Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Smik_3.121.3ON36036018420.0
YCL064C (CHA1)1.3ON36036016770.0
Skud_3.11.3ON36036016550.0
Suva_3.1501.3ON36136115830.0
NCAS0B091301.3ON36734313450.0
KNAG0C001801.3ON35934012921e-179
NDAI0A001201.3ON37734112771e-176
KAFR0D001101.3ON36536012471e-172
TPHA0E040401.3ON35733712271e-169
Kpol_2002.61.3ON35034812191e-168
CAGL0B00286g1.3ON36033411611e-159
TBLA0A049201.3ON36035811581e-158
ZYRO0F15774gsingletonON41036011441e-155
KAFR0I00130singletonON34434310931e-149
KAFR0F04430singletonON34333610861e-148
NCAS0A15330singletonON34734110811e-147
SAKL0C00418g1.3ON36433110321e-139
NDAI0K02950singletonON33432810031e-135
ZYRO0F18524g1.3ON3353399271e-124
KNAG0D05380singletonON3343299211e-123
KLTH0F00440g1.3ON3413318981e-119
AFR747W1.3ON4263419021e-119
Ecym_10061.3ON3643458941e-118
KLLA0C00440g1.3ON3773268941e-118
SAKL0C13904gsingletonON3393248891e-118
Smik_9.2na 1ON3383268791e-116
Scer_YGOB_SDL1 (SDL1)na 1ON3373318611e-114
Skud_9.2na 1ON3393258421e-111
TDEL0D06540singletonON3373338211e-108
KLLA0E01805gsingletonON3223217841e-102
KNAG0A01150singletonON2312236283e-80
YIL167W (SDL1)singletonOFF2101975951e-75
YIL168WsingletonOFF1271222772e-29
SAKL0F11858g7.367ON5622591763e-13
KAFR0K017007.367ON5792281579e-11
CAGL0I05126g7.367ON5712641551e-10
NCAS0A142307.367ON5692641523e-10
Kpol_530.167.367ON5662591514e-10
Suva_5.1997.367ON5762591506e-10
NDAI0A018107.367ON5702591481e-09
TPHA0F031307.367ON5682641471e-09
SAKL0A10626gsingletonON3203141451e-09
Skud_5.2057.367ON5762591471e-09
YER086W (ILV1)7.367ON5762591471e-09
Smik_5.2257.367ON5762591452e-09
ZYRO0B02772g7.367ON5692591453e-09
TDEL0C018007.367ON5692641434e-09
Ecym_47087.367ON5702861417e-09
KLLA0E19779g7.367ON5672641417e-09
ACR232C7.367ON5602591401e-08
KNAG0C036907.367ON5772641382e-08
TBLA0C050707.367ON5752811302e-07
YKL218C (SRY1)na 2ON3263171282e-07
Kwal_33.148227.367ON5622641203e-06
KLTH0B04884g7.367ON5732641151e-05
Skud_11.2na 2ON3263181085e-05
Kwal_26.75184.69ON493200900.015
TBLA0E015804.69ON506305860.044
KLTH0D04092g4.69ON493200820.12
TDEL0F028104.69ON497128770.43
TBLA0B072402.343ON379123740.93
KLLA0F09317g4.69ON493219741.2
Smik_11.3na 2ON269223721.6
AEL161Wna 3ON35656712.1
Ecym_80227.273ON47078712.4
NCAS0I011203.357ON15986683.2
Suva_12.1787.462ON1086197686.9
SAKL0H23364g4.69ON495197677.4
KAFR0I012304.69ON507201677.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Smik_3.12
         (360 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Smik_3.12 Chr3 complement(17223..18305) [1083 bp, 360 aa] {ON} Y...   714   0.0  
YCL064C Chr3 complement(15798..16880) [1083 bp, 360 aa] {ON}  CH...   650   0.0  
Skud_3.1 Chr3 complement(3828..4910) [1083 bp, 360 aa] {ON} YCL0...   642   0.0  
Suva_3.150 Chr3 complement(225656..226741) [1086 bp, 361 aa] {ON...   614   0.0  
NCAS0B09130 Chr2 (1751219..1752322) [1104 bp, 367 aa] {ON} Anc_1.3    522   0.0  
KNAG0C00180 Chr3 complement(27151..28230) [1080 bp, 359 aa] {ON}...   502   e-179
NDAI0A00120 Chr1 complement(4652..5785) [1134 bp, 377 aa] {ON} A...   496   e-176
KAFR0D00110 Chr4 complement(7211..8308) [1098 bp, 365 aa] {ON} A...   484   e-172
TPHA0E04040 Chr5 (846219..847292) [1074 bp, 357 aa] {ON} Anc_1.3...   477   e-169
Kpol_2002.6 s2002 complement(7840..8892) [1053 bp, 350 aa] {ON} ...   474   e-168
CAGL0B00286g Chr2 complement(12803..13885) [1083 bp, 360 aa] {ON...   451   e-159
TBLA0A04920 Chr1 complement(1214344..1215426) [1083 bp, 360 aa] ...   450   e-158
ZYRO0F15774g Chr6 (1300486..1301718) [1233 bp, 410 aa] {ON} simi...   445   e-155
KAFR0I00130 Chr9 complement(26703..27737) [1035 bp, 344 aa] {ON}...   425   e-149
KAFR0F04430 Chr6 (868691..869722) [1032 bp, 343 aa] {ON}              422   e-148
NCAS0A15330 Chr1 (3015596..3016639) [1044 bp, 347 aa] {ON}            421   e-147
SAKL0C00418g Chr3 complement(37529..38623) [1095 bp, 364 aa] {ON...   402   e-139
NDAI0K02950 Chr11 (671102..672106) [1005 bp, 334 aa] {ON}             390   e-135
ZYRO0F18524g Chr6 (1528741..1529748) [1008 bp, 335 aa] {ON} simi...   361   e-124
KNAG0D05380 Chr4 complement(986308..987312) [1005 bp, 334 aa] {O...   359   e-123
KLTH0F00440g Chr6 complement(34215..35240) [1026 bp, 341 aa] {ON...   350   e-119
AFR747W Chr6 (1808016..1809296) [1281 bp, 426 aa] {ON} Syntenic ...   352   e-119
Ecym_1006 Chr1 complement(9635..10729) [1095 bp, 364 aa] {ON} si...   348   e-118
KLLA0C00440g Chr3 complement(32008..33141) [1134 bp, 377 aa] {ON...   348   e-118
SAKL0C13904g Chr3 (1223973..1224992) [1020 bp, 339 aa] {ON} simi...   347   e-118
Smik_9.2 Chr9 (6779..7795) [1017 bp, 338 aa] {ON} YCL064C (REAL)      343   e-116
Scer_YGOB_SDL1 Chr9 (29032..29411,29415..30048) [1014 bp, 337 aa...   336   e-114
Skud_9.2 Chr9 (5919..6938) [1020 bp, 339 aa] {ON} YCL064C (REAL)      328   e-111
TDEL0D06540 Chr4 (1175562..1176575) [1014 bp, 337 aa] {ON}            320   e-108
KLLA0E01805g Chr5 complement(173125..174093) [969 bp, 322 aa] {O...   306   e-102
KNAG0A01150 Chr1 (6346..7041) [696 bp, 231 aa] {ON}                   246   3e-80
YIL167W Chr9 (29416..30048) [633 bp, 210 aa] {OFF}  SDL1Open rea...   233   1e-75
YIL168W Chr9 (29032..29415) [384 bp, 127 aa] {OFF} Open reading ...   111   2e-29
SAKL0F11858g Chr6 (920767..922455) [1689 bp, 562 aa] {ON} highly...    72   3e-13
KAFR0K01700 Chr11 (352943..354682) [1740 bp, 579 aa] {ON} Anc_7....    65   9e-11
CAGL0I05126g Chr9 complement(481145..482860) [1716 bp, 571 aa] {...    64   1e-10
NCAS0A14230 Chr1 (2801647..2803356) [1710 bp, 569 aa] {ON} Anc_7...    63   3e-10
Kpol_530.16 s530 complement(41170..42870) [1701 bp, 566 aa] {ON}...    63   4e-10
Suva_5.199 Chr5 (303073..304803) [1731 bp, 576 aa] {ON} YER086W ...    62   6e-10
NDAI0A01810 Chr1 complement(400890..402602) [1713 bp, 570 aa] {O...    62   1e-09
TPHA0F03130 Chr6 complement(685292..686998) [1707 bp, 568 aa] {O...    61   1e-09
SAKL0A10626g Chr1 complement(932879..933841) [963 bp, 320 aa] {O...    60   1e-09
Skud_5.205 Chr5 (322688..324418) [1731 bp, 576 aa] {ON} YER086W ...    61   1e-09
YER086W Chr5 (328477..330207) [1731 bp, 576 aa] {ON}  ILV1Threon...    61   1e-09
Smik_5.225 Chr5 (337064..338794) [1731 bp, 576 aa] {ON} YER086W ...    60   2e-09
ZYRO0B02772g Chr2 (224426..226135) [1710 bp, 569 aa] {ON} highly...    60   3e-09
TDEL0C01800 Chr3 complement(313699..315408) [1710 bp, 569 aa] {O...    60   4e-09
Ecym_4708 Chr4 (1386138..1387850) [1713 bp, 570 aa] {ON} similar...    59   7e-09
KLLA0E19779g Chr5 complement(1760800..1762503) [1704 bp, 567 aa]...    59   7e-09
ACR232C Chr3 complement(767330..769012) [1683 bp, 560 aa] {ON} S...    59   1e-08
KNAG0C03690 Chr3 complement(722238..723971) [1734 bp, 577 aa] {O...    58   2e-08
TBLA0C05070 Chr3 (1230732..1232459) [1728 bp, 575 aa] {ON} Anc_7...    55   2e-07
YKL218C Chr11 complement(17359..18339) [981 bp, 326 aa] {ON}  SR...    54   2e-07
Kwal_33.14822 s33 complement(830029..831717) [1689 bp, 562 aa] {...    51   3e-06
KLTH0B04884g Chr2 (400193..401914) [1722 bp, 573 aa] {ON} highly...    49   1e-05
Skud_11.2 Chr11 complement(1812..2792) [981 bp, 326 aa] {ON} YKL...    46   5e-05
Kwal_26.7518 s26 (398913..400394) [1482 bp, 493 aa] {ON} YGR155W...    39   0.015
TBLA0E01580 Chr5 (373152..374672) [1521 bp, 506 aa] {ON} Anc_4.6...    38   0.044
KLTH0D04092g Chr4 (391381..392862) [1482 bp, 493 aa] {ON} highly...    36   0.12 
TDEL0F02810 Chr6 (511257..512750) [1494 bp, 497 aa] {ON} Anc_4.6...    34   0.43 
TBLA0B07240 Chr2 complement(1716738..1717877) [1140 bp, 379 aa] ...    33   0.93 
KLLA0F09317g Chr6 (861757..863238) [1482 bp, 493 aa] {ON} simila...    33   1.2  
Smik_11.3 Chr11 complement(1725..2534) [810 bp, 269 aa] {ON} YKL...    32   1.6  
AEL161W Chr5 (329283..330353) [1071 bp, 356 aa] {ON} Non-synteni...    32   2.1  
Ecym_8022 Chr8 complement(57006..58418) [1413 bp, 470 aa] {ON} s...    32   2.4  
NCAS0I01120 Chr9 complement(205511..205990) [480 bp, 159 aa] {ON...    31   3.2  
Suva_12.178 Chr12 complement(273386..276646) [3261 bp, 1086 aa] ...    31   6.9  
SAKL0H23364g Chr8 complement(2023937..2025424) [1488 bp, 495 aa]...    30   7.4  
KAFR0I01230 Chr9 (242855..244378) [1524 bp, 507 aa] {ON} Anc_4.6...    30   7.5  

>Smik_3.12 Chr3 complement(17223..18305) [1083 bp, 360 aa] {ON}
           YCL064C (REAL)
          Length = 360

 Score =  714 bits (1842), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 345/360 (95%), Positives = 345/360 (95%)

Query: 1   MSIVYNKTPLLRQFFPGKSPAQFFLKYECLQPSGSFKSRGIGNLIMKSAIRIQKDGKKSP 60
           MSIVYNKTPLLRQFFPGKSPAQFFLKYECLQPSGSFKSRGIGNLIMKSAIRIQKDGKKSP
Sbjct: 1   MSIVYNKTPLLRQFFPGKSPAQFFLKYECLQPSGSFKSRGIGNLIMKSAIRIQKDGKKSP 60

Query: 61  QIXXXXXXXXXXXXXXXCQRLSLPCTVVVPTATKKRMVEKIRNTGAQVIVSGAYWKEADT 120
           QI               CQRLSLPCTVVVPTATKKRMVEKIRNTGAQVIVSGAYWKEADT
Sbjct: 61  QIFASSGGNAGFAAATACQRLSLPCTVVVPTATKKRMVEKIRNTGAQVIVSGAYWKEADT 120

Query: 121 FLKADVMQKIDTQVVEPIYVHPFDNPDIWEGHSSMVDEMVQDLEFQRISMNKVKGIVCSV 180
           FLKADVMQKIDTQVVEPIYVHPFDNPDIWEGHSSMVDEMVQDLEFQRISMNKVKGIVCSV
Sbjct: 121 FLKADVMQKIDTQVVEPIYVHPFDNPDIWEGHSSMVDEMVQDLEFQRISMNKVKGIVCSV 180

Query: 181 GGGGLYNGIVQGLERYGLADKIPIVGVETNGCHVFNTSLRIGQPVQFKKITSIATSLGTA 240
           GGGGLYNGIVQGLERYGLADKIPIVGVETNGCHVFNTSLRIGQPVQFKKITSIATSLGTA
Sbjct: 181 GGGGLYNGIVQGLERYGLADKIPIVGVETNGCHVFNTSLRIGQPVQFKKITSIATSLGTA 240

Query: 241 VISNQTFDYARKYNTRSVVIEDKDVIDTCLKYTHQFNMVVEPACGAALHLGYNTEILERA 300
           VISNQTFDYARKYNTRSVVIEDKDVIDTCLKYTHQFNMVVEPACGAALHLGYNTEILERA
Sbjct: 241 VISNQTFDYARKYNTRSVVIEDKDVIDTCLKYTHQFNMVVEPACGAALHLGYNTEILERA 300

Query: 301 LGSKLAADDIVIIIACGGSSNTIQDLEEALDHFNKRSAPAIEVTDNFIFPEKTTATLKSA 360
           LGSKLAADDIVIIIACGGSSNTIQDLEEALDHFNKRSAPAIEVTDNFIFPEKTTATLKSA
Sbjct: 301 LGSKLAADDIVIIIACGGSSNTIQDLEEALDHFNKRSAPAIEVTDNFIFPEKTTATLKSA 360

>YCL064C Chr3 complement(15798..16880) [1083 bp, 360 aa] {ON}
           CHA1Catabolic L-serine (L-threonine) deaminase,
           catalyzes the degradation of both L-serine and
           L-threonine; required to use serine or threonine as the
           sole nitrogen source, transcriptionally induced by
           serine and threonine
          Length = 360

 Score =  650 bits (1677), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 308/360 (85%), Positives = 328/360 (91%)

Query: 1   MSIVYNKTPLLRQFFPGKSPAQFFLKYECLQPSGSFKSRGIGNLIMKSAIRIQKDGKKSP 60
           MSIVYNKTPLLRQFFPGK+ AQFFLKYECLQPSGSFKSRGIGNLIMKSAIRIQKDGK+SP
Sbjct: 1   MSIVYNKTPLLRQFFPGKASAQFFLKYECLQPSGSFKSRGIGNLIMKSAIRIQKDGKRSP 60

Query: 61  QIXXXXXXXXXXXXXXXCQRLSLPCTVVVPTATKKRMVEKIRNTGAQVIVSGAYWKEADT 120
           Q+               CQRLSLPCTVVVPTATKKRMV+KIRNTGAQVIVSGAYWKEADT
Sbjct: 61  QVFASSGGNAGFAAATACQRLSLPCTVVVPTATKKRMVDKIRNTGAQVIVSGAYWKEADT 120

Query: 121 FLKADVMQKIDTQVVEPIYVHPFDNPDIWEGHSSMVDEMVQDLEFQRISMNKVKGIVCSV 180
           FLK +VM KID+QV+EPIYVHPFDNPDIWEGHSSM+DE+VQDL+ Q IS+NKVKGIVCSV
Sbjct: 121 FLKTNVMNKIDSQVIEPIYVHPFDNPDIWEGHSSMIDEIVQDLKSQHISVNKVKGIVCSV 180

Query: 181 GGGGLYNGIVQGLERYGLADKIPIVGVETNGCHVFNTSLRIGQPVQFKKITSIATSLGTA 240
           GGGGLYNGI+QGLERYGLAD+IPIVGVETNGCHVFNTSL+IGQPVQFKKITSIATSLGTA
Sbjct: 181 GGGGLYNGIIQGLERYGLADRIPIVGVETNGCHVFNTSLKIGQPVQFKKITSIATSLGTA 240

Query: 241 VISNQTFDYARKYNTRSVVIEDKDVIDTCLKYTHQFNMVVEPACGAALHLGYNTEILERA 300
           VISNQTF+YARKYNTRSVVIEDKDVI+TCLKYTHQFNMV+EPACGAALHLGYNT+ILE A
Sbjct: 241 VISNQTFEYARKYNTRSVVIEDKDVIETCLKYTHQFNMVIEPACGAALHLGYNTKILENA 300

Query: 301 LGSKLAADDIVIIIACGGSSNTIQDLEEALDHFNKRSAPAIEVTDNFIFPEKTTATLKSA 360
           LGSKLAADDIVIIIACGGSSNTI+DLEEALD   K+  P IEV DNFIFPEK    LKSA
Sbjct: 301 LGSKLAADDIVIIIACGGSSNTIKDLEEALDSMRKKDTPVIEVADNFIFPEKNIVNLKSA 360

>Skud_3.1 Chr3 complement(3828..4910) [1083 bp, 360 aa] {ON} YCL064C
           (REAL)
          Length = 360

 Score =  642 bits (1655), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 305/360 (84%), Positives = 327/360 (90%)

Query: 1   MSIVYNKTPLLRQFFPGKSPAQFFLKYECLQPSGSFKSRGIGNLIMKSAIRIQKDGKKSP 60
           MSIVYNKTPLLRQFFP KSPAQFFLKYECLQPSGSFKSRGIGNLI+K+AIRIQKDG++SP
Sbjct: 1   MSIVYNKTPLLRQFFPSKSPAQFFLKYECLQPSGSFKSRGIGNLILKNAIRIQKDGRRSP 60

Query: 61  QIXXXXXXXXXXXXXXXCQRLSLPCTVVVPTATKKRMVEKIRNTGAQVIVSGAYWKEADT 120
           Q+               CQRLSLPCTVVVPTATKKRMVEKIRNTGAQVIV+GAYWKEADT
Sbjct: 61  QVFASSGGNAGLAAATTCQRLSLPCTVVVPTATKKRMVEKIRNTGAQVIVNGAYWKEADT 120

Query: 121 FLKADVMQKIDTQVVEPIYVHPFDNPDIWEGHSSMVDEMVQDLEFQRISMNKVKGIVCSV 180
           FLKA++M +ID+QVVEPIYVHPFDNPDIWEGHSSMVDE+VQDL+ QRISMNKVKGIVCSV
Sbjct: 121 FLKANIMNQIDSQVVEPIYVHPFDNPDIWEGHSSMVDEIVQDLKSQRISMNKVKGIVCSV 180

Query: 181 GGGGLYNGIVQGLERYGLADKIPIVGVETNGCHVFNTSLRIGQPVQFKKITSIATSLGTA 240
           GGGGLYNGI+QGLERY LADKIPIVGVETNGCHVFNTSLRIGQPVQFKKITSIATSLGTA
Sbjct: 181 GGGGLYNGIIQGLERYHLADKIPIVGVETNGCHVFNTSLRIGQPVQFKKITSIATSLGTA 240

Query: 241 VISNQTFDYARKYNTRSVVIEDKDVIDTCLKYTHQFNMVVEPACGAALHLGYNTEILERA 300
           VISNQTF+YA KYNT+SVVIEDKDVI+TCLKYTHQ NMV EPACGAALHLGY+TEILE+A
Sbjct: 241 VISNQTFEYAHKYNTKSVVIEDKDVIETCLKYTHQCNMVAEPACGAALHLGYHTEILEKA 300

Query: 301 LGSKLAADDIVIIIACGGSSNTIQDLEEALDHFNKRSAPAIEVTDNFIFPEKTTATLKSA 360
           LGSKLAADDIVIIIACGGSSNT+QDLEE L+   K+  PAIE  DNFIF EKT+  LKSA
Sbjct: 301 LGSKLAADDIVIIIACGGSSNTVQDLEETLEDLKKQGLPAIETADNFIFVEKTSTILKSA 360

>Suva_3.150 Chr3 complement(225656..226741) [1086 bp, 361 aa] {ON}
           YCL064C (REAL)
          Length = 361

 Score =  614 bits (1583), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 292/361 (80%), Positives = 321/361 (88%), Gaps = 1/361 (0%)

Query: 1   MSIVYNKTPLLRQFFPGKSPAQFFLKYECLQPSGSFKSRGIGNLIMKSAIRIQKDGKKSP 60
           MSIVYNKTPLLRQFFPGKS AQF+LKYECLQPSGSFKSRGIGNLI+K+AIRIQK+GK+SP
Sbjct: 1   MSIVYNKTPLLRQFFPGKSLAQFYLKYECLQPSGSFKSRGIGNLILKNAIRIQKNGKRSP 60

