+GGEDLE
Sbjct: 53  VDKIKNRLNNEDHPNSSIDVTKSSSEDQIPVSQSQLLSTLYDGGEDLE 100

 Score = 64.7 bits (156), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 107/404 (26%), Positives = 172/404 (42%), Gaps = 59/404 (14%)

Query: 126 TQRIPVSIQQDKVVDVPIHSVNEEKPTQIIKDDCFVNKIPQAQKLSTTTIKPVATQRIDS 185
           TQ +    Q  ++VD       + +PTQII  D    ++  AQ       +   TQ ID 
Sbjct: 258 TQLVDTDTQPTQIVDT------DSQPTQIIDTDTQPTQLIDAQPAQIIDAETQPTQIID- 310

Query: 186 DDIITQSQQALPIKPIESPSQ--GKTATSNDLDVQSSKPP--VLTIGKSPLFQPLLTRGP 241
               T +Q    I P   P+Q    +  SN   + +   P  +L+ G S L         
Sbjct: 311 ----TNAQPTQIIDPDTQPTQLINYSHESNGKHIPTLPAPDALLSTGTSLL--------- 357

Query: 242 VNQMDTPLESSPNNDETQLDVMPQNTQSDNKTQIDTIPQTTHYEDKTQMDTMSQTLQDGV 301
              ++ PL        T       N +  N +Q           D+ +      T+ D V
Sbjct: 358 --GLNIPLHRYATAGTTS------NPKHKNDSQHIIEDNIATMRDRLETQEFQPTVADDV 409

Query: 302 P---HTLKIREIQNELALEDSRRERASNVEYTKPQKTIA-TKLKFSKESFLADFDDSSSN 357
               +TLKI EIQ ++  E++R      VE+ K +   +  +++F+KESF+ADF++S S 
Sbjct: 410 KSGGNTLKIHEIQTQID-EETRNMLNRGVEHRKSRGVPSRVEVRFTKESFMADFEESDSA 468

Query: 358 EDAEI---KVESAHPKPLGNEEELHEDKNIEPSINEVTKKTDKRVPLLSSYANNLKREID 414
            D E    ++    P+  G+ +    +K  +P+  E  K   KRV  LSSY   L+ +++
Sbjct: 469 SDMESDSDQINDTTPET-GSSQNSDSNKARKPT--EAPKT--KRVTGLSSYETILRNKVN 523

Query: 415 SSKCITXXXXXXXXXXXXXXXXXRKLIKDEGALPISQLSKATILNLKARLSKQNQDISQR 474
             +C+                  +          +SQ SKA +LN+KA+  K+   +   
Sbjct: 524 DDECLDLGSDDTYSSEEEYDKESK----------VSQASKAAVLNIKAKALKKKAIVKAA 573

Query: 475 PLEGRDARLDHNKLFNTLRKASRKQILDHQREVIETKGFKLEDM 518
                   LD   LF+ L+K +R+QIL HQ E+I TKG   +D+
Sbjct: 574 --NTNKTTLD--SLFSDLKKKNRQQILSHQAEIIGTKGINHKDL 613

>Kpol_2002.8 s2002 complement(11914..14871) [2958 bp, 985 aa] {ON}
            complement(11914..14871) [2958 nt, 986 aa]
          Length = 985

 Score =  278 bits (710), Expect = 9e-78,   Method: Compositional matrix adjust.
 Identities = 202/478 (42%), Positives = 265/478 (55%), Gaps = 73/478 (15%)

Query: 640  PKRIAINLGHYGDNIEEEVNKFQETNDMNTQQTDKITMERNIVENKAILEDTAXXXXXXX 699
            P    INLGHYGDN+ +E N   E N++++ +++   + + +V+ +              
Sbjct: 575  PSLNTINLGHYGDNLSQENN--NERNNIDSDESEDEELYKEMVKKEI------------- 619

Query: 700  XXXXXXXXRRELIDKEKLQLRQXXXXXXXXXXXXXXXGVTNFFEMEAEESDDEWHGIGGA 759
                    RR+   K++ +LR+               G+T+ FE+EAEES+DEWHGIGG 
Sbjct: 620  ------DRRRDQERKQRQKLRELKDK-----------GITDMFEVEAEESEDEWHGIGGV 662

Query: 760  DGEGSDEYDSDVEKMIDDYSKNNFNSHEIREMLAAENKEMDVKMINKILYDIKNGGFRNK 819
            DGE SDEYDS+VEKMIDDYSK NFN+ EIRE LAAENK+MD+KM+N+IL DIKNGGFR +
Sbjct: 663  DGELSDEYDSEVEKMIDDYSKENFNAGEIREKLAAENKDMDLKMVNRILNDIKNGGFRKR 722

Query: 820  RAKNXXXXXXXXXXXXVLQQYXXXXXXXXXXXXXXIGDGTKLVKNPKSKAFFESMVEDIM 879
            R  N             L+ Y                   KL+ N KS AF ESMV+DI+
Sbjct: 723  R--NALEIELSDDEDDDLKAYRAKRRQLMKEKRLETDHNKKLMTNKKSHAFLESMVDDIV 780

Query: 880  EYKNPFRAEEESNQDIT-STATDLDTLDNNSLNVRDSTRNNEKGPVDDKSKKIIISEDFV 938
            E KNPF   +++  D T  T  + D   N  LN               K KK I+SE FV
Sbjct: 781  EVKNPFDERDDNIMDDTPETDAEGDVNSNELLN---------------KKKKFILSEAFV 825

Query: 939  QKSLSFLKSN-NYNEFEMDKELAKMQHGNDDEPIEDLFTLKQHSSIKSFTN---SQTDSF 994
            QKSLSFL S+ N  EFEM+  LAK QH +      D+F LK H SIKS  +   S  +S 
Sbjct: 826  QKSLSFLSSSRNLEEFEMNNNLAKEQHSH---AATDMFALKSHCSIKSLESLPGSHNNSI 882

Query: 995  TSRTVTTMIDLEKRTEDEDEMENGDSSLVSGFKHPSIVKSFASRTDINDKFKEGNKTVKI 1054
            +S+     +DL          E   S+  SG K  S++KSF+S  DI+ KFK+GNKTVK+
Sbjct: 883  SSK-----LDL--------LHEEIVSTPFSGLKQTSVIKSFSSSIDIDSKFKDGNKTVKV 929

Query: 1055 SKSYKMVGSSKASITYMGKTRKLMAPKRKAGTDQNHHRHXXXXXXXXXLFESGQNSFD 1112
            SKSY+ VGS+KASITY+GK RKL+ PK+K   +   H H         LF+   NSF+
Sbjct: 930  SKSYRTVGSAKASITYLGKARKLVPPKKK---EHKPHSHKSKTASASRLFDEQDNSFE 984

 Score =  118 bits (295), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 154/521 (29%), Positives = 242/521 (46%), Gaps = 108/521 (20%)

Query: 1   MDDALNALSSLRSKKRVTTYKKVAIHIPDDNDNTDGNLYTNDIVAPPALTGNGFLFANAT 60
           MD   + L +L+ KKR TTYKKV      D D  D    +   +  P L G   LF N+ 
Sbjct: 1   MDFVFDGLDALKGKKR-TTYKKVT-----DGDVEDEPKISEFNIELPGL-GQSILFNNSK 53

Query: 61  LNRVKNRLEGGKAPEQEHDNKDDEDEDVSSSQLIANLYEGGEDLEETKSNENDCTGKNCM 120
           L +++NRLEG    + E+D+   E + ++ +Q+I+NLYEGGEDLEE              
Sbjct: 54  LKQIRNRLEGNN-NDSENDSSQAETQVIADTQIISNLYEGGEDLEE-------------- 98

Query: 121 PTFTQTQRIPVSIQQDKVVDVPIHSVNEEKPTQIIKDDCFVNKIPQAQKLSTTTIKPVAT 180
               + +R    +Q+ ++V         E  TQII  D  V          T + K + +
Sbjct: 99  ---KEERRF---LQRTQIV---------EDHTQII--DASV----------TYSSKTIES 131

Query: 181 QRIDSDDIITQSQQALPIKPIESPSQGKTATSNDLDVQSSKPPVLTIGKSPLFQPLLTRG 240
            ++D+      +  + P +   S        +++LD Q        +  +   Q L T+ 
Sbjct: 132 NKMDNTQKYINASDSEPTQIQISKVDKLLKITDNLDSQKK-----VLDTTLETQELETQY 186

Query: 241 PVNQMDTPLESSPNNDETQLDVMPQNTQSDNKTQIDTIPQTTHYEDKTQMDTMSQTLQDG 300
              Q+D          +TQ+D     TQ D KTQI   P     ++     T  QT+ D 
Sbjct: 187 GKTQVD----------KTQVD----KTQVD-KTQI--FPTLVADDEIKHSSTAVQTVDDN 229

Query: 301 VPHT---LKIREIQNELALEDS-RRERASNVEYTKPQKTIATKLKFSKESFLADFDDSSS 356
             H+   LKI EI+ +L  ED   +E++   EY +    + +K+KFSK  FL  FD SSS
Sbjct: 230 T-HSNSELKINEIERQLDEEDQILKEKSMGTEYKRNIAPVMSKVKFSKNDFLEHFDSSSS 288

Query: 357 NEDAE--IKVESAHPKPLGNEEELHEDKNIEPSINEVTKKTDKRVPLLSSYANNLKREID 414
            ED E  +K+ S  P+            N+E S+ + +K++  +   LS+Y N LK++I+
Sbjct: 289 EEDEEGVVKLSSTEPETAA--------MNLENSLPQFSKES--KFIGLSNYENILKKDIN 338

Query: 415 SSKCITXXXXXXXXXXXXXXXXXRKLIKDEGALPISQLSKATILNLKARLSKQNQDISQR 474
              CI                        E    +S+ SKATIL++KA LS+     +Q 
Sbjct: 339 KQNCIEFSDSEDET---------------EVTSKVSRASKATILSIKANLSRHKP--AQS 381

Query: 475 PLEGRDARLDHNKLFNTLRKASRKQILDHQREVIETKGFKL 515
            +  ++A      LF+ L+KA++ QILDH++E++E KG+K+
Sbjct: 382 SINNKNAL---GNLFSDLKKATKAQILDHKKEIMEQKGYKM 419

>TPHA0E04010 Chr5 (839903..842800) [2898 bp, 965 aa] {ON} Anc_1.5
            YCL061C
          Length = 965

 Score =  253 bits (645), Expect = 3e-69,   Method: Compositional matrix adjust.
 Identities = 186/478 (38%), Positives = 261/478 (54%), Gaps = 68/478 (14%)

Query: 611  KKAHHVKRMIDESDSENEAV---PKEKVDASVPKRIAINLGHYGDNIEEEVNKFQETNDM 667
            K+ H    ++D+SDSE EA     KE + A+      I+LGHYGDNI   + + +ET + 
Sbjct: 523  KRKHKKTEIVDDSDSEIEAQIVDSKEIITAN-----TIDLGHYGDNI---IQQSRETLNE 574

Query: 668  NTQQTDKITMERNIVENKAILEDTAXXXXXXXXXXXXXXXRRELIDKEKLQLRQXXXXXX 727
              +  ++     N + ++ I                    ++EL  +E  +L++      
Sbjct: 575  TEESDEEDEERYNAIISEGI------------------RKQKELEKREAKRLKEMKTS-- 614

Query: 728  XXXXXXXXXGVTNFFEMEAEESDDEWHGIGGADGEGSDEYDSDVEKMIDDYSKNNFNSHE 787
                     GV+  FE+EAEES+DEWHGIGG D + SD YDS+VEKMIDDYS+ NFN  E
Sbjct: 615  ---------GVSKMFEVEAEESEDEWHGIGGVDSDFSDAYDSEVEKMIDDYSRQNFNPSE 665

Query: 788  IREMLAAENKEMDVKMINKILYDIKNGGFRNKRAKNXXXXXXXXXXXXVLQQYXXXXXXX 847
            IREMLA ENKE D+ ++NKILYDIKNGGFR ++ ++             L+ Y       
Sbjct: 666  IREMLAKENKETDLALVNKILYDIKNGGFRTRKRRDRDLEFSDDDDDD-LKAYRAKRRAL 724

Query: 848  XXXXXXXIGDGTKLVKNPKSKAFFESMVEDIMEYKNPFRAEEESNQDITSTATDLDTLDN 907
                   I    K+VKNPKSKAFFES+V+DI+E KNPF     S + I    T    +DN
Sbjct: 725  MREKRLDIEGDKKIVKNPKSKAFFESIVDDIIETKNPFDDMNTSIEQIVEKETPTVDIDN 784

Query: 908  NSLNVRDSTRNNEKGPVDDKSKKIIISEDFVQKSLSFLKS-NNYNEFEMDKELAKMQH-- 964
            +     + T+         K KKI+ISE+FVQ+SLSFL S    +EFE++      QH  
Sbjct: 785  DEKLATNVTK---------KKKKIVISEEFVQRSLSFLNSCREQDEFEINN-----QHNG 830

Query: 965  GNDDEPIEDLFTLKQHSSIKSFTNSQTDSFTSRTVTTMIDLEKRTEDEDEMENGDSSLVS 1024
            G       DL+TLK++SSIK+  +  +   +S                ++      SL +
Sbjct: 831  GEKATSTADLYTLKRYSSIKTLQSVTSSRSSSIASNL----------NEQPSQSSGSLFN 880

Query: 1025 GFKHPSIVKSFASRTDINDKFKEGNKTVKISKSYKMVGSSKASITYMGKTRKLMAPKR 1082
              +  S++ SF+S  DIN KFKEG K+VK+S +YK VGS++ASITYMG +R+L+APK+
Sbjct: 881  DLRKTSVLNSFSSDVDINSKFKEGTKSVKVSNAYKTVGSARASITYMGTSRRLVAPKK 938

 Score = 57.4 bits (137), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 143/529 (27%), Positives = 217/529 (41%), Gaps = 131/529 (24%)

Query: 1   MDDALNALSSLRSKKRVTTYKKVAIHIPDDNDNTDGNLYTNDIVAPPALTGNGFLFANAT 60
           MD   + L+    KK+ TTY K+   + ++   ++  L          L G G LF N+ 
Sbjct: 1   MDSLFDQLNHF--KKKRTTYDKIPHDLLEEEQESEDILKNKTAKEISQLDG-GILFGNSI 57

Query: 61  LNRVKNRLEGGKAPEQEHDNKDDEDEDVSSSQLIANLYEGGEDLEETKSNENDCTGKNCM 120
           L +++NRL          +N D+ED+D           E  E +  +K NE D T     
Sbjct: 58  LGQIRNRL----------NNIDNEDKDKGK--------EASESIT-SKDNEQDST----- 93

Query: 121 PTFTQTQRIPVSIQQDKVVDVPIHSVNEEKPTQIIKDDCFV-----NKIPQAQKLSTTTI 175
             F QTQ I       + ++  I   N  K TQII D+  +     +K  Q +K    TI
Sbjct: 94  QIFPQTQIINNLYDGGEDLENEIFH-NSFKKTQIITDNILIETNTNDKSTQYEKTQVITI 152

Query: 176 ------KPVATQRIDSDDIITQSQQALPI---KPIESPSQGKTATSNDLDVQSSKPPVLT 226
                 KP+        D++  +Q  L I   +P+  PS+ KT   N+++          
Sbjct: 153 NERLSDKPL--------DVVNNTQTVLVIENTQPL--PSEIKTQVVNEVN---------- 192

Query: 227 IGKSPLFQPLLTRGPVNQMDTPLESSPNNDETQLDVMPQNTQSDNKTQIDTIPQTTHYED 286
               P+ QP                      TQ  V  Q  +    TQ + +P      D
Sbjct: 193 -SALPVTQP----------------------TQTIVATQANEVTYDTQ-ELMPTV----D 224

Query: 287 KTQMDTMSQTLQDGVPHTLKIREIQNELALEDSR--RERASNVEYTKPQKTIATKLKFSK 344
              M +            LKI +I+ EL  E+ R  +E     E+   +       KFSK
Sbjct: 225 DVAMRSTG----------LKITDIEKELE-EEQRLAKETEFGTEFKFKESESKISKKFSK 273

Query: 345 ESFLADFDDSSSNEDAEIKVESAHPKPLGNEEELHEDKNIEPSINEVTKKTDKRVPLLSS 404
           E FL  FDDSSS+ED   K E   P  +   E LH D N   ++ +V     K +  L +
Sbjct: 274 EDFLNHFDDSSSSEDETSKNEKG-PN-VDKSEVLHPD-NKSKTLLKV-----KSINGLGN 325

Query: 405 YANNLKREIDSSKCITXXXXXXXXXXXXXXXXXRKLIKDEGALPISQLSKATILNLKARL 464
           Y +NL+R+ ++ + I                       D    P S  SKA ILN++A  
Sbjct: 326 YEHNLRRKANNEQIIEFSESDEDS--------------DTNISP-SYASKAVILNIRANK 370

Query: 465 SKQNQDISQRPLEGRDARLDHNKLFNTLRKASRKQILDHQREVIETKGF 513
           SKQ   +SQ+    +   L    L+N L++AS++QI+ +Q+E++E KG 
Sbjct: 371 SKQQPKVSQKS--DQTTLL---MLYNNLKRASKEQIVSYQKELMEKKGI 414

>TBLA0A07570 Chr1 (1874419..1878177) [3759 bp, 1252 aa] {ON} Anc_1.5
            YCL061C
          Length = 1252

 Score =  243 bits (619), Expect = 4e-65,   Method: Compositional matrix adjust.
 Identities = 186/477 (38%), Positives = 245/477 (51%), Gaps = 37/477 (7%)

Query: 616  VKRMIDESDSENEAVPKEKVDASVPKRIAINLGHYGDNIEEEVNKFQETNDMNTQQTDKI 675
            +K + +ESDSEN+  P E     +   I INLGHYGDN++ +   F E +          
Sbjct: 768  LKLVTEESDSENDN-PLESEKIPINPNI-INLGHYGDNLDSKSTIFNENS---------- 815

Query: 676  TMERNIVENKAILEDTAXXXXXXXXXXXXXXXRRELIDKEKLQLRQXXXXXXXXXXXXXX 735
               +  +E+    E  A                +  I +E  + +               
Sbjct: 816  ---KKFIEDIEQFE--ADNSTENSNNELNELEYKRHIKQELEKQKLKEAKKKAKLRELKK 870

Query: 736  XGVTNFFEMEAEESDDEWHGIGGADGEGSDEYDSDVEKMIDDYSKNNFNSHEIREMLAAE 795
             G +  F+MEAEES+DEW GIGGADGE SDEYDS+VEK+IDDYS+ +FN  EIR  L  E
Sbjct: 871  VGASKMFDMEAEESEDEWFGIGGADGEVSDEYDSEVEKLIDDYSRQDFNPDEIRNKLMNE 930

Query: 796  NKEMDVKMINKILYDIKNGGFRNKRAKNXXXXXXXXXXXXVLQQYXXXXXXXXXXXXXXI 855
            NKEMD+KM+N+ILYDIKNGGFR KR +N             L++Y              +
Sbjct: 931  NKEMDIKMVNRILYDIKNGGFR-KRNRNNIDLELSDDEDDELREYRIKRREIMKKKRLEV 989

Query: 856  GDGTKLVKNPKSKAFFESMVEDIMEYKNPFRAEEESNQDITSTATDLDTLDNN-----SL 910
             +  K++K  KSKAFF SMV+DI+E  NPF   + S+ D      D  +  N+     + 
Sbjct: 990  TNTDKILKTSKSKAFFMSMVDDIVETSNPFMITQPSDDDSDDNNMDSISNKNHKDANNAK 1049

Query: 911  NVRDSTRNNEKGPVDDKS-KKIIISEDFVQKSLSFL-KSNNYNEFEMDKELAKMQHGNDD 968
              +   R ++   +   S KK ++SEDFV K+LSFL KS   NEF+   E  K Q G   
Sbjct: 1050 KDKKDKRTDDHARLSQSSRKKFVMSEDFVHKTLSFLTKSKEVNEFQHVNEHYKSQIGT-- 1107

Query: 969  EPIEDLFTLKQHSSIK-----SFTNSQTDSFTSRTVTTMIDLEKRTEDEDEMENGDSSLV 1023
              I D+ +LKQ SSIK     S  +  T+     +     D+       D   + D  L 
Sbjct: 1108 --INDIQSLKQKSSIKTMHVLSMMSQDTNVDLDASDKDDDDMIHHAGSFD--NSFDDPLS 1163

Query: 1024 SGFKHPSIVKSFASRTDINDKFKEGNKTVKISKSYKMVGSSKASITYMGKTRKLMAP 1080
            S  K PSI+K F S  DINDKFK+GNKTV IS SYK VG  K SIT  G+ RKL+AP
Sbjct: 1164 SVSKAPSIIKIFGSTHDINDKFKDGNKTVTISNSYKTVGGMKTSITSFGR-RKLVAP 1219

 Score = 65.9 bits (159), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 85/287 (29%), Positives = 132/287 (45%), Gaps = 46/287 (16%)

Query: 248 PLESSPNNDETQLDVMPQNTQSDNKTQIDTIPQTTHYEDKTQMDTMSQTLQDGV-PHTLK 306
           PL + P  ++TQ D++  NT  +    ++ IPQT       + D    +++DG+    L+
Sbjct: 421 PLMTLP--EKTQADLL--NTVPNQNDALNEIPQTA------RDDIFQTSVKDGILDKKLR 470

Query: 307 IREIQNELALEDSRRERASNVEYTKPQKTIATKLKFSKESFLADFD-----------DSS 355
           I EIQ+ L  E   +E+ +            TK  F+KE FLAD D           ++ 
Sbjct: 471 IHEIQDALLQEVKEKEKQTEHHIQDSDSLTKTKFTFTKEDFLADLDDDDSDAVYANGEND 530

Query: 356 SNEDAEIKVESAHPKPLGNEEELHEDKNIEPSINEVTKKT----DKRVPLLSSYANNLKR 411
            NED   +  ++H K L         + IE   N+V  K      KR  +LS Y N LK 
Sbjct: 531 KNEDKSERANTSHAK-LKAMPVTIPHQQIEVQFNKVQLKNVIAKPKRKVILSQYENRLKE 589

Query: 412 EIDSSKCITXXXXXXXXXXXXXXXXXRKLIKDEGALPISQLSKATILNLKARLSKQNQDI 471
            +  +  I                        +  +  S  SKA IL+++ +LSK+   +
Sbjct: 590 NLLYNNSIDLYSDSEENT--------------QSDILFSTASKAQILDIRHKLSKKKPQV 635

Query: 472 SQRPLEGRDARLDHNKLFNTLRKASRKQILDHQREVIETKGFKLEDM 518
            ++ ++     LD  +LFN L+KAS+KQI DHQ+  IE+KG KLED+
Sbjct: 636 KKKTIQ---TNLD--QLFNKLKKASKKQIFDHQKNAIESKGLKLEDL 677

 Score = 41.6 bits (96), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 38/71 (53%), Gaps = 4/71 (5%)

Query: 1  MDDALNALSSLRSKKRVTTYKKVAIHIPDDNDNTDGNLYTNDIVAPPALTGNGFLFANAT 60
          MD   ++L  L+ KKR TTYKKV   +  + D     + +N +  P      GFLFAN  
Sbjct: 3  MDAVFDSLDELKIKKR-TTYKKVPEQVATELDKAATTI-SNPV--PSFNLSEGFLFANDK 58

Query: 61 LNRVKNRLEGG 71
          L ++KNRL  G
Sbjct: 59 LEKIKNRLNLG 69

>ZYRO0F18480g Chr6 (1524051..1526933) [2883 bp, 960 aa] {ON} weakly
            similar to uniprot|P25588 Saccharomyces cerevisiae
            YCL061C MRC1 S-phase checkpoint protein found at
            replication forks required for DNA replication also
            required for Rad53p activation during DNA replication
            stress where it forms a replication-pausing complex with
            Tof1p and is phosphorylated by Mec1p protein involved in
            replication checkpoint
          Length = 960

 Score =  231 bits (590), Expect = 3e-62,   Method: Compositional matrix adjust.
 Identities = 151/362 (41%), Positives = 208/362 (57%), Gaps = 42/362 (11%)

Query: 753  WHGIGGADGEGSDEYDSDVEKMIDDYSKNNFNSHEIREMLAAENKEMDVKMINKILYDIK 812
            W G+GG DG+ SDE+DSD+E+MIDD++K+N N  ++R++LA ENKE+D KM+NKILYDIK
Sbjct: 640  WKGVGGVDGDLSDEHDSDLEEMIDDFTKSNENFDDVRQLLAKENKELDEKMVNKILYDIK 699

Query: 813  NGGFRNKRAKNXXXXXXXXXXXXVLQQYXXXXXXXXXXXXXXIGDGTKLVKNPKSKAFFE 872
            NGGFR KR +N             L+ Y                D  K  +N KSKAF E
Sbjct: 700  NGGFR-KRGRNALDLELSDDEDEDLRNYRLKRRELMKKSRIEGKDKEKAFRNAKSKAFLE 758

Query: 873  SMVEDIMEYKNPFRAEEESNQDITSTATDLDTLDNNSLNVRDSTRNNEKGPVDDKSKKII 932
            SMV+DI E KNPF   E   +D     TD+DT +N      D  +N EK           
Sbjct: 759  SMVDDIDESKNPFGDPEMDVED----NTDVDTQEN------DYPKNKEKN---------T 799

Query: 933  ISEDFVQKSLSFLKSNNYN-EFEMDKELAKMQHGNDDEPIEDLFTLKQHSSIKSFTNSQT 991
            +S++FVQ+SLSFL +NN + EFE+ +++     G+++   +D+ +LK++SSI +  NS +
Sbjct: 800  LSQEFVQRSLSFLSNNNSSREFELGEQIT---LGDEE---QDVSSLKRNSSIHALHNSSS 853

Query: 992  DSFTSRTVTTMIDLEKRTEDEDEMENGDSSLVSGFKHPSIVKSFASRTDINDKFKEGNKT 1051
                        DLEK  +DED +       +  FK PS++KS A   D N+KF+ G KT
Sbjct: 854  --------PIKEDLEKENQDEDFI------TLPNFKPPSLIKSLAGGFDPNNKFQSGKKT 899

Query: 1052 VKISKSYKMVGSSKASITYMGKTRKLMAPKRKAGTDQNHHRHXXXXXXXXXLFESGQNSF 1111
            V +SKSY+ VG S++SITY GK RKL+ PK +  T     R          L+ES QNSF
Sbjct: 900  VTVSKSYRAVGGSRSSITYFGKMRKLVGPKNRNSTLSKGPR-PASKPTMGKLWESQQNSF 958

Query: 1112 DS 1113
            D+
Sbjct: 959  DT 960

 Score =  152 bits (385), Expect = 7e-37,   Method: Compositional matrix adjust.
 Identities = 158/530 (29%), Positives = 243/530 (45%), Gaps = 117/530 (22%)

Query: 1   MDDALNALSSLRSKKRVTTYKKVAIHIPDDNDNTDGNLYTNDIVAPPALTGNGFLFANAT 60
           MD  L  L  L SK+R TTYKKV     ++      N        PP + GNGFLF N+T
Sbjct: 1   MDSLLEKLDPLSSKRR-TTYKKVFEPQEEEETQQISN------SPPPPILGNGFLFQNST 53

Query: 61  LNRVKNRLEGG-----KAPEQEHDNKDDEDEDVSSSQLIANLYEGGEDLEETKSNENDC- 114
           +++V+NRL        K  ++E + + +++  ++ +Q+IA+LYEG E+LEE         
Sbjct: 54  IDKVRNRLRNAEDGANKVQQKEQEQEQEQETQLNQTQVIADLYEGAEELEEQNKERVRLP 113

Query: 115 -TGKNCMPTFTQTQRIPVSIQQDKVVDVPIHS--VNEEKPTQIIKDDCFVNKIPQAQKLS 171
            + K    +  +TQ IP +   + V +       ++EEK  Q+  +  +  K    Q   
Sbjct: 114 LSKKTSSASQEKTQVIPWAPTVEGVENNVEQGTDIHEEKTQQVPNEISYDQKTQAIQSFQ 173

Query: 172 TTTIKPVATQRIDSDDIITQSQQALPIKPIESPSQGKTATSND-LDVQSSKPPV-LTIGK 229
            T ++P+ TQRI           + P + ++ P+    ATS D LD Q   P   L I  
Sbjct: 174 QTEVEPL-TQRI-----------SEPERTLDVPTYA--ATSEDQLDTQEQNPITQLDISN 219

Query: 230 SPLFQPLLTRGPVNQMDTPLESSPNNDETQLDVMPQNTQSDNKTQIDTIPQTTHYEDKTQ 289
           S LFQ                                T SD       IP++        
Sbjct: 220 SLLFQA-------------------------------TDSD-------IPKSP------- 234

Query: 290 MDTMSQTLQDGVPHTLKIREIQNELALEDSRRERASNVEYTKPQKTIATKLKFSKESFLA 349
                       P  LK+ +I+ EL  +   R+   N+EY  P+K +  K  FSKE+FL 
Sbjct: 235 ------------PQRLKMHDIEKELEEKRQERDHRRNIEYRAPEKPVNVKRVFSKEAFLK 282

Query: 350 DFDDSSSNEDAEIKVESAHPKPLGNEEELHEDKNIEPSINEVTKKTDKRVPLLSSYANNL 409
           +FD+ SS+ED  I++ S       + E+ H +K+   S  E T ++ +R  + S Y   L
Sbjct: 283 NFDEESSSEDELIELRSR------DIEKKHTEKD--KSTLENTTESSQRQRVFSVYEYKL 334

Query: 410 KREIDSSKCITXXXXXXXXXXXXXXXXXRKLIKDEGALPISQLSKATILNLKARLSKQNQ 469
           K E+DS +CI                           +P+S++SKAT+L++KAR SK   
Sbjct: 335 KGELDSKRCIQLDDDEDESDEDV-------------EVPLSRVSKATVLDIKARRSK--- 378

Query: 470 DISQRPLEG-RDARLDHNKLFNTLRKASRKQILDHQREVIETKGFKLEDM 518
              Q PL   +  +   N L  TL+KAS+KQI DHQ E+++++G+KLED+
Sbjct: 379 ---QEPLSKIKQKKTTLNDLICTLKKASKKQITDHQNELMKSRGYKLEDI 425

>KLLA0C00484g Chr3 complement(35397..38174) [2778 bp, 925 aa] {ON}
            weakly similar to uniprot|P25588 Saccharomyces cerevisiae
            YCL061C MRC1 S-phase checkpoint protein found at
            replication forks required for DNA replication also
            required for Rad53p activation during DNA replication
            stress where it forms a replication-pausing complex with
            Tof1p and is phosphorylated by Mec1p protein involved in
            replication checkpoint
          Length = 925

 Score =  227 bits (579), Expect = 6e-61,   Method: Compositional matrix adjust.
 Identities = 173/451 (38%), Positives = 231/451 (51%), Gaps = 66/451 (14%)

Query: 643  IAINLGHYGDNIEEE---VNKFQETNDMNTQQTDKITMERNIVENKAI--LEDTAXXXXX 697
            I INLGHYGDN+       N   + +D N     ++ M R+      +  L   +     
Sbjct: 515  IGINLGHYGDNLTSSNVTENDGADQSDRNVPSNSELKMNRSHSAKLLVGELSSDSSVDSD 574

Query: 698  XXXXXXXXXXRRELIDKEKLQLRQXXXXXXXXXXXXXXXGVTNFFEMEAEESDDEWHGIG 757
                      R  L ++ K++ R                G+    EMEAEES+DEWHG+G
Sbjct: 575  SSEDELDEVERNRLQERAKMRRRMEIEAAKKRKQVLKSTGLNKILEMEAEESEDEWHGVG 634

Query: 758  GADGEGSDEYDSDVEKMIDDYSKNNFNSHEIREMLAAENKEMDVKMINKILYDIKNGGFR 817
            GADGE SD+YDSD++ MIDD+SK+ F++  IRE LA ENKEMD +MINKIL+DI  GGFR
Sbjct: 635  GADGENSDDYDSDLDTMIDDFSKSKFDTASIRERLALENKEMDERMINKILHDINTGGFR 694

Query: 818  NKRAKNXXXXXXXXXXXXVLQQYXXXXXXXXXXXXXXIGDGTKLVKNPKSKAFFESMVED 877
             KR +             +L+Q+                DG  +V N KSKAFF+SMVED
Sbjct: 695  -KRGRGALDLELSDDEDELLRQFREKRREIMKQKLLENVDG--VVNNSKSKAFFDSMVED 751

Query: 878  IMEYKNPFRAEEESNQDITSTATDLDTLDNNSLNVRDSTRNNEKGPVDDKSKKIIISEDF 937
            I     P          +TS +           N RD     E G      KKI+ISE+F
Sbjct: 752  ITRKSIPA---------VTSFS-----------NTRD-----EMGK-----KKIVISEEF 781

Query: 938  VQKSLSFL--KSNNYNEFEMDKELAKMQHGNDDEPIEDLFTLKQHSSIKSFTNSQTDSFT 995
            VQ SLSFL  K ++ NEF    E+ +  H    +  EDL +LKQ S+IKS  + Q +   
Sbjct: 782  VQSSLSFLSAKDDDINEF----EVTEAAH----DATEDLESLKQRSNIKSLDSPQRN--- 830

Query: 996  SRTVTTMIDLEKRTEDEDEMENGDSSLVSGFKHPSIVKSFASRTDINDKFKEGNKTVKIS 1055
             R      D++  + D              FK PSIVKSF+S +D+NDKFK G KTV IS
Sbjct: 831  -RNSAFFDDVDGTSLD--------------FKLPSIVKSFSSNSDVNDKFKTGIKTVTIS 875

Query: 1056 KSYKMVGSSKASITYMGKTRKLMAPKRKAGT 1086
            KSY++   S+++IT++GK RKL AP+ +  T
Sbjct: 876  KSYRVASGSRSAITFLGKKRKLKAPQGRKST 906

>Ecym_1008 Chr1 complement(13340..16696) [3357 bp, 1118 aa] {ON}
            similar to Ashbya gossypii AFR745W
          Length = 1118

 Score =  227 bits (578), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 144/380 (37%), Positives = 210/380 (55%), Gaps = 47/380 (12%)

Query: 709  RELIDKEKLQLRQXXXXXXXXXXXXXXXGVTNFFEMEAEESDDEWHGIGGADGEGSDEYD 768
            R+++ +  L+LR                GV    E+EA+ES+DEWHG+GG D E SDEYD
Sbjct: 753  RKIVKELMLKLRLQEKIKRQKQKEMRKLGVNKMVELEADESEDEWHGVGGVDYEASDEYD 812

Query: 769  SDVEKMIDDYSKNNFNSHEIREMLAAENKEMDVKMINKILYDIKNGGFRNKRAKNXXXXX 828
            SD++KMIDDY+KN F+  EIR++LA+E+ + D  M+NKIL+DIK GGFR KR +      
Sbjct: 813  SDLDKMIDDYNKNEFDPVEIRKILASEDLQHDKNMVNKILHDIKTGGFR-KRGRGELDLE 871

Query: 829  XXXXXXXVLQQYXXXXXXXXXXXXXXIGDGTKLVKNPKSKAFFESMVEDIMEYKNPFRAE 888
                   +LQ Y                  T +  NPKS  FFESMV+   E+  P    
Sbjct: 872  LSEDEDGILQSYRAKRWNEQKQKMLDSEHNTSVKSNPKSLPFFESMVD---EFTIPVERA 928

Query: 889  EESNQDITSTATDLDTLDNNSLNVRDSTRNNEKGPVDDKSKKIIISEDFVQKSLSFLKSN 948
              +     + +T       N L ++ +T+           +KI+ISE FV+++LSFL S+
Sbjct: 929  LGTPDSPPAQST-------NVLELKQNTK-----------QKIVISEHFVKQTLSFLTSD 970

Query: 949  NYNEFEMDKELAKMQHGNDDE----PIEDLFTLKQHSSIKSFTNSQTDSFTSRTVTTMID 1004
              N   M  E+   +  ND++     +EDL+TLK+ S+IK       ++++ + +     
Sbjct: 971  E-NMTNMRSEINVEKPNNDNDIYSSEVEDLYTLKETSTIKVL-----NTYSGKPIV---- 1020

Query: 1005 LEKRTEDEDEMENGDSSLVSGFKHPSIVKSFASRTDINDKFKEGNKTVKISKSYKMVGSS 1064
                 EDED  E        GFK PS++++F SR D+NDKFK+G K+VKIS  YK +GSS
Sbjct: 1021 ----NEDEDGAE-------FGFKAPSVMQTFGSRNDVNDKFKDGFKSVKISNKYKTLGSS 1069

Query: 1065 KASITYMGKTRKLMAPKRKA 1084
            +A+IT++GK RKL+ PKR +
Sbjct: 1070 RAAITFLGKKRKLIIPKRSS 1089

 Score = 50.8 bits (120), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 28/72 (38%), Positives = 48/72 (66%), Gaps = 2/72 (2%)

Query: 447 LPISQLSKATILNLKARLSKQNQDISQRPLEGRDARLDHNKLFNTLRKASRKQILDHQRE 506
              S + KA +LN+KA++SK N ++S+   +  ++     +LF +L+KA++KQILDH+RE
Sbjct: 436 FATSTMVKAALLNIKAKISK-NMNLSKNAEQSINSPT-LKQLFISLKKANKKQILDHRRE 493

Query: 507 VIETKGFKLEDM 518
           + E +G  LE +
Sbjct: 494 ITEKRGISLEQL 505

 Score = 32.7 bits (73), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 25/66 (37%), Positives = 37/66 (56%), Gaps = 12/66 (18%)

Query: 43  IVAPPALTGNGFLFANATLNRVKNRLEGGKAPEQEHDNKDDEDEDVSS--SQLIANLYEG 100
           I+  P+   N  +FANA +++V+NRLEG  +     D        +SS  S+ + NLY+ 
Sbjct: 31  IIIKPSNAEN--VFANAIVDKVRNRLEGTISSPDRLDT-------LSSKLSETVGNLYD- 80

Query: 101 GEDLEE 106
           GE LEE
Sbjct: 81  GEALEE 86

>TDEL0C06970 Chr3 (1264155..1266980) [2826 bp, 941 aa] {ON} Anc_1.5
            YCL061C
          Length = 941

 Score =  224 bits (571), Expect = 8e-60,   Method: Compositional matrix adjust.
 Identities = 151/348 (43%), Positives = 194/348 (55%), Gaps = 43/348 (12%)

Query: 737  GVTNFFEMEAEESDDEWHGIGGADGEGSDEYDSDVEKMIDDYSKNNFNSHEIREMLAAEN 796
            GVTN F+MEAEESDDEW G+GG DGE  D+YDSD+EKMIDD+S    N+ +IR++L AEN
Sbjct: 606  GVTNMFDMEAEESDDEWRGVGGVDGETIDDYDSDLEKMIDDFSNTTSNADQIRQLLMAEN 665

Query: 797  KEMDVKMINKILYDIKNGGFRNKRAKNXXXXXXXXXXXXVLQQYXXXXXXXXXXXXXXIG 856
            KE D+K +NKIL+DIKNGGFR +R  N            +L                   
Sbjct: 666  KETDLKTVNKILHDIKNGGFRKRRQNNLQLELSDDEDDELLNYKKRKLELMRKRRLQFGA 725

Query: 857  DGTKLVKNPKSKAFFESMVEDIMEYKNPFRAEEESNQDITSTATDLDTLDNNSLNVRDST 916
            D  KL+KN +SKAFFESMVEDI++ K+PF     SNQ  TS        D  S       
Sbjct: 726  DDKKLLKNSRSKAFFESMVEDIIDLKDPF-----SNQAETSEK------DKKS------- 767

Query: 917  RNNEKGPVDDKSK-KIIISEDFV-QKSLSFLKSNNYNEFEMDKELAKMQHGNDDEPIEDL 974
                +G VD  +K K  IS +FV Q       S +++EFE+ +     Q G   E   DL
Sbjct: 768  ----EGLVDASNKQKDTISHEFVQQSLSFLSSSRDFSEFEVAR---VSQEG---ERNTDL 817

Query: 975  FTLKQHSSIKSFTNSQTDSFTSRTVTTMIDLEKRTEDEDEMENGDSSLVSGFKHPSIVKS 1034
             +LKQ S++K+               + I  E    D +E +N  S L     + S+VKS
Sbjct: 818  NSLKQDSTVKTL-----------YAPSNIISESERADHEEFDN--SVLPVESSYSSVVKS 864

Query: 1035 FASRTDINDKFKEGNKTVKISKSYKMVGSSKASITYMGKTRKLMAPKR 1082
            F    + NDK KEG KTV +SKSY+ VG +KASITY+GK RKL+APK+
Sbjct: 865  FGFDLNANDKLKEGRKTVTVSKSYRTVGGNKASITYLGKMRKLVAPKK 912

 Score =  108 bits (270), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 144/514 (28%), Positives = 222/514 (43%), Gaps = 119/514 (23%)

Query: 14  KKRVTTYKKVAIHIPDDNDNTDGNLYTNDIVAPPALTGNGFLFANATLNRVKNRLEGGKA 73
           KKR  TY+K A+   DD        YT D + PPA+ GNGFLF ++TL++VKNRL     
Sbjct: 13  KKRRATYQK-AVQNEDDE-------YTEDPLVPPAVLGNGFLFNSSTLDKVKNRL----- 59

Query: 74  PEQEHDNKDDED--EDVSSSQLIANLYEGGEDLEETKSNENDCTGKNCMPTFTQTQRIPV 131
                 NKD E   + + ++Q+++NLYE GEDLE+             +P+  Q++  P+
Sbjct: 60  ------NKDQEQGTQAIDTTQVLSNLYEDGEDLEKE------------VPSILQSKSKPI 101

Query: 132 SIQQDKVVDVPIHSVNEEKPTQIIKDDCFVNKIPQAQKLSTTTIKPVA-----TQRIDSD 186
                    + I S+  E    I+K     N        +  T+ P+A     T+ +D +
Sbjct: 102 PT-------ILIPSIERE----ILKQPFNEN-----HNFTGVTV-PIAKSSAITKNLDRE 144

Query: 187 DIITQSQQALPIKPIESPSQGKTATSNDLDVQSSKPPVLTIGKSPLFQPLLTRGPVNQMD 246
           D+  +S +    +PI              D  +S  P  T       +     G V    
Sbjct: 145 DL--ESPEIPETQPIP-------------DFSASDVPTQTQVLKTTSETAADTGTVATAA 189

Query: 247 TPLESSPNNDETQLDVMPQNTQSDNKTQIDTIPQTTHYEDKTQMDTMSQTLQDGVPHT-L 305
              E S     TQ++V  Q       +Q D I QT                 D VP T L
Sbjct: 190 IAYEESL----TQVEVSEQTYPDQRNSQEDIIQQTA---------------ADAVPITRL 230

Query: 306 KIREIQNELALEDSRRERASNVEYTKPQKTIATKLK-FSKESFLADFDDSSSNEDAEIKV 364
           KI EI+   + E     +   V+Y  P+      LK F+KE+F+ DFD SS ++      
Sbjct: 231 KIHEIEEMWSREVQTETKEHKVKYRAPR-----PLKVFTKEAFMQDFDKSSDSDSDVFDQ 285

Query: 365 ESAHPKPLGNEEELHEDKNIEPSINEVTKKTDKRVPLLSSYANNLKREIDSSKCITXXXX 424
           E     P+G     + D   E   ++V    DK    L++Y   LK + + +K +     
Sbjct: 286 EIKATSPIGR----NNDSISEVGTSDVKVLKDKSSGALTAYQRELKEKAEIAKGVMLLSE 341

Query: 425 XXXXXXXXXXXXXRKLIKDEGALPISQLSKATILNLKARLSKQNQDISQRPLEGRDARLD 484
                            +++ A+  S  +KAT+L LKARLSK+     + P+E +  +  
Sbjct: 342 SDD--------------EEDLAVSTSHEAKATVLKLKARLSKR-----RPPVESQHGKAS 382

Query: 485 HNKLFNTLRKASRKQILDHQREVIETKGFKLEDM 518
            + L   LR ++++QILD Q+E IE +G K ED+
Sbjct: 383 LSALMKNLRNSTKRQILDRQKEGIERQGLKFEDV 416

>CAGL0B00330g Chr2 complement(18031..21441) [3411 bp, 1136 aa] {ON}
            similar to uniprot|P25588 Saccharomyces cerevisiae
            YCL061c
          Length = 1136

 Score =  222 bits (566), Expect = 9e-59,   Method: Compositional matrix adjust.
 Identities = 156/346 (45%), Positives = 211/346 (60%), Gaps = 37/346 (10%)

Query: 737  GVTNFFEMEAEESDDEWHGIGGADGEGSDEYDSDVEKMIDDYSKNNFNSHEIREMLAAEN 796
            GV  +FE EAEESDDEW GIGG DG+   EYDS+VEKMIDDYSK   +   +R+ +  EN
Sbjct: 802  GVNQYFEEEAEESDDEWRGIGGVDGDDFGEYDSEVEKMIDDYSKTEVDLTSLRQKIMDEN 861

Query: 797  KEMDVKMINKILYDIKNGGFRNKRAKNXXXXXXXXXXXXVLQQYXXXXXXXXXXXXXXIG 856
            KEMD+K++NKILYDIKNGGFR KR +N             LQ++                
Sbjct: 862  KEMDLKLVNKILYDIKNGGFR-KRGRNDMELEFSDDEDAELQEFRRKRRELMKQRMLENE 920

Query: 857  DGTKLVKNPKSKAFFESMVEDIMEYKNPFRAEEESNQDITSTATDLDTLDNNSLNVRDST 916
            D  KL KNPKSKAFFESM+ D++E KN F  ++ S+Q I     ++   DN      +  
Sbjct: 921  DTDKLTKNPKSKAFFESMIVDLVEDKNNF--DDLSDQ-IELKEENITQEDNEK--EYNEA 975

Query: 917  RNNEKGPVDDKSKKIIISEDFVQKSLSFLKSN-NYNEFEMDKELAKMQHGNDDEPIEDLF 975
            ++N++G       KI ISEDFVQK+LSFL ++ +  EF+    ++K      ++ I D+ 
Sbjct: 976  KSNKRG-------KIRISEDFVQKTLSFLHNDESTQEFQPSFIMSK------EKGIGDMN 1022

Query: 976  TLKQHSSIKSFTNSQTDSFTSRTVTTMIDLEKRTEDEDEMENGDSSLVSGFKHPSIVKSF 1035
             LK +SS+         SF S+  T+   +    ++ED +E  +S     FK PSI++SF
Sbjct: 1023 ALKSNSSL---------SFCSKLSTSRKII---NDEEDVIEEFES-----FKRPSIIQSF 1065

Query: 1036 ASRTDINDKFKEGNKTVKISKSYKMVGSSKASITYMGKTRKLMAPK 1081
            +S+  I+DKFK+GNK+VK+S SYK VG SKASITY+GKTRKL+ PK
Sbjct: 1066 SSKFTIDDKFKDGNKSVKVSTSYKTVGGSKASITYLGKTRKLVPPK 1111

 Score = 72.8 bits (177), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 79/282 (28%), Positives = 128/282 (45%), Gaps = 58/282 (20%)

Query: 268 QSDNKTQIDTIPQTTHY--EDKTQMDTMSQTLQDGVPHTLKIREIQNELALEDSRRERAS 325
           ++ ++TQID + +  H   E+ TQMD         +   L I +I+ EL   D R     
Sbjct: 342 EAQSETQIDVVHEEVHKTKENDTQMDDTQ------ITEVLAITKIEQELE-NDERAITDK 394

Query: 326 NVEYTKPQKT---IATKLKFSKESFLADFDDSSSNEDAEIKVESAHPKPLGNEEELH--- 379
             EY  P+++   +  K +F+KE  L +FD SSS+E+  I  E    + L + E L    
Sbjct: 395 QTEYI-PKRSPNVLPAKSQFTKEKLLQNFDSSSSDEEDTILGEKQKDQNLSDSESLENND 453

Query: 380 ----EDKNIEPSI------NEVTKKTDKRVP------------LLSSYANNLKREIDSSK 417
               +  ++ PS       NE +     R              +L +Y NNLK+++++ K
Sbjct: 454 IMTDQKTSVTPSSEYNGSDNEHSASISLRSSPISKPRWKSSSMILPAYVNNLKQKVENKK 513

Query: 418 CITXXXXXXXXXXXXXXXXXRKLIKDEGALPISQLSKATILNLKARLSKQNQDISQRPLE 477
                                          +S  SKAT+LNLK RLSK+      +P++
Sbjct: 514 LQLSSDSDDEVDSAV-------------IYKLSNKSKATLLNLKVRLSKK------KPVK 554

Query: 478 GRDARLDH-NKLFNTLRKASRKQILDHQREVIETKGFKLEDM 518
                 D  N LFN LRKA+++QI+ H++E++E++G   ED+
Sbjct: 555 KVHNEKDSTNLLFNNLRKATKQQIMLHRKELMESRGLNFEDL 596

 Score = 35.4 bits (80), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 39/142 (27%), Positives = 61/142 (42%), Gaps = 37/142 (26%)

Query: 1   MDDALNALSSLRSKKRVTTYKKVAIHIPDDNDNTDGNLYTNDIVAPPALTGN-------- 52
           MD   + L  ++ KKR TTYKKV +      D       +N IV   A T +        
Sbjct: 1   MDFLFDELEQVKIKKR-TTYKKVQVVGTGQGDEIAREDTSNQIVPNNASTSSDSERLLNN 59

Query: 53  ----GFLFANATLNRVKNRLEGGK-----------APEQEHDNKD------------DED 85
               GFL  +  L+ +++RL   K            P+ E  +K+            ++ 
Sbjct: 60  VNKKGFLLTSDKLDTIRSRLAQSKDSEVVEDRALINPQIEEQSKEKTFSSEQNNIVVNQS 119

Query: 86  EDVSSSQLIANLYEGGEDLEET 107
           +D+S+ Q+I   Y+GGEDL+ T
Sbjct: 120 DDIST-QIINEYYDGGEDLDAT 140

>KLTH0F00484g Chr6 complement(37017..39998) [2982 bp, 993 aa] {ON}
            weakly similar to uniprot|P25588 Saccharomyces cerevisiae
            YCL061C MRC1 S-phase checkpoint protein found at
            replication forks required for DNA replication also
            required for Rad53p activation during DNA replication
            stress where it forms a replication-pausing complex with
            Tof1p and is phosphorylated by Mec1p protein involved in
            replication checkpoint
          Length = 993

 Score =  202 bits (515), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 156/425 (36%), Positives = 203/425 (47%), Gaps = 77/425 (18%)

Query: 709  RELIDKEKLQ--LRQXXXXXXXXXXXXXXXGVTNFFEMEAEESDDEWHGIGGADGEGSDE 766
            RELI+K K +  LR+                 +   + EAEESDDEWHGIGG DGE  D+
Sbjct: 626  RELIEKHKRKELLREAKLEKLHQSK------ASRIIDYEAEESDDEWHGIGGVDGERFDD 679

Query: 767  YDSDVEKMIDDYSKNNFNSHEIREMLAAENKEMDVKMINKILYDIKNGGFRNKRAKNXXX 826
            +DSD+EKMIDDYS + F+S E+R+    E    D  M+NKIL+DI+ GGFR KR +N   
Sbjct: 680  HDSDLEKMIDDYSNSRFDSSEVRKRQIEEEISEDKSMVNKILHDIETGGFR-KRGRNALD 738

Query: 827  XXXXXXXXXVLQQYXXXXXXXXXXXXXXIGDGTKLVKNPKSKAFFESMVEDIM------- 879
                      L +Y               G+   L +NPKSKAFFE++VEDI        
Sbjct: 739  LELSDDDDEELLKYHSRRKELLRQKVSAQGEAKLLAENPKSKAFFETIVEDIRSKGALED 798

Query: 880  EYKNPFR------AEEESNQDITSTATDLDTLDNNSLNVRDSTRNNEKGPVDDKSKKIII 933
            E   P R      A EE N D                              D K KK ++
Sbjct: 799  EGPPPVRGFSSVNAPEEKNSD-----------------------------SDKKGKKTVL 829

Query: 934  SEDFVQKSLSFLKSNNYNEFEMDKE-----LAKMQHGNDDEPIEDLFTLKQHSSIKSFTN 988
            SE FVQ++LSFL S    E E   E     L       + E  +D+F LKQ+SSIKS   
Sbjct: 830  SEAFVQQTLSFLTSGEVGE-EKGPENNLGSLPTHVPSFNTEETQDIFALKQNSSIKSL-- 886

Query: 989  SQTDSFTSRTVTTMIDLEKRTEDEDEMENGDSSLVSGFKHPSIVKSFASRTDINDKFKEG 1048
                S  +R  + M+      +D+++       L+S  +  S    F  R D N+KF+EG
Sbjct: 887  ----SAPTRNSSNML-----IDDQED-------LLSRKRACSFFARFTKRVDANEKFEEG 930

Query: 1049 NKTVKISKSYKMVGSSKASITYMGKTRKLMAPKRKAGTDQNHHRHXXXXXXXXXLFESGQ 1108
             KTV+   SYK+ GSSKASITY+GK RKL APK+ A   Q   +          +F S  
Sbjct: 931  KKTVRSLNSYKVAGSSKASITYLGKARKLNAPKKVA--HQQSRKRGHKPAAGFGIFASNS 988

Query: 1109 NSFDS 1113
             SF+S
Sbjct: 989  ESFES 993

 Score = 46.6 bits (109), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 26/60 (43%), Positives = 39/60 (65%)

Query: 454 KATILNLKARLSKQNQDISQRPLEGRDARLDHNKLFNTLRKASRKQILDHQREVIETKGF 513
           KA IL+LKARLSK++Q +     +       H  LF +LRKA++ QILD+++E  ++KG 
Sbjct: 360 KAAILDLKARLSKKSQSLLIPRSKVTSNFSSHQILFASLRKANKSQILDYRKEKYQSKGI 419

 Score = 43.9 bits (102), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 27/64 (42%), Positives = 38/64 (59%), Gaps = 7/64 (10%)

Query: 47  PALTGNGFLFANATLNRVKNRLEGGKAPEQEHDNK----DDEDEDVSSSQLIANLYEGGE 102
           P +TG GFLF N+ L RVK+RL  G     E D+     D+   D+S +Q++   Y+ GE
Sbjct: 29  PLVTGTGFLFGNSVLRRVKSRL--GDDENHEADSTKSPIDNGCCDLSQTQVVGLAYD-GE 85

Query: 103 DLEE 106
           DLE+
Sbjct: 86  DLEQ 89

>AFR745W Chr6 (1803046..1806102) [3057 bp, 1018 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YCL061C (MRC1)
          Length = 1018

 Score =  183 bits (464), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 131/351 (37%), Positives = 190/351 (54%), Gaps = 54/351 (15%)

Query: 737  GVTNFFEMEAEESDDEWHGIGGADGEGSDEYDSDVEKMIDDYSKNNFNSHEIREMLAAEN 796
            G+T   EMEAEES+DEWHGIGG+D E S++YDS+VEKMIDDYS ++ N+  +R +LA   
Sbjct: 685  GITKMLEMEAEESEDEWHGIGGSDNELSEDYDSEVEKMIDDYSVHSSNADHLRAILAKNE 744

Query: 797  KEMDVKMINKILYDIKNGGFRNKRAKNXXXXXXXXXXXXVLQQYXXXXXXXXXXXXXXIG 856
            ++ D  ++NKIL+DI  GGFR +R K              LQQ+               G
Sbjct: 745  RQHDENIVNKILHDISTGGFR-RRGKGALDLEMSENEDQELQQFRQKRRELLKQKILENG 803

Query: 857  DGTKLVKNPKSKAFFESMVEDIME--YKNPFRAEEESNQDITSTATDLDTLDNNSLNVRD 914
            D +KLV NPKS AFF++MV+D+ E  + N F A                       N+ +
Sbjct: 804  DTSKLVSNPKSYAFFQTMVDDVTEASFGNTFDA-----------------------NIDE 840

Query: 915  STRNNEKGPVDDKSKKIIISEDFVQKSLSFLKSNNYNEFEMDKELAKMQHGN-DDEPIED 973
             T  +  G      +KI+ISE FV+++LSFL S +  + E+  E   +     + E I+D
Sbjct: 841  KTDPSAAG------RKIVISEQFVKETLSFLSSKS-GDSEIPAETKSISSSTVEREEIQD 893

Query: 974  LFTLKQHSSIKSFTNSQTDSFTSRTVTTMIDLEKRTEDEDEMENGDSSLVSGF---KHPS 1030
            L TLKQ+S+IK    S             ++L  +  +    + GD     GF   +  S
Sbjct: 894  LHTLKQNSNIKHLKGS-------------LELPAQMAELSSGDEGDY----GFSLDRFRS 936

Query: 1031 IVKSFASRTDINDKFKEGNKTVKISKSYKMVGSSKASITYMGKTRKLMAPK 1081
              KSF + T+++DKFK G K V+I K+ K +G SKA+IT++G+ R+L+ PK
Sbjct: 937  AAKSFNNGTNVDDKFKSGTKAVRILKANKTIGGSKAAITFIGRKRRLIPPK 987

 Score = 48.1 bits (113), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 135/529 (25%), Positives = 212/529 (40%), Gaps = 115/529 (21%)

Query: 13  SKKRVTTYKKVAIHIPDDNDNTDGNLYTNDIVAPPALTGNGFLFANATLNRVKNRL--EG 70
           S ++ TTYKKV + I + + +             P+      +F ++ L+RV+ RL  E 
Sbjct: 10  SARKKTTYKKVRLGIAEQSKDE------------PSSNKPAAVFRSSLLDRVRTRLNVED 57

Query: 71  GKAPEQEHDNKDDEDEDVSSSQLIANLYEGGEDLE---ETKSNENDCTGKNCMPTFTQTQ 127
           G AP          D     S L  ++Y+G E+LE   +    E+DC     +PT  Q  
Sbjct: 58  GHAPSS--------DALEPESGLTDDVYDG-ENLEVSFDVGDAEDDC-----LPT--QAD 101

Query: 128 RIPVSIQQDKVVDVPIHSVNEEKPTQIIKDDCFVNKIPQAQKLSTTTIKPVATQRIDSDD 187
             P  I+      V + +  EE  ++I        KIP   KLS   I   +TQ  D   
Sbjct: 102 GKPEQIE------VNVGTAPEEPFSRI--------KIPL--KLSDGGIFSPSTQVDDEMA 145

Query: 188 IITQSQQALPIKPIESPSQGKTATSNDLDVQSSKPPVLTIGKSPLFQPLLTRGPVNQMDT 247
           +  Q  Q LP    ESP+     T  +L     +  V   G+  L Q  +          
Sbjct: 146 MQLQPTQKLPP---ESPALQAVDTHTELQ-DELETGVAVDGRISLSQTQV---------- 191

Query: 248 PLESSPNNDETQLDVMPQNTQSDNKTQIDTIPQTTHYEDKTQMDTM------SQTLQDGV 301
            + S  N   T++D     TQ D+    D     T   D    D        +QTL    
Sbjct: 192 -IVSGTNYGPTRVDDEVVATQQDSMGTADAQCWDTQTLDCALADDFQATIPDAQTLATAR 250

Query: 302 PHTLKIREIQNELALEDSRR----ERASNVEYTKPQKTIATKLKFSKESFLADFDDSSSN 357
              L I +I+ E+A +  +      +A    Y   QK     L F+K++FL  FDD S  
Sbjct: 251 HEKLFIHQIEEEIATKTQKELPMMTQAKEAPYIPKQK-----LVFTKDNFLDSFDDDSET 305

Query: 358 EDAEIKVESAHPKPLGNEEELHED--KNIEPSINEVTKKTDKRVPLLSSYANNLKREIDS 415
           E     ++ +  +   N+ E  E   ++ +P+  E  + T    P L S +   K     
Sbjct: 306 E-IHGGLDGSDRQVSYNDREHTETGPQSSQPATGE-GQDTQVLYPALQSLSITSK----- 358

Query: 416 SKCITXXXXXXXXXXXXXXXXXRKLIKDEGALP------ISQLSKATILNLKARLSKQNQ 469
                                 R++I DE +         S +SKA +L +KAR SK   
Sbjct: 359 -----------------SYQEARQIILDESSEDDTDVNLSSAVSKAAVLAIKARNSKFI- 400

Query: 470 DISQRPLEGRDARLDHNKLFNTLRKASRKQILDHQREVIETKGFKLEDM 518
              Q+  E + ++   N+LF  LRKA+R+Q+L+ +R  IE +G  ++++
Sbjct: 401 -TPQKIDETKSSK--SNELFAKLRKANREQLLEQRRNAIERRGINMQNL 446

>Kwal_33.13005 s33 complement(36797..39709) [2913 bp, 970 aa] {ON}
            YCL061C (MRC1) - protein involved in replication
            checkpoint [contig 123] FULL
          Length = 970

 Score =  177 bits (450), Expect = 8e-45,   Method: Compositional matrix adjust.
 Identities = 162/514 (31%), Positives = 240/514 (46%), Gaps = 67/514 (13%)

Query: 607  VPKKKKAHHVKRMIDESDSENEAVPKEKVDASVPKRIAINLGHYGDNI--EEEVNKFQET 664
            V KKKK     R  +  DS++EA+  ++      ++  I+LG YG+NI   E +++    
Sbjct: 515  VTKKKKV----RRWNLIDSDDEALSNDE------QKTVIDLGAYGENILGTERIDEGAGA 564

Query: 665  NDMNTQQT-DKITMERNIVENKAILEDTAXXXXXXXXXXXXXXXRRELIDKEKLQ--LRQ 721
              + T  +  +  +ERN  ++   + +                  + LI+K KL+  LR+
Sbjct: 565  QVVGTSSSMCEAKLERNTTKSPVRILNRPCEEKIDQDEETRNPIIKNLIEKRKLKEALRE 624

Query: 722  XXXXXXXXXXXXXXXGVTNFFEMEAEESDDEWHGIGGADGEGSDEYDSDVEKMIDDYSKN 781
                           G+ +F   EAEESDDEW G+GGADGE SD YDS++++MIDDYS  
Sbjct: 625  AKMKELNRSKAN---GMIDF---EAEESDDEWFGVGGADGENSDGYDSELDRMIDDYSNT 678

Query: 782  NFNSHEIREMLAAENKEMDVKMINKILYDIKNGGFRNKRAKNXXXXXXXXXXXXVLQQYX 841
              +   +R+ L  E K  D  M+++IL+DI+NGGFR KR +              L +Y 
Sbjct: 679  KSDPEFLRKKLMEEEKLHDKDMVDRILHDIENGGFR-KRGRYAMDLTLSDDEDDDLLRYH 737

Query: 842  XXXXXXXXXXXXXIGDGTKLVKNPKSKAFFESMVEDIMEYKNPFRAEEESNQDITSTATD 901
                           + + L  NPKSKAFF+S+ ED ++       E +S+      A D
Sbjct: 738  ARRKELLNERKSGNQEISVLATNPKSKAFFDSIFEDDLKGGIANLKEYQSHASPLKAAKD 797

Query: 902  LDTLDNNSLNVRDSTRNNEKGPVDDKSKKIIISEDFVQKSLSFLKSNNYNEFEMD-KELA 960
                    ++ +  TR               ISE FVQK+LSFLKS    + + +   +A
Sbjct: 798  -------EISGKRETR---------------ISEQFVQKTLSFLKSKEDEQGDAEFVSVA 835

Query: 961  KMQHGNDDEPIE--DLFTLKQHSSIKSFTNSQTDSFTSRTVTTMIDLEKRTEDEDEMENG 1018
              Q  +  +  E  D + LKQ S IKSF         S  + + I L+ R +D       
Sbjct: 836  DTQESSSGDFAEATDFYRLKQLSGIKSF---------SAPLRSSIRLQVRNKD------- 879

Query: 1019 DSSLVSGFKHPSIVKSFASRTDINDKFKEGNKTVKISKSYKMVGSSKASITYMGKTRKLM 1078
               ++SG  + ++V+ F    D N+KF+EG KTVK   SYK+ GSS+ASIT++GK R L 
Sbjct: 880  --GVLSGKANTTLVERFVRSVDTNEKFEEGRKTVKSLNSYKIAGSSRASITFLGKARSLK 937

Query: 1079 APKRKAGTDQNHHRHXXXXXXXXXLFESGQNSFD 1112
            A  RK G       H          F S   SF+
Sbjct: 938  A--RKRGPHARSAPHGQKIMTSHQFFASDGQSFE 969

 Score = 43.9 bits (102), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 26/68 (38%), Positives = 44/68 (64%), Gaps = 4/68 (5%)

Query: 453 SKATILNLKARLSKQNQDISQRPLEGR--DARLDHNKLFNTLRKASRKQILDHQREVIET 510
           SKA IL+LKAR+SK+ Q ++    +     A L H  LF++LRKA+R Q+++H+  ++  
Sbjct: 338 SKAAILDLKARMSKKKQSLAVTSSKETMPSASLRH--LFSSLRKANRDQLVEHRNGLLLL 395

Query: 511 KGFKLEDM 518
           +G  L ++
Sbjct: 396 RGVDLAEI 403

 Score = 35.4 bits (80), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 55/205 (26%), Positives = 86/205 (41%), Gaps = 37/205 (18%)

Query: 38  LYTNDIVAPPALTGNGFLFANATLNRVKNRLEGGKAPEQEHDNKDDED----EDVSSSQL 93
           L+  D  + P + G GFLF N+  N+VK R++     E  H+          +D   +Q 
Sbjct: 21  LHLFDDESCPTVGGTGFLFENSIFNQVKKRIKATDDNEINHNAPTTASTEILKDTCETQA 80

Query: 94  IANLYEGGEDLE----------ETKSNENDCTGKNCMPTFTQTQRIPVSIQQDKVVDVPI 143
           I   Y+ GE+LE          E K NE   +  +    F   Q    S +      +  
Sbjct: 81  IERPYD-GEELETDFVLAKAPSEPKDNEVRASQSSSRLKFQAQQEFTASGE----TRLDN 135

Query: 144 HSVNEEKPTQIIKDDCFVNKIPQAQKLSTTTI--KPVATQRIDSDDIITQSQQALPIKPI 201
           H   +   TQ+I D            +S+T+I  + + TQ+  S+D+IT S     I   
Sbjct: 136 HKEADIANTQLIGD-----------SISSTSICDEDLETQKTSSNDMIT-SLTTQKIDLS 183

Query: 202 ESPSQGKT-ATSNDLDVQSSKPPVL 225
            SP +G   ATS D +++   PP +
Sbjct: 184 HSPIKGTLQATSRDDNLE---PPTV 205

>NDAI0G03420 Chr7 (817362..818816) [1455 bp, 484 aa] {ON} Anc_8.144
           YER130C
          Length = 484

 Score = 33.1 bits (74), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 28/95 (29%), Positives = 46/95 (48%), Gaps = 12/95 (12%)

Query: 857 DGTKLVKNPKSKAFFESMVEDIMEYKN-PFRAEEES--------NQDITSTATDLDTLDN 907
           DGT+   N +S + +E  ++      +  FR   ES        + D T+TA   +  +N
Sbjct: 38  DGTRSTNNDRSDSTYEDRIDKFCTQSDEAFRTFFESFCVSLDGSDNDTTTTAASKNNFNN 97

Query: 908 NSLNVRDSTRNNEKGPVDDKSKKIIISEDFVQKSL 942
            +L+ RD   N + G +D   +K+ +  DFV KSL
Sbjct: 98  LNLHTRDYISNYDAGSID---QKLNLDMDFVPKSL 129

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.308    0.127    0.343 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 112,981,343
Number of extensions: 5387851
Number of successful extensions: 30247
Number of sequences better than 10.0: 426
Number of HSP's gapped: 31663
Number of HSP's successfully gapped: 475
Length of query: 1113
Length of database: 53,481,399
Length adjustment: 120
Effective length of query: 993
Effective length of database: 39,721,479
Effective search space: 39443428647
Effective search space used: 39443428647
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.7 bits)
S2: 71 (32.0 bits)