Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Smik_3.131.4ON42542521190.0
YCL063W (VAC17)1.4ON42342617930.0
Skud_3.21.4ON42642617520.0
Suva_3.1511.4ON42142616710.0
TDEL0C069801.4ON4264495452e-64
ZYRO0F18502g1.4ON4504705236e-61
Kpol_2002.71.4ON4744784392e-48
CAGL0B00308g1.4ON4304544171e-45
KNAG0C001901.4ON4424684126e-45
SAKL0C00440g1.4ON4624044083e-44
NDAI0A001301.4ON4785043804e-40
TPHA0E040201.4ON5404283642e-37
NCAS0B091201.4ON4334703391e-34
TBLA0A075801.4ON5133162865e-27
KLLA0C00462g1.4ON4604682581e-23
Kwal_33.130031.4ON4492412192e-18
KLTH0F00462g1.4ON4512382076e-17
KAFR0D001201.4ON3994671906e-15
Ecym_10071.4ON4621581017e-04
Skud_13.2212.632ON501221840.079
Suva_5.1507.217ON391109760.82
CAGL0D01672g3.340ON1014160751.1
Skud_5.1587.217ON39138741.2
KNAG0L013307.217ON396102722.1
Ecym_50677.68ON155877722.7
Smik_5.1737.217ON39144713.4
YER048C (CAJ1)7.217ON39144703.8
NCAS0F020205.56ON784109695.5
NDAI0G002701.487ON1149119695.8
SAKL0D05588g1.274ON119964697.0
NOTE: 1 genes in the same pillar as Smik_3.13 were not hit in these BLAST results
LIST: AFR746C

BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Smik_3.13
         (425 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Smik_3.13 Chr3 (18714..19991) [1278 bp, 425 aa] {ON} YCL063W (REAL)   820   0.0  
YCL063W Chr3 (17290..18561) [1272 bp, 423 aa] {ON}  VAC17Phospho...   695   0.0  
Skud_3.2 Chr3 (5324..6604) [1281 bp, 426 aa] {ON} YCL063W (REAL)      679   0.0  
Suva_3.151 Chr3 (227186..228451) [1266 bp, 421 aa] {ON} YCL063W ...   648   0.0  
TDEL0C06980 Chr3 complement(1267077..1268357) [1281 bp, 426 aa] ...   214   2e-64
ZYRO0F18502g Chr6 complement(1527109..1528461) [1353 bp, 450 aa]...   206   6e-61
Kpol_2002.7 s2002 (10372..11796) [1425 bp, 474 aa] {ON} (10372.....   173   2e-48
CAGL0B00308g Chr2 (16533..17825) [1293 bp, 430 aa] {ON} similar ...   165   1e-45
KNAG0C00190 Chr3 (28746..30074) [1329 bp, 442 aa] {ON} Anc_1.4 Y...   163   6e-45
SAKL0C00440g Chr3 (39662..41050) [1389 bp, 462 aa] {ON} weakly s...   161   3e-44
NDAI0A00130 Chr1 (6694..8130) [1437 bp, 478 aa] {ON} Anc_1.4 YCL...   150   4e-40
TPHA0E04020 Chr5 complement(842960..844582) [1623 bp, 540 aa] {O...   144   2e-37
NCAS0B09120 Chr2 complement(1749531..1750832) [1302 bp, 433 aa] ...   135   1e-34
TBLA0A07580 Chr1 complement(1878594..1880135) [1542 bp, 513 aa] ...   114   5e-27
KLLA0C00462g Chr3 (33948..35330) [1383 bp, 460 aa] {ON} weakly s...   103   1e-23
Kwal_33.13003 s33 (35425..36774) [1350 bp, 449 aa] {ON} YCL063W ...    89   2e-18
KLTH0F00462g Chr6 (35640..36995) [1356 bp, 451 aa] {ON} weakly s...    84   6e-17
KAFR0D00120 Chr4 (9052..10251) [1200 bp, 399 aa] {ON} Anc_1.4 YC...    78   6e-15
Ecym_1007 Chr1 (11741..13129) [1389 bp, 462 aa] {ON} similar to ...    44   7e-04
Skud_13.221 Chr13 (374262..375767) [1506 bp, 501 aa] {ON} YMR065...    37   0.079
Suva_5.150 Chr5 complement(223538..224713) [1176 bp, 391 aa] {ON...    34   0.82 
CAGL0D01672g Chr4 complement(173338..176382) [3045 bp, 1014 aa] ...    33   1.1  
Skud_5.158 Chr5 complement(244775..245950) [1176 bp, 391 aa] {ON...    33   1.2  
KNAG0L01330 Chr12 complement(239806..240996) [1191 bp, 396 aa] {...    32   2.1  
Ecym_5067 Chr5 complement(146782..151458) [4677 bp, 1558 aa] {ON...    32   2.7  
Smik_5.173 Chr5 complement(251699..252874) [1176 bp, 391 aa] {ON...    32   3.4  
YER048C Chr5 complement(246982..248157) [1176 bp, 391 aa] {ON}  ...    32   3.8  
NCAS0F02020 Chr6 (402424..404778) [2355 bp, 784 aa] {ON} Anc_5.5...    31   5.5  
NDAI0G00270 Chr7 (41767..45216) [3450 bp, 1149 aa] {ON} Anc_1.48...    31   5.8  
SAKL0D05588g Chr4 (448828..452427) [3600 bp, 1199 aa] {ON} simil...    31   7.0  

>Smik_3.13 Chr3 (18714..19991) [1278 bp, 425 aa] {ON} YCL063W (REAL)
          Length = 425

 Score =  820 bits (2119), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 410/425 (96%), Positives = 410/425 (96%)

Query: 1   MTTQALEDITERLLIRSQEAILQLDLWIQRQQRSSVCQTTDQELLDKVSKQYNQYMSQLN 60
           MTTQALEDITERLLIRSQEAILQLDLWIQRQQRSSVCQTTDQELLDKVSKQYNQYMSQLN
Sbjct: 1   MTTQALEDITERLLIRSQEAILQLDLWIQRQQRSSVCQTTDQELLDKVSKQYNQYMSQLN 60

Query: 61  SLYVRSESVRDKLSKEQQRRLITEDNEHQRIEDLVREFQDITLRLNELATAPNEVANDSP 120
           SLYVRSESVRDKLSKEQQRRLITEDNEHQRIEDLVREFQDITLRLNELATAPNEVANDSP
Sbjct: 61  SLYVRSESVRDKLSKEQQRRLITEDNEHQRIEDLVREFQDITLRLNELATAPNEVANDSP 120

Query: 121 QSQSTRSSLESFQPRPLKIIERQRLCMVTPSKPPKKSVGFNPINDVDCPSKTNSLPCSPK 180
           QSQSTRSSLESFQPRPLKIIERQRLCMVTPSKPPKKSVGFNPINDVDCPSKTNSLPCSPK
Sbjct: 121 QSQSTRSSLESFQPRPLKIIERQRLCMVTPSKPPKKSVGFNPINDVDCPSKTNSLPCSPK 180

Query: 181 KQPAKNHTLRAAKSHDTGLNKSKKPSSADAYESFFKNRQRLSLTXXXXXXXXXXXXXXXT 240
           KQPAKNHTLRAAKSHDTGLNKSKKPSSADAYESFFKNRQRLSLT               T
Sbjct: 181 KQPAKNHTLRAAKSHDTGLNKSKKPSSADAYESFFKNRQRLSLTFFDEMDDEDFDSDQDT 240

Query: 241 VILPNISTPPHVNVTAKGAEFEPLRRYNSHESILSNKPAPLMSHSLGSFPVSFFKPSNPT 300
           VILPNISTPPHVNVTAKGAEFEPLRRYNSHESILSNKPAPLMSHSLGSFPVSFFKPSNPT
Sbjct: 241 VILPNISTPPHVNVTAKGAEFEPLRRYNSHESILSNKPAPLMSHSLGSFPVSFFKPSNPT 300

Query: 301 FGTSISNVQANCHPTITATMAPRRNGVHAPSSKALLSSFIGRSERPMVKQNTPNLKHVSL 360
           FGTSISNVQANCHPTITATMAPRRNGVHAPSSKALLSSFIGRSERPMVKQNTPNLKHVSL
Sbjct: 301 FGTSISNVQANCHPTITATMAPRRNGVHAPSSKALLSSFIGRSERPMVKQNTPNLKHVSL 360

Query: 361 LDKFNSSLTTISESFQSKKKKNKDLNDERISSLDHIGAHDRNNCIMDMSVSIEELQDALN 420
           LDKFNSSLTTISESFQSKKKKNKDLNDERISSLDHIGAHDRNNCIMDMSVSIEELQDALN
Sbjct: 361 LDKFNSSLTTISESFQSKKKKNKDLNDERISSLDHIGAHDRNNCIMDMSVSIEELQDALN 420

Query: 421 TELLL 425
           TELLL
Sbjct: 421 TELLL 425

>YCL063W Chr3 (17290..18561) [1272 bp, 423 aa] {ON}
           VAC17Phosphoprotein involved in vacuole inheritance;
           degraded in late M phase of the cell cycle; acts as a
           vacuole-specific receptor for myosin Myo2p
          Length = 423

 Score =  695 bits (1793), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 348/426 (81%), Positives = 371/426 (87%), Gaps = 4/426 (0%)

Query: 1   MTTQALEDITERLLIRSQEAILQLDLWIQRQQRSSVCQTTDQELLDKVSKQYNQYMSQLN 60
           M TQALEDITERLLIRSQEAILQLDLWIQRQQRSS+CQTTDQE LDK+S+QYNQYMSQLN
Sbjct: 1   MATQALEDITERLLIRSQEAILQLDLWIQRQQRSSICQTTDQESLDKLSQQYNQYMSQLN 60

Query: 61  SLYVRSESVRDKLSKEQQRRLITEDNEHQRIEDLVREFQDITLRLNELATAPNEVANDSP 120
           SLYVRSESVRDKLSKEQQRRLITEDNEHQRIEDLVREFQDITLRLNELAT PNE  NDSP
Sbjct: 61  SLYVRSESVRDKLSKEQQRRLITEDNEHQRIEDLVREFQDITLRLNELATVPNEAPNDSP 120

Query: 121 QSQSTRSSLESFQPRPLKIIERQRLCMVTPSKPPKKSVGFNPINDVDCPSKTNSLPCSPK 180
           QSQSTRSSL SFQPRPLKIIERQRLCMVTPSKPPKKSVGFNPIN+VDCPSKTNSLPCSPK
Sbjct: 121 QSQSTRSSLGSFQPRPLKIIERQRLCMVTPSKPPKKSVGFNPINEVDCPSKTNSLPCSPK 180

Query: 181 KQPAKNHTLRAAKSHDTGLNKSKKPSSADAYESFFKNRQRLSLTXXXXXXXXXXXXXXXT 240
           KQPA+N TLRAAKSHDTGLNKSKKPSS+D YESFFKNRQRLSLT               T
Sbjct: 181 KQPARNRTLRAAKSHDTGLNKSKKPSSSDTYESFFKNRQRLSLTFFDEMDDEDFDSDQDT 240

Query: 241 VILPNISTPPHVNVTAKGAEFEPLRRYNSHESILSNKPAPLMSHSLGSFPVSFFKPSNPT 300
           +ILPNISTPPHV VTAKGAEFEPLRRYNSHESILSNKPAP  S +LGSF  SFF+PSNPT
Sbjct: 241 IILPNISTPPHVGVTAKGAEFEPLRRYNSHESILSNKPAPSKSLNLGSFSASFFRPSNPT 300

Query: 301 FGTSISNVQANCHPTITATMAPRRNGVHAPSSKALLSSFIGRSERPMVKQNTPNLKHVSL 360
           FGTSISNVQ NCHPT+ ATMAP RNG    SSKALLSSFI RS+   VK+N  NLKH S 
Sbjct: 301 FGTSISNVQVNCHPTVAATMAPSRNGPRISSSKALLSSFIARSDTHTVKENNTNLKHASF 360

Query: 361 LDKFNSSLTTISESFQSKK-KKNKDLNDERISSLDHIGAHDRNNCIMDMSVSIEELQDAL 419
           +DKFNSSL+TISESFQSK+ +KNK +N+ERIS+  ++    +NN  MD+SVSIEELQDAL
Sbjct: 361 MDKFNSSLSTISESFQSKRGRKNKGMNEERISN-HNVAQEQKNN--MDISVSIEELQDAL 417

Query: 420 NTELLL 425
           NTELL 
Sbjct: 418 NTELLF 423

>Skud_3.2 Chr3 (5324..6604) [1281 bp, 426 aa] {ON} YCL063W (REAL)
          Length = 426

 Score =  679 bits (1752), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 349/426 (81%), Positives = 373/426 (87%), Gaps = 1/426 (0%)

Query: 1   MTTQALEDITERLLIRSQEAILQLDLWIQRQQRSSVCQTTDQELLDKVSKQYNQYMSQLN 60
           M TQALEDITERLLIRSQEAILQLDLWIQRQQRSSVCQT+DQE LDK+S+QYNQYMSQLN
Sbjct: 1   MATQALEDITERLLIRSQEAILQLDLWIQRQQRSSVCQTSDQESLDKLSQQYNQYMSQLN 60

Query: 61  SLYVRSESVRDKLSKEQQRRLITEDNEHQRIEDLVREFQDITLRLNELATAPNEVANDSP 120
           SLYVRSESVRDKLSKEQQRRLITEDNEHQRIEDLV EFQDIT RLNELAT P+ V+NDSP
Sbjct: 61  SLYVRSESVRDKLSKEQQRRLITEDNEHQRIEDLVHEFQDITSRLNELATVPHGVSNDSP 120

Query: 121 QSQSTRSSLESFQPRPLKIIERQRLCMVTPSKPPKKSVGFNPINDVDCPSKTNSLPCSPK 180
           QSQSTRSS  SFQPRPLKIIERQR+CMVTPSKPPKKSVGFNPINDVDCPSKTNSLPCSPK
Sbjct: 121 QSQSTRSSSGSFQPRPLKIIERQRVCMVTPSKPPKKSVGFNPINDVDCPSKTNSLPCSPK 180

Query: 181 KQPAKNHTLRAAKSHDTGLNKSKKPSSADAYESFFKNRQRLSLTXXXXXXXXXXXXXXXT 240
           K PAKN TLRAAKSHDTGLNKSKK SS DAYESFFKN+QRLSLT               T
Sbjct: 181 KPPAKNRTLRAAKSHDTGLNKSKKMSSTDAYESFFKNKQRLSLTFFDEMDDEDLDSDQDT 240

Query: 241 VILPNISTPPHVNVTAKGAEFEPLRRYNSHESILSNKPAPLMSHSLGSFPVSFFKPSNPT 300
           +ILPNISTPPH+NVTAKGAEFEPLRRYNSHESILSNKPAP+MS SLG FP SF+KPS+PT
Sbjct: 241 IILPNISTPPHMNVTAKGAEFEPLRRYNSHESILSNKPAPIMSLSLGGFPGSFYKPSHPT 300

Query: 301 FGTSISNVQANCHPTITATMAPRRNGVHAPSSKALLSSFIGRSERPMVKQNTPNLKHVSL 360
           FGTS SNVQ +CHPTIT +MA RRNG +APSSKALLSSFI R +R   KQ+  NLKH S 
Sbjct: 301 FGTSTSNVQVDCHPTITVSMASRRNGCYAPSSKALLSSFIARPDRIAAKQDPTNLKHTSF 360

Query: 361 LDKFNSSLTTISESFQSKK-KKNKDLNDERISSLDHIGAHDRNNCIMDMSVSIEELQDAL 419
           LDKFNSSL+TISESFQ+KK KKNKD+ND RIS+L+HI   ++   IMDMSVSIEELQDAL
Sbjct: 361 LDKFNSSLSTISESFQNKKGKKNKDVNDGRISNLNHIATQEQKKNIMDMSVSIEELQDAL 420

Query: 420 NTELLL 425
           NTELL 
Sbjct: 421 NTELLF 426

>Suva_3.151 Chr3 (227186..228451) [1266 bp, 421 aa] {ON} YCL063W
           (REAL)
          Length = 421

 Score =  648 bits (1671), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 328/426 (76%), Positives = 364/426 (85%), Gaps = 6/426 (1%)

Query: 1   MTTQALEDITERLLIRSQEAILQLDLWIQRQQRSSVCQTTDQELLDKVSKQYNQYMSQLN 60
           M TQALEDITERLL RS+EAILQLDLWIQRQQRSSVC+ +D++ LDK+S+QYNQYMSQLN
Sbjct: 1   MATQALEDITERLLTRSEEAILQLDLWIQRQQRSSVCEPSDRDSLDKLSQQYNQYMSQLN 60

Query: 61  SLYVRSESVRDKLSKEQQRRLITEDNEHQRIEDLVREFQDITLRLNELATAPNEVANDSP 120
           SLYVRSESVRDKLSKEQ RRL TE+NEH+RIEDLV EFQDIT+RLN+LAT PN+ +NDSP
Sbjct: 61  SLYVRSESVRDKLSKEQWRRLNTEENEHKRIEDLVHEFQDITVRLNDLATVPNKASNDSP 120

Query: 121 QSQSTRSSLESFQPRPLKIIERQRLCMVTPSKPPKKSVGFNPINDVDCPSKTNSLPCSPK 180
           QSQSTRSSL+SFQPRPLKIIERQRLC+VTPSKPPKKSV FNPINDV+CPSKTNSLPCSPK
Sbjct: 121 QSQSTRSSLDSFQPRPLKIIERQRLCVVTPSKPPKKSVVFNPINDVECPSKTNSLPCSPK 180

Query: 181 KQPAKNHTLRAAKSHDTGLNKSKKPSSADAYESFFKNRQRLSLTXXXXXXXXXXXXXXXT 240
           KQP K HTLRAAKSHDTGLNKSKKPSS DAYESFFKN+QRLSLT               T
Sbjct: 181 KQPGKAHTLRAAKSHDTGLNKSKKPSSTDAYESFFKNKQRLSLTFFDEMDDEDLDSDQDT 240

Query: 241 VILPNISTPPHVNVTAKGAEFEPLRRYNSHESILSNKPAPLMSHSLGSFPVSFFKPSNPT 300
           +ILPNISTP H+++  KGAEFEPLRRYNSHESILSNKPAP MS SLGSFP  FFKPSNPT
Sbjct: 241 IILPNISTPSHMDMATKGAEFEPLRRYNSHESILSNKPAPAMSLSLGSFP--FFKPSNPT 298

Query: 301 FGTSISNVQANCHPTITATMAPRRNGVHAPSSKALLSSFIGRSERPMVKQNTPNLKHVSL 360
           FGTS+SNVQ N  P + A+M P+RNG  AP+SKALLSSFI + +R +VKQ + NLKH S 
Sbjct: 299 FGTSVSNVQVNYRPKMAASMIPKRNGSRAPTSKALLSSFIAQPDRIVVKQKSTNLKHTSF 358

Query: 361 LDKFNSSLTTISESFQSKK-KKNKDLNDERISSLDHIGAHDRNNCIMDMSVSIEELQDAL 419
           LDKFNSSL+TISESFQ+KK KK+ DLND+RI    HI   + NN +MDM VSIEELQDAL
Sbjct: 359 LDKFNSSLSTISESFQNKKGKKSSDLNDDRIPP--HIMP-EHNNNLMDMGVSIEELQDAL 415

Query: 420 NTELLL 425
           NTELLL
Sbjct: 416 NTELLL 421

>TDEL0C06980 Chr3 complement(1267077..1268357) [1281 bp, 426 aa]
           {ON} Anc_1.4 YCL063W
          Length = 426

 Score =  214 bits (545), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 173/449 (38%), Positives = 246/449 (54%), Gaps = 58/449 (12%)

Query: 6   LEDITERLLIRSQEAILQLDLWIQRQQRSSVCQTTDQELLDKVSKQYNQYMSQLNSLYVR 65
           LED++ERLL RSQEAILQL+LWIQRQQ     +  +   +DK+  QYN Y++QLNSL VR
Sbjct: 3   LEDLSERLLTRSQEAILQLELWIQRQQH---LRELEDSSIDKLGNQYNVYIAQLNSLCVR 59

Query: 66  SESVRDKLSKEQQRRLITEDNEHQRIEDLVREFQDITLRLNELATAPNEVANDSPQSQST 125
           SE VRDKL+KE++RR+ +  N+ + IEDLV EFQDIT++LNELA +  +  + +P S+ST
Sbjct: 60  SEYVRDKLNKERERRM-SIINDRKYIEDLVFEFQDITVKLNELAQS--QSIDSTPSSKST 116

Query: 126 RSSLESFQPRPLKIIERQ----RLCMVTP--SKPPKKSVGFNPINDV--DCPSKTNSLPC 177
           RSSL SFQPRPLK+ ER     +    +P  +K   KSV F+ ++D   +  SK  SLP 
Sbjct: 117 RSSLGSFQPRPLKLTERHGPNVKALRESPLKNKSVIKSVKFSGLHDSKEEAVSKCLSLPG 176

Query: 178 SPKKQPAKNHTLRAAKSHDTGLNK--SKKPSSADAYE--SFFKNRQRLSLTXXXXXXXXX 233
           SP +      ++R AKS+DTGLN   +KK   +  Y+  S F+  QRLS+T         
Sbjct: 177 SPVRVTGPTRSIRMAKSYDTGLNSKNTKKSKGSRDYDVPSIFRENQRLSITVFDDFDEDA 236

Query: 234 XXXXXXTVILPNISTPPHVNVTAKGAEFEPLRRYNSHESILSNKPAPLMSHSLGSFPVSF 293
                   +   IS  P     A   +  PLRR+NSHESILS K  P+ S  L S   SF
Sbjct: 237 DSTSDQDTV---ISLVP-----ADDGKGLPLRRFNSHESILSTKVQPISSLPLFS---SF 285

Query: 294 FKPSNPTFGTSISNVQANCHPTITATMAPRRNGVHAPSSKALLSSFIGRSERPMVKQNTP 353
             PS+     S+ +V+ +  P  + T AP        SS+ LLS+F+    RP    N  
Sbjct: 286 LLPSSNR--PSMKSVRVSSAPVFSKTSAP-------ASSRDLLSTFV---TRPGKASNAT 333

Query: 354 NLKHVSLLD-----KFNSSLTTISESFQSKKKK------NKDLNDERISSLDHIGAHDRN 402
            +K  + L       F    ++ S   ++ K+K        +  D R  +L+ +     +
Sbjct: 334 GIKQENKLGFFANWNFFKGPSSASHDIRATKQKASASRPESNSADCRSKTLEKMAPRRFS 393

Query: 403 ------NCIMDMSVSIEELQDALNTELLL 425
                   + D  +S E+L++AL+TE++L
Sbjct: 394 PRSPVKAPVFDSLISYEDLREALSTEIIL 422

>ZYRO0F18502g Chr6 complement(1527109..1528461) [1353 bp, 450 aa]
           {ON} similar to uniprot|P25591 Saccharomyces cerevisiae
           YCL063W VAC17 vacuole inheritance
          Length = 450

 Score =  206 bits (523), Expect = 6e-61,   Method: Compositional matrix adjust.
 Identities = 173/470 (36%), Positives = 241/470 (51%), Gaps = 71/470 (15%)

Query: 5   ALEDITERLLIRSQEAILQLDLWIQRQQRSSVCQTTDQELLDKVSKQYNQYMSQLNSLYV 64
           +L+DI+ERL IRSQEA+LQL+LWI+RQQ   + +   +   DK++ QYN YM+QLNSL V
Sbjct: 3   SLDDISERLFIRSQEAVLQLELWIRRQQH--LSEIEHEHARDKIADQYNLYMAQLNSLCV 60

Query: 65  RSESVRDKLSKEQQRRLITEDNEHQRIEDLVREFQDITLRLNELATAPNEVANDSPQSQS 124
           RSE VRDKL+   Q R     NE   IEDLV EFQDIT++LNELA   N+    +P S+ 
Sbjct: 61  RSEYVRDKLNAGYQNRKPPIVNEQNYIEDLVYEFQDITVKLNELAQ--NQKEQVTPSSKH 118

Query: 125 TRSSLESFQPRPLKIIERQRLCMVTPSKPPKKSVG-FNPINDVD-------CPSKTNSLP 176
           +  S+ SFQPRPLKI ER R  +    + P +  G    +N V+       CPSK  SLP
Sbjct: 119 SNGSVNSFQPRPLKITERYRTDIGATRQSPTRINGKLKNVNFVEESLPELFCPSKCTSLP 178

Query: 177 CSPKKQPAKNHT----LRAAKSHDTGLNKSKKPSSADAYE----SFFKNRQRLSLTXXXX 228
            SP K  + +      LR AKS+DTGLN + +       E    S FK  QRLS+T    
Sbjct: 179 GSPLKMRSPDRLPDRPLRVAKSYDTGLNPNSRAKLKKQKEEEMLSVFKENQRLSITFCDD 238

Query: 229 XXXXXXXXXXXTVILPNISTPP-HVNVTAKGAEFEPLRRYNSHESILSNKPAPLMSHSLG 287
                        ++     PP H       +E  PLRRYNSH+S+LS K  P+ S    
Sbjct: 239 IDEGSDSASDQNTVISTSPIPPSHPIQYDVQSEKPPLRRYNSHDSVLSTKVQPISSAKCP 298

Query: 288 SFPVSFFKPSNPTFGTSISNVQANCHPTITATMAPRRNGVHAPSSKALLSSFIGRSERPM 347
           +F ++    + P    S+ +V  +  P I++T      G  A SSK LLSSFI  ++   
Sbjct: 299 TF-LTIPTANRP----SMKSVTVSSAPIISST------GGKA-SSKDLLSSFISNTQDYD 346

Query: 348 VKQNTPNLKHVSLLDKFNSSLTTISESFQSKKKKNK----------DLNDER-------- 389
            K    N  +    ++F+S+L  I   F+ K +KN+          D+  ER        
Sbjct: 347 KKARNDNGNN----NRFSSNL--IWNLFKQKSQKNRNPTPLRVPQQDVTSERKENQLLTT 400

Query: 390 ------ISSLDHIGAHDRNNCIM--------DMSVSIEELQDALNTELLL 425
                  SS   +   ++N+ I+        + +   +ELQ+AL+TEL+L
Sbjct: 401 SHPSGVYSSCSRLLVKNQNSSIISPTRQRITNGNTMYDELQEALDTELVL 450

>Kpol_2002.7 s2002 (10372..11796) [1425 bp, 474 aa] {ON}
           (10372..11796) [1425 nt, 475 aa]
          Length = 474

 Score =  173 bits (439), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 173/478 (36%), Positives = 246/478 (51%), Gaps = 68/478 (14%)

Query: 6   LEDITERLLIRSQEAILQLDLWIQRQQRSSVCQTT-DQELLDKVSKQYNQYMSQLNSLYV 64
           ++D++ERLL+RSQEAILQLDLWIQRQQ+ +      D+  L+KV+  YN YMSQLNSLY+
Sbjct: 6   IDDLSERLLVRSQEAILQLDLWIQRQQQWAESDDNHDENDLEKVTDTYNLYMSQLNSLYI 65

Query: 65  RSESVRDKLSKEQQRRLIT---------EDNEHQRIEDLVREFQDITLRLNELATAPNEV 115
           RS++VRDKL+ +++ R  T           N    IEDL+ EFQDIT +LN LA++    
Sbjct: 66  RSQNVRDKLNTKKKSRTNTIKYVSPSKVNMNGQSDIEDLIFEFQDITRKLNVLASSRRRC 125

Query: 116 ANDSPQSQSTRSSLESFQPRPLKIIERQRLCMVTPSKPPKKSVGFN--PINDVDCPSKTN 173
           ++ S  S S  SS+ SFQP+PLKI  ++   +    +  KK+V F+   + D++  S   
Sbjct: 126 SS-SKSSSSRSSSIGSFQPKPLKISLKRNKSL---KEQNKKTVTFDVEEVTDLNINSVI- 180

Query: 174 SLPCSP----KKQPAKNHTLRAAKSHDTGLN-----KSKKPSSADAYESFFKNRQRLSLT 224
           SLP SP    +  P  NH LR AKS+DTGLN     K KK      Y+S FKN QRLS++
Sbjct: 181 SLPGSPLRNEQSSPPMNHHLRQAKSYDTGLNSKRSIKPKKSKIDSVYDSTFKNTQRLSIS 240

Query: 225 ---XXXXXXXXXXXXXXXTVILPNIST--PPHVNVTAKGAEFEPLRRYNSHESILSNKPA 279
                             TVI  +  T   P   +  +    +PLRRYNSHESILS K  
Sbjct: 241 LFDIDTNENDITNISDQETVISSSSLTMDEPLEIIDDQKNNLKPLRRYNSHESILSTKIR 300

Query: 280 PLMSHSLGS-FPVSFFKPSNPTFGTSISNVQANCHPTITATMAPRRNGVHAPSSKALLSS 338
           P+   S+   F +  F+  + T  ++  +  A  +  + A    + N  ++ +SK +LS 
Sbjct: 301 PI---SISKRFQIGPFRSVSTTTTSTNYDTTA-SNTDVKADDFYKPNLSNSTTSKDILSM 356

Query: 339 F-----IGRSERPMV----KQNTPNLKHVSLLDKFNSSLTTISESFQSKKKKN---KDLN 386
           +     +  S R  +    K++  +    +  + FN  L   SE   SK++ N   K   
Sbjct: 357 YSIKNDVQNSNRGNIINNKKESNSSTSFFNKWNIFNFPLIASSE-VGSKQENNTTAKHFG 415

Query: 387 DER---ISSLDH---------IGAHDRNNC-------IMDMSVSIEELQDALNTELLL 425
            +R   ISSL +         IG +    C           +VS +EL DALNTEL L
Sbjct: 416 SQRKKQISSLSYNKANYSTMTIGPNGSMFCSPTIYEPTFSNTVSFQELHDALNTELDL 473

>CAGL0B00308g Chr2 (16533..17825) [1293 bp, 430 aa] {ON} similar to
           uniprot|P25591 Saccharomyces cerevisiae YCL063w
          Length = 430

 Score =  165 bits (417), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 147/454 (32%), Positives = 232/454 (51%), Gaps = 59/454 (12%)

Query: 5   ALEDITERLLIRSQEAILQLDLWI--QRQQRSSVCQTTDQELLDKVSKQYNQYMSQLNSL 62
           +LE+ITERLL RS EAI QLD WI  Q + R      +  + ++++  +Y +++ +LNSL
Sbjct: 3   SLEEITERLLERSNEAIEQLDEWILLQNKNRHISENKSGLDSIERLDDKYTEFLEKLNSL 62

Query: 63  YVRSESVRDKLSKEQQRRLITEDNE--HQRIEDLVREFQDITLRLNELATAPNEVAND-- 118
           Y+RS+ ++DK+  E+  +     +E    RI++L+ EF++ITL LNE+A   +E  +   
Sbjct: 63  YIRSQYIKDKIRTEKNAKATKRKSELNTSRIQELMLEFKEITLSLNEIAQQDDETNSKQL 122

Query: 119 SPQSQSTRSSLESFQPRPLKIIERQRLCMVTPSKPPKK-SVGFNPINDVDCPSKTNSLPC 177
           SP S ST+SSLESF P+PLKI+ R  +     + PPKK ++ F PI++    ++  SLP 
Sbjct: 123 SPASTSTKSSLESFTPKPLKILNRASMIRSPINSPPKKRNISFCPIHENLSVTEYESLPS 182

Query: 178 SPKKQ---PAKNHTLRAAKSHDTGL--NKSKKPSSADAYESFFKNRQRLSLTXXXXXXX- 231
           SP +      +   L  A+S  TGL   K++KP   +  + +FK++QRLSLT        
Sbjct: 183 SPNRSNLLEEQEQVLHPARSFQTGLRTEKARKP-DKNQLDKYFKDKQRLSLTLFGSADAD 241

Query: 232 ------XXXXXXXXTVILPNISTPPHVNVTAKGAEFEPLRRYNSHESILS--NKPAP--- 280
                         TVI    ++  ++   A   + +P+RR NSHES+LS  NK  P   
Sbjct: 242 DGESLNNNDYSDEETVIF---TSSSNIETDAITDDMKPIRRCNSHESVLSVHNKFVPKNN 298

Query: 281 ---LMSHSLGSFPVSFFKPSNPTFGT-SISNVQANCHPTITATMAPR---RNGVHAPSSK 333
                 + L  F       +N  F   SI N+Q +   T++     +      + + +SK
Sbjct: 299 NNLQFQNRLEPFGRYLATSNNRNFTIPSIQNIQVSGTSTLSRFSREQDREMTQLGSKTSK 358

Query: 334 ALLSSFIGRSERPMVKQNTPNLKHVSLLDKFNS--SLTTISESFQSKKKKNKDLNDERIS 391
            LL+S +  +  P+  Q    L   +  DKFNS  + +TISE  ++  +KN+        
Sbjct: 359 DLLTSVMTAT--PITTQRNNKL---TFFDKFNSMFNFSTISEEQKTTVEKNRS------- 406

Query: 392 SLDHIGAHDRNNCIMDMSVSIEELQDALNTELLL 425
                    RN+      VSIEEL +AL T +++
Sbjct: 407 -----AESPRNDF-----VSIEELNEALTTNMVM 430

>KNAG0C00190 Chr3 (28746..30074) [1329 bp, 442 aa] {ON} Anc_1.4
           YCL063W
          Length = 442

 Score =  163 bits (412), Expect = 6e-45,   Method: Compositional matrix adjust.
 Identities = 161/468 (34%), Positives = 235/468 (50%), Gaps = 75/468 (16%)

Query: 5   ALEDITERLLIRSQEAILQLDLWIQRQQRSSVCQ--TTDQELLDKVSKQYNQYMSQLNSL 62
            LED+T+RLLIRSQ+AILQL+LW+Q+Q++  +    + D++  + +++Q N ++SQLNSL
Sbjct: 3   CLEDVTDRLLIRSQDAILQLELWVQQQEKLLLTDHASVDRKKFEAIAQQRNLHLSQLNSL 62

Query: 63  YVRSESVRDKLSKEQQRRLITEDNEHQR--IEDLVREFQDITLRLNELATAPNEVANDSP 120
            +RS  +++KL+ E   R I    + +R  IE+LV EFQDI + LNEL+    +  N SP
Sbjct: 63  CLRSRYIKEKLASE---RNICSIRKGRRSYIENLVYEFQDIAMSLNELSETNRK--NGSP 117

Query: 121 QSQSTRSSLESFQPRPLKIIERQRLCMVTPSKPPKKSVGFNPI-----------NDVDCP 169
            SQ+T +S +SF+P+PL+I+ERQR C      P K++     I           N  DC 
Sbjct: 118 VSQATTNSSDSFEPKPLRILERQRTC--NAKSPTKRNSNHIKIPRETEKSDFTENVADCL 175

Query: 170 SKTNSLPCSP-KKQPAKNHTLRAAKSHDTGLNKSKKPSSADAYESFFKNRQRLSLTXXXX 228
              +SLP SP +       T+R  KS+   LN  +KP+S     + F  + RLSL     
Sbjct: 176 H--SSLPSSPLRGSNGSQQTIRLTKSYHESLN-GQKPTSHSPLMNPFNAKNRLSLYLFDN 232

Query: 229 XXXXXXX------XXXXTVILPNISTPPHVNVTAKGAEFEPLRRYNSHESILS-NKPAPL 281
                            TV+    ++P    V +KGA FEPLRRYNSHESILS  K AP+
Sbjct: 233 IDEKELTPCDDDNSDQETVMY---NSP----VVSKGAAFEPLRRYNSHESILSVAKKAPI 285

Query: 282 MSHSLGSFPVSFFKPSNPTFGTSISNVQANCHPTITATMAPRRNGVHAPSSKALLSSFIG 341
            S    +  + F+ PS     TS  +V  +  P  T  ++ +        SK LLSS I 
Sbjct: 286 HS---SAQKLQFY-PSATNGTTSAQSVFVSSKPVYTKPLSVQSR------SKDLLSS-IA 334

Query: 342 RSERPMVKQNTPNLKHVSLLDKFNSSLTT-------ISESFQSKKKKNKDL--------- 385
            +E     + T      +L  K +++  T       IS+   S  K N+           
Sbjct: 335 HAEASKDTKTTSVFNGWNLFGKSSTAAITSEVGTCAISQKKHSAIKTNRRYITGDTLVIS 394

Query: 386 --NDERI--SSLDHIGAHDRNNC----IMDMSVSIEELQDALNTELLL 425
             N  R+  SS+     ++R+      I+D  V   EL +AL TELLL
Sbjct: 395 TSNRPRLSRSSVRQPHGYNRHTSPITPIVDHQVRQNELSEALETELLL 442

>SAKL0C00440g Chr3 (39662..41050) [1389 bp, 462 aa] {ON} weakly
           similar to uniprot|P25591 Saccharomyces cerevisiae
           YCL063W VAC17 vacuole inheritance
          Length = 462

 Score =  161 bits (408), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 149/404 (36%), Positives = 207/404 (51%), Gaps = 50/404 (12%)

Query: 4   QALEDITERLLIRSQEAILQLDLWIQRQQRSSVCQTTDQ---ELLDKVSKQYNQYMSQLN 60
           + L +I+++LL+RSQEAILQLDL+IQRQQR    +T DQ    LL K+ ++Y   ++QLN
Sbjct: 2   EGLHEISQKLLVRSQEAILQLDLYIQRQQRLYEYETLDQPDNGLLTKL-QEYQTCLAQLN 60

Query: 61  SLYVRSESVRDKLSKEQQRRLITEDNEHQRIEDLVREFQDITLRLNELATAPNEVANDSP 120
           SL++RSE +RD+++    R   ++D +   I  LV EFQ IT +LNELA A  + A  SP
Sbjct: 61  SLHIRSEHLRDRIASTDHR--ASQDGDS--IGHLVTEFQKITTKLNELA-ATQDRAYQSP 115

Query: 121 QSQSTRSSLESFQPRPLKIIERQRLCMVT-PSK----PPKKSVGF--NPIND----VDCP 169
            SQST+ S+ SF+P+PLKI+ER +L   T P+K    PPKK      NP  D        
Sbjct: 116 GSQSTK-SVSSFEPKPLKILERTKLQHPTSPTKRVATPPKKIAPLRKNPPFDKKVMFSGH 174

Query: 170 SKTNSLPCSPKKQPAKNHTL------RAAKSHDTGLNK-SKKPSSADAYESFFKNRQRLS 222
           SK+ SLP SP    +   ++      R AKS D GLNK  ++   +D   +FFK  QRLS
Sbjct: 175 SKSTSLPGSPSMAASSPVSIQQERFPRHAKSCDAGLNKQQRRRQDSDNRLNFFKENQRLS 234

Query: 223 LTXXXXXXXXXXXXXXXTVILPNISTPPHVNVTAKGAEFEPLRRYNSHESILSNK---PA 279
           ++                 +     +PP         + EPLRRYNSHES+LS K   PA
Sbjct: 235 ISFFDDEIDYSSDEDTVISV-----SPPETTSFKGFPKAEPLRRYNSHESVLSRKEVLPA 289

Query: 280 PLMSHSLGSFPVSFFKPSNPTFGTSISNVQANCHPTITATMAPRRNGVHAPSSKALLSSF 339
            L + + G F  S +   N        +V  N  P  +     R +     +SK LL+ F
Sbjct: 290 ALPARA-GWF--SLWAGRNNKPKPMAESVSINDKPVYSTAALLRSHSKTTETSKDLLAQF 346

Query: 340 IGRSERPMVKQNT---------PNLKHVSLLDKFNSSLTTISES 374
           +  S  P  K+ T         P     S    FN+S+   SE+
Sbjct: 347 V--SAAPKQKKQTTSWFGPAEEPKRSIFSGWKLFNNSVLVTSET 388

>NDAI0A00130 Chr1 (6694..8130) [1437 bp, 478 aa] {ON} Anc_1.4
           YCL063W
          Length = 478

 Score =  150 bits (380), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 158/504 (31%), Positives = 235/504 (46%), Gaps = 112/504 (22%)

Query: 5   ALEDITERLLIRSQEAILQLDLWIQR---QQRSSVCQTTDQELLDKV-SKQYNQYMSQLN 60
            L+DITERLLIRSQEAILQLDLWIQR   QQ  S    ++    D V ++QYN Y++QLN
Sbjct: 4   TLQDITERLLIRSQEAILQLDLWIQREKKQQELSTLNNSNNITYDHVDNQQYNVYLAQLN 63

Query: 61  SLYVRSESVRDKLSKEQQRRLITEDNEHQRIEDLVREFQDITLRLNELATAPNEVAN--D 118
           SL VR + +RDK      +   T+D E + IE+LV EF+ ITL+LN+L+      ++  +
Sbjct: 64  SLIVRVQYIRDKFLHNINQLDSTQD-EQKYIENLVYEFKQITLKLNDLSKKNKTTSSSEN 122

Query: 119 SPQSQSTRSSLESFQPRPLKIIERQRLCMVTPSKPPKKSVGFNPINDV----DCPSKTNS 174
           S ++ S++SS+ESF+P+PLKII+R +          K S   N  +D+    +   + NS
Sbjct: 123 SSKTASSKSSMESFEPKPLKIIKRTK-------NDQKVSNTINNDHDLIMQDENLQRPNS 175

Query: 175 LPCSPKKQPA------KNHTLRAAKSHD--TGLNKSKKPS-------SADAYESFFKNRQ 219
           LP SP ++ +          LR  KS D  T  N S+  +         D    FFK++Q
Sbjct: 176 LPSSPIEKSSYVTISQNEQNLRLMKSQDFSTKKNTSRNTNYNTIRKFENDTINQFFKSQQ 235

Query: 220 RLSLTXXXXXXXXXXXXXXXTVI-----LPNISTPPHVNVTAKGA------EFEPLRRYN 268
           RLS+                T           +      V ++G       +F PLRRYN
Sbjct: 236 RLSIGIFDNDDDNIYSTNMGTATRITGEYLTDNNSDQATVISQGTIKRNDDDFTPLRRYN 295

Query: 269 SHESILSNK--PAPLMSHSLGSFPVSFFKPSNPTFGTSISNVQANCHPTITATMAPRRNG 326
           SHESILS K    PL+ ++           +N TF + +        P  ++   P    
Sbjct: 296 SHESILSQKISSTPLIDNN-----------NNLTFNSKL--------PLYSSIRRPSMQS 336

Query: 327 VHAPS------------SKALLSSFIGRS--------------ERPMVKQNTPNLKHV-- 358
           +H  S            SK LLSSF+  S               R   ++N     H   
Sbjct: 337 IHVTSNPIFARSSQGKTSKDLLSSFVTSSIPRNNNRNIQTRTKTRTQSRRNNQLRDHTIN 396

Query: 359 -----------SLLDKFNSSLTTISESFQSKKKKNKDL---NDERISSLDHIGAHDRNNC 404
                      + L++FN  + T   +  + +K+N ++   N  R  ++D     D  + 
Sbjct: 397 QTSTSSFFGNWNFLNRFN--MITSETNTTTNRKRNYNIPLVNQSRAHNIDVNDTMDSISI 454

Query: 405 ---IMDMSVSIEELQDALNTELLL 425
              + D ++S+++L+DALNTELLL
Sbjct: 455 KEPVYDNTISLDDLEDALNTELLL 478

>TPHA0E04020 Chr5 complement(842960..844582) [1623 bp, 540 aa] {ON}
           Anc_1.4 YCL063W
          Length = 540

 Score =  144 bits (364), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 140/428 (32%), Positives = 202/428 (47%), Gaps = 94/428 (21%)

Query: 6   LEDITERLLIRSQEAILQLDLWIQRQQR-------SSVCQTTDQ-----ELLDKVSKQYN 53
           LE+++E+LLIRSQEAILQLDLWI RQQ+        +   T ++     E L+ +   Y+
Sbjct: 8   LEELSEKLLIRSQEAILQLDLWILRQQQQHNDHRFGTATDTGNKTKDSNEALNALRSTYD 67

Query: 54  QYMSQLNSLYVRSESVRDKLSKEQQRRLITEDN-EHQRIEDLVREFQDITLRLNELATAP 112
            YMSQLNSLYVRSE +RDKL+ E+    + + N +H+ IE+LV EFQ+I  +LN+LA A 
Sbjct: 68  LYMSQLNSLYVRSEFIRDKLNSEKNN--VNKFNLDHRNIEELVFEFQNIREKLNQLA-AS 124

Query: 113 NEVANDSPQSQSTR-SSLESFQPRPLKIIER--QRLCMVTPSKPPKKSVGFNPINDVDCP 169
           +++   SP   STR SS+ES   +PLK++ +  +R+      K  +KSV F     +   
Sbjct: 125 SKLDKHSPPKTSTRSSSMESMNLKPLKVVAKHEKRMSKELELKNKEKSVTFGKETRISLT 184

Query: 170 SKTNSLP----------CSPKKQPAKNHTLRAAKSHDTGLN---KSKKPSSAD------- 209
             TN +            SP+    K   LR A S+DTGLN   KS K S+ +       
Sbjct: 185 --TNGIGGKLMIKDDSDASPQLIDKKYKVLRNAISYDTGLNSKSKSNKRSNREYRKKNDA 242

Query: 210 AYESFFKNRQRLSLTXXXXXXXXXXXXXX----------------------XTVI----L 243
           AY+S FKN+QR S++                                     TVI    L
Sbjct: 243 AYDSLFKNKQRFSISLFEDYVDTTTNTNYNEFNPTVDASINTELIENNSDQETVISSSHL 302

Query: 244 PNISTPP--------------HVNVTAKGAEFEPLRRYNSHESILSNKPAPLMSHSLGS- 288
           P I+  P              + N      +   LRR NSHESILS K       ++GS 
Sbjct: 303 PCITNEPLDDYILSNSIQLDKNNNSGNNEGKKSHLRRCNSHESILSTKLENTFYKNVGSN 362

Query: 289 -----FPVSFFKPSNPTFGTSISNVQ------ANCHPTITATMAPRRNGVHAPSSKALLS 337
                   SF++P+  +  T+ +N++       N  P     + P  +     +S+ LLS
Sbjct: 363 FYDRFIFSSFYRPTVASVSTTSTNIEPFLSDGKNESPNKNLQL-PLTSSTRGVTSRELLS 421

Query: 338 SFIGRSER 345
            F  + E+
Sbjct: 422 KFADKPEQ 429

>NCAS0B09120 Chr2 complement(1749531..1750832) [1302 bp, 433 aa]
           {ON} Anc_1.4 YCL063W
          Length = 433

 Score =  135 bits (339), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 156/470 (33%), Positives = 219/470 (46%), Gaps = 90/470 (19%)

Query: 6   LEDITERLLIRSQEAILQLDLWIQRQQRSSVCQ------------TTDQEL---LDKVSK 50
           L+DI+ERLL+RSQEAILQLD+WIQRQ+R                  T+ ++   L +  +
Sbjct: 4   LQDISERLLVRSQEAILQLDVWIQRQRRLQELMEGEEEQEQGGDTNTNMDIRGTLPQFLE 63

Query: 51  QYNQYMSQLNSLYVRSESVRDKLS-------KEQQRRLITEDNEHQRIEDLVREFQDITL 103
           QYN YM+QLNSL VR E +RD L        + QQ       +E + I+DLV EFQDIT 
Sbjct: 64  QYNTYMAQLNSLQVRVEFIRDTLVNKKNTGIRNQQLESNNSVDEQKYIQDLVHEFQDITQ 123

Query: 104 RLNELATAPNEVANDSPQSQSTRSSLESFQPRPLKIIERQRL-CMVTPSKPPKKSVGFNP 162
           +L+EL+T  N     S +S ST+SS+ESF+P+PL+II R      +       K V FN 
Sbjct: 124 KLSELSTVRNPSTASS-RSTSTKSSIESFKPKPLRIISRSNTHSHLHQQTSLDKKVSFNE 182

Query: 163 INDVDCPSKTNSLPCSPKKQPAKNHTLRAAKSHDTGLNKSKKPSSADAYESFFKNRQRLS 222
               D  + + S   S +     + +LR  KS D  L +S   + +D +     +RQRLS
Sbjct: 183 ----DESNSSISHSRSMESLHENSKSLRNTKSMDV-LKRSTFKNHSD-FSKLLNSRQRLS 236

Query: 223 LT----------XXXXXXXXXXXXXXXTVILPNISTPPHVNVTAKGAEFEPLRRYNSHES 272
           +                          TVI  +  TP       +GA+   LRRYNSHES
Sbjct: 237 INIFDDDLIANEDGNEFYNQYSDSDQATVI--SHGTP------IRGADTPLLRRYNSHES 288

Query: 273 IL-------SNKPAPLMSHSLGSFPVSFFKPSNPTFGTSISNVQANCHPTITATMAPRRN 325
           IL       S +P  ++ +S    P             S+ +V  N +P I + M P   
Sbjct: 289 ILSFRKPTQSRQPNQILPYSSVRQP-------------SMQSVAVNSNP-IFSRMRPN-- 332

Query: 326 GVHAPSSKALLSSFIGRSERPMVKQNTPN------LKHVSLLDKFNSSL----TTISESF 375
                +SK LLSSFI + +   + Q  P           +  +KFNS      TT ++ +
Sbjct: 333 ----ATSKDLLSSFINKPQPNRLHQQKPKPNSNSLFGKWNFFNKFNSVTSEIGTTTTQLY 388

Query: 376 QSKKKKNKDLNDERISSLDHIGAHDRNNCIMDMSVSIEELQDALNTELLL 425
            +    +   N   I S   I        + D S+ +E+L DALNTELLL
Sbjct: 389 PTNSSMSNKFNPNDIPSSASIRE-----PVFDDSLHLEDLNDALNTELLL 433

>TBLA0A07580 Chr1 complement(1878594..1880135) [1542 bp, 513 aa]
           {ON} Anc_1.4 YCL063W
          Length = 513

 Score =  114 bits (286), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 100/316 (31%), Positives = 153/316 (48%), Gaps = 59/316 (18%)

Query: 7   EDITERLLIRSQEAILQLDLWIQRQQ----RSSVCQTTDQELLDKVSKQYNQYMSQLNSL 62
           E+++ RLL ++QEA+LQLDLWI+ QQ    R  +  +T  E L++  + YN+YM QLNSL
Sbjct: 5   EEVSIRLLTKAQEAVLQLDLWIKDQQGFQNRDGLRAST-SESLEQAERDYNRYMFQLNSL 63

Query: 63  YVRSESVRDKLSKEQQRRLITED------NEHQRIEDLVREFQDITLRLNELATAPNEVA 116
           Y+R++ +RDK+ K+    L   D      N H  ++ LV EF  +++++NEL+     V 
Sbjct: 64  YLRAQYIRDKIEKQNAYNLADSDVAGNDTNSHAYVQQLVTEFYSLSIKMNELSAIQENVT 123

Query: 117 NDSP----QSQSTRSSL----ESFQPRPLKIIERQRLCMVTPSKPPKKSVGFNPINDVDC 168
           N S     +S  +  SL    + FQPRPLKI++RQ+            +   +P  D++ 
Sbjct: 124 NGSSPLSNKSSHSNDSLSKITDGFQPRPLKILQRQKH---------NNNQNTHPQPDLES 174

Query: 169 P------SKTNSLPCSPKKQ--PAKNHTLRAAKSHD------------------TGLNKS 202
           P      S  N L  S KK+  P KN   + +K+++                  +  N  
Sbjct: 175 PLKLKHRSSYNKLLSSNKKESKPYKNFNSKKSKNNELLSDISPVKIQSFEEPTFSVANTR 234

Query: 203 KKPSSADAYESFFKNRQRLSLTXXXXXXXXXXXXXXXTVILPN---ISTPPHVNVTAKGA 259
            K S    + S FK   RLS+                 +   +   +ST P +  + K  
Sbjct: 235 NKNSMDPLHYSLFKTNNRLSIQFPDGYDNDDEYDDPTCISDQDTIFVST-PKIASSIKNT 293

Query: 260 EFEPLRRYNSHESILS 275
             EPLR++NSHESILS
Sbjct: 294 S-EPLRKFNSHESILS 308

>KLLA0C00462g Chr3 (33948..35330) [1383 bp, 460 aa] {ON} weakly
           similar to uniprot|P25591 Saccharomyces cerevisiae
           YCL063W VAC17 vacuole inheritance
          Length = 460

 Score =  103 bits (258), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 139/468 (29%), Positives = 216/468 (46%), Gaps = 69/468 (14%)

Query: 9   ITERLLIRSQEAILQLDLWIQRQQRSSVCQT--TDQELLDKVSKQYNQYMSQLNSLYVRS 66
           + ERL+IR  EA++QL+L IQR+    +C+    +     +V ++Y  ++++L+SL +R+
Sbjct: 7   VAERLVIRCNEAVMQLELSIQRK----MCEFDPNNSHCFIQV-QEYYSFLARLSSLKLRA 61

Query: 67  ESVRDKLSKEQQRRLITEDNEHQRIEDLVREFQDITLRLNELATAPNEVANDSPQSQSTR 126
           E V++ L + Q++       E++ +E L+ EFQDIT+ LNE+A A       +    S  
Sbjct: 62  EHVQESL-RHQRKDPNDVCIEYETLEKLIYEFQDITMSLNEVARAYQSPTKSARSGSSKE 120

Query: 127 SSLESFQPRPLKIIERQR--LCMVTPSK---------------PPKKSVGFNPINDVDC- 168
           SS+     + LKIIER R  L   +P K               P K++V F   +D+D  
Sbjct: 121 SSVIPL--KTLKIIERNRDSLIGTSPMKKSLSQLKKEEHNQSLPAKRNVRFQE-DDLDIL 177

Query: 169 -----PSKTNSLPCSP-------KKQPAKNH-TLRAAKSHDTGLNKSKKPSSADAYESFF 215
                  + NSLP SP        +  ++ H TLR AKS+D GLN   K    +A   FF
Sbjct: 178 HHLHSVKRANSLPGSPMPDTLLESQMFSREHKTLRMAKSYDVGLNGRAK---KNADWEFF 234

Query: 216 KNRQRLSLTX-XXXXXXXXXXXXXXTVILPNISTPPHVNVTAKGAEFEPLRRYNSHESIL 274
           KN+ RLSL+                +V  PNIS   +++        + +RR NSHESIL
Sbjct: 235 KNKNRLSLSVFDDVNTDASDEETVISVSPPNISY--YLSQNEDQYPSKQVRRCNSHESIL 292

Query: 275 SNK------PAPL-MSHSLGSFPVSFFKPSNPTFGTSISNVQANCHPTITATMAPR---R 324
           S K      PA L M  +  S        + PT   S SN  A+  PTI +    +    
Sbjct: 293 SRKILSPSTPANLIMRPTYQSVWQKKAIVTKPTISCSTSNSTAS--PTIGSPHLSKDMLS 350

Query: 325 NGVHAPSSKALLSSFIGRSERPMVKQ------NTPNLKHVSLLDKFNSSLTTISESFQSK 378
             V AP SK     F   +  P          N+ +L    + +  NSS ++     +++
Sbjct: 351 QFVTAPPSKKYRGWFSSSNSTPFASSIFQKWFNSDSLVTKEIGNPDNSSPSSGRPIVENR 410

Query: 379 KKKNKDLNDERISSLDHIGA---HDRNNCIMDMSVSIEELQDALNTEL 423
           ++ +   +      +   GA      N+ ++  +VS  ELQ+ALNTE 
Sbjct: 411 QRHSSSNSYSTSIVIGPNGAKFIRGLNDPLVTCTVSYNELQEALNTEF 458

>Kwal_33.13003 s33 (35425..36774) [1350 bp, 449 aa] {ON} YCL063W -
           Hypothetical ORF [contig 123] FULL
          Length = 449

 Score = 89.0 bits (219), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 78/241 (32%), Positives = 124/241 (51%), Gaps = 30/241 (12%)

Query: 4   QALEDITERLLIRSQEAILQLDLWIQRQQRSSVCQTTDQELLDKVSK---QYNQYMSQLN 60
           + L  I +  L RS+EA+++L+  + +Q+R    + +DQ L ++ S    QY  Y+ QLN
Sbjct: 2   EQLAKIAQCALERSEEALVRLEKCVGKQRRLYESERSDQCLSEESSSTIVQYYSYLGQLN 61

Query: 61  SLYVRSESVRDKLSKEQQRRLITEDNEHQRIEDLVREFQDITLRLNELATAPNEVANDSP 120
            LY++++S++D +     R     ++  + IE L  +++ +    NEL      +  DSP
Sbjct: 62  CLYIKAQSLKDMMG---NRCGHLPNSTQEAIERLEHDYKALCNHANELGIREKNL-EDSP 117

Query: 121 QSQSTRSSLESFQPRPLKIIERQ---------RLCMVTPSKPPKKSVGFNPINDV--DCP 169
              S  +S+ SFQP+PLKIIER+         ++C  T         G +  +D   D  
Sbjct: 118 SCLSP-ASVSSFQPKPLKIIERRLAQTNTSPTKVCTATVMAKSFCRSGTDKNSDYIPDEI 176

Query: 170 SKTNSL----PCS--PKKQPAKNHTLRAAKSHDTGLNKSKKPSSADAYESFFKNRQRLSL 223
            KTNS     PC+   KK+P     +R  KS  TGLNK   P   +   SFF++RQRLS+
Sbjct: 177 GKTNSCNTNSPCTNEAKKEP---KFIRVVKSCGTGLNKHSNPH--ENRLSFFRDRQRLSI 231

Query: 224 T 224
           +
Sbjct: 232 S 232

>KLTH0F00462g Chr6 (35640..36995) [1356 bp, 451 aa] {ON} weakly
           similar to uniprot|P25591 Saccharomyces cerevisiae
           YCL063W VAC17 vacuole inheritance
          Length = 451

 Score = 84.3 bits (207), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 75/238 (31%), Positives = 125/238 (52%), Gaps = 27/238 (11%)

Query: 6   LEDITERLLIRSQEAILQLDLWIQRQQRSSVCQTTDQELLDKVS---KQYNQYMSQLNSL 62
           L++I +  L  SQ A+ +LD  ++RQ+R       DQ L DK S    QY +Y+ QL SL
Sbjct: 4   LQEIAQESLALSQSALARLDSCLERQRRLYESGFPDQCLSDKSSTNMAQYYEYIGQLYSL 63

Query: 63  YVRSESVRDKLSKEQQRRLITEDNEHQRIEDLVREFQDITLRLNELATAPNEVANDSPQS 122
           Y +++ + D +     + L +   + + IE+L++EFQ+I        +       +SP S
Sbjct: 64  YTKAQKLSDTVILSDSKSLSSV--QQRAIENLIQEFQEIAKNDENFISYS---MRESPNS 118

Query: 123 QSTRSSLESFQPRPLKIIERQRLCMVTPSK---PPKKSVGFNPINDVDCPSKTN------ 173
            S + S+ SFQP+PLKI++R++  + +P+K    P  S+  N  ++ +  + ++      
Sbjct: 119 MSVQ-SICSFQPKPLKILQRRQAQLESPTKRSFRPSMSLLDNRGDETNLATASDRSQERL 177

Query: 174 --SLPCS-----PKKQPAKNHTLRAAKSHDTGLNKSKKPSSADAYESFFKNRQRLSLT 224
             S P S     P    A    +R+AKS D GLN+   P   +   +FFK+RQRLS++
Sbjct: 178 LGSSPSSIHFFRPSHTNADTLFIRSAKSCDAGLNRRSNPH--ENRLNFFKDRQRLSIS 233

>KAFR0D00120 Chr4 (9052..10251) [1200 bp, 399 aa] {ON} Anc_1.4
           YCL063W
          Length = 399

 Score = 77.8 bits (190), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 124/467 (26%), Positives = 200/467 (42%), Gaps = 124/467 (26%)

Query: 9   ITERLLIRSQEAILQLDLWIQRQQRSSVCQTTDQELLDKVSKQYN------QYMSQLNSL 62
           +++ LL RS+EA+ QL+ W+++Q++  + QTT +       KQ N      +Y+S L  L
Sbjct: 5   VSDTLLQRSEEAVSQLESWLKQQEQ--LHQTTAEY------KQLNSLCAKSKYISNL--L 54

Query: 63  YVRSESVRDKLSKEQQRRLITEDNEHQRIEDLVREFQDITLRLNELATAPNEVANDSPQS 122
              S S+   L ++++R  I        +E L+ EF +I+ +LNE+      V + SPQ 
Sbjct: 55  KDDSSSIPHDLMEQKERSFI--------VESLIHEFNEISTKLNEI------VTHTSPQ- 99

Query: 123 QSTRSSLESFQPRPLKIIERQRLCM-------VTPSKPPKK-SVGFNPINDVDCPSKTNS 174
               S+++SF+P+PL ++ + ++         VT  +  +K S+   P++     +K NS
Sbjct: 100 ----STIDSFEPKPLNLLRKNKILESPTRSSPVTRGRLERKISINLFPMH---TTTKCNS 152

Query: 175 LPCSPKKQPAKN---HTLRAAKSHDTGLNKSKKPSSADAYESFFKNRQRLSL-------T 224
           +P SPK +        TLR  KS+  GLN          Y + FK   RLS+       T
Sbjct: 153 VPTSPKCKSTSTLNQRTLRNIKSYHYGLNGD--------YINPFKENNRLSISFFNGDNT 204

Query: 225 XXXXXXXXXXXXXXXTVILPNISTPPHVNVTAKGAEFEPLRRYNSHESILSNKP---APL 281
                            +L  +++P   N   K      L+R NS +S+  N+     P 
Sbjct: 205 FNDNNSDSESDIDDDDTVL--VTSPFLTNPKQK------LKRSNSQDSVFWNENYLRKPS 256

Query: 282 MSHSLGSFPVSFFKPSNPTFGTSISNVQANCHPTITATMAPRRNGVHAPSSKALLSSFIG 341
               L  FP +  KP+       +S+ Q     T          G    SSKALL+SF  
Sbjct: 257 FQKQLNLFPSTLTKPT-----AELSSTQVFLKNT----------GRLGSSSKALLTSF-- 299

Query: 342 RSERPMVKQNTPNLKHVSLLDKFNSSLTTI-SESFQSKKKKNKDLNDE------------ 388
                 VK N    +       FN+   ++ SE  +SK  K++ ++ E            
Sbjct: 300 ------VKDNLQQQQRTHNASSFNNIFNSVTSEIGKSKLDKSQIIHTERRVLSDNSIVIS 353

Query: 389 -----------RISSLDHIGAHDRNNCIMDMSVSIEELQDALNTELL 424
                      R SS+D+I    +   I++  V   +L DALNTE L
Sbjct: 354 TLITSKKSRFNRFSSVDNISPTKK--PIINNDVQYSDLNDALNTEFL 398

>Ecym_1007 Chr1 (11741..13129) [1389 bp, 462 aa] {ON} similar to
           XP_452214  K. lactis KLLA0C00462g
          Length = 462

 Score = 43.5 bits (101), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 44/158 (27%), Positives = 70/158 (44%), Gaps = 31/158 (19%)

Query: 12  RLLIRSQEAILQLDLWIQ-----------------RQQRSSVCQTT-----DQELLDKVS 49
           RLL R QE+++ L+L IQ                       +C+ T      Q   D+ +
Sbjct: 10  RLLTRCQESLVDLNLHIQMSWSLFELAQDCGGSECNGHNCDICRYTCRSAVQQSCGDQRT 69

Query: 50  KQYNQY---MSQLNSLYVRSESVRDKLSKEQQRRLITEDNEHQRIEDLVREFQDITLRLN 106
           +Q  +Y   M+ L SL +R++ + DK  K      I  D     ++ L  EF+DI+  L 
Sbjct: 70  EQMRRYQSSMAHLMSLSIRAQFLIDKFHKGGSGYQIDLDT----VKKLGSEFEDISHNLC 125

Query: 107 ELATAPNEVANDSPQSQSTRSSLESFQPRPLKIIERQR 144
            L   PN+V + +     +      FQ RPLK+++R R
Sbjct: 126 FL--EPNKVFDKNHTRFRSSEYPAPFQLRPLKLLQRIR 161

>Skud_13.221 Chr13 (374262..375767) [1506 bp, 501 aa] {ON} YMR065W
           (REAL)
          Length = 501

 Score = 37.0 bits (84), Expect = 0.079,   Method: Compositional matrix adjust.
 Identities = 53/221 (23%), Positives = 97/221 (43%), Gaps = 27/221 (12%)

Query: 12  RLLIRSQEAILQLDLWIQRQQRSSVCQTTDQELLDKVSKQYNQYMSQLNSLYVRSESVRD 71
           R +  S   IL+ DL + R + + V   T ++L  ++ ++ NQ +  +NS++     + D
Sbjct: 202 RNMTESNRIILESDLSLFRSKVNDVLYDTSEQLEVQIIEKNNQLLDNVNSIHRTMSELTD 261

Query: 72  KLSKEQQRRLITE--DNEHQRIEDLVREFQDI---TLRLNELATA--PNEVANDSPQSQS 124
           +L+K   R  I +  D     ++DLV    D+     R NEL  A   N + +   Q  +
Sbjct: 262 ELNKGDMRSKIYDLKDENLNNLQDLVEMSHDVKEYYSRNNELVNAELENFLIDLKTQLGA 321

Query: 125 TRSSLESFQPRPLKIIERQRLCMVTPSKPPKKSVGFNPI-NDVDCPSKTNSLPCSPKKQP 183
           T   L   Q   + +++                 GFN I +D   PS TN +   P+ + 
Sbjct: 322 TSRDLSESQIEAIDLLQ-----------------GFNSILHDSLLPSITNEIV--PEMKN 362

Query: 184 AKNHTLRAAKSHDTGLNKSKKPSSADAYESFFKNRQRLSLT 224
            KN  L+   +  + LNK     + + + +F +  ++L+ T
Sbjct: 363 FKNSVLQEWTAMTSTLNKDFALWNEEIFSTFSEISEKLNGT 403

>Suva_5.150 Chr5 complement(223538..224713) [1176 bp, 391 aa] {ON}
           YER048C (REAL)
          Length = 391

 Score = 33.9 bits (76), Expect = 0.82,   Method: Compositional matrix adjust.
 Identities = 30/109 (27%), Positives = 55/109 (50%), Gaps = 14/109 (12%)

Query: 63  YVRSESVRDKLSKEQQRRLITEDNEHQRIEDLVREFQDITLRLNE------LATAPNEVA 116
           Y+R    +D+LSKEQ+++L+  + E +R ED++++  ++ ++LNE      +A   N + 
Sbjct: 151 YMR----KDRLSKEQRKKLL--EMERKRREDMMKQVDELAVKLNEKISRYLIAVKANNLE 204

Query: 117 NDSPQ-SQSTRS-SLESFQPRPLKIIERQRLCMVTPSKPPKKSVGFNPI 163
             + +  Q      LESF    L ++ R            KK+ GF+ I
Sbjct: 205 EFTRKLDQEIEDLKLESFGLELLYLLARVYKTKANNFIMSKKTYGFSKI 253

>CAGL0D01672g Chr4 complement(173338..176382) [3045 bp, 1014 aa]
           {ON} similar to uniprot|P32855 Saccharomyces cerevisiae
           YPR055w SEC8 transport protein
          Length = 1014

 Score = 33.5 bits (75), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 38/160 (23%), Positives = 68/160 (42%), Gaps = 35/160 (21%)

Query: 3   TQALEDITERLLIRSQEAILQLDLWIQRQQRSSVCQTTDQELLDKVSKQYNQYMSQLNSL 62
           TQA+  IT     +SQ+ IL+L   ++      V   +D E L+  S +YNQ +  LNS+
Sbjct: 109 TQAVNAIT-----KSQQKILELKDSVREANHKFVLDKSDLEDLNNQSLKYNQVIEDLNSI 163

Query: 63  ------------YVRSESVRDK---------LSKEQQRRLIT---------EDNEHQRIE 92
                       ++R ++ RD          L+  Q  + ++         E  EH    
Sbjct: 164 EKLIQYPDIIEEHIRGKNYRDARILLEKGFLLAGSQTLKDVSAIKPLVQQLELQEHVLFN 223

Query: 93  DLVREFQDITLRLNELATAPNEVANDSPQSQSTRSSLESF 132
            ++ E  +I    N+ +   NE+      +Q+  S+LE++
Sbjct: 224 TIIEEIHNILYSKNDDSFVTNEIGRMVGTAQTNFSTLENY 263

>Skud_5.158 Chr5 complement(244775..245950) [1176 bp, 391 aa] {ON}
           YER048C (REAL)
          Length = 391

 Score = 33.1 bits (74), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 16/38 (42%), Positives = 29/38 (76%), Gaps = 2/38 (5%)

Query: 70  RDKLSKEQQRRLITEDNEHQRIEDLVREFQDITLRLNE 107
           +DKLSKEQ+ +L+  + E +R ED++++  ++T +LNE
Sbjct: 154 KDKLSKEQREKLL--EMEKKRREDMMKQVDELTEKLNE 189

>KNAG0L01330 Chr12 complement(239806..240996) [1191 bp, 396 aa] {ON}
           Anc_7.217 YER048C
          Length = 396

 Score = 32.3 bits (72), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 30/102 (29%), Positives = 52/102 (50%), Gaps = 10/102 (9%)

Query: 70  RDKLSKEQQRRLITEDNEHQRIEDLVREFQDITLRLNE------LATAPNEVAN-DSPQS 122
           R+KL+KEQ+ +L+  + E +R EDL ++  D+T +LNE      +A   N + + ++   
Sbjct: 159 RNKLTKEQREKLM--ELEKRRREDLEKQVVDLTKKLNERLEKYLIAVKENHLKDFEAKLK 216

Query: 123 QSTRS-SLESFQPRPLKIIERQRLCMVTPSKPPKKSVGFNPI 163
           Q      LESF    L ++ +            KK++GF+ I
Sbjct: 217 QEIEDLKLESFGIELLYLLAKVYKTKAHDYLLSKKTMGFSKI 258

>Ecym_5067 Chr5 complement(146782..151458) [4677 bp, 1558 aa] {ON}
           similar to Ashbya gossypii ADR354W
          Length = 1558

 Score = 32.3 bits (72), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 23/77 (29%), Positives = 41/77 (53%), Gaps = 6/77 (7%)

Query: 322 PRRNGVHAPSSKALLSSFIGRS----ERPMVKQNTPNLKHVSLLD-KFNSSLTTISESFQ 376
           PR++ VH   S  ++ S + R     +  ++KQ   ++ H+  +  K  + +  ++ES  
Sbjct: 893 PRKSYVHYKKSTIVVQSLVRRRFAKRQLDVLKQEAKSVNHLKEVSYKLENKVIELTESLA 952

Query: 377 SKKKKNKDLNDERISSL 393
           +K K+NKDLN  RI  L
Sbjct: 953 AKVKENKDLN-ARIKEL 968

>Smik_5.173 Chr5 complement(251699..252874) [1176 bp, 391 aa] {ON}
           YER048C (REAL)
          Length = 391

 Score = 32.0 bits (71), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 17/44 (38%), Positives = 33/44 (75%), Gaps = 3/44 (6%)

Query: 65  RSESVR-DKLSKEQQRRLITEDNEHQRIEDLVREFQDITLRLNE 107
           ++ES++ DKLSKEQ+ +L+  + E +R ED++++  ++  +LNE
Sbjct: 148 KAESLKKDKLSKEQREKLL--EMERKRREDMMKQVDELAEKLNE 189

>YER048C Chr5 complement(246982..248157) [1176 bp, 391 aa] {ON}
           CAJ1Nuclear type II J heat shock protein of the E. coli
           dnaJ family, contains a leucine zipper-like motif, binds
           to non-native substrates for presentation to Ssa3p, may
           function during protein translocation, assembly and
           disassembly
          Length = 391

 Score = 31.6 bits (70), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 17/44 (38%), Positives = 33/44 (75%), Gaps = 3/44 (6%)

Query: 65  RSESVR-DKLSKEQQRRLITEDNEHQRIEDLVREFQDITLRLNE 107
           ++ES++ DKLSKEQ+ +L+  + E +R ED++++  ++  +LNE
Sbjct: 148 KAESLKKDKLSKEQREKLM--EMEKKRREDMMKQVDELAEKLNE 189

>NCAS0F02020 Chr6 (402424..404778) [2355 bp, 784 aa] {ON} Anc_5.56
           YHR182W
          Length = 784

 Score = 31.2 bits (69), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 36/109 (33%), Positives = 54/109 (49%), Gaps = 20/109 (18%)

Query: 81  LITEDNEHQRIEDLVREFQDITLRLNELATAPNEVANDSPQSQSTRSSLESFQPRPLKII 140
           L T +   Q +E L+ E QD            +E A+ SP+S++   S+E   P P+ +I
Sbjct: 676 LFTNEKIIQDLERLLTERQD---------PESSEQASVSPKSRT--RSIEELAPAPIILI 724

Query: 141 ERQ----RLCMVTPSKPPKKSVGFNPINDVDC---PSKTNSLPCSPKKQ 182
           ++     R  ++T   P KKS+    IND D    P KTNS P SP+ +
Sbjct: 725 DKADSQTRTPVMTMHSPDKKSLL--DINDEDFVPKPFKTNSTPPSPQGK 771

>NDAI0G00270 Chr7 (41767..45216) [3450 bp, 1149 aa] {ON} Anc_1.487
           YEL043W
          Length = 1149

 Score = 31.2 bits (69), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 31/119 (26%), Positives = 51/119 (42%), Gaps = 13/119 (10%)

Query: 29  QRQQRSSVCQTTDQELLDKVSKQYNQYMSQLNSLYVRSESVRDKLSKEQQ---RRLITED 85
           Q  +RS +     +ELL K S   N  + QL         +RD+L  +Q+   +  I   
Sbjct: 542 QTLERSGLLTNYGEELLSKFSANNNSMLVQL---------IRDQLKIDQELDSKAKIRRS 592

Query: 86  NEHQRIEDLVREFQDITL-RLNELATAPNEVANDSPQSQSTRSSLESFQPRPLKIIERQ 143
              +RIE L   F DI++   N +AT   +  N++P +    S      P P  ++  +
Sbjct: 593 RMTKRIEYLENNFNDISINNRNLMATLIAQPYNNNPPATVNTSQSRDHYPPPTNLLSSE 651

>SAKL0D05588g Chr4 (448828..452427) [3600 bp, 1199 aa] {ON} similar
           to uniprot|P12954 Saccharomyces cerevisiae YJL092W HPR5
           DNA helicase and DNA-dependent ATPase involved in DNA
           repair required for proper timing of commitment to
           meiotic recombination and the transition from Meiosis I
           to Meiosis II potential Cdc28p substrate
          Length = 1199

 Score = 31.2 bits (69), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 23/64 (35%), Positives = 35/64 (54%), Gaps = 3/64 (4%)

Query: 27  WIQRQQRSSVCQTTDQEL-LDKVSKQYNQYMSQLNSLYVRSESVRDKLSKEQQRRLITED 85
           W  R+QRS+   T D+EL +  +     Q+++ +N LY  SE   D+L K +Q R  +E 
Sbjct: 608 WANREQRSNAPSTNDEELPVVDIQDVLRQFINSIN-LY-SSEIESDELQKTEQERKESEA 665

Query: 86  NEHQ 89
            E Q
Sbjct: 666 REKQ 669

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.312    0.126    0.352 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 44,008,610
Number of extensions: 1943528
Number of successful extensions: 8853
Number of sequences better than 10.0: 161
Number of HSP's gapped: 9178
Number of HSP's successfully gapped: 164
Length of query: 425
Length of database: 53,481,399
Length adjustment: 112
Effective length of query: 313
Effective length of database: 40,638,807
Effective search space: 12719946591
Effective search space used: 12719946591
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 67 (30.4 bits)