Query: 61  QIXXXXXXXXXXXXXXXCQRLSLPCTVVVPTATKKRMVEKIRNTGAQVIVSGAYWKEADT 120
           Q+               CQRLSLPCTVVVPTATK+RMVEKIRNTGAQVIV+GA+WKEADT
Sbjct: 61  QVFASSGGNAGFAAATACQRLSLPCTVVVPTATKERMVEKIRNTGAQVIVNGAFWKEADT 120

Query: 121 FLKADVMQKIDTQVVEPIYVHPFDNPDIWEGHSSMVDEMVQDLEFQRISMNKVKGIVCSV 180
           +LK +VM  ID Q VEPIYVHPFDNPDIWEGHSSMVDE+VQDL+ QR+ M KVKGIVCSV
Sbjct: 121 YLKTNVMNLIDHQAVEPIYVHPFDNPDIWEGHSSMVDEIVQDLKSQRVPMEKVKGIVCSV 180

Query: 181 GGGGLYNGIVQGLERYGLADKIPIVGVETNGCHVFNTSLRIGQPVQFKKITSIATSLGTA 240
           GGGGLYNGI+QGLER+GLADKIPIVGVET GCHVFNTSLRIGQPVQFKKITSIATSLGTA
Sbjct: 181 GGGGLYNGIIQGLERHGLADKIPIVGVETKGCHVFNTSLRIGQPVQFKKITSIATSLGTA 240

Query: 241 VISNQTFDYARKYNTRSVVIEDKDVIDTCLKYTHQFNMVVEPACGAALHLGYNTEILERA 300
            ISNQTF+YARKYNT+SVV+EDKDVI+TCLKY+HQFNMV EPACGAALHLGY+T+ILE A
Sbjct: 241 NISNQTFEYARKYNTKSVVVEDKDVIETCLKYSHQFNMVTEPACGAALHLGYHTDILETA 300

Query: 301 LGSKLAADDIVIIIACGGSSNTIQDLEEALDHFNKRSAPAIEVTDNFIFPEKTTAT-LKS 359
           L +KLAADDIV+IIACGGSSNT+QDLEE L    K   PAIE+ DNFIFPEK ++T LKS
Sbjct: 301 LDTKLAADDIVLIIACGGSSNTVQDLEETLASMKKEGVPAIELADNFIFPEKISSTILKS 360

Query: 360 A 360
           A
Sbjct: 361 A 361

>NCAS0B09130 Chr2 (1751219..1752322) [1104 bp, 367 aa] {ON} Anc_1.3
          Length = 367

 Score =  522 bits (1345), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 246/343 (71%), Positives = 285/343 (83%), Gaps = 6/343 (1%)

Query: 1   MSIVYNKTPLLRQFFPGKS--PA----QFFLKYECLQPSGSFKSRGIGNLIMKSAIRIQK 54
           MSIVYNKTPLLRQFFP  S  P+    QFFLKYECLQPSGSFKSRGIGNLIMK+AIRI+K
Sbjct: 1   MSIVYNKTPLLRQFFPAVSTKPSTSIPQFFLKYECLQPSGSFKSRGIGNLIMKNAIRIKK 60

Query: 55  DGKKSPQIXXXXXXXXXXXXXXXCQRLSLPCTVVVPTATKKRMVEKIRNTGAQVIVSGAY 114
            G KSPQ+                QRLSLPCTVVVPTATK+RMVEKIR TGA VI++GA+
Sbjct: 61  SGNKSPQVFSSSGGNAGFAAATASQRLSLPCTVVVPTATKQRMVEKIRATGANVIINGAH 120

Query: 115 WKEADTFLKADVMQKIDTQVVEPIYVHPFDNPDIWEGHSSMVDEMVQDLEFQRISMNKVK 174
           WKEADT+LK+ VM  ID    EPIYVHPFDNPDIWEGHS+MVDE+V  L  Q I++NK+K
Sbjct: 121 WKEADTYLKSSVMNSIDLNTTEPIYVHPFDNPDIWEGHSTMVDEIVDTLNEQNIALNKIK 180

Query: 175 GIVCSVGGGGLYNGIVQGLERYGLADKIPIVGVETNGCHVFNTSLRIGQPVQFKKITSIA 234
           GIVCSVGGGGLYNGI+QGLE++ LADKIPIVGVET GCHVFNTSL++G+ ++F KITSIA
Sbjct: 181 GIVCSVGGGGLYNGIIQGLEKHKLADKIPIVGVETKGCHVFNTSLKLGKQIEFSKITSIA 240

Query: 235 TSLGTAVISNQTFDYARKYNTRSVVIEDKDVIDTCLKYTHQFNMVVEPACGAALHLGYNT 294
           TSLGTA IS+QTF+YA+KY+TRSVV+ED DVI+TCLKYT  FNMV EPACGA+LHL YNT
Sbjct: 241 TSLGTASISSQTFEYAKKYHTRSVVVEDTDVIETCLKYTQDFNMVAEPACGASLHLAYNT 300

Query: 295 EILERALGSKLAADDIVIIIACGGSSNTIQDLEEALDHFNKRS 337
            ILE ALG KL++DDI+++IACGGSSNT+QDLEE L    +++
Sbjct: 301 NILENALGHKLSSDDIILVIACGGSSNTVQDLEETLVRLREKA 343

>KNAG0C00180 Chr3 complement(27151..28230) [1080 bp, 359 aa] {ON}
           Anc_1.3 YCL064C
          Length = 359

 Score =  502 bits (1292), Expect = e-179,   Method: Compositional matrix adjust.
 Identities = 231/340 (67%), Positives = 277/340 (81%)

Query: 1   MSIVYNKTPLLRQFFPGKSPAQFFLKYECLQPSGSFKSRGIGNLIMKSAIRIQKDGKKSP 60
           MS+VYNKTPLLRQFFPGK+  Q FLKYECLQPSGSFKSRGIGNLI+K+A+RIQK G++  
Sbjct: 1   MSLVYNKTPLLRQFFPGKNLPQLFLKYECLQPSGSFKSRGIGNLILKNAMRIQKIGERRA 60

Query: 61  QIXXXXXXXXXXXXXXXCQRLSLPCTVVVPTATKKRMVEKIRNTGAQVIVSGAYWKEADT 120
            +               CQRLSLPCTVVVPTATK RMVEKIRNTGA+VIV+GA+WKEAD 
Sbjct: 61  HVFASSGGNAGFAAATACQRLSLPCTVVVPTATKTRMVEKIRNTGAKVIVNGAHWKEADQ 120

Query: 121 FLKADVMQKIDTQVVEPIYVHPFDNPDIWEGHSSMVDEMVQDLEFQRISMNKVKGIVCSV 180
            LK  VM +ID +  EPIYVHPFDNPDIWEGH+++VDE+++ L  Q+I    VKGIVCSV
Sbjct: 121 HLKKTVMSQIDLKTTEPIYVHPFDNPDIWEGHATLVDEIMETLNSQKIQTENVKGIVCSV 180

Query: 181 GGGGLYNGIVQGLERYGLADKIPIVGVETNGCHVFNTSLRIGQPVQFKKITSIATSLGTA 240
           GGGGLYNGI+QGLE++GLA+KIPIVGVET GCHV NTSL + + ++F+KITSIATSLGTA
Sbjct: 181 GGGGLYNGIMQGLEKHGLAEKIPIVGVETRGCHVLNTSLNLNKQIEFEKITSIATSLGTA 240

Query: 241 VISNQTFDYARKYNTRSVVIEDKDVIDTCLKYTHQFNMVVEPACGAALHLGYNTEILERA 300
            IS QTF+ A+KYNTRSVV++D  VI+TCLKYT  FNMV EPACGAALHL YN +ILE+A
Sbjct: 241 SISKQTFELAKKYNTRSVVVDDSKVIETCLKYTRDFNMVAEPACGAALHLAYNVDILEKA 300

Query: 301 LGSKLAADDIVIIIACGGSSNTIQDLEEALDHFNKRSAPA 340
           LG  L  +D++++IACGGSSNT++DLE+ L   N +S P+
Sbjct: 301 LGHSLTPNDVILVIACGGSSNTLKDLEDTLVTLNSKSIPS 340

>NDAI0A00120 Chr1 complement(4652..5785) [1134 bp, 377 aa] {ON}
           Anc_1.3
          Length = 377

 Score =  496 bits (1277), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 234/341 (68%), Positives = 278/341 (81%), Gaps = 11/341 (3%)

Query: 1   MSIVYNKTPLLRQFFP---GKSPA--------QFFLKYECLQPSGSFKSRGIGNLIMKSA 49
           MS+VYNKTPLLRQFF     KS A        QFF+KYECLQPSGSFKSRGIGNLI+KSA
Sbjct: 1   MSVVYNKTPLLRQFFQNSVAKSSATASVTATPQFFVKYECLQPSGSFKSRGIGNLILKSA 60

Query: 50  IRIQKDGKKSPQIXXXXXXXXXXXXXXXCQRLSLPCTVVVPTATKKRMVEKIRNTGAQVI 109
           + I K G+K+PQ+               CQRLSLPCTVVVPTATK+RMVEKI++TGA VI
Sbjct: 61  MNINKIGQKTPQVFASSGGNAGFAAATACQRLSLPCTVVVPTATKQRMVEKIKSTGANVI 120

Query: 110 VSGAYWKEADTFLKADVMQKIDTQVVEPIYVHPFDNPDIWEGHSSMVDEMVQDLEFQRIS 169
           ++GA+WKEAD FLK  +M KIDT  +EPIYVHPFDNP IWEGH++MVDE++  L  Q I 
Sbjct: 121 INGAHWKEADMFLKNSIMNKIDTNHIEPIYVHPFDNPLIWEGHATMVDEIMDSLNDQNIP 180

Query: 170 MNKVKGIVCSVGGGGLYNGIVQGLERYGLADKIPIVGVETNGCHVFNTSLRIGQPVQFKK 229
           +NKVKGIVCSVGGGGLYNGI+QGL++Y LADKIPIVGVET GCHVFNTSL++ + ++F K
Sbjct: 181 INKVKGIVCSVGGGGLYNGIIQGLQKYNLADKIPIVGVETKGCHVFNTSLKLNKQIEFSK 240

Query: 230 ITSIATSLGTAVISNQTFDYARKYNTRSVVIEDKDVIDTCLKYTHQFNMVVEPACGAALH 289
           ITSIATSLGTA IS +TF+YA+KY TRSVVIEDK+VI+TCLKYT  +NMVVEPACGA++H
Sbjct: 241 ITSIATSLGTANISKKTFEYAQKYKTRSVVIEDKNVIETCLKYTQDYNMVVEPACGASIH 300

Query: 290 LGYNTEILERALGSKLAADDIVIIIACGGSSNTIQDLEEAL 330
           L Y+T+ILE++LG KL +DDI+++IACGGSSNT  DLE  L
Sbjct: 301 LAYHTDILEKSLGHKLNSDDIILVIACGGSSNTTHDLESLL 341

>KAFR0D00110 Chr4 complement(7211..8308) [1098 bp, 365 aa] {ON}
           Anc_1.3 YCL064C
          Length = 365

 Score =  484 bits (1247), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 227/360 (63%), Positives = 277/360 (76%), Gaps = 6/360 (1%)

Query: 1   MSIVYNKTPLLRQFFPG------KSPAQFFLKYECLQPSGSFKSRGIGNLIMKSAIRIQK 54
           MS+VYNKTPLLRQFFPG       S  QFFLKYECLQPSGSFKSRGIGNLI+K A++I K
Sbjct: 1   MSVVYNKTPLLRQFFPGTKSRKSNSLPQFFLKYECLQPSGSFKSRGIGNLILKQAMQIHK 60

Query: 55  DGKKSPQIXXXXXXXXXXXXXXXCQRLSLPCTVVVPTATKKRMVEKIRNTGAQVIVSGAY 114
            G K P++               CQRLSLPCTVVVPTATK+RM+EKI++TGA VI+ GA+
Sbjct: 61  KGTKRPEVFASSGGNAGYAAAVACQRLSLPCTVVVPTATKQRMIEKIKDTGANVIIDGAF 120

Query: 115 WKEADTFLKADVMQKIDTQVVEPIYVHPFDNPDIWEGHSSMVDEMVQDLEFQRISMNKVK 174
           WKEAD +LK  VM KI+   ++PIYVHPFDNP IWEGHSS+VDE++  L  Q++  + +K
Sbjct: 121 WKEADQYLKKSVMNKINKNEIDPIYVHPFDNPLIWEGHSSIVDEIMDTLREQKVQPSNIK 180

Query: 175 GIVCSVGGGGLYNGIVQGLERYGLADKIPIVGVETNGCHVFNTSLRIGQPVQFKKITSIA 234
           GIVCSVGGGGLYNGI+QGLER+ L DKIP+VGVET GCHVFNTSL++G+ V+F+KITSIA
Sbjct: 181 GIVCSVGGGGLYNGIIQGLERHKLVDKIPVVGVETEGCHVFNTSLKLGKQVEFEKITSIA 240

Query: 235 TSLGTAVISNQTFDYARKYNTRSVVIEDKDVIDTCLKYTHQFNMVVEPACGAALHLGYNT 294
           TSL TA IS +TF+ A KY TRSV+++D DVI+TCLKYT  +NMV EPACGA++HL YN 
Sbjct: 241 TSLATASISAKTFENALKYGTRSVIVKDADVIETCLKYTKDYNMVTEPACGASIHLAYNI 300

Query: 295 EILERALGSKLAADDIVIIIACGGSSNTIQDLEEALDHFNKRSAPAIEVTDNFIFPEKTT 354
           +ILE ALG+KL  DD V++IACGGSSNT+QD+EE L         A+ + + F+   K T
Sbjct: 301 DILENALGTKLTKDDTVVVIACGGSSNTLQDMEETLLRLRSEENAAMTLPNPFLKVNKET 360

>TPHA0E04040 Chr5 (846219..847292) [1074 bp, 357 aa] {ON} Anc_1.3
           YCL064C
          Length = 357

 Score =  477 bits (1227), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 219/337 (64%), Positives = 269/337 (79%)

Query: 1   MSIVYNKTPLLRQFFPGKSPAQFFLKYECLQPSGSFKSRGIGNLIMKSAIRIQKDGKKSP 60
           MS VYNKTPLLR  FPGK+  Q FLKYEC QPSGSFKSRGIGNLI  +++ IQK+ KKSP
Sbjct: 1   MSQVYNKTPLLRHLFPGKNLPQVFLKYECFQPSGSFKSRGIGNLIQSTSLEIQKNSKKSP 60

Query: 61  QIXXXXXXXXXXXXXXXCQRLSLPCTVVVPTATKKRMVEKIRNTGAQVIVSGAYWKEADT 120
           ++                + LSLPCTVVVPTATK RMVEKI+ TGA VIV G +WKEADT
Sbjct: 61  EVFSSSGGNAGLAAATASKMLSLPCTVVVPTATKLRMVEKIKATGANVIVKGNHWKEADT 120

Query: 121 FLKADVMQKIDTQVVEPIYVHPFDNPDIWEGHSSMVDEMVQDLEFQRISMNKVKGIVCSV 180
           +LK +V+  ID +++EPIYVHPFDN  IWEGH++M+DE+V+    Q I + KVK IVCSV
Sbjct: 121 YLKTNVLSNIDKKLIEPIYVHPFDNKKIWEGHATMIDEIVETFGQQHIPIEKVKAIVCSV 180

Query: 181 GGGGLYNGIVQGLERYGLADKIPIVGVETNGCHVFNTSLRIGQPVQFKKITSIATSLGTA 240
           GGGGLYNGI+QGLE++ LA KIP+VGVET GCHVFNTSL++G+ +QF+KI +IATSLGTA
Sbjct: 181 GGGGLYNGIIQGLEKHDLATKIPVVGVETLGCHVFNTSLKMGKVIQFEKINTIATSLGTA 240

Query: 241 VISNQTFDYARKYNTRSVVIEDKDVIDTCLKYTHQFNMVVEPACGAALHLGYNTEILERA 300
            ISNQTF+YA+KYNT+S+V++D  V++TCLK+T   NMV EPACGAALH+GYN +ILE++
Sbjct: 241 NISNQTFEYAKKYNTKSIVVDDLKVVETCLKFTRDSNMVAEPACGAALHMGYNMDILEKS 300

Query: 301 LGSKLAADDIVIIIACGGSSNTIQDLEEALDHFNKRS 337
           LG KLA DDIV+IIACGGSSNT+Q+LE +L     +S
Sbjct: 301 LGKKLATDDIVLIIACGGSSNTVQELEASLTELKNKS 337

>Kpol_2002.6 s2002 complement(7840..8892) [1053 bp, 350 aa] {ON}
           complement(7840..8892) [1053 nt, 351 aa]
          Length = 350

 Score =  474 bits (1219), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 227/348 (65%), Positives = 280/348 (80%)

Query: 1   MSIVYNKTPLLRQFFPGKSPAQFFLKYECLQPSGSFKSRGIGNLIMKSAIRIQKDGKKSP 60
           MS+VYNKTPLL+ FFPGK+  QF+LKYE LQPSGSFKSRGIGNLI+K+AIRI+K   K P
Sbjct: 1   MSLVYNKTPLLKHFFPGKNLPQFYLKYESLQPSGSFKSRGIGNLILKNAIRIKKINVKKP 60

Query: 61  QIXXXXXXXXXXXXXXXCQRLSLPCTVVVPTATKKRMVEKIRNTGAQVIVSGAYWKEADT 120
            +                QRLSLPCTVVVPTATK+RMV+KIR TGA VI+ G +WKEAD 
Sbjct: 61  YVFSSSGGNAGLAAATASQRLSLPCTVVVPTATKERMVQKIRATGANVIIKGNHWKEADN 120

Query: 121 FLKADVMQKIDTQVVEPIYVHPFDNPDIWEGHSSMVDEMVQDLEFQRISMNKVKGIVCSV 180
           FLK ++M +I+   +EPIYVHPFDNP IWEGHS+MVDE+++    Q+ ++  +K IVCSV
Sbjct: 121 FLKQNIMNEINKDKIEPIYVHPFDNPLIWEGHSTMVDEIMETFSQQKFNIKNLKAIVCSV 180

Query: 181 GGGGLYNGIVQGLERYGLADKIPIVGVETNGCHVFNTSLRIGQPVQFKKITSIATSLGTA 240
           GGGGLYNGI+QGLE+Y LADKIP+VGVET GCHVFNTSL++ +PV+F KI++IATSLGTA
Sbjct: 181 GGGGLYNGIIQGLEKYNLADKIPVVGVETQGCHVFNTSLKLNKPVEFTKISTIATSLGTA 240

Query: 241 VISNQTFDYARKYNTRSVVIEDKDVIDTCLKYTHQFNMVVEPACGAALHLGYNTEILERA 300
            ISNQ FDYA+KYNT+SVV+EDKDV++TCLK+TH  NMV+EPACGAA+HLGY+T++LE A
Sbjct: 241 NISNQMFDYAKKYNTKSVVVEDKDVVETCLKFTHDHNMVIEPACGAAIHLGYHTDLLETA 300

Query: 301 LGSKLAADDIVIIIACGGSSNTIQDLEEALDHFNKRSAPAIEVTDNFI 348
           LG+KL  DD V+I+ACGGSSNT+++LE AL   N +S  A     +FI
Sbjct: 301 LGTKLTCDDAVLIVACGGSSNTVKELETALLELNLKSQKASPTIPSFI 348

>CAGL0B00286g Chr2 complement(12803..13885) [1083 bp, 360 aa] {ON}
           highly similar to uniprot|P25379 Saccharomyces
           cerevisiae YCL064c CHA1 L-serine/L-threonine deaminase
          Length = 360

 Score =  451 bits (1161), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 213/334 (63%), Positives = 264/334 (79%), Gaps = 5/334 (1%)

Query: 4   VYNKTPLLRQFFPGKSPAQFFLKYECLQPSGSFKSRGIGNLIMKSAIRIQKDG-KKSPQI 62
           VYNKTPL+RQ FP  S  Q +LK+EC QPSGSFKSRGIG+LI K + RI  +G  K P +
Sbjct: 3   VYNKTPLIRQIFP--SIPQMYLKHECFQPSGSFKSRGIGHLISKQSQRILGNGLGKKPMV 60

Query: 63  XXXXXXXXXXXXXXXCQRLSLPCTVVVPTATKKRMVEKIRNTGAQVIVSGAYWKEADTFL 122
                           + L+LPCTVV+PTATK+RM +KIR TGA VIVSG +WKEAD +L
Sbjct: 61  FASSGGNAGLAAATAAKFLNLPCTVVIPTATKQRMADKIRATGANVIVSGNFWKEADNYL 120

Query: 123 KADVMQKIDT--QVVEPIYVHPFDNPDIWEGHSSMVDEMVQDLEFQRISMNKVKGIVCSV 180
           K +++ K++   + VEPIYVHPFDNPDIWEGH+SMVDE+V+D + + I +NK+K IVCSV
Sbjct: 121 KDNILSKLEELHKNVEPIYVHPFDNPDIWEGHASMVDEIVEDFKNKMIPLNKIKAIVCSV 180

Query: 181 GGGGLYNGIVQGLERYGLADKIPIVGVETNGCHVFNTSLRIGQPVQFKKITSIATSLGTA 240
           GGGGLYNGI+QGLE+Y LADKIPIVGVET GCHVFNTSLR+ + V FKKITSIATSLGTA
Sbjct: 181 GGGGLYNGIIQGLEKYNLADKIPIVGVETKGCHVFNTSLRMNKVVSFKKITSIATSLGTA 240

Query: 241 VISNQTFDYARKYNTRSVVIEDKDVIDTCLKYTHQFNMVVEPACGAALHLGYNTEILERA 300
            IS + F YA++Y T+SVV+ D+DV+ TCL+YTH FNMV+EPACGAA+HL Y+TEILE+ 
Sbjct: 241 DISTEAFKYAKRYGTKSVVLSDQDVVKTCLRYTHDFNMVIEPACGAAVHLAYHTEILEKE 300

Query: 301 LGSKLAADDIVIIIACGGSSNTIQDLEEALDHFN 334
           LG+KL ADDIV+++ACGGSSNT++D+E  L   +
Sbjct: 301 LGTKLNADDIVLVVACGGSSNTVEDMESILQRLS 334

>TBLA0A04920 Chr1 complement(1214344..1215426) [1083 bp, 360 aa]
           {ON} Anc_1.3 YCL064C
          Length = 360

 Score =  450 bits (1158), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 215/358 (60%), Positives = 269/358 (75%), Gaps = 3/358 (0%)

Query: 1   MSIVYNKTPLLRQFFPGKSPAQFFLKYECLQPSGSFKSRGIGNLIMKSAIRIQKDG-KKS 59
           MSIVYNKTPLLRQFF G    QFFLKYEC+QPSGSFKSRGIGNLI+KS  +I      K 
Sbjct: 1   MSIVYNKTPLLRQFFRGSPIPQFFLKYECMQPSGSFKSRGIGNLILKSIDKINSSNLNKR 60

Query: 60  PQIXXXXXXXXXXXXXXXCQRLSLPCTVVVPTATKKRMVEKIRNTGAQVIVSGAYWKEAD 119
           PQ+                +RLS+PCTVVVPTATK+RMV KI++TGA+VIV+G +W EAD
Sbjct: 61  PQVFSSSGGNAGLAAATASRRLSIPCTVVVPTATKERMVNKIKDTGAKVIVNGGHWSEAD 120

Query: 120 TFLKADVMQKIDTQVVEPIYVHPFDNPDIWEGHSSMVDEMVQDLEFQRISMNKVKGIVCS 179
            +L+  V+ KID   +EPIYVHPFDNP IWEGHS+M+DE+++ L  Q I +  VK I CS
Sbjct: 121 DYLQNHVINKIDLNEIEPIYVHPFDNPLIWEGHSTMIDEIIESLNEQNIDIRNVKAITCS 180

Query: 180 VGGGGLYNGIVQGLERYGLADKIPIVGVETNGCHVFNTSLRIGQPVQFKKITSIATSLGT 239
           +GGGGLYNG+++GLE+Y LA KIPI+GVETNGC VFNTSL++ + V+F KI +IATSLGT
Sbjct: 181 IGGGGLYNGLIRGLEKYNLASKIPIIGVETNGCQVFNTSLKLKKLVKFPKINTIATSLGT 240

Query: 240 AVISNQTFDYARKYNTRSVVIEDKDVIDTCLKYTHQFNMVVEPACGAALHLGYNTEILER 299
           + IS +TF+ A KYNT+SVV+++ DVI TCL+YT+ FN V EPACGAALHL YNT ++E 
Sbjct: 241 STISAKTFENALKYNTKSVVVDNIDVIKTCLRYTYDFNQVAEPACGAALHLAYNTGLIEN 300

Query: 300 ALGSKLAADDIVIIIACGGSSNTIQDLEEALDHFNKRSAPAIEVTDNFIFPEKTTATL 357
           AL + L  DDI+I+IACGGSSNT+Q+LEEAL  +  +   ++  T  +IF E  T  L
Sbjct: 301 ALDTTLTKDDIIIVIACGGSSNTVQELEEALLKY--KLDYSLPQTPEYIFTENHTPIL 356

>ZYRO0F15774g Chr6 (1300486..1301718) [1233 bp, 410 aa] {ON} similar
           to uniprot|P25379 Saccharomyces cerevisiae YCL064C CHA1
           catabolism of hydroxy amino acids catabolic serine
           (threonine) dehydratase
          Length = 410

 Score =  445 bits (1144), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 204/360 (56%), Positives = 273/360 (75%), Gaps = 9/360 (2%)

Query: 1   MSIVYNKTPLLRQFFPGKSPAQFFLKYECLQPSGSFKSRGIGNLIMKSAIRIQKDGKKSP 60
           M  +YNKTPLL+Q F   + AQ F+KYECLQPSGSFKSRGIG+LI K A  IQ DG+KSP
Sbjct: 47  MPSIYNKTPLLKQIFNHATSAQVFVKYECLQPSGSFKSRGIGHLISKRAKDIQGDGRKSP 106

Query: 61  QIXXXXXXXXXXXXXXXCQRLSLPCTVVVPTATKKRMVEKIRNTGAQVIVSGAYWKEADT 120
            +                Q+L+LPCTVV+PT TK+RM +KIR  GA V+V G++WKEAD+
Sbjct: 107 HVFSSSGGNAGYAAAVAAQKLNLPCTVVIPTTTKQRMADKIRGCGANVVVQGSHWKEADS 166

Query: 121 FLKADVMQKIDTQVVEPIYVHPFDNPDIWEGHSSMVDEMVQDLEFQRISMNKVKGIVCSV 180
            LK  +  +++  ++EPIYVHPFDNP IWEGH+S+VDE++  L+ +  ++N+VKGIVCSV
Sbjct: 167 HLKNILQNQVNMAILEPIYVHPFDNPTIWEGHASIVDEIISSLKNENTALNRVKGIVCSV 226

Query: 181 GGGGLYNGIVQGLERYGLADKIPIVGVETNGCHVFNTSLRIGQPVQFKKITSIATSLGTA 240
           GGGGLYNGI+QGLE+Y LA+KIP++ VET GCHV NTSL++GQ V+F K+ S+ATSL T+
Sbjct: 227 GGGGLYNGIIQGLEKYNLANKIPLLAVETKGCHVLNTSLQVGQCVEFNKMNSVATSLCTS 286

Query: 241 VISNQTFDYARKYNTRSVVIEDKDVIDTCLKYTHQFNMVVEPACGAALHLGYNTEILERA 300
            IS++T DY +KY ++S+V+EDK+V+ TCLKY   FNM+ EPACGA+LHLGY+ +++ERA
Sbjct: 287 QISSRTLDYVQKYGSKSIVLEDKEVLQTCLKYAENFNMITEPACGASLHLGYHPQLIERA 346

Query: 301 LGSKLAADDIVIIIACGGSSNTIQDLEEAL------DHFNKR--SAPAIEVTDNFIFPEK 352
           LG  L  DD++I+IACGGSSNTI DLEE+L       H + R  + P++E  +N I+P++
Sbjct: 347 LGKNLDKDDVIIVIACGGSSNTILDLEESLAKLEEAPHLSIRRNATPSLE-HENIIYPKR 405

>KAFR0I00130 Chr9 complement(26703..27737) [1035 bp, 344 aa] {ON}
           Anc_1.3 YCL064C
          Length = 344

 Score =  425 bits (1093), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 196/343 (57%), Positives = 262/343 (76%), Gaps = 6/343 (1%)

Query: 1   MSIVYNKTPLLRQFFPG------KSPAQFFLKYECLQPSGSFKSRGIGNLIMKSAIRIQK 54
           M IVYNKTPL+ Q FPG       S  Q  +KYE LQPSGSFKSRGIGNL+ + A++IQK
Sbjct: 1   MPIVYNKTPLVPQSFPGTEIRSSDSLPQVLIKYEYLQPSGSFKSRGIGNLVYQKALQIQK 60

Query: 55  DGKKSPQIXXXXXXXXXXXXXXXCQRLSLPCTVVVPTATKKRMVEKIRNTGAQVIVSGAY 114
           +  K+P++                Q+LSLPCTVVVP ATK+RM+EKIR+TGA+V + G +
Sbjct: 61  NSTKNPEVFSSSGGNAGYAAAVVAQKLSLPCTVVVPAATKQRMIEKIRSTGAKVTIHGTF 120

Query: 115 WKEADTFLKADVMQKIDTQVVEPIYVHPFDNPDIWEGHSSMVDEMVQDLEFQRISMNKVK 174
           WK AD ++K  V+ +I+T+ VEPIYVHP D+P IWEG+S +VDE+++ L+ Q+I  +KVK
Sbjct: 121 WKGADKYMKNSVLNEINTEKVEPIYVHPSDDPLIWEGNSMIVDELMESLQEQKIDPSKVK 180

Query: 175 GIVCSVGGGGLYNGIVQGLERYGLADKIPIVGVETNGCHVFNTSLRIGQPVQFKKITSIA 234
            IVCSVGGGGLYNG++QGLERY LADKIPIVGVET+G HVFNT L+ G+ ++F+KI+++A
Sbjct: 181 AIVCSVGGGGLYNGLMQGLERYKLADKIPIVGVETDGSHVFNTCLKSGKHIEFEKISTVA 240

Query: 235 TSLGTAVISNQTFDYARKYNTRSVVIEDKDVIDTCLKYTHQFNMVVEPACGAALHLGYNT 294
           TSLG+A I+ +TF+YA KY  R V+++D +V++TCL+YT  +NM+ EPACGAA+HL Y+ 
Sbjct: 241 TSLGSASITKKTFEYAMKYRPRGVIVKDIEVLETCLRYTQDYNMITEPACGAAIHLAYHV 300

Query: 295 EILERALGSKLAADDIVIIIACGGSSNTIQDLEEALDHFNKRS 337
           +ILE+AL ++L  DD+VIIIACGGSSN++ D+EE L      S
Sbjct: 301 DILEKALDTRLDGDDVVIIIACGGSSNSLHDMEETLKKMKSES 343

>KAFR0F04430 Chr6 (868691..869722) [1032 bp, 343 aa] {ON} 
          Length = 343

 Score =  422 bits (1086), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 189/336 (56%), Positives = 260/336 (77%), Gaps = 6/336 (1%)

Query: 1   MSIVYNKTPLLRQFF------PGKSPAQFFLKYECLQPSGSFKSRGIGNLIMKSAIRIQK 54
           M  VYNKTPLLR +F         S  Q F KYE  QP  SFKSRGIGNLI+K+A ++++
Sbjct: 1   MPTVYNKTPLLRPYFLEANRGTSDSSPQVFFKYESFQPGCSFKSRGIGNLILKNAKKVEE 60

Query: 55  DGKKSPQIXXXXXXXXXXXXXXXCQRLSLPCTVVVPTATKKRMVEKIRNTGAQVIVSGAY 114
           +G K+ ++               C+ LS+PCTVVVP++TK RMVEKIR+TGAQVIVSG +
Sbjct: 61  EGIKTLEVFSSSGGNAGYAAAVACRELSIPCTVVVPSSTKVRMVEKIRSTGAQVIVSGNF 120

Query: 115 WKEADTFLKADVMQKIDTQVVEPIYVHPFDNPDIWEGHSSMVDEMVQDLEFQRISMNKVK 174
           WKEAD +L+  V+ K+D+  VEP+YVHPFD+P IWEGHS+++DE+V+ L  + +  +KVK
Sbjct: 121 WKEADEYLRNSVINKVDSSKVEPLYVHPFDDPLIWEGHSTIIDEIVESLNDENVHTSKVK 180

Query: 175 GIVCSVGGGGLYNGIVQGLERYGLADKIPIVGVETNGCHVFNTSLRIGQPVQFKKITSIA 234
           G+VCS+GGGGLYNGI++GLER+ LADKIP++ VET GCHVFNT L +G+ V+F+KI+SIA
Sbjct: 181 GVVCSIGGGGLYNGIIEGLERHALADKIPVIAVETEGCHVFNTCLELGKHVEFEKISSIA 240

Query: 235 TSLGTAVISNQTFDYARKYNTRSVVIEDKDVIDTCLKYTHQFNMVVEPACGAALHLGYNT 294
           TSLG+  IS +TF+YA+KY+++ VV++D DV++TCL+Y+   NM++EPAC A++HL YN 
Sbjct: 241 TSLGSPSISTKTFEYAQKYHSKGVVLQDIDVLETCLRYSEDSNMIIEPACAASVHLAYNV 300

Query: 295 EILERALGSKLAADDIVIIIACGGSSNTIQDLEEAL 330
           +ILE AL  KL+ DD++IIIACGGS+ T+QD++++L
Sbjct: 301 DILEEALNKKLSKDDVIIIIACGGSATTLQDIKDSL 336

>NCAS0A15330 Chr1 (3015596..3016639) [1044 bp, 347 aa] {ON} 
          Length = 347

 Score =  421 bits (1081), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 191/341 (56%), Positives = 257/341 (75%), Gaps = 5/341 (1%)

Query: 1   MSIVYNKTPLLRQFFPG----KSPAQFFLKYECLQPSGSFKSRGIGNLIMKSAIRIQKDG 56
           MS+VYNKTPLLR+ FP      S  Q ++KYE LQPSGSFKSRGIG+LIMK+A+R+Q+ G
Sbjct: 1   MSLVYNKTPLLRRVFPTGLKVPSAPQLYVKYESLQPSGSFKSRGIGHLIMKNALRVQQLG 60

Query: 57  KKSPQIXXXXXXXXXXXXXXXCQRLSLPCTVVVPTATKKRMVEKIRNTGAQVIVSGAYWK 116
            KS  +                Q L LPCTVVVPT+TK RMVEKIRN G +VIV G++WK
Sbjct: 61  GKSLHVFSSSGGNAGLAAATASQSLKLPCTVVVPTSTKSRMVEKIRNVGTEVIVKGSHWK 120

Query: 117 EADTFLKADVMQKIDTQVVEPIYVHPFDNPDIWEGHSSMVDEMVQDLEFQRISMNKVKGI 176
           EAD+FLK  V+  +D ++ EPIYVHPFD+PD+WEGHS+MVDE+V     Q +S+NKVK I
Sbjct: 121 EADSFLKNSVIPSVD-RIEEPIYVHPFDHPDVWEGHSTMVDEIVDTFRSQNVSLNKVKAI 179

Query: 177 VCSVGGGGLYNGIVQGLERYGLADKIPIVGVETNGCHVFNTSLRIGQPVQFKKITSIATS 236
           VCSVGGGGLYNGI+ GLE+Y LADKIP++ +ET+GC+ FN  L+  + V+  KITS+ATS
Sbjct: 180 VCSVGGGGLYNGIIHGLEKYHLADKIPVIAMETDGCNSFNACLKAKKQVELPKITSVATS 239

Query: 237 LGTAVISNQTFDYARKYNTRSVVIEDKDVIDTCLKYTHQFNMVVEPACGAALHLGYNTEI 296
           LG   ++ + F+  ++Y + SVV++D DV++TCLKY + FN++ EPACGA+LH+ YNT++
Sbjct: 240 LGATGVATKAFENGQRYQSPSVVLQDIDVVNTCLKYANDFNIITEPACGASLHMAYNTKL 299

Query: 297 LERALGSKLAADDIVIIIACGGSSNTIQDLEEALDHFNKRS 337
           +E+ALG KL +DDI++IIACGGS+NT++DL+ +    +  +
Sbjct: 300 IEKALGKKLDSDDIIVIIACGGSANTMEDLQNSYKQLSAEA 340

>SAKL0C00418g Chr3 complement(37529..38623) [1095 bp, 364 aa] {ON}
           similar to uniprot|P25379 Saccharomyces cerevisiae
           YCL064C CHA1 catabolism of hydroxy amino acids catabolic
           serine (threonine) dehydratase
          Length = 364

 Score =  402 bits (1032), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 189/331 (57%), Positives = 237/331 (71%), Gaps = 3/331 (0%)

Query: 1   MSIVYNKTPLLRQFFPGK---SPAQFFLKYECLQPSGSFKSRGIGNLIMKSAIRIQKDGK 57
           M+  Y+KTPLLR+ FP     +  QF +KYE  QPSGSFKSRGIG+LI +SA RI+ +G 
Sbjct: 1   MTSFYSKTPLLRRIFPSSVLSATPQFLVKYEVFQPSGSFKSRGIGHLITQSAARIESEGN 60

Query: 58  KSPQIXXXXXXXXXXXXXXXCQRLSLPCTVVVPTATKKRMVEKIRNTGAQVIVSGAYWKE 117
           K+  +               C+  SLPCTVVVPT T  RMV KIR TGA VIV G +W +
Sbjct: 61  KTAHVFASSGGNAGLAAATACRAFSLPCTVVVPTTTNLRMVAKIRQTGADVIVHGNHWGD 120

Query: 118 ADTFLKADVMQKIDTQVVEPIYVHPFDNPDIWEGHSSMVDEMVQDLEFQRISMNKVKGIV 177
           AD +L   VM  IDT   EP+Y HPFDNP IWEGHS++VDE+V+ LE QRI  ++VKGIV
Sbjct: 121 ADQYLHRSVMPCIDTTKFEPVYAHPFDNPVIWEGHSTIVDEIVESLERQRIPASQVKGIV 180

Query: 178 CSVGGGGLYNGIVQGLERYGLADKIPIVGVETNGCHVFNTSLRIGQPVQFKKITSIATSL 237
           CS+GGGGLYNGI++GLE++ LA  IPI+GVET GC VF+ SL+ G+P+ F KITS+ATSL
Sbjct: 181 CSIGGGGLYNGIIEGLEKHDLATTIPIIGVETKGCEVFHQSLKAGKPLVFDKITSVATSL 240

Query: 238 GTAVISNQTFDYARKYNTRSVVIEDKDVIDTCLKYTHQFNMVVEPACGAALHLGYNTEIL 297
           GTA I  +T + A KYNT+SVV+ D DV+ TCL +    N+V EPACGA+LH GYN  +L
Sbjct: 241 GTATICKKTLENALKYNTKSVVLSDADVVRTCLDFADDTNIVPEPACGASLHFGYNPHLL 300

Query: 298 ERALGSKLAADDIVIIIACGGSSNTIQDLEE 328
           E  LG  L  +DI+I+IACGGSS T+QDL++
Sbjct: 301 EDTLGGSLGPEDIIIVIACGGSSTTVQDLQQ 331

>NDAI0K02950 Chr11 (671102..672106) [1005 bp, 334 aa] {ON} 
          Length = 334

 Score =  390 bits (1003), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 183/328 (55%), Positives = 241/328 (73%), Gaps = 2/328 (0%)

Query: 1   MSIVYNKTPLLRQFF-PGKSPAQFFLKYECLQPSGSFKSRGIGNLIMKSAIRIQKDGKKS 59
           MS +YNKTPLLRQ F   K   + FLKYE LQPSGSFKSRGIG LI++   ++++DG K+
Sbjct: 1   MSFIYNKTPLLRQTFDSAKIGPRIFLKYENLQPSGSFKSRGIGCLILQHINKLKQDGNKT 60

Query: 60  PQIXXXXXXXXXXXXXXXCQRLSLPCTVVVPTATKKRMVEKIRNTGAQVIVSGAYWKEAD 119
             +                + L +PCTVVVP +TK+RMV KIR TGA V++ G +WKEAD
Sbjct: 61  AHVFSSSGGNAGLAAATASRSLQVPCTVVVPKSTKERMVNKIRKTGASVLIKGDHWKEAD 120

Query: 120 TFLKADVMQKIDTQVVEPIYVHPFDNPDIWEGHSSMVDEMVQDLEFQRISMNKVKGIVCS 179
            FL+   M+++D    +PIYVHPFD+P IWEGHS+++DE+VQ L+ ++IS+ KVKGI+CS
Sbjct: 121 DFLRKS-MKEMDNTQEQPIYVHPFDDPVIWEGHSTIIDEIVQTLQTEKISIEKVKGIICS 179

Query: 180 VGGGGLYNGIVQGLERYGLADKIPIVGVETNGCHVFNTSLRIGQPVQFKKITSIATSLGT 239
           VGGGGL+NGI++GLER+ LA  IP++ VET GC V N SL+ G PVQ  KITS+ATSLG+
Sbjct: 180 VGGGGLFNGIIKGLERHNLAQSIPVIAVETKGCDVLNKSLKNGTPVQLPKITSVATSLGS 239

Query: 240 AVISNQTFDYARKYNTRSVVIEDKDVIDTCLKYTHQFNMVVEPACGAALHLGYNTEILER 299
             IS+  F+ A KYN+RS+ + DKDV++TCLKY   F+M +EPACGA++HL YN  I+E 
Sbjct: 240 TYISSTAFENAMKYNSRSITLNDKDVLETCLKYNDDFSMTLEPACGASVHLAYNPGIVES 299

Query: 300 ALGSKLAADDIVIIIACGGSSNTIQDLE 327
           ALG+ L+  DIVI++ CGGSS T+ DLE
Sbjct: 300 ALGTALSNHDIVIVVLCGGSSCTLHDLE 327

>ZYRO0F18524g Chr6 (1528741..1529748) [1008 bp, 335 aa] {ON} similar
           to uniprot|P25379 Saccharomyces cerevisiae YCL064C CHA1
           catabolism of hydroxy amino acids catabolic serine
           (threonine) dehydratase
          Length = 335

 Score =  361 bits (927), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 176/339 (51%), Positives = 239/339 (70%), Gaps = 11/339 (3%)

Query: 1   MSIVYNKTPLLRQFFPGKSPA---QFFLKYECLQPSGSFKSRGIGNLI-MKSAIRIQKDG 56
           M+  Y KTPLLRQ    K+     Q F+KYE LQP GSFKSRGIGNLI +KS     ++G
Sbjct: 1   MNNWYYKTPLLRQILNWKTTTELPQIFIKYENLQPGGSFKSRGIGNLISLKS-----ENG 55

Query: 57  KKSPQIXXXXXXXXXXXXXXXCQRLSLPCTVVVPTATKKRMVEKIRNTGAQVIVSGAYWK 116
                +                +++ LPCTVVVPT+TK+RMV+KI+N+GA+VI+ G++WK
Sbjct: 56  LVKSHVLSSSGGNAGLAAAIASKQMELPCTVVVPTSTKQRMVQKIKNSGAEVIIRGSHWK 115

Query: 117 EADTFLKADVMQKI-DTQVVEPIYVHPFDNPDIWEGHSSMVDEMVQDLEFQRISMNKVKG 175
           EAD +L+ + +Q   +    +P+YVHPFD+P +WEGHS+MV E++ +L  Q IS+  V+G
Sbjct: 116 EADNYLQQNYIQSFRNDGTSKPLYVHPFDDPKVWEGHSTMVHEIIDNLREQNISVENVRG 175

Query: 176 IVCSVGGGGLYNGIVQGLERYGLADKIPIVGVETNGCHVFNTSLRIGQPVQFKKITSIAT 235
           IVCSVGGGGL+NGI++GLE +GLADKIP++ VET GC+V N SL  G+PV   KITS+AT
Sbjct: 176 IVCSVGGGGLFNGIIKGLEDHGLADKIPVIAVETYGCNVLNASLNAGRPVMLDKITSLAT 235

Query: 236 SLGTAVISNQTFDYARKYNTRSVVIEDKDVIDTCLKYTHQFNMVVEPACGAALHLGYNTE 295
           SLG+  I    F+ A +Y  +S+V+EDKDVI+TCL+Y   F  +VEPACGA+LH+GY+ E
Sbjct: 236 SLGSTYIPQGVFENAVRYGAKSLVLEDKDVIETCLRYVSDFGQIVEPACGASLHIGYHPE 295

Query: 296 ILERALGSKLAADDIVIIIACGGSSNTIQDLEEALDHFN 334
           +LE  LG   + DDI++IIACGGS+ T +DL  A  +F+
Sbjct: 296 LLENFLGG-FSKDDIIVIIACGGSTTTFKDLTIASKNFS 333

>KNAG0D05380 Chr4 complement(986308..987312) [1005 bp, 334 aa] {ON} 
          Length = 334

 Score =  359 bits (921), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 175/329 (53%), Positives = 221/329 (67%), Gaps = 2/329 (0%)

Query: 1   MSIVYNKTPLLRQFFPGKSPAQFFLKYECLQPSGSFKSRGIGNLIMKSAIRIQKDGKKSP 60
           M  +YNKTPLL +   G     F  KYE +QP GSFK RG+ +LI K   +I+ +GKK P
Sbjct: 1   MPALYNKTPLLPKNLSGGDGPTFLFKYENMQPGGSFKIRGVSHLIEKRVEQIKSEGKKPP 60

Query: 61  QIXXXXXXXXXXXXXXXCQRLSLPCTVVVPTATKKRMVEKIRNTGAQVIVSGAYWKEADT 120
            +               C  LS+PCTVVVPT TK RMVEKIR   A+VIV G+ WKEAD 
Sbjct: 61  HVFSSSGGNAGLAAATACHILSIPCTVVVPTLTKPRMVEKIRKANAEVIVKGSNWKEADD 120

Query: 121 FLKADVMQKIDTQVVEPIYVHPFDNPDIWEGHSSMVDEMVQDLEFQRISMNKVKGIVCSV 180
           +L+  V+       V+PIYV+PFD+P +WEGHS+M+DE++  L  + I ++ VKGIVCSV
Sbjct: 121 YLRGTVIAS--NNAVQPIYVNPFDDPLLWEGHSTMIDEILNALNQENIKLDAVKGIVCSV 178

Query: 181 GGGGLYNGIVQGLERYGLADKIPIVGVETNGCHVFNTSLRIGQPVQFKKITSIATSLGTA 240
           GGGGL+NGIV GLE + LA  IP+V VET GC V   SL   +PV+  KI SIATSLG++
Sbjct: 179 GGGGLFNGIVHGLENHQLACTIPVVAVETKGCDVLGLSLAAEKPVRLNKIDSIATSLGSS 238

Query: 241 VISNQTFDYARKYNTRSVVIEDKDVIDTCLKYTHQFNMVVEPACGAALHLGYNTEILERA 300
            +S Q FD A K+ +RSVV+ D DV++TC +Y   FN +VEPACGA +H  Y+ +ILE+A
Sbjct: 239 YVSCQAFDNAVKFKSRSVVLHDSDVLNTCYRYLDDFNAIVEPACGATIHTAYHYKILEKA 298

Query: 301 LGSKLAADDIVIIIACGGSSNTIQDLEEA 329
           LG KL   DI+III CGGS  TIQDLE A
Sbjct: 299 LGQKLTPSDIIIIIVCGGSCVTIQDLENA 327

>KLTH0F00440g Chr6 complement(34215..35240) [1026 bp, 341 aa] {ON}
           similar to uniprot|P25379 Saccharomyces cerevisiae
           YCL064C CHA1 catabolism of hydroxy amino acids catabolic
           serine (threonine) dehydratase
          Length = 341

 Score =  350 bits (898), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 167/331 (50%), Positives = 226/331 (68%), Gaps = 5/331 (1%)

Query: 1   MSIVYNKTPLLRQFFPGKS-----PAQFFLKYECLQPSGSFKSRGIGNLIMKSAIRIQKD 55
           M   + KTPLL  +F   S       QF LK E LQPSGSFKSRGIG +I K AI+I+ +
Sbjct: 1   MKSAFVKTPLLAHYFAASSNRLPNQPQFMLKCEFLQPSGSFKSRGIGYMITKQAIKIRSE 60

Query: 56  GKKSPQIXXXXXXXXXXXXXXXCQRLSLPCTVVVPTATKKRMVEKIRNTGAQVIVSGAYW 115
           G K P +                + LS+PC+VVVP +T  RMV+KI N GA+V V G  W
Sbjct: 61  GNKLPHVFASSGGNAGLAAATTSRALSIPCSVVVPESTSNRMVQKIWNLGAEVHVYGRNW 120

Query: 116 KEADTFLKADVMQKIDTQVVEPIYVHPFDNPDIWEGHSSMVDEMVQDLEFQRISMNKVKG 175
           KEAD FLK  ++   +    + IY HPFD+P IWEGHSS+VDE++  L+ Q+I +  +K 
Sbjct: 121 KEADKFLKESIISGHNPSRTQVIYAHPFDHPLIWEGHSSIVDEIIDSLKEQKIDLKNIKA 180

Query: 176 IVCSVGGGGLYNGIVQGLERYGLADKIPIVGVETNGCHVFNTSLRIGQPVQFKKITSIAT 235
           IVCSVGGGGLYNGI++GL R+ L  KIPI+GVE+ GC VFN+SL++G+  +F+ ITSIAT
Sbjct: 181 IVCSVGGGGLYNGIIEGLSRHKLVHKIPIIGVESKGCEVFNSSLKLGKLTEFEDITSIAT 240

Query: 236 SLGTAVISNQTFDYARKYNTRSVVIEDKDVIDTCLKYTHQFNMVVEPACGAALHLGYNTE 295
           S+GT  IS +T + A +Y+T+SVV+ D+++I TCL++  + N++ EPACGAALHLGY  +
Sbjct: 241 SIGTNSISKKTLENALRYHTKSVVLTDQEIISTCLRFADETNIIPEPACGAALHLGYYPD 300

Query: 296 ILERALGSKLAADDIVIIIACGGSSNTIQDL 326
           IL +AL S    +D++I+I CGGS+ +  DL
Sbjct: 301 ILYQALNSDFTPEDVIIMIGCGGSATSYNDL 331

>AFR747W Chr6 (1808016..1809296) [1281 bp, 426 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YCL064C (CHA1)
          Length = 426

 Score =  352 bits (902), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 171/341 (50%), Positives = 230/341 (67%), Gaps = 7/341 (2%)

Query: 1   MSIVYNKTPLLRQFFPGK-----SPAQFFLKYECLQPSGSFKSRGIGNLIMKSAIRIQKD 55
           M+  Y KTPL+R  F  +     +  +  LKYE  QPSGSFKSRGIGNLI K   +I+++
Sbjct: 69  MASFYCKTPLMRHVFARQNVRYTANPEIMLKYEFFQPSGSFKSRGIGNLIWKEMQKIRQN 128

Query: 56  GKKSPQIXXXXXXXXXXXXXXXCQRLSLPCTVVVPTATKKRMVEKIRNTGAQVIVSGAYW 115
               P +                ++L LPCTVVVP  T++RMVE+IR+TGA VI  G+  
Sbjct: 129 SSLQPHVFASSGGNAGLAAATASRQLGLPCTVVVPETTRRRMVERIRSTGADVISMGSVL 188

Query: 116 KEADTFLKADVMQKIDTQVVEPIYVHPFDNPDIWEGHSSMVDEMVQDLEFQRISMNKVKG 175
           KE+D +L++++M  ++ + V PIY HPFDNP IWEGH++MVDE+V+ L  Q + +  VKG
Sbjct: 189 KESDDYLRSELMGNVNLEKVAPIYAHPFDNPLIWEGHATMVDEVVEALHLQGVQLESVKG 248

Query: 176 IVCSVGGGGLYNGIVQGLERYGLADKIPIVGVETNGCHVFNTSLRIGQPVQFKKITSIAT 235
           IVCSVGGGGLYNGIV GLE++GLAD IP+V VET GC V + SL +G+ V      S+AT
Sbjct: 249 IVCSVGGGGLYNGIVYGLEKHGLADSIPVVAVETEGCEVLHRSLLLGRNVSMNP-KSVAT 307

Query: 236 SLGTAVISNQTFDYARKYNTRSVVIEDKDVIDTCLKYTHQFNMVVEPACGAALHLGYNTE 295
           SL T+ +++ T  YA+KY T+SVV++   V+ TCL +  + N+V EPACGAALHLGY+ E
Sbjct: 308 SLCTSFVTDLTLSYAQKYRTKSVVLDQLAVVQTCLNFAEESNIVTEPACGAALHLGYHPE 367

Query: 296 ILERALGSKLAADDIVIIIACGGSSNTIQDLEEALDHFNKR 336
           ILER LG  L   D+VI+IACGGS+  + DL+E+ D    +
Sbjct: 368 ILERELG-PLTPQDVVIVIACGGSTMNLADLKESEDQLQPK 407

>Ecym_1006 Chr1 complement(9635..10729) [1095 bp, 364 aa] {ON}
           similar to Ashbya gossypii AFR747W
          Length = 364

 Score =  348 bits (894), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 174/345 (50%), Positives = 235/345 (68%), Gaps = 14/345 (4%)

Query: 1   MSIVYNKTPLLRQFFP------GKSPAQFFLKYECLQPSGSFKSRGIGNLIMKSAIRIQK 54
           MS +Y KTPLLR+ F        K P QF +KYE  QPSGSFKSRGIGNLI      I++
Sbjct: 1   MSSLYVKTPLLRRAFGKPNIQISKVP-QFLVKYEFFQPSGSFKSRGIGNLIYNKVSEIRR 59

Query: 55  DGKKSPQIXXXXXXXXXXXXXXXCQRLSLPCTVVVPTATKKRMVEKIRNTGAQVIVSGAY 114
           D  K P +                QR+ +PCTVVVPT+T++R++EKI  TGA +I  G Y
Sbjct: 60  DPAKQPHVFSSSGGNAGLAAATASQRMGIPCTVVVPTSTRQRIIEKIMATGATIICRGDY 119

Query: 115 WKEADTFLKADVMQKIDTQVVE-----PIYVHPFDNPDIWEGHSSMVDEMVQDLEFQRIS 169
           + EAD++LK D+MQ+   +        PIYVHPF++P IW GHS +V+E+++ L  + I 
Sbjct: 120 FAEADSYLK-DLMQEAANKNTRDKKNVPIYVHPFNHPLIWHGHSYIVEEILESLRNENIP 178

Query: 170 MNKVKGIVCSVGGGGLYNGIVQGLERYGLADKIPIVGVETNGCHVFNTSLRIGQPVQFKK 229
            ++VKGIVCSVGGGGLYNGI++GLER+ LA+ IPI+GVET GC V + SL  G+ + FKK
Sbjct: 179 YSRVKGIVCSVGGGGLYNGIIEGLERHSLANTIPIIGVETEGCEVLHKSLIAGKLITFKK 238

Query: 230 ITSIATSLGTAVISNQTFDYARKYNTRSVVIEDKDVIDTCLKYTHQFNMVVEPACGAALH 289
             S+ATSL    I+ +T  YA+KY T+S+V+ + +V+DTCL++T + N+V EPACGA LH
Sbjct: 239 ALSVATSLSVPTITKETLRYAQKYKTKSLVLGEGEVLDTCLRFTDESNIVTEPACGATLH 298

Query: 290 LGYNTEILERALGSKLAADDIVIIIACGGSSNTIQDLEEALDHFN 334
           LGY+  IL + LG  L+++DIVI+IACGGS+ T+ DL E    +N
Sbjct: 299 LGYHPAILHKELGP-LSSEDIVILIACGGSATTLADLRELKLKYN 342

>KLLA0C00440g Chr3 complement(32008..33141) [1134 bp, 377 aa] {ON}
           similar to uniprot|P25379 Saccharomyces cerevisiae
           YCL064C CHA1 catabolism of hydroxy amino acids catabolic
           serine (threonine) dehydratase
          Length = 377

 Score =  348 bits (894), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 168/326 (51%), Positives = 224/326 (68%), Gaps = 1/326 (0%)

Query: 4   VYNKTPLLRQFFPGKSPAQFFLKYECLQPSGSFKSRGIGNLIMKSAIRIQKDG-KKSPQI 62
           +++KTPLL+  F      Q  LKYE LQPSGSFKSRGIG+LI      I+K   +K   +
Sbjct: 24  LFSKTPLLKHQFKRSKGPQVLLKYEFLQPSGSFKSRGIGHLISTKVEEIKKSSPEKIGHV 83

Query: 63  XXXXXXXXXXXXXXXCQRLSLPCTVVVPTATKKRMVEKIRNTGAQVIVSGAYWKEADTFL 122
                             L++PCTVVV  AT+ R++EKIR+ GA V+V G +WKEAD+F+
Sbjct: 84  FASSGGNAGLAAAVASLELNVPCTVVVSNATRPRIIEKIRSYGADVVVHGNHWKEADSFM 143

Query: 123 KADVMQKIDTQVVEPIYVHPFDNPDIWEGHSSMVDEMVQDLEFQRISMNKVKGIVCSVGG 182
           K  +M+K+D+   EPIY HPFDNP IWEGHS MVDE++  L   +I + K+KGIVCS GG
Sbjct: 144 KEHLMKKLDSFKYEPIYSHPFDNPLIWEGHSFMVDEIMDVLASSKIPITKIKGIVCSFGG 203

Query: 183 GGLYNGIVQGLERYGLADKIPIVGVETNGCHVFNTSLRIGQPVQFKKITSIATSLGTAVI 242
           GGLYNG++ GL+RY LADKIPIV VET G  V + SLR+G PV+F+KI+S ATSLGTA I
Sbjct: 204 GGLYNGLILGLQRYNLADKIPIVCVETKGTDVLSASLRVGAPVEFEKISSCATSLGTATI 263

Query: 243 SNQTFDYARKYNTRSVVIEDKDVIDTCLKYTHQFNMVVEPACGAALHLGYNTEILERALG 302
           S   +   +++ ++S VI D +VI TCL++++  N+V EP CGA L+ GYN + L+  LG
Sbjct: 264 STTAYQNVKRHGSKSAVISDTEVISTCLQFSNDTNIVAEPGCGATLYFGYNIDKLQNILG 323

Query: 303 SKLAADDIVIIIACGGSSNTIQDLEE 328
           S +  DD VI+I CGGSS +++DL+E
Sbjct: 324 SDIKDDDYVILIGCGGSSTSLEDLKE 349

>SAKL0C13904g Chr3 (1223973..1224992) [1020 bp, 339 aa] {ON} similar
           to uniprot|P25379 Saccharomyces cerevisiae YCL064C CHA1
           catabolism of hydroxy amino acids catabolic serine
           (threonine) dehydratase
          Length = 339

 Score =  347 bits (889), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 167/324 (51%), Positives = 226/324 (69%), Gaps = 1/324 (0%)

Query: 5   YNKTPLLRQFFPGKSPA-QFFLKYECLQPSGSFKSRGIGNLIMKSAIRIQKDGKKSPQIX 63
           YNKTPLL +       A +FFLKYE LQP GSFKSRGIG L+ KS  + ++DG KS  + 
Sbjct: 8   YNKTPLLPRVLTTTDGAPRFFLKYEFLQPGGSFKSRGIGYLVKKSYEKARRDGGKSLAVF 67

Query: 64  XXXXXXXXXXXXXXCQRLSLPCTVVVPTATKKRMVEKIRNTGAQVIVSGAYWKEADTFLK 123
                          Q  S+ CTVVVP  TK RMVEKIR TGA+V+V G +W  AD +L+
Sbjct: 68  SSSGGNAGLAAAIAAQTFSINCTVVVPRTTKSRMVEKIRKTGAEVLVYGKHWGMADEYLR 127

Query: 124 ADVMQKIDTQVVEPIYVHPFDNPDIWEGHSSMVDEMVQDLEFQRISMNKVKGIVCSVGGG 183
             VM+++D   V P+YVHPFDNP IW+GHS++VDE+V  L+ + +S++KVK IVCSVGGG
Sbjct: 128 EVVMKEVDVSKVVPLYVHPFDNPIIWQGHSTIVDEVVAQLKEENVSIDKVKAIVCSVGGG 187

Query: 184 GLYNGIVQGLERYGLADKIPIVGVETNGCHVFNTSLRIGQPVQFKKITSIATSLGTAVIS 243
           GLYNGIV+GLE + LAD+IPI+ +ET GC V N SL  G PV  + +TS+A+SL +  IS
Sbjct: 188 GLYNGIVKGLETHQLADRIPILAIETKGCDVLNKSLNSGNPVVLESLTSVASSLASPYIS 247

Query: 244 NQTFDYARKYNTRSVVIEDKDVIDTCLKYTHQFNMVVEPACGAALHLGYNTEILERALGS 303
            + F+ ARKY ++S++++D  VI+TCL +     +VVEPACGA+L+  Y+ E+L   +G 
Sbjct: 248 EKAFENARKYESKSILLKDSQVIETCLNFADDAGIVVEPACGASLYSCYHPELLPLYIGK 307

Query: 304 KLAADDIVIIIACGGSSNTIQDLE 327
           +L  DD++++IACGGS+ T +DLE
Sbjct: 308 ELTEDDVIVVIACGGSAVTYKDLE 331

>Smik_9.2 Chr9 (6779..7795) [1017 bp, 338 aa] {ON} YCL064C (REAL)
          Length = 338

 Score =  343 bits (879), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 169/326 (51%), Positives = 227/326 (69%), Gaps = 1/326 (0%)

Query: 5   YNKTPLLRQFFP-GKSPAQFFLKYECLQPSGSFKSRGIGNLIMKSAIRIQKDGKKSPQIX 63
           Y KTPL+RQ F  GK+   F++K++ LQP GSFKSRGIG+LI K       +G     + 
Sbjct: 6   YEKTPLIRQVFDNGKTNPLFYIKHDMLQPGGSFKSRGIGHLIRKKNKEALAEGSGKLVVF 65

Query: 64  XXXXXXXXXXXXXXCQRLSLPCTVVVPTATKKRMVEKIRNTGAQVIVSGAYWKEADTFLK 123
                         C+ ++L CTVVVP  TK RMV+KI++ GA+VI+ G +W EAD +LK
Sbjct: 66  SSSGGNAGLAAATSCRLMALNCTVVVPKTTKSRMVKKIQSAGAKVIIHGDHWGEADEYLK 125

Query: 124 ADVMQKIDTQVVEPIYVHPFDNPDIWEGHSSMVDEMVQDLEFQRISMNKVKGIVCSVGGG 183
            +VM +      + +YVHPFD+  IWEGHS++VDE++Q L+ + IS  +VKG+VCSVGGG
Sbjct: 126 QEVMAQEGQHGSKTLYVHPFDDEIIWEGHSTIVDEILQQLQEKDISPLQVKGLVCSVGGG 185

Query: 184 GLYNGIVQGLERYGLADKIPIVGVETNGCHVFNTSLRIGQPVQFKKITSIATSLGTAVIS 243
           GL++GI++GLER  LA KIPIV VET GC V N SL+ G PV  +++TS+ATSLG+  I+
Sbjct: 186 GLFSGIIKGLERNRLAGKIPIVAVETAGCDVLNKSLKNGSPVALERLTSVATSLGSPYIA 245

Query: 244 NQTFDYARKYNTRSVVIEDKDVIDTCLKYTHQFNMVVEPACGAALHLGYNTEILERALGS 303
              F+    Y  +SVV+ D+DV+DTCL+Y   +N +VEPACGA+LHL Y+ EILE+ALG 
Sbjct: 246 PFAFESFITYGCKSVVLSDQDVLDTCLRYADDYNFIVEPACGASLHLCYHPEILEKALGQ 305

Query: 304 KLAADDIVIIIACGGSSNTIQDLEEA 329
           KL+ DD+VIIIACGGS  T +DL +A
Sbjct: 306 KLSEDDVVIIIACGGSCMTYEDLVKA 331

>Scer_YGOB_SDL1 Chr9 (29032..29411,29415..30048) [1014 bp, 337 aa]
           {ON} ANNOTATED BY YGOB - Skipping over stop codon in
           S288c
          Length = 337

 Score =  336 bits (861), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 164/331 (49%), Positives = 226/331 (68%), Gaps = 2/331 (0%)

Query: 5   YNKTPLLRQFFP-GKSPAQFFLKYECLQPSGSFKSRGIGNLIMKSAIRIQKDGKKSPQIX 63
           Y KTPL+RQF   GK+ + F++K+E LQP GSFKSRGIG+LI KS      +G     + 
Sbjct: 6   YEKTPLIRQFLNNGKTNSWFYVKHEMLQPGGSFKSRGIGHLIRKSNEEALSEGSGKLAVF 65

Query: 64  XXXXXXXXXXXXXXCQRLSLPCTVVVPTATKKRMVEKIRNTGAQVIVSGAYWKEADTFLK 123
                         C+ ++L C+VVVP  TK RMV+KI++ GA+VI+ G +W EAD +L+
Sbjct: 66  SSSGGNAGLAAATACRSMALNCSVVVPKTTKPRMVKKIQSAGAKVIIHGDHWGEADEYLR 125

Query: 124 ADVMQKIDTQVVEPIYVHPFDNPDIWEGHSSMVDEMVQDLEFQRISMNKVKGIVCSVGGG 183
            ++ Q+      + +YVHPFDN  IWEGHS++VDE+++ L+   IS+ +VK +VCSVGGG
Sbjct: 126 HEMAQE-SQHGSKTLYVHPFDNETIWEGHSTIVDEIIEQLKENDISLPRVKALVCSVGGG 184

Query: 184 GLYNGIVQGLERYGLADKIPIVGVETNGCHVFNTSLRIGQPVQFKKITSIATSLGTAVIS 243
           GL++GI++GL+R  LA+KIP+V VET GC V N SL+ G PV  +K+TS+ATSL +  I+
Sbjct: 185 GLFSGIIKGLDRNQLAEKIPVVAVETAGCDVLNKSLKKGSPVTLEKLTSVATSLASPYIA 244

Query: 244 NQTFDYARKYNTRSVVIEDKDVIDTCLKYTHQFNMVVEPACGAALHLGYNTEILERALGS 303
           +  F+   KY  +SVV+ D+DV+ TCL+Y   +N +VEPACGA+LHL Y+ EILE  L  
Sbjct: 245 SFAFESFNKYGCKSVVLSDQDVLATCLRYADDYNFIVEPACGASLHLCYHPEILEDILEQ 304

Query: 304 KLAADDIVIIIACGGSSNTIQDLEEALDHFN 334
           K+  DDIVIIIACGGS  T +DL +A    N
Sbjct: 305 KIYEDDIVIIIACGGSCMTYEDLVKASSTLN 335

>Skud_9.2 Chr9 (5919..6938) [1020 bp, 339 aa] {ON} YCL064C (REAL)
          Length = 339

 Score =  328 bits (842), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 158/325 (48%), Positives = 221/325 (68%), Gaps = 1/325 (0%)

Query: 5   YNKTPLLRQFFP-GKSPAQFFLKYECLQPSGSFKSRGIGNLIMKSAIRIQKDGKKSPQIX 63
           Y +TPL+ Q F  G++  + ++K+E LQP GSFKSRGIG+LI +S      DG     + 
Sbjct: 6   YERTPLIHQVFNNGQTGPRLYVKHEMLQPGGSFKSRGIGHLINRSNEEALADGSGKLAVF 65

Query: 64  XXXXXXXXXXXXXXCQRLSLPCTVVVPTATKKRMVEKIRNTGAQVIVSGAYWKEADTFLK 123
                         C  ++L CTVVVP  TK RM++KI+N GA+VI+ G++W EAD +L+
Sbjct: 66  SSSGGNAGLAAATACSSMALDCTVVVPKTTKSRMIKKIQNAGAKVIIHGSHWGEADEYLR 125

Query: 124 ADVMQKIDTQVVEPIYVHPFDNPDIWEGHSSMVDEMVQDLEFQRISMNKVKGIVCSVGGG 183
            ++M +      + +YVHPFD+  IWEGHS++VDE++Q L+ + IS+ ++K +VCSVGGG
Sbjct: 126 QELMIQESQLGSKTLYVHPFDDERIWEGHSTIVDEVLQQLQEKNISLARIKAMVCSVGGG 185

Query: 184 GLYNGIVQGLERYGLADKIPIVGVETNGCHVFNTSLRIGQPVQFKKITSIATSLGTAVIS 243
           GL++GI++GLER  LA KI ++ VET GC V N SL  G P+  ++++SIATSLG+  I+
Sbjct: 186 GLFSGIIKGLERNNLAGKIRVIAVETIGCDVLNKSLVNGSPITLERLSSIATSLGSPYIA 245

Query: 244 NQTFDYARKYNTRSVVIEDKDVIDTCLKYTHQFNMVVEPACGAALHLGYNTEILERALGS 303
              F+    Y  +SVV+ D+DV+ TCL+Y   +N +VEPACGA+LHL Y+ EILE AL  
Sbjct: 246 PFAFESFNAYGCKSVVLSDQDVLATCLRYADDYNSIVEPACGASLHLCYHQEILENALEQ 305

Query: 304 KLAADDIVIIIACGGSSNTIQDLEE 328
           KL+ DDIVIIIACGGS  T +DL E
Sbjct: 306 KLSDDDIVIIIACGGSCMTYEDLVE 330

>TDEL0D06540 Chr4 (1175562..1176575) [1014 bp, 337 aa] {ON} 
          Length = 337

 Score =  320 bits (821), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 162/333 (48%), Positives = 219/333 (65%), Gaps = 3/333 (0%)

Query: 6   NKTPLLRQFF--PGKSPAQFFLKYECLQPSGSFKSRGIGNLIMKSAIRIQKDGKKSPQIX 63
           +K+PLL + F    K   QFFLKYE LQPSGSFKSRGIG LI   A   +        + 
Sbjct: 5   HKSPLLNRRFKESEKDGPQFFLKYETLQPSGSFKSRGIGYLINSKAKEARSRDGSDVHVF 64

Query: 64  XXXXXXXXXXXXXXCQRLSLPCTVVVPTATKKRMVEKIRNTGAQVIVSGAYWKEADTFLK 123
                          + L+L CTVVVP  TK+ M+++I+N G+QVIV G +W  ADT+LK
Sbjct: 65  SSSGGNAGLAAANASKLLNLNCTVVVPVTTKRHMIDRIQNAGSQVIVHGTHWGMADTYLK 124

Query: 124 ADVMQKIDTQVVEPIYVHPFDNPDIWEGHSSMVDEMVQDLEFQRISMNKVKGIVCSVGGG 183
             VM+K+ + V EP+YVHPFD+P +WEGHS M+DE+V+ L+ Q  SM  VKGI+CSVGGG
Sbjct: 125 EVVMKKVPSNV-EPLYVHPFDDPLVWEGHSFMIDEIVEQLQEQGRSMRDVKGIICSVGGG 183

Query: 184 GLYNGIVQGLERYGLADKIPIVGVETNGCHVFNTSLRIGQPVQFKKITSIATSLGTAVIS 243
           GLYNGIV GLER+G A KIPI+ VET G      SL  G+PV+  ++TSIA+SLG+  I+
Sbjct: 184 GLYNGIVGGLERHGYAGKIPIIAVETVGADALAKSLAAGKPVRLTEVTSIASSLGSPYIA 243

Query: 244 NQTFDYARKYNTRSVVIEDKDVIDTCLKYTHQFNMVVEPACGAALHLGYNTEILERALGS 303
             +F+ A +Y TRS V  D++ + T L++  + N++VEPAC A++ L Y+ + L + L  
Sbjct: 244 QDSFEKAIRYKTRSFVQTDEEAVRTSLRFFQETNILVEPACAASVSLCYHVDELNKLLSC 303

Query: 304 KLAADDIVIIIACGGSSNTIQDLEEALDHFNKR 336
           KL++ DIVI+I CGGS+ TI DLE     +N +
Sbjct: 304 KLSSKDIVIVIVCGGSATTISDLEMLQRRYNPK 336

>KLLA0E01805g Chr5 complement(173125..174093) [969 bp, 322 aa] {ON}
           similar to uniprot|P25379 Saccharomyces cerevisiae
           YCL064C CHA1 catabolism of hydroxy amino acids catabolic
           serine (threonine) dehydratase
          Length = 322

 Score =  306 bits (784), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 154/321 (47%), Positives = 213/321 (66%), Gaps = 8/321 (2%)

Query: 7   KTPLLRQFFPGKSPAQFFLKYECLQPSGSFKSRGIGNLIMKSAIRIQKDGKKSPQIXXXX 66
           KTPLL    P      F LKYE LQP GSFKSRGI +LI K+ +    D +    +    
Sbjct: 7   KTPLLPFREPLNGGPTFLLKYENLQPGGSFKSRGISHLI-KTTMDSISDPENELAVYSSS 65

Query: 67  XXXXXXXXXXXCQRLSLPCTVVVPTATKKRMVEKIRNTGAQVIVSGAYWKEADTFLKADV 126
                      C  L +PCTV+VP +TK RM++KI + GA+V++ G +WKEADT+L+  V
Sbjct: 66  GGNAGLAAARACATLKVPCTVIVPKSTKPRMIKKIESAGAKVVIFGDHWKEADTYLREYV 125

Query: 127 MQKIDTQVVEPIYVHPFDNPDIWEGHSSMVDEMVQDLEFQRISMNKVKGIVCSVGGGGLY 186
           M++  +     +YVHPFDNP IW+GHS+M+DE+++ L      +N VKGIVCSVGGGGLY
Sbjct: 126 MRQ--SSYSNTLYVHPFDNPIIWDGHSTMIDEIIEQLAESHTDINDVKGIVCSVGGGGLY 183

Query: 187 NGIVQGLERYGLADKIPIVGVETNGCHVFNTSLRIGQPVQFKKITSIATSLGTAVISNQT 246
           NG+V GLER+GLA  IP+  +ET+GC V + SL  G+PV   +I+SIATSLG+  I   +
Sbjct: 184 NGVVNGLERHGLAGSIPVFAMETDGCDVLSKSLIAGEPVVLDRISSIATSLGSTEICADS 243

Query: 247 FDYARKYNTRSVVIEDKDVIDTCLKYTHQFNMVVEPACGAALHLGYNTEILERALGSKLA 306
           F  A K++++S+V++DK+V+DTCL++  + +++VEPACGA+LH  Y  E+L       L 
Sbjct: 244 FQKAIKFSSKSIVLDDKNVVDTCLRFFDETSILVEPACGASLHTCYRPELL-----GPLG 298

Query: 307 ADDIVIIIACGGSSNTIQDLE 327
            DDIV++I CGGS NT  DL+
Sbjct: 299 PDDIVVVILCGGSCNTYDDLK 319

>KNAG0A01150 Chr1 (6346..7041) [696 bp, 231 aa] {ON}
          Length = 231

 Score =  246 bits (628), Expect = 3e-80,   Method: Compositional matrix adjust.
 Identities = 119/223 (53%), Positives = 156/223 (69%), Gaps = 2/223 (0%)

Query: 107 QVIVSGAYWKEADTFLKADVMQKIDTQVVEPIYVHPFDNPDIWEGHSSMVDEMVQDLEFQ 166
           +V V  A  KEAD +L+  V+     + V+PIYV+PFD+P IWEGHS+++DE++  L  +
Sbjct: 4   EVFVHVANLKEADYYLQNVVIDL--YKDVQPIYVNPFDDPLIWEGHSTIIDEILNTLTQE 61

Query: 167 RISMNKVKGIVCSVGGGGLYNGIVQGLERYGLADKIPIVGVETNGCHVFNTSLRIGQPVQ 226
            I +  VKGI+CS  GGGLYNGI+QGLE+Y LA  IP+V VET GC V N SL   +PVQ
Sbjct: 62  NIEVGSVKGIICSFSGGGLYNGIMQGLEKYDLAYNIPVVAVETKGCDVLNLSLAANKPVQ 121

Query: 227 FKKITSIATSLGTAVISNQTFDYARKYNTRSVVIEDKDVIDTCLKYTHQFNMVVEPACGA 286
              ITSIA SLG++V+S + FD   KY+++S+V+ D D +DTC KY   F  V+EPACGA
Sbjct: 122 LDSITSIAKSLGSSVVSQKVFDNVIKYHSKSLVLNDSDALDTCFKYLDDFGTVLEPACGA 181

Query: 287 ALHLGYNTEILERALGSKLAADDIVIIIACGGSSNTIQDLEEA 329
           ++H  Y+  +LE AL  KL  DD++IIIACGGS  T QDLE A
Sbjct: 182 SVHTAYHYNVLEEALDQKLRPDDVIIIIACGGSCATFQDLERA 224

>YIL167W Chr9 (29416..30048) [633 bp, 210 aa] {OFF}  SDL1Open
           reading frame, unlikely to produce a functional protein
           in S288C; in closely related species and other S.
           cerevisiae strain backgrounds YIL167W and adjacent
           ORF, YIL168W, constitute a single ORF encoding L-serine
           dehydratase
          Length = 210

 Score =  233 bits (595), Expect = 1e-75,   Method: Compositional matrix adjust.
 Identities = 109/197 (55%), Positives = 146/197 (74%)

Query: 138 IYVHPFDNPDIWEGHSSMVDEMVQDLEFQRISMNKVKGIVCSVGGGGLYNGIVQGLERYG 197
           +YVHPFDN  IWEGHS++VDE+++ L+   IS+ +VK +VCSVGGGGL++GI++GL+R  
Sbjct: 12  LYVHPFDNETIWEGHSTIVDEIIEQLKENDISLPRVKALVCSVGGGGLFSGIIKGLDRNQ 71

Query: 198 LADKIPIVGVETNGCHVFNTSLRIGQPVQFKKITSIATSLGTAVISNQTFDYARKYNTRS 257
           LA+KIP+V VET GC V N SL+ G PV  +K+TS+ATSL +  I++  F+   KY  +S
Sbjct: 72  LAEKIPVVAVETAGCDVLNKSLKKGSPVTLEKLTSVATSLASPYIASFAFESFNKYGCKS 131

Query: 258 VVIEDKDVIDTCLKYTHQFNMVVEPACGAALHLGYNTEILERALGSKLAADDIVIIIACG 317
           VV+ D+DV+ TCL+Y   +N +VEPACGA+LHL Y+ EILE  L  K+  DDIVIIIACG
Sbjct: 132 VVLSDQDVLATCLRYADDYNFIVEPACGASLHLCYHPEILEDILEQKIYEDDIVIIIACG 191

Query: 318 GSSNTIQDLEEALDHFN 334
           GS  T +DL +A    N
Sbjct: 192 GSCMTYEDLVKASSTLN 208

>YIL168W Chr9 (29032..29415) [384 bp, 127 aa] {OFF} Open reading
           frame, unlikely to produce a functional protein in
           S288C; in closely related species and other S.
           cerevisiae strain backgrounds YIL168W and adjacent
           ORF, YIL167W, constitute a single ORF encoding L-serine
           dehydratase
          Length = 127

 Score =  111 bits (277), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 54/122 (44%), Positives = 76/122 (62%), Gaps = 1/122 (0%)

Query: 5   YNKTPLLRQFFP-GKSPAQFFLKYECLQPSGSFKSRGIGNLIMKSAIRIQKDGKKSPQIX 63
           Y KTPL+RQF   GK+ + F++K+E LQP GSFKSRGIG+LI KS      +G     + 
Sbjct: 6   YEKTPLIRQFLNNGKTNSWFYVKHEMLQPGGSFKSRGIGHLIRKSNEEALSEGSGKLAVF 65

Query: 64  XXXXXXXXXXXXXXCQRLSLPCTVVVPTATKKRMVEKIRNTGAQVIVSGAYWKEADTFLK 123
                         C+ ++L C+VVVP  TK RMV+KI++ GA+VI+ G +W EAD +L+
Sbjct: 66  SSSGGNAGLAAATACRSMALNCSVVVPKTTKPRMVKKIQSAGAKVIIHGDHWGEADEYLR 125

Query: 124 AD 125
            +
Sbjct: 126 HE 127

>SAKL0F11858g Chr6 (920767..922455) [1689 bp, 562 aa] {ON} highly
           similar to uniprot|P00927 Saccharomyces cerevisiae
           YER086W ILV1 Threonine deaminase catalyzes the first
           step in isoleucine biosynthesis expression is under
           general amino acid control ILV1 locus exhibits highly
           positioned nucleosomes whose organization is independent
           of known ILV1 regulation
          Length = 562

 Score = 72.4 bits (176), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 67/259 (25%), Positives = 121/259 (46%), Gaps = 17/259 (6%)

Query: 25  LKYECLQPSGSFKSRGIGNLIMKSAIRIQKDGKKSPQIXXXXXXXXXXXXXXXCQRLSLP 84
           LK E L P  SFK RG  N+I K       + +K+  +                + L++P
Sbjct: 83  LKREDLLPVFSFKLRGAYNMIAK-----LDESQKTQGVIACSAGNHAQGVAYASKHLNIP 137

Query: 85  CTVVVPTATKKRMVEKIRNTGAQVIVSGAYWKEADTFLKADVMQKIDTQVVEPIYVHPFD 144
            T+V+P +T     + +   G+QV++ G  + EA    KA+  +  + + +  I   PFD
Sbjct: 138 ATIVMPVSTPSIKYQNVSRLGSQVVLYGNDFDEA----KAECTKLTEERGLTNI--PPFD 191

Query: 145 NPDIWEGHSSMVDEMVQDLEFQRISMNKVKGIVCSVGGGGLYNGIVQGLERYGLADKIPI 204
           +P +  G  ++  E+++ +     + +K+K + C+VGGGGL  G+   L+R  +A  I +
Sbjct: 192 HPYVIAGQGTIAMEILRQVH----NASKIKAVFCAVGGGGLITGVGAYLKR--IAPHIKV 245

Query: 205 VGVETNGCHVFNTSLRIGQPVQFKKITSIATSLGTAVISNQTFDYARKYNTRSVVIEDKD 264
           +GVET      +TSL+ G+ V    + + A      +I  +TF  A+      V++   +
Sbjct: 246 IGVETYDAATLHTSLKAGKRVPLPNVGTFADGTSVRMIGEETFRVAKDVVDEVVLVNTDE 305

Query: 265 VIDTCLKYTHQFNMVVEPA 283
           +             +VEP+
Sbjct: 306 ICAAVKDIFEDTRSIVEPS 324

>KAFR0K01700 Chr11 (352943..354682) [1740 bp, 579 aa] {ON} Anc_7.367
           YER086W
          Length = 579

 Score = 65.1 bits (157), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 62/228 (27%), Positives = 109/228 (47%), Gaps = 17/228 (7%)

Query: 25  LKYECLQPSGSFKSRGIGNLIMKSAIRIQKDGKKSPQIXXXXXXXXXXXXXXXCQRLSLP 84
           LK E L P  SFK RG  N+I K    ++  G     +                ++L +P
Sbjct: 100 LKREDLLPVFSFKLRGAYNMIAKLDDNVRNQG-----VIACSAGNHAQGVAYAAKKLGIP 154

Query: 85  CTVVVPTATKKRMVEKIRNTGAQVIVSGAYWKEADTFLKADVMQKIDTQVVEPIYVHPFD 144
            T+V+P +T     + +   G+QV++ G  + EA    KA+  +  + + +  I   PFD
Sbjct: 155 ATIVMPVSTPSIKYQNVSRLGSQVVLYGNDFDEA----KAECAKLSEERGLTNI--PPFD 208

Query: 145 NPDIWEGHSSMVDEMVQDLEFQRISMNKVKGIVCSVGGGGLYNGIVQGLERYGLADKIPI 204
           +P +  G  ++  E+++ +     + NK+  +   VGGGGL  G+   L+R  +A  I +
Sbjct: 209 HPYVIAGQGTVAMEILRQVH----NANKINAVFVPVGGGGLIAGVGAYLKR--IAPHIKV 262

Query: 205 VGVETNGCHVFNTSLRIGQPVQFKKITSIATSLGTAVISNQTFDYARK 252
           +GVET      +TSL+ G+  +  K+ + A      +I  +TF  A++
Sbjct: 263 IGVETYDATTLHTSLQNGKRTELTKVGTFADGTSVRLIGEETFRVAQE 310

>CAGL0I05126g Chr9 complement(481145..482860) [1716 bp, 571 aa] {ON}
           highly similar to uniprot|P00927 Saccharomyces
           cerevisiae YER086w ILV1 anabolic serine and threonine
           dehydratase precursor
          Length = 571

 Score = 64.3 bits (155), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 67/264 (25%), Positives = 118/264 (44%), Gaps = 17/264 (6%)

Query: 25  LKYECLQPSGSFKSRGIGNLIMKSAIRIQKDGKKSPQIXXXXXXXXXXXXXXXCQRLSLP 84
           LK E L P  SFK RG  N+I K       D +++  +                + L +P
Sbjct: 92  LKREDLLPVFSFKLRGAYNMIAK-----LDDTQRNQGVIACSAGNHAQGVAYAARHLDIP 146

Query: 85  CTVVVPTATKKRMVEKIRNTGAQVIVSGAYWKEADTFLKADVMQKIDTQVVEPIYVHPFD 144
            T+V+P +T     + +   G+QV++ G  + EA    KA+  +  + + +  I   PFD
Sbjct: 147 ATIVMPVSTPSIKYQNVSRLGSQVVLYGNDFDEA----KAECTKLAEERGLTNI--PPFD 200

Query: 145 NPDIWEGHSSMVDEMVQDLEFQRISMNKVKGIVCSVGGGGLYNGIVQGLERYGLADKIPI 204
           +P +  G  ++  E+++    Q  + NK+  +   VGGGGL  G+   L+R  +   I I
Sbjct: 201 HPYVIAGQGTVAMEILR----QVYNSNKIGAVFVPVGGGGLIAGVGAYLKR--VTPHIKI 254

Query: 205 VGVETNGCHVFNTSLRIGQPVQFKKITSIATSLGTAVISNQTFDYARKYNTRSVVIEDKD 264
           +GVET+     +TSL+  +      + + A      +I  +TF  AR+     V++   +
Sbjct: 255 IGVETHDAATLHTSLQRNKRTNLASVGTFADGTSVRIIGEETFRVAREVVDEIVLVNTDE 314

Query: 265 VIDTCLKYTHQFNMVVEPACGAAL 288
           +             +VEP+   A+
Sbjct: 315 ICAAVKDVFEDTRSIVEPSGALAV 338

>NCAS0A14230 Chr1 (2801647..2803356) [1710 bp, 569 aa] {ON}
           Anc_7.367
          Length = 569

 Score = 63.2 bits (152), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 65/264 (24%), Positives = 117/264 (44%), Gaps = 17/264 (6%)

Query: 25  LKYECLQPSGSFKSRGIGNLIMKSAIRIQKDGKKSPQIXXXXXXXXXXXXXXXCQRLSLP 84
           LK E L P  SFK RG  N+I K       D +++  +                + L +P
Sbjct: 90  LKREDLLPVFSFKLRGAYNMIAK-----LDDSQRNQGVIACSAGNHAQGVAYAAKHLGIP 144

Query: 85  CTVVVPTATKKRMVEKIRNTGAQVIVSGAYWKEADTFLKADVMQKIDTQVVEPIYVHPFD 144
            T+V+P +T     + +   G+QV++ G  + EA    KA+  +  + + +  I   PFD
Sbjct: 145 ATIVMPVSTPSIKYQNVSRLGSQVVLYGNDFDEA----KAECTKLAEERGLTNI--PPFD 198

Query: 145 NPDIWEGHSSMVDEMVQDLEFQRISMNKVKGIVCSVGGGGLYNGIVQGLERYGLADKIPI 204
           +P +  G  ++  E+++ +     + NK+  +   VGGGG   G+   L+R  +A  I +
Sbjct: 199 HPYVIAGQGTVAMEILRQVH----NANKIGAVFVPVGGGGFIAGVGAYLKR--IAPHIKV 252

Query: 205 VGVETNGCHVFNTSLRIGQPVQFKKITSIATSLGTAVISNQTFDYARKYNTRSVVIEDKD 264
           +GVET      +TSL+  +      + + A      VI  +TF  A++     V++   +
Sbjct: 253 IGVETFDAATLHTSLKHNKRTPLPTVGTFADGTSVRVIGEETFRVAQQVVDEVVLVNTDE 312

Query: 265 VIDTCLKYTHQFNMVVEPACGAAL 288
           +             +VEP+   A+
Sbjct: 313 ICAAVKDIFEDTRSIVEPSGALAV 336

>Kpol_530.16 s530 complement(41170..42870) [1701 bp, 566 aa] {ON}
           complement(41170..42870) [1701 nt, 567 aa]
          Length = 566

 Score = 62.8 bits (151), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 66/259 (25%), Positives = 117/259 (45%), Gaps = 17/259 (6%)

Query: 25  LKYECLQPSGSFKSRGIGNLIMKSAIRIQKDGKKSPQIXXXXXXXXXXXXXXXCQRLSLP 84
           LK E L P  SFK RG  N++ K       D +K+  +                + L++P
Sbjct: 87  LKREDLLPVFSFKLRGAYNMMAK-----LDDSQKNQGVIACSAGNHAQGIAYAAKHLNIP 141

Query: 85  CTVVVPTATKKRMVEKIRNTGAQVIVSGAYWKEADTFLKADVMQKIDTQVVEPIYVHPFD 144
            T+V+P +T     + +   G+QV++ G  + EA    KA+  +  + + +  I   PFD
Sbjct: 142 ATIVMPVSTPSIKYQNVSRLGSQVVLYGNDFDEA----KAECARLAEERGLTNI--PPFD 195

Query: 145 NPDIWEGHSSMVDEMVQDLEFQRISMNKVKGIVCSVGGGGLYNGIVQGLERYGLADKIPI 204
           +P +  G  ++  E+++ +       NK+  +   VGGGGL  G+   L+R  +A  I I
Sbjct: 196 HPYVIAGQGTVAMEILRQVH----KANKIGAVFVPVGGGGLIAGVGAYLKR--IAPHIKI 249

Query: 205 VGVETNGCHVFNTSLRIGQPVQFKKITSIATSLGTAVISNQTFDYARKYNTRSVVIEDKD 264
           +GVET   +   TSL+ G+ V    + + A      +I  +TF   ++     V++   +
Sbjct: 250 IGVETFDANCLYTSLQSGKRVPLSSVGTFADGTAVRLIGEETFRVCQEVVDEVVLVNTDE 309

Query: 265 VIDTCLKYTHQFNMVVEPA 283
           +             +VEP+
Sbjct: 310 ICAAVKDVFEDTRSIVEPS 328

>Suva_5.199 Chr5 (303073..304803) [1731 bp, 576 aa] {ON} YER086W
           (REAL)
          Length = 576

 Score = 62.4 bits (150), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 65/259 (25%), Positives = 115/259 (44%), Gaps = 17/259 (6%)

Query: 25  LKYECLQPSGSFKSRGIGNLIMKSAIRIQKDGKKSPQIXXXXXXXXXXXXXXXCQRLSLP 84
           LK E L P  SFK RG  N+I K       D +++  +                + L +P
Sbjct: 97  LKREDLLPVFSFKLRGAYNMIAK-----LDDSQRNQGVIACSAGNHAQGVAFAAKHLKIP 151

Query: 85  CTVVVPTATKKRMVEKIRNTGAQVIVSGAYWKEADTFLKADVMQKIDTQVVEPIYVHPFD 144
            T+V+P  T     + +   G+QV++ G  + EA    KA+  +  + + +  I   PFD
Sbjct: 152 ATIVMPVCTPSIKYQNVSRLGSQVVLFGNDFDEA----KAECTKLAEERGLTNI--PPFD 205

Query: 145 NPDIWEGHSSMVDEMVQDLEFQRISMNKVKGIVCSVGGGGLYNGIVQGLERYGLADKIPI 204
           +P +  G  ++  E+++ +     ++NK+  +   VGGGGL  GI   L+R  +A  I +
Sbjct: 206 HPYVIAGQGTVAMEILRQVR----TVNKIGAVFVPVGGGGLIAGIGAYLKR--IAPHIKV 259

Query: 205 VGVETNGCHVFNTSLRIGQPVQFKKITSIATSLGTAVISNQTFDYARKYNTRSVVIEDKD 264
           +GVET      + SL+  Q      + + A      +I  +TF  A++     V++   +
Sbjct: 260 IGVETYDAATLHNSLQRNQRTPLPAVGTFADGTSVRMIGEETFRVAQQVVDEVVLVNTDE 319

Query: 265 VIDTCLKYTHQFNMVVEPA 283
           +             +VEP+
Sbjct: 320 ICAAVKDVFEDTRSIVEPS 338

>NDAI0A01810 Chr1 complement(400890..402602) [1713 bp, 570 aa] {ON}
           Anc_7.367
          Length = 570

 Score = 61.6 bits (148), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 66/259 (25%), Positives = 117/259 (45%), Gaps = 17/259 (6%)

Query: 25  LKYECLQPSGSFKSRGIGNLIMKSAIRIQKDGKKSPQIXXXXXXXXXXXXXXXCQRLSLP 84
           LK E L P  SFK RG  N+I K       D +++  +                + L++P
Sbjct: 91  LKREDLLPVFSFKLRGAYNMIAK-----LDDSQRNQGVIACSAGNHAQGVAFAAKHLNIP 145

Query: 85  CTVVVPTATKKRMVEKIRNTGAQVIVSGAYWKEADTFLKADVMQKIDTQVVEPIYVHPFD 144
            T+V+P +T     + +   G+QV++ G  + EA    KA+  +  + + +  I   PFD
Sbjct: 146 ATIVMPVSTPSIKYQNVSRLGSQVVLYGNDFDEA----KAECTKLAEERGLTNI--PPFD 199

Query: 145 NPDIWEGHSSMVDEMVQDLEFQRISMNKVKGIVCSVGGGGLYNGIVQGLERYGLADKIPI 204
           +P +  G  ++  E+++ +     + NK+  +   VGGGGL  G+   L+R  +A  I I
Sbjct: 200 HPYVIAGQGTVAMEILRQVH----NANKIGAVFVPVGGGGLVAGVGAYLKR--IAPHIKI 253

Query: 205 VGVETNGCHVFNTSLRIGQPVQFKKITSIATSLGTAVISNQTFDYARKYNTRSVVIEDKD 264
           +GVET+      TSL+ G+      +   A      +I  +TF  A++     V++   +
Sbjct: 254 IGVETHDAATLQTSLKHGRRTPLSVVGPFADGTSVRLIGEETFRVAQEVVDEVVLVNTDE 313

Query: 265 VIDTCLKYTHQFNMVVEPA 283
           +             +VEP+
Sbjct: 314 ICAAVKDVFEDTRSIVEPS 332

>TPHA0F03130 Chr6 complement(685292..686998) [1707 bp, 568 aa] {ON}
           Anc_7.367 YER086W
          Length = 568

 Score = 61.2 bits (147), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 65/264 (24%), Positives = 118/264 (44%), Gaps = 17/264 (6%)

Query: 25  LKYECLQPSGSFKSRGIGNLIMKSAIRIQKDGKKSPQIXXXXXXXXXXXXXXXCQRLSLP 84
           LK + L P  SFK RG  N++ K       D +K+  +                + L +P
Sbjct: 89  LKRDDLLPVFSFKLRGAYNMMAK-----LDDTQKNQGVIACSAGNHAQGVAYAAKHLKIP 143

Query: 85  CTVVVPTATKKRMVEKIRNTGAQVIVSGAYWKEADTFLKADVMQKIDTQVVEPIYVHPFD 144
            T+V+P +T     + +   G+QV++ G  + EA    KA+  +  + + +  I   PFD
Sbjct: 144 ATIVMPVSTPSIKYQNVSRLGSQVVLYGNDFDEA----KAECARLAEERGLTNI--PPFD 197

Query: 145 NPDIWEGHSSMVDEMVQDLEFQRISMNKVKGIVCSVGGGGLYNGIVQGLERYGLADKIPI 204
           +P +  G  ++  E+++ +       +K+  +   VGGGGL  G+   L+R  +A  I I
Sbjct: 198 HPYVIAGQGTVAMEILRQVHMS----SKIGAVFVPVGGGGLIAGVGTYLKR--IAPHIKI 251

Query: 205 VGVETNGCHVFNTSLRIGQPVQFKKITSIATSLGTAVISNQTFDYARKYNTRSVVIEDKD 264
           +GVET       TSL+ G+    + + S A      ++  +TF  A++     V++   +
Sbjct: 252 IGVETYDACALYTSLQSGKRAALESVGSFADGTAVRLLGEETFRVAQEVVDEVVLVNTDE 311

Query: 265 VIDTCLKYTHQFNMVVEPACGAAL 288
           +             +VEP+   A+
Sbjct: 312 ICAGIKDIFEDTRSIVEPSGALAV 335

>SAKL0A10626g Chr1 complement(932879..933841) [963 bp, 320 aa] {ON}
           similar to uniprot|P36007 Saccharomyces cerevisiae
           YKL218C SRY1 3-hydroxyaspartate dehydratase deaminates
           L- threo-3-hydroxyaspartate to form oxaloacetate and
           ammonia required for survival in the presence of
           hydroxyaspartate
          Length = 320

 Score = 60.5 bits (145), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 74/314 (23%), Positives = 132/314 (42%), Gaps = 30/314 (9%)

Query: 6   NKTPLL-RQFFPGKSPAQFFLKYECLQPSGSFKSRGIGNLIMKSAIRIQKDGKKSPQIXX 64
           NKTP+L  +    +  A+ + K E  Q  G+FK RG  N ++K         +++  +  
Sbjct: 21  NKTPVLTSRTVNAELGAEVYFKCENFQRIGAFKFRGAMNTLLK-----LTQEQRAAGVVA 75

Query: 65  XXXXXXXXXXXXXCQRLSLPCTVVVPTATKKRMVEKIRNTGAQVIVSGAYWKEADTFLKA 124
                         + L +P T+V+P       V      GA ++    Y ++ +   +A
Sbjct: 76  FSSGNHAQAIALSAKLLGVPATIVMPNDAPAAKVRATAGYGANIVRYDRYTEDREQIGRA 135

Query: 125 DVMQKIDTQVVEPIYVHPFDNPDIWEGHSSMVDEMVQDLEFQRISMNKVKGIVCSVGGGG 184
              +K  T       V P+D+PD+  G  +   E+++++        ++  +   +GGGG
Sbjct: 136 LAEEKGLT------LVPPYDHPDVIAGQGTAAKELIEEV-------GELDLLFVPLGGGG 182

Query: 185 LYNGIVQGLERYGLADKIPIVGVETNGCHVFNTSLRIGQPVQFKKITSIATSLGTAVISN 244
           L +G     +R  L+ +  I+GVE    +    SLR G  V      +IA    T  +  
Sbjct: 183 LLSGSALAAKR--LSPRCEIIGVEPEAGNDGQQSLRSGSIVHIDTPETIADGAQTQHLGQ 240

Query: 245 QTFDYARKYNTRSVVIEDKDVIDTCLKYTHQFNMVVEP-ACGAALHLGYNTEILERALGS 303
            TF+         +   D +++D+   +  +  +VVEP  C     LG+      RA  +
Sbjct: 241 YTFEVIHANVADILTASDAELVDSMRFFAERMKIVVEPTGC-----LGFAA---ARAQKA 292

Query: 304 KLAADDIVIIIACG 317
           KLA   + II++ G
Sbjct: 293 KLAGKRVGIIVSGG 306

>Skud_5.205 Chr5 (322688..324418) [1731 bp, 576 aa] {ON} YER086W
           (REAL)
          Length = 576

 Score = 61.2 bits (147), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 66/259 (25%), Positives = 114/259 (44%), Gaps = 17/259 (6%)

Query: 25  LKYECLQPSGSFKSRGIGNLIMKSAIRIQKDGKKSPQIXXXXXXXXXXXXXXXCQRLSLP 84
           LK E L P  SFK RG  N+I K       D +++  +                + L +P
Sbjct: 97  LKREDLLPVFSFKLRGAYNMIAK-----LDDSQRNQGVIACSAGNHAQGVAFAAKHLKIP 151

Query: 85  CTVVVPTATKKRMVEKIRNTGAQVIVSGAYWKEADTFLKADVMQKIDTQVVEPIYVHPFD 144
            T+V+P  T     + +   G+QV++ G  + EA    KA+  +  + + +  I   PFD
Sbjct: 152 ATIVMPVCTPSIKYQNVSRLGSQVVLYGNDFDEA----KAECAKLAEERGLTNI--PPFD 205

Query: 145 NPDIWEGHSSMVDEMVQDLEFQRISMNKVKGIVCSVGGGGLYNGIVQGLERYGLADKIPI 204
           +P +  G  ++  E+++ +     + NK+  +   VGGGGL  GI   L+R  +A  I +
Sbjct: 206 HPYVIAGQGTVAMEILRQVR----TANKIGAVFVPVGGGGLIAGIGAYLKR--VAPHIKV 259

Query: 205 VGVETNGCHVFNTSLRIGQPVQFKKITSIATSLGTAVISNQTFDYARKYNTRSVVIEDKD 264
           +GVET      + SL+  Q      + S A      +I  +TF  A++     V++   +
Sbjct: 260 IGVETFDAPTLHNSLQRNQRTPLPVVGSFADGTSVRMIGEETFRVAQQVVDEVVLVNTDE 319

Query: 265 VIDTCLKYTHQFNMVVEPA 283
           +             +VEP+
Sbjct: 320 ICAAVKDVFEDTRSIVEPS 338

>YER086W Chr5 (328477..330207) [1731 bp, 576 aa] {ON}  ILV1Threonine
           deaminase, catalyzes the first step in isoleucine
           biosynthesis; expression is under general amino acid
           control; ILV1 locus exhibits highly positioned
           nucleosomes whose organization is independent of known
           ILV1 regulation
          Length = 576

 Score = 61.2 bits (147), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 66/259 (25%), Positives = 114/259 (44%), Gaps = 17/259 (6%)

Query: 25  LKYECLQPSGSFKSRGIGNLIMKSAIRIQKDGKKSPQIXXXXXXXXXXXXXXXCQRLSLP 84
           LK E L P  SFK RG  N+I K       D +++  +                + L +P
Sbjct: 97  LKREDLLPVFSFKLRGAYNMIAK-----LDDSQRNQGVIACSAGNHAQGVAFAAKHLKIP 151

Query: 85  CTVVVPTATKKRMVEKIRNTGAQVIVSGAYWKEADTFLKADVMQKIDTQVVEPIYVHPFD 144
            T+V+P  T     + +   G+QV++ G  + EA    KA+  +  + + +  I   PFD
Sbjct: 152 ATIVMPVCTPSIKYQNVSRLGSQVVLYGNDFDEA----KAECAKLAEERGLTNI--PPFD 205

Query: 145 NPDIWEGHSSMVDEMVQDLEFQRISMNKVKGIVCSVGGGGLYNGIVQGLERYGLADKIPI 204
           +P +  G  ++  E+++ +     + NK+  +   VGGGGL  GI   L+R  +A  I I
Sbjct: 206 HPYVIAGQGTVAMEILRQVR----TANKIGAVFVPVGGGGLIAGIGAYLKR--VAPHIKI 259

Query: 205 VGVETNGCHVFNTSLRIGQPVQFKKITSIATSLGTAVISNQTFDYARKYNTRSVVIEDKD 264
           +GVET      + SL+  Q      + + A      +I  +TF  A++     V++   +
Sbjct: 260 IGVETYDAATLHNSLQRNQRTPLPVVGTFADGTSVRMIGEETFRVAQQVVDEVVLVNTDE 319

Query: 265 VIDTCLKYTHQFNMVVEPA 283
           +             +VEP+
Sbjct: 320 ICAAVKDIFEDTRSIVEPS 338

>Smik_5.225 Chr5 (337064..338794) [1731 bp, 576 aa] {ON} YER086W
           (REAL)
          Length = 576

 Score = 60.5 bits (145), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 65/259 (25%), Positives = 114/259 (44%), Gaps = 17/259 (6%)

Query: 25  LKYECLQPSGSFKSRGIGNLIMKSAIRIQKDGKKSPQIXXXXXXXXXXXXXXXCQRLSLP 84
           LK E L P  SFK RG  N+I K       D +++  +                + L +P
Sbjct: 97  LKREDLLPVFSFKLRGAYNMIAK-----LDDSQRNQGVIACSAGNHAQGVAFAAKHLKIP 151

Query: 85  CTVVVPTATKKRMVEKIRNTGAQVIVSGAYWKEADTFLKADVMQKIDTQVVEPIYVHPFD 144
            T+V+P  T     + +   G+QV++ G  + EA    KA+  +  + + +  I   PFD
Sbjct: 152 ATIVMPVCTPSIKYQNVSRLGSQVVLYGNDFDEA----KAECAKLAEERGLTNI--PPFD 205

Query: 145 NPDIWEGHSSMVDEMVQDLEFQRISMNKVKGIVCSVGGGGLYNGIVQGLERYGLADKIPI 204
           +P +  G  ++  E+++ +     + NK+  +   VGGGGL  GI   L+R  +A  I +
Sbjct: 206 HPYVIAGQGTVAMEILRQVR----TANKIGAVFVPVGGGGLIAGIGAYLKR--VAPHIKV 259

Query: 205 VGVETNGCHVFNTSLRIGQPVQFKKITSIATSLGTAVISNQTFDYARKYNTRSVVIEDKD 264
           +GVET      + SL+  Q      + + A      +I  +TF  A++     V++   +
Sbjct: 260 IGVETYDAATLHNSLQRNQRTPLPVVGTFADGTSVRMIGEETFRVAQQVVDEVVLVNTDE 319

Query: 265 VIDTCLKYTHQFNMVVEPA 283
           +             +VEP+
Sbjct: 320 ICAAVKDIFEDTRSIVEPS 338

>ZYRO0B02772g Chr2 (224426..226135) [1710 bp, 569 aa] {ON} highly
           similar to uniprot|P00927 Saccharomyces cerevisiae
           YER086W ILV1 Threonine deaminase catalyzes the first
           step in isoleucine biosynthesis expression is under
           general amino acid control ILV1 locus exhibits highly
           positioned nucleosomes whose organization is independent
           of known ILV1 regulation
          Length = 569

 Score = 60.5 bits (145), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 64/259 (24%), Positives = 118/259 (45%), Gaps = 17/259 (6%)

Query: 25  LKYECLQPSGSFKSRGIGNLIMKSAIRIQKDGKKSPQIXXXXXXXXXXXXXXXCQRLSLP 84
           LK E L P  SFK RG  N+I K       + +K+  +                + +++P
Sbjct: 90  LKREDLLPVFSFKLRGAYNMIAK-----LDENQKNQGVIACSAGNHAQGVAYAARHMNIP 144

Query: 85  CTVVVPTATKKRMVEKIRNTGAQVIVSGAYWKEADTFLKADVMQKIDTQVVEPIYVHPFD 144
            T+V+P +T     + +   G+QV++ G  + EA    KA+  +  + + +  I   PFD
Sbjct: 145 ATIVMPVSTPSIKYQNVSRLGSQVVLYGNDFDEA----KAECAKLAEERGLTNI--PPFD 198

Query: 145 NPDIWEGHSSMVDEMVQDLEFQRISMNKVKGIVCSVGGGGLYNGIVQGLERYGLADKIPI 204
           +P +  G  ++  E+++ +     +  K+  +   VGGGGL  GI   L+R  +A  I I
Sbjct: 199 HPYVIAGQGTVAMEILRQVH----NSLKIGAVFVPVGGGGLIAGIGAYLKR--IAPHIKI 252

Query: 205 VGVETNGCHVFNTSLRIGQPVQFKKITSIATSLGTAVISNQTFDYARKYNTRSVVIEDKD 264
           VGVET+     + S++ G+    K + S A      +I  +TF  +++     V++   +
Sbjct: 253 VGVETHDAPTLSASMKTGKRELLKTVGSFADGTSVRIIGEETFRVSQEVVDEIVLVNTDE 312

Query: 265 VIDTCLKYTHQFNMVVEPA 283
           +             ++EP+
Sbjct: 313 ICAAVKDIFEDTRSIIEPS 331

>TDEL0C01800 Chr3 complement(313699..315408) [1710 bp, 569 aa] {ON}
           Anc_7.367 YER086W
          Length = 569

 Score = 59.7 bits (143), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 67/264 (25%), Positives = 117/264 (44%), Gaps = 17/264 (6%)

Query: 25  LKYECLQPSGSFKSRGIGNLIMKSAIRIQKDGKKSPQIXXXXXXXXXXXXXXXCQRLSLP 84
           LK E L P  SFK RG  N+I K       D +K+  +                + +S+P
Sbjct: 90  LKREDLLPVFSFKLRGAYNMIAK-----LDDSQKNQGVIACSAGNHAQGVAFAAKHMSIP 144

Query: 85  CTVVVPTATKKRMVEKIRNTGAQVIVSGAYWKEADTFLKADVMQKIDTQVVEPIYVHPFD 144
            T+V+P +T     + +   G+QV++ G  + EA    KA+  +  + + +  I   PFD
Sbjct: 145 ATIVMPVSTPSIKYQNVSRLGSQVVLYGNDFDEA----KAECTRLSEERGLTNI--PPFD 198

Query: 145 NPDIWEGHSSMVDEMVQDLEFQRISMNKVKGIVCSVGGGGLYNGIVQGLERYGLADKIPI 204
           +P +  G  ++  E+++ +     +  K+  +    GGGGL  GI   L+R  +A  I I
Sbjct: 199 HPYVIAGQGTVAMEILRQVR----NSAKIGAVFVPCGGGGLVAGIGAYLKR--IAPHIKI 252

Query: 205 VGVETNGCHVFNTSLRIGQPVQFKKITSIATSLGTAVISNQTFDYARKYNTRSVVIEDKD 264
           +GVET      +TSL+ G+      + + A      +I  +TF  A+      V++   +
Sbjct: 253 IGVETFDSATLHTSLKNGKRTPLASVGTFADGTSVRMIGEETFRIAQDVVDEVVLVGTDE 312

Query: 265 VIDTCLKYTHQFNMVVEPACGAAL 288
           +             +VEP+   A+
Sbjct: 313 ICAAIKDIFEDTRGIVEPSGALAV 336

>Ecym_4708 Chr4 (1386138..1387850) [1713 bp, 570 aa] {ON} similar to
           Ashbya gossypii ACR232C
          Length = 570

 Score = 58.9 bits (141), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 66/286 (23%), Positives = 123/286 (43%), Gaps = 18/286 (6%)

Query: 4   VYNKTPLLR-QFFPGKSPAQFFLKYECLQPSGSFKSRGIGNLIMKSAIRIQKDGKKSPQI 62
           + N++P+ R +F   +      LK E L P  SFK RG  N+I         D +K   +
Sbjct: 69  IINESPISRSEFLSSRLNTDVQLKREDLLPVFSFKLRGAYNMISH-----LDDVQKKCGV 123

Query: 63  XXXXXXXXXXXXXXXCQRLSLPCTVVVPTATKKRMVEKIRNTGAQVIVSGAYWKEADTFL 122
                           + L +P T+V+P +T     + +   GA+V++ G      D F 
Sbjct: 124 IACSAGNHAQGVAYSAKHLGIPATIVMPVSTPSIKYQNVSRLGAEVVLYG------DNFD 177

Query: 123 KADVMQKIDTQVVEPIYVHPFDNPDIWEGHSSMVDEMVQDLEFQRISMNKVKGIVCSVGG 182
            A V     ++      + PFD+P +  G  ++  E+++ ++    + +K+  + C+VGG
Sbjct: 178 AAKVECSRLSEEKGLYDIPPFDHPYVIAGQGTIAMEILKQIQ----NSSKIGAVFCAVGG 233

Query: 183 GGLYNGIVQGLERYGLADKIPIVGVETNGCHVFNTSLRIGQPVQFKKITSIATSLGTAVI 242
           GGL  G+   ++R   A  I ++GVET      +TS++        ++   A      +I
Sbjct: 234 GGLIAGVGAYIKR--AAPHIKVIGVETYDAATLHTSMQNNARTTLSQVGGFADGTSVRLI 291

Query: 243 SNQTFDYARKYNTRSVVIEDKDVIDTCLKYTHQFNMVVEPACGAAL 288
             ++F  AR+     +++   ++             VVEP+   A+
Sbjct: 292 GEESFRVAREVVDEVILVNTDEICAAIKDIFEDTRAVVEPSGALAV 337

>KLLA0E19779g Chr5 complement(1760800..1762503) [1704 bp, 567 aa]
           {ON} highly similar to uniprot|P00927 Saccharomyces
           cerevisiae YER086W ILV1 Threonine deaminase catalyzes
           the first step in isoleucine biosynthesis expression is
           under general amino acid control ILV1 locus exhibits
           highly positioned nucleosomes whose organization is
           independent of known ILV1 regulation
          Length = 567

 Score = 58.9 bits (141), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 62/264 (23%), Positives = 118/264 (44%), Gaps = 17/264 (6%)

Query: 25  LKYECLQPSGSFKSRGIGNLIMKSAIRIQKDGKKSPQIXXXXXXXXXXXXXXXCQRLSLP 84
           LK E L P  SFK RG  N+I K       + +K+  +                  +++P
Sbjct: 88  LKREDLLPVFSFKLRGAYNMIAK-----LDETQKNAGVIACSAGNHAQGVAFSSNHMNIP 142

Query: 85  CTVVVPTATKKRMVEKIRNTGAQVIVSGAYWKEADTFLKADVMQKIDTQVVEPIYVHPFD 144
            T+V+P +T     + +   GAQV++ G  + EA    K +  +  + + +  I   PFD
Sbjct: 143 ATIVMPVSTPSIKYQNVSRLGAQVVLYGDDFDEA----KLECARLAEERGMTDI--PPFD 196

Query: 145 NPDIWEGHSSMVDEMVQDLEFQRISMNKVKGIVCSVGGGGLYNGIVQGLERYGLADKIPI 204
           +P +  G  ++  E+++ ++    + + +  + C+VGGGGL +GI   L+R  +A  I +
Sbjct: 197 HPYVIAGQGTIAMEILRQVQ----NGSNIGAVFCAVGGGGLISGIGSYLKR--IAPHIKV 250

Query: 205 VGVETNGCHVFNTSLRIGQPVQFKKITSIATSLGTAVISNQTFDYARKYNTRSVVIEDKD 264
           +GVET      + SL+ G+      + + A      +I  +TF   +      +++   +
Sbjct: 251 IGVETYDAATLDVSLKNGKRTPLPSVGTFADGTSVRLIGEETFRVCQDVVDEVILVNTDE 310

Query: 265 VIDTCLKYTHQFNMVVEPACGAAL 288
           +             +VEP+   A+
Sbjct: 311 ICAAVKDVFEDTRSIVEPSGALAV 334

>ACR232C Chr3 complement(767330..769012) [1683 bp, 560 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YER086W
           (ILV1)
          Length = 560

 Score = 58.5 bits (140), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 64/259 (24%), Positives = 114/259 (44%), Gaps = 17/259 (6%)

Query: 25  LKYECLQPSGSFKSRGIGNLIMKSAIRIQKDGKKSPQIXXXXXXXXXXXXXXXCQRLSLP 84
           LK E L P  SFK RG  N+I         + +KS  +                + L + 
Sbjct: 82  LKREDLLPVFSFKLRGAYNMISN-----LDEYQKSAGVIACSAGNHAQGVAFSARELGIR 136

Query: 85  CTVVVPTATKKRMVEKIRNTGAQVIVSGAYWKEADTFLKADVMQKIDTQVVEPIYVHPFD 144
             +V+PT+T       +   GA+V++ G  + EA    KA+  +    Q+ +   + PFD
Sbjct: 137 AMIVMPTSTPSIKYNSVAAMGAEVVLYGKDFDEA----KAECARL--AQLHKLTDIPPFD 190

Query: 145 NPDIWEGHSSMVDEMVQDLEFQRISMNKVKGIVCSVGGGGLYNGIVQGLERYGLADKIPI 204
           +P +  G  ++  E+++ +     + +++  + C VGGGGL  GI   L+R  +A  I I
Sbjct: 191 HPYVIAGQGTIATEILRQVH----NASQIGAVFCGVGGGGLIAGIGSYLKR--IAPHIKI 244

Query: 205 VGVETNGCHVFNTSLRIGQPVQFKKITSIATSLGTAVISNQTFDYARKYNTRSVVIEDKD 264
           +GVET+     +T+L+ G+      +   A      ++  +TF  AR      V++   +
Sbjct: 245 IGVETHDAPTLHTALKQGRRTMLPAVGCFADGTSVRMMGEETFRVARDVVDEVVLVNTDE 304

Query: 265 VIDTCLKYTHQFNMVVEPA 283
           +             +VEP+
Sbjct: 305 LCAAIKDIFEDTRAIVEPS 323

>KNAG0C03690 Chr3 complement(722238..723971) [1734 bp, 577 aa] {ON}
           Anc_7.367 YER086W
          Length = 577

 Score = 57.8 bits (138), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 66/264 (25%), Positives = 115/264 (43%), Gaps = 17/264 (6%)

Query: 25  LKYECLQPSGSFKSRGIGNLIMKSAIRIQKDGKKSPQIXXXXXXXXXXXXXXXCQRLSLP 84
           LK E L P  SFK RG  N++ K       D +K+  +                + L +P
Sbjct: 98  LKREDLLPVFSFKLRGAYNMMAK-----LDDTQKNQGVIACSAGNHAQGVAFAAKHLDIP 152

Query: 85  CTVVVPTATKKRMVEKIRNTGAQVIVSGAYWKEADTFLKADVMQKIDTQVVEPIYVHPFD 144
            T+V+P +T     + +   G+QV++ G  + EA    KA+  +    + +  I   PFD
Sbjct: 153 ATIVMPVSTPSIKYQNVSRLGSQVVLYGNDFDEA----KAECTKLSKERGLTNI--PPFD 206

Query: 145 NPDIWEGHSSMVDEMVQDLEFQRISMNKVKGIVCSVGGGGLYNGIVQGLERYGLADKIPI 204
           +P +  G  ++  E+++ +       NK+  +   VGGGGL  G+   L+R  +A  I I
Sbjct: 207 HPYVIAGQGTVAMEILRQVHI----ANKIGAVFVPVGGGGLVAGVGAYLKR--IAPHIKI 260

Query: 205 VGVETNGCHVFNTSLRIGQPVQFKKITSIATSLGTAVISNQTFDYARKYNTRSVVIEDKD 264
           +GVET       TSL+ G+      + + A      +I  +TF  ++      V++   +
Sbjct: 261 IGVETFDASTLYTSLQRGRRTSLPSVGTFADGTSVKLIGEETFRISQDVVDEVVLVNTDE 320

Query: 265 VIDTCLKYTHQFNMVVEPACGAAL 288
           +             +VEP+   A+
Sbjct: 321 ICAAVKDIFEDTRSIVEPSGALAV 344

>TBLA0C05070 Chr3 (1230732..1232459) [1728 bp, 575 aa] {ON}
           Anc_7.367 YER086W
          Length = 575

 Score = 54.7 bits (130), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 68/281 (24%), Positives = 123/281 (43%), Gaps = 18/281 (6%)

Query: 4   VYNKTPLLRQF-FPGKSPAQFFLKYECLQPSGSFKSRGIGNLIMKSAIRIQKDGKKSPQI 62
           V N++P+ +      K  +Q  LK E L P  SFK RG  N++ K     +K G     +
Sbjct: 69  VINESPMTKGIGLSSKLNSQIQLKREDLLPVFSFKMRGAYNMVAKLDETQRKQG-----V 123

Query: 63  XXXXXXXXXXXXXXXCQRLSLPCTVVVPTATKKRMVEKIRNTGAQVIVSGAYWKEADTFL 122
                           + L +P T+V+P +T     E +   G+QV++ G  +  +    
Sbjct: 124 IACSAGNHAQGVAYAAKHLGIPATIVMPVSTPSIKYENVSRLGSQVVLYGNDFDSS---- 179

Query: 123 KADVMQKIDTQVVEPIYVHPFDNPDIWEGHSSMVDEMVQDLEFQRISMNKVKGIVCSVGG 182
           K +  +  + + +  + + PFD+P +  G  ++  E+++ ++    +  K+  +   VGG
Sbjct: 180 KGECERLCEERGL--VNIPPFDHPYVIAGQGTVAMEILRQVK----NSAKIGAVFVPVGG 233

Query: 183 GGLYNGIVQGLERYGLADKIPIVGVETNGCHVFNTSLRIGQPVQFKKITSIATSLGTAVI 242
           GGL  GI   L+R  +A  I IVGVET       TSL  G+  +   + + A      +I
Sbjct: 234 GGLVAGIGAYLKR--IAPHIKIVGVETYDAATLKTSLDNGKRTELNTVGTFADGTAVKMI 291

Query: 243 SNQTFDYARKYNTRSVVIEDKDVIDTCLKYTHQFNMVVEPA 283
             +TF  ++      V++   ++             +VEP+
Sbjct: 292 GEETFRVSKDVVDEIVLVNTDELCAAVKDIFEDTRSIVEPS 332

>YKL218C Chr11 complement(17359..18339) [981 bp, 326 aa] {ON}
           SRY13-hydroxyaspartate dehydratase, deaminates
           L-threo-3-hydroxyaspartate to form oxaloacetate and
           ammonia; required in the presence of hydroxyaspartate;
           highly similar to mouse serine racemase (Srr) but has no
           serine racemase activity
          Length = 326

 Score = 53.9 bits (128), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 71/317 (22%), Positives = 125/317 (39%), Gaps = 36/317 (11%)

Query: 6   NKTPLL-RQFFPGKSPAQFFLKYECLQPSGSFKSRGIGNLIMKSAIRIQKDGKKSPQIXX 64
           NKTP+L  +    +  AQ + K E  Q  G+FK RG  N + K +     D K+S  +  
Sbjct: 21  NKTPVLTSRMLNDRLGAQIYFKGENFQRVGAFKFRGAMNAVSKLS-----DEKRSKGVIA 75

Query: 65  XXXXXXXXXXXXXCQRLSLPCTVVVPTATKKRMVEKIRNTGAQVIVSGAYWKEADTFLKA 124
                         + L++P T+V+P       V      GA +I    Y ++       
Sbjct: 76  FSSGNHAQAIALSAKLLNVPATIVMPEDAPALKVAATAGYGAHIIRYNRYTED------- 128

Query: 125 DVMQKIDTQVVEP---IYVHPFDNPDIWEGHSSMVDEMVQDLEFQRISMNKVKGIVCSVG 181
              ++I  Q+        + P+D+PD+  G  +   E+++++        ++  +   V 
Sbjct: 129 --REQIGRQLAAEHGFALIPPYDHPDVIAGQGTSAKELLEEV-------GQLDALF--VP 177

Query: 182 GGGLYNGIVQGLERYGLADKIPIVGVETNGCHVFNTSLRIGQPVQFKKITSIATSLGTAV 241
            GG        L    L+    I GVE    +    S R G  V      +IA    T  
Sbjct: 178 LGGGGLLSGSALAARSLSPGCKIFGVEPEAGNDGQQSFRSGSIVHINTPKTIADGAQTQH 237

Query: 242 ISNQTFDYARKYNTRSVVIEDKDVIDTCLKYTHQFNMVVEP-ACGAALHLGYNTEILERA 300
           +   TF   R+     + + D++++        +  +VVEP AC     LG+   +L++ 
Sbjct: 238 LGEYTFAIIRENVDDILTVSDQELVKCMHFLAERMKVVVEPTAC-----LGFAGALLKK- 291

Query: 301 LGSKLAADDIVIIIACG 317
              +L    + II++ G
Sbjct: 292 --EELVGKKVGIILSGG 306

>Kwal_33.14822 s33 complement(830029..831717) [1689 bp, 562 aa] {ON}
           YER086W (ILV1) - threonine deaminase [contig 101] FULL
          Length = 562

 Score = 50.8 bits (120), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 64/264 (24%), Positives = 112/264 (42%), Gaps = 17/264 (6%)

Query: 25  LKYECLQPSGSFKSRGIGNLIMKSAIRIQKDGKKSPQIXXXXXXXXXXXXXXXCQRLSLP 84
           LK E L P  SFK RG  N++ K A     +G+ +  +                + L++P
Sbjct: 83  LKREDLLPVFSFKLRGAYNMMAKLA-----EGQGNKGVIACSAGNHAQGVAFASRHLNIP 137

Query: 85  CTVVVPTATKKRMVEKIRNTGAQVIVSGAYWKEADTFLKADVMQKIDTQVVEPIYVHPFD 144
             +V+P  T     + +   G QV++ G  + EA    K +  +  + + +  I   PFD
Sbjct: 138 AIIVMPVNTPSIKYQNVSRLGGQVVLYGNDFDEA----KIECARISEERGLTNI--PPFD 191

Query: 145 NPDIWEGHSSMVDEMVQDLEFQRISMNKVKGIVCSVGGGGLYNGIVQGLERYGLADKIPI 204
           +P +  G  ++  E+++ +     + +K+  +   VGGGGL  G+   L+R  +A  I I
Sbjct: 192 HPYVIAGQGTVAMEILRQVH----NASKIGAVFVPVGGGGLVAGVAAYLKR--IAPHIKI 245

Query: 205 VGVETNGCHVFNTSLRIGQPVQFKKITSIATSLGTAVISNQTFDYARKYNTRSVVIEDKD 264
           VGVET       TSL  G       + + A      +I  +TF     +    V++   +
Sbjct: 246 VGVETYDSATLKTSLDAGCRTPLTSVGTFADGTSVRMIGEETFRICEDFVDEVVLVNTDE 305

Query: 265 VIDTCLKYTHQFNMVVEPACGAAL 288
           +             +VEP+   A+
Sbjct: 306 ICAAVKDIFEDTRSIVEPSGALAV 329

>KLTH0B04884g Chr2 (400193..401914) [1722 bp, 573 aa] {ON} highly
           similar to uniprot|P00927 Saccharomyces cerevisiae
           YER086W ILV1 Threonine deaminase catalyzes the first
           step in isoleucine biosynthesis expression is under
           general amino acid control ILV1 locus exhibits highly
           positioned nucleosomes whose organization is independent
           of known ILV1 regulation
          Length = 573

 Score = 48.9 bits (115), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 61/264 (23%), Positives = 109/264 (41%), Gaps = 17/264 (6%)

Query: 25  LKYECLQPSGSFKSRGIGNLIMKSAIRIQKDGKKSPQIXXXXXXXXXXXXXXXCQRLSLP 84
           LK E L P  SFK RG  N++ K +     + +K+  +                + L++P
Sbjct: 94  LKREDLLPVFSFKLRGAYNMMAKLS-----EAQKNQGVIACSAGNHAQGVAFASRHLNIP 148

Query: 85  CTVVVPTATKKRMVEKIRNTGAQVIVSGAYWKEADTFLKADVMQKIDTQVVEPIYVHPFD 144
             +V+P  T     + +   G QV++ G  + EA T       ++  T +       PFD
Sbjct: 149 AIIVMPVNTPSIKYQNVSRLGGQVVLYGNDFDEAKTECTRISEERGLTNIP------PFD 202

Query: 145 NPDIWEGHSSMVDEMVQDLEFQRISMNKVKGIVCSVGGGGLYNGIVQGLERYGLADKIPI 204
           +P +  G  ++  E+++ +     +  K+  +   VGGGGL  G+   L+R  +A  I I
Sbjct: 203 HPYVIAGQGTVAMEILRQVH----NAAKIGAVFVPVGGGGLVAGVAAYLKR--IAPHIKI 256

Query: 205 VGVETNGCHVFNTSLRIGQPVQFKKITSIATSLGTAVISNQTFDYARKYNTRSVVIEDKD 264
           +GVET       TSL  G       + + A      +I  +TF   +      +++   +
Sbjct: 257 IGVETYDSATLKTSLEAGTRTPLSTVGTFADGTSVRMIGEETFRICQDLVDDVILVNTDE 316

Query: 265 VIDTCLKYTHQFNMVVEPACGAAL 288
           +             +VEP+   A+
Sbjct: 317 ICAAVKDIFEDTRSIVEPSGALAV 340

>Skud_11.2 Chr11 complement(1812..2792) [981 bp, 326 aa] {ON}
           YKL218C (REAL)
          Length = 326

 Score = 46.2 bits (108), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 64/318 (20%), Positives = 125/318 (39%), Gaps = 38/318 (11%)

Query: 6   NKTPLL-RQFFPGKSPAQFFLKYECLQPSGSFKSRGIGNLIMKSAIRIQKDGKKSPQIXX 64
           NKTP+L  +    +  A+ + K E  Q  G+FK RG  N + K + + +K G     +  
Sbjct: 21  NKTPVLTSRTLNDRLEAEVYFKGENYQRVGAFKFRGAMNAVSKLSDKERKKG-----VIA 75

Query: 65  XXXXXXXXXXXXXCQRLSLPCTVVVPTATKKRMVEKIRNTGAQVIVSGAYWKEADTFLKA 124
                         +  ++P T+++P       V      GA +I    Y ++       
Sbjct: 76  FSSGNHAQAIALSAKLFNVPATIIMPEDAPALKVAATAGYGAHIIKYNRYTED------- 128

Query: 125 DVMQKIDTQVVEP---IYVHPFDNPDIWEGHSSMVDEMVQDL-EFQRISMNKVKGIVCSV 180
              + I  Q+      + + P+D+PD+  G  +   E+ +++ E   + +    G + S 
Sbjct: 129 --REHIGRQLAAKHGYVLIPPYDHPDVIAGQGTSAKELFEEVGELDALFVPLGGGGLLS- 185

Query: 181 GGGGLYNGIVQGLERYGLADKIPIVGVETNGCHVFNTSLRIGQPVQFKKITSIATSLGTA 240
                       L    L+    + GVE    +    S + G  V     ++IA    T 
Sbjct: 186 ---------GSALAARSLSPGCKVFGVEPEAGNDGQQSFKSGSIVHIDTPSTIADGAQTQ 236

Query: 241 VISNQTFDYARKYNTRSVVIEDKDVIDTCLKYTHQFNMVVEP-ACGAALHLGYNTEILER 299
            +   T+   R+     + + D+++++       +  +VVEP AC     LG+   +L++
Sbjct: 237 HLGEYTYAVIRENVDDILTVSDEELVECMHFLAERMKLVVEPTAC-----LGFAGALLKK 291

Query: 300 ALGSKLAADDIVIIIACG 317
               +L    + II++ G
Sbjct: 292 ---RELVGKKVGIILSGG 306

>Kwal_26.7518 s26 (398913..400394) [1482 bp, 493 aa] {ON} YGR155W
           (CYS4) - Cystathionine beta-synthase [contig 52] FULL
          Length = 493

 Score = 39.3 bits (90), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 45/200 (22%), Positives = 77/200 (38%), Gaps = 21/200 (10%)

Query: 22  QFFLKYECLQPSGSFKSRGIGNLIMKSAIRIQKDGKKSPQIXXXXXXXXXXXXXXXCQRL 81
           Q + K E   P GS K R     I K  I   +D +KS +I                  L
Sbjct: 34  QVYAKLELYNPGGSIKDR-----IAKCMI---EDAEKSGRIHPSRTTLIEPTSGNTGIGL 85

Query: 82  SLPCTV-------VVPTATKKRMVEKIRNTGAQVIVS--GAYWKEADTFLKADVMQKIDT 132
           +L   V        +P       V  ++  GA++I +   A W   ++ +   V +K++ 
Sbjct: 86  ALMGAVKGYRTIITLPEKMSNEKVSVLKALGAEIIRTPTAAAWDSPESHI--GVAKKLEK 143

Query: 133 QVVEPIYVHPFDNPDIWEGHSSMVDEMVQDLEFQRISMNKVKGIVCSVGGGGLYNGIVQG 192
           ++   + +  ++N    E H     + + +   QR    K+ G+    G GG  +GI + 
Sbjct: 144 EIPHAVILDQYNNMKNPEAHYLGTGKEIHEQLAQRGQFEKLHGVFAGAGTGGTISGIAKY 203

Query: 193 LERYGLADKIPIVGVETNGC 212
           L+       I IVG +  G 
Sbjct: 204 LKEQD--SNIKIVGADPEGS 221

>TBLA0E01580 Chr5 (373152..374672) [1521 bp, 506 aa] {ON} Anc_4.69
           YGR155W
          Length = 506

 Score = 37.7 bits (86), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 63/305 (20%), Positives = 117/305 (38%), Gaps = 38/305 (12%)

Query: 22  QFFLKYECLQPSGSFKSRGIGNLIMKSAIRIQKDGKKSPQIXXXXXXXXXXXXXXXCQRL 81
           + + K E   P GS K R    +I  +  R   D  +S  I                 + 
Sbjct: 31  KIYAKLELYNPGGSIKDRIAKYMIEDAEARGIIDPSRSTLIEPTSGNTGIGLALIGAIK- 89

Query: 82  SLPCTVVVPTATKKRMVEKIRNTGAQVIVS--GAYWKEADTFLKADVMQKIDTQVVEPIY 139
                + +P       V  ++  GA++I +   A W   ++ +   V +K++ ++   I 
Sbjct: 90  GYRTIITLPEKMSNEKVSVLKALGAEIIRTPTQAAWDSPESHI--GVAKKLEKEIPGAII 147

Query: 140 VHPFDNPD----IWEGHSSMVDEMVQDLEFQRISMNKVKGIVCSVGGGGLYNGIVQGLER 195
           +  ++N       +EG    + E +Q+L+       K+  ++   G GG  +GI + L+ 
Sbjct: 148 LDQYNNMQNPFAHYEGTGREIKEQLQELK----KYEKLNAVIAGAGTGGTISGIAKYLKE 203

Query: 196 YGLADKIPIVGVETNGCHVFNTSLRIGQPVQFKKITSIATSLGTAVISNQTFDYARKYNT 255
                KI IVG +  G         + QP +  +     T L    +    +D+      
Sbjct: 204 QN--PKIKIVGADPEGSI-------LAQPAKLNE-----TDLAEYKVEGIGYDFIPNVLD 249

Query: 256 RSVV-IEDKDVIDTCLKYTHQF----NMVVEPACGAALHLGYNTEILER-ALGSKLAADD 309
           RS+V +  K       KY  Q      M+V  + G+A      T ++E      +L  DD
Sbjct: 250 RSLVDVWYKTTDKPAFKYARQVIANEGMLVGGSSGSAF-----TALVEYCKEHPELTEDD 304

Query: 310 IVIII 314
           ++++I
Sbjct: 305 VIVVI 309

>KLTH0D04092g Chr4 (391381..392862) [1482 bp, 493 aa] {ON} highly
           similar to uniprot|P32582 Saccharomyces cerevisiae
           YGR155W CYS4 Cystathionine beta-synthase catalyzes the
           synthesis of cystathionine from serine and homocysteine
           the first committed step in cysteine biosynthesis
          Length = 493

 Score = 36.2 bits (82), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 44/200 (22%), Positives = 77/200 (38%), Gaps = 21/200 (10%)

Query: 22  QFFLKYECLQPSGSFKSRGIGNLIMKSAIRIQKDGKKSPQIXXXXXXXXXXXXXXXCQRL 81
           Q + K E   P GS K R     I KS I   +D +KS +I                  L
Sbjct: 34  QVYAKLELYNPGGSIKDR-----IAKSMI---EDAEKSGRIHPSRTTLIEPTSGNTGIGL 85

Query: 82  SLPCTV-------VVPTATKKRMVEKIRNTGAQVIVS--GAYWKEADTFLKADVMQKIDT 132
           +L   V        +P       V  ++  GA++I +   A W   ++ +   V +K++ 
Sbjct: 86  ALMGAVKGYRTIITLPEKMSNEKVSVLKALGAEIIRTPTAAAWDSPESHI--GVAKKLEK 143

Query: 133 QVVEPIYVHPFDNPDIWEGHSSMVDEMVQDLEFQRISMNKVKGIVCSVGGGGLYNGIVQG 192
           ++   + +  ++N    E H     + +Q    Q      + G+    G GG  +GI + 
Sbjct: 144 EIPHAVILDQYNNMKNPEAHYQGTGKEIQGQLQQLGEYENLHGVFAGAGTGGTISGISKY 203

Query: 193 LERYGLADKIPIVGVETNGC 212
           L+      +I I+G +  G 
Sbjct: 204 LKEQN--PEIKIIGADPEGS 221

>TDEL0F02810 Chr6 (511257..512750) [1494 bp, 497 aa] {ON} Anc_4.69
           YGR155W
          Length = 497

 Score = 34.3 bits (77), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 26/128 (20%), Positives = 58/128 (45%), Gaps = 6/128 (4%)

Query: 87  VVVPTATKKRMVEKIRNTGAQVIVS--GAYWKEADTFLKADVMQKIDTQVVEPIYVHPFD 144
           + +P       V  ++  GA+++ +   A W   ++ +   V +++  ++   + +  ++
Sbjct: 97  ITLPEKMSNEKVSVLKALGAEIVRTPTEAAWDSPESHI--GVAERLQKEIPGAVILDQYN 154

Query: 145 NPDIWEGHSSMVDEMVQDLEFQRISMNKVKGIVCSVGGGGLYNGIVQGLERYGLADKIPI 204
           NP   E H     + +QD   +    + +K ++   G GG  +GI + L+  G  + I I
Sbjct: 155 NPRNPEAHYLGTGKEIQDQLEKLGKFDSLKAVIAGAGTGGTISGISKWLK--GKNEDIKI 212

Query: 205 VGVETNGC 212
           VG +  G 
Sbjct: 213 VGADPVGS 220

>TBLA0B07240 Chr2 complement(1716738..1717877) [1140 bp, 379 aa]
           {ON} Anc_2.343 YDL104C
          Length = 379

 Score = 33.1 bits (74), Expect = 0.93,   Method: Compositional matrix adjust.
 Identities = 29/123 (23%), Positives = 58/123 (47%), Gaps = 5/123 (4%)

Query: 152 HSSMVDEMVQDLEFQRISMNKVKGIVCSVGGGGLYNGIVQGLE-RYGLA--DKIPIVGVE 208
           H   + +MV +L  Q+I ++    +VC+  G G+   +  GL+   GLA    +P+VGV 
Sbjct: 71  HQKYLADMV-NLILQKIPLDNKLDLVCATRGPGMPGSLAVGLDFAKGLAVGRGVPLVGVH 129

Query: 209 TNGCHVFNTSLRIGQPVQFKKITSIATSLGTAVISNQTFDYARKYNTRSVVIEDKDVIDT 268
               H+  + L+    + F   T + +   T ++ +++ +   K    ++ I   D +D 
Sbjct: 130 HMLGHLLVSRLKNESSLNFPFATLLVSGGHTQLVVSKSVE-EHKVICNTLDIAAGDALDK 188

Query: 269 CLK 271
           C +
Sbjct: 189 CAR 191

>KLLA0F09317g Chr6 (861757..863238) [1482 bp, 493 aa] {ON} similar
           to uniprot|P32582 Saccharomyces cerevisiae YGR155W CYS4
           Cystathionine beta-synthase catalyzes the synthesis of
           cystathionine from serine and homocysteine the first
           committed step in cysteine biosynthesis
          Length = 493

 Score = 33.1 bits (74), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 50/219 (22%), Positives = 87/219 (39%), Gaps = 28/219 (12%)

Query: 8   TPLLR-QFFP---GKSPAQFFLKYECLQPSGSFKSRGIGNLIMKSAIRI-QKDGKKSPQI 62
           TPL+R Q  P   G  P + + K E   P GS K R     I KS I   +++G   P  
Sbjct: 16  TPLIRLQKLPKAIGIKP-KVYAKLELYNPGGSIKDR-----IAKSMIEAAEEEGIIHPSR 69

Query: 63  XXXXXXXXXXXXXXXCQRLSLP---CTVVVPTATKKRMVEKIRNTGAQVIVS--GAYWKE 117
                              ++      + +P       V  ++  GA++I +   A W  
Sbjct: 70  STLIEPTSGNTGIGLALIGAIKGYRTIITLPEKMSNEKVSVLKALGAEIIRTPTAAAWDS 129

Query: 118 ADTFLKADVMQKIDTQVVEPIYVHPFDNPDIWEGH----SSMVDEMVQDLEFQRISMNKV 173
            ++ +   V  +++ ++   I +  ++N    E H       +   ++DL       +K+
Sbjct: 130 PESHIG--VALRLEKEIPGGIILDQYNNMKNPEAHYFGTGKEIHHQLEDLSL----FSKL 183

Query: 174 KGIVCSVGGGGLYNGIVQGLERYGLADKIPIVGVETNGC 212
           K +V   G GG  +GI + ++     DKI IVG +  G 
Sbjct: 184 KAVVAGAGTGGTISGISKYIKEQN--DKIAIVGADPVGS 220

>Smik_11.3 Chr11 complement(1725..2534) [810 bp, 269 aa] {ON}
           YKL218C (REAL)
          Length = 269

 Score = 32.3 bits (72), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 48/223 (21%), Positives = 85/223 (38%), Gaps = 27/223 (12%)

Query: 81  LSLPCTVVVPTATKKRMVEKIRNTGAQVIVSGAYWKEADTFLKADVMQKIDTQVVEP--- 137
           L++P T+V+P       V      GA +     Y ++ D         KI  Q+      
Sbjct: 35  LNVPATIVMPEDASTLKVAATTGYGAHITKYNRYTEDRD---------KIGRQLAAKHGF 85

Query: 138 IYVHPFDNPDIWEGHSSMVDEMVQDLEFQRISMNKVKGIVCSVGGGGLYNGIVQGLERYG 197
             + P+D+PD+  G S+   ++++++        ++  +   V  GG        L    
Sbjct: 86  ALIPPYDHPDVIAGQSASAKKLLEEV-------GQLDALF--VLLGGGGLLSGSTLASRS 136

Query: 198 LADKIPIVGVETNGCHVFNTSLRIGQPVQFKKITSIATSLGTAVISNQTFDYARKYNTRS 257
           L+    I GVE    +    S R G  V      +IA    T  +   TF   R+     
Sbjct: 137 LSPDCKIFGVEPEAGNDGQQSFRSGSVVHIDTPNTIAGEAQTQHLGEYTFAIIRENVDDI 196

Query: 258 VVIEDKDVIDTCLKYTHQFNMVVEP-ACGAALHLGYNTEILER 299
           + + D  +I+       +  +VV P AC     LG+   +L++
Sbjct: 197 LTVTDGKLIECMHFLAERMKLVVGPTAC-----LGHAGAVLKK 234

>AEL161W Chr5 (329283..330353) [1071 bp, 356 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YGR012W
          Length = 356

 Score = 32.0 bits (71), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 16/56 (28%), Positives = 28/56 (50%), Gaps = 2/56 (3%)

Query: 138 IYVHPFDNPDIWEGHSSMVDEMVQDLEFQRISMNKVKGIVCSVGGGGLYNGIVQGL 193
           ++ + FDN   W+ H +     +  L+  R +  +V    CS G GG ++GI + L
Sbjct: 156 VWTNQFDNEANWKAHYATTGPEI--LQQMRNAGLEVDAFTCSTGTGGTFSGIARYL 209

>Ecym_8022 Chr8 complement(57006..58418) [1413 bp, 470 aa] {ON}
           similar to Ashbya gossypii ACL032C
          Length = 470

 Score = 32.0 bits (71), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 26/78 (33%), Positives = 36/78 (46%), Gaps = 7/78 (8%)

Query: 283 ACGAALHLGYNTEILERALGSKLAADDIVIIIACGGSSNTIQDLEEALDH--FNKRSAPA 340
            CG   H+G    +L  A G  +   DIV I+A  GS+  +  L E L+   F     PA
Sbjct: 206 GCG---HIGSQLSVLAEAFGMHVLYYDIVTIMAL-GSAKQVPTLNELLNRSDFVSLHVPA 261

Query: 341 IEVTDNFIFPEKTTATLK 358
            E T+N +F     A +K
Sbjct: 262 TEETNN-MFSAPQMAAMK 278

>NCAS0I01120 Chr9 complement(205511..205990) [480 bp, 159 aa] {ON}
           Anc_3.357 YPR067W
          Length = 159

 Score = 30.8 bits (68), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 22/86 (25%), Positives = 43/86 (50%), Gaps = 3/86 (3%)

Query: 194 ERYGLADKIPIVGVETNGCHVFNTSLRIGQPVQFKKITSIATSLGTAVISNQTFDYARKY 253
           E Y  ++++  +GVE+ GCH F  +L +    Q ++ T   + +    I+ ++  Y    
Sbjct: 46  EIYKASNEVLKIGVESGGCHGFQYNLDLIPADQSQQETKRTSMMSLLRITIKSVVYVMPP 105

Query: 254 NTRSVVIED---KDVIDTCLKYTHQF 276
           +   V+I++   K + DT L YT + 
Sbjct: 106 DGGKVIIDENSLKILNDTVLNYTTEL 131

>Suva_12.178 Chr12 complement(273386..276646) [3261 bp, 1086 aa]
           {ON} YJR091C (REAL)
          Length = 1086

 Score = 30.8 bits (68), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 44/197 (22%), Positives = 77/197 (39%), Gaps = 32/197 (16%)

Query: 131 DTQ----VVEPIYVHPFDNPDIWEGHSSMVDEMVQDLEFQRISMNKVKGIVCSVGGGGLY 186
           DTQ    + EP+ V  FD P + E   S+   +  DLE +++++  ++ +   +    L 
Sbjct: 573 DTQNFGPLPEPLSVREFDPPKLRELRKSIDSNLFSDLEIEQLAIAMLEEL-PELSSDYLG 631

Query: 187 NGIVQGLERYG-----------LADKIPIVGVETNGCHVFNTSLRIGQ-PVQFKKITSIA 234
           N IVQ L  +             +  +  +GV  NG       + +   P Q  ++T   
Sbjct: 632 NTIVQKLFEHSSDIIRDIMLKKTSKYLTSMGVHKNGTWACQKMITMAHTPRQIMQVTQGV 691

Query: 235 TSLGTAVISNQTFDYARKYNTRSVVIEDKDVIDTCLKYTHQFNMVVEPACGAALHLGYNT 294
               T +I++Q  +Y               VI   LK+   +N  +  +  A   +    
Sbjct: 692 KDYCTPLINDQFGNY---------------VIQCVLKFGFPWNQFIFESIIANFWVIVQN 736

Query: 295 EILERALGSKLAADDIV 311
               RA+ + L A DIV
Sbjct: 737 RYGARAVRACLEAHDIV 753

>SAKL0H23364g Chr8 complement(2023937..2025424) [1488 bp, 495 aa]
           {ON} highly similar to uniprot|P32582 Saccharomyces
           cerevisiae YGR155W CYS4 Cystathionine beta-synthase
           catalyzes the synthesis of cystathionine from serine and
           homocysteine the first committed step in cysteine
           biosynthesis
          Length = 495

 Score = 30.4 bits (67), Expect = 7.4,   Method: Compositional matrix adjust.
 Identities = 38/197 (19%), Positives = 77/197 (39%), Gaps = 15/197 (7%)

Query: 22  QFFLKYECLQPSGSFKSRGIGNLIMKSAIRIQKDGKKSPQIXXXXXXXXXXXXXXXCQRL 81
           Q + K E   P GS K R   ++I  +  + Q    ++  I                 + 
Sbjct: 35  QIYAKLELYNPGGSIKDRIAKSMIEYAESQGQIHPSRTTLIEPTSGNTGIGLALIGAVK- 93

Query: 82  SLPCTVVVPTATKKRMVEKIRNTGAQVIVS--GAYWKEADTFLKADVMQKIDTQVVEPIY 139
                + +P       V  ++  GA++I +   A W   ++ +   V ++++ ++   + 
Sbjct: 94  GYRTIITLPEKMSNEKVSVLKALGAEIIRTPTAAAWDSPESHI--GVAKRLENEIPGAVI 151

Query: 140 VHPFDN---PDI-WEGHSSMVDEMVQDLEFQRISMNKVKGIVCSVGGGGLYNGIVQGLER 195
           +  ++N   PD  + G    +   + DL       +K+  ++   G GG  +GI + L+ 
Sbjct: 152 LDQYNNMKNPDAHYHGTGKEIQTQLNDLN----KFSKLHAVIAGAGTGGTISGISKYLKE 207

Query: 196 YGLADKIPIVGVETNGC 212
                KI IVG +  G 
Sbjct: 208 QD--SKIQIVGADPVGS 222

>KAFR0I01230 Chr9 (242855..244378) [1524 bp, 507 aa] {ON} Anc_4.69
           YGR155W
          Length = 507

 Score = 30.4 bits (67), Expect = 7.5,   Method: Compositional matrix adjust.
 Identities = 43/201 (21%), Positives = 76/201 (37%), Gaps = 23/201 (11%)

Query: 22  QFFLKYECLQPSGSFKSRGIGNLIMKSAIRI-QKDGKKSPQIXXXXXXXXXXXXXXXCQR 80
           + F K E   P GS K R     I KS I   +  G  SP+                   
Sbjct: 36  RVFAKLELYNPGGSIKDR-----IAKSMIEYAEATGVISPERSTLIEPTSGNTGIGLALI 90

Query: 81  LSLP---CTVVVPTATKKRMVEKIRNTGAQVIVSG--AYWKEADTFLKADVMQKIDTQVV 135
            ++      + +P       V  ++  GA++I +   A W   ++ +   V +K++ ++ 
Sbjct: 91  GAIKGYRTIITLPEKMSNEKVSVLKALGAEIIRTPTMAAWDSPESHIG--VAKKLEKEIP 148

Query: 136 EPIYVHPFDNPDIWEGH----SSMVDEMVQDLEFQRISMNKVKGIVCSVGGGGLYNGIVQ 191
             I +  ++N    E H       + E + +L       NK+  +V   G GG  +GI +
Sbjct: 149 GAIILDQYNNMKNPEAHYFGTGKEIKEQLSELNL----FNKLNAVVAGAGTGGTISGIAK 204

Query: 192 GLERYGLADKIPIVGVETNGC 212
            ++       I IVG +  G 
Sbjct: 205 FIKEQN--SDIKIVGADPKGS 223

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.136    0.396 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 35,376,673
Number of extensions: 1435802
Number of successful extensions: 3769
Number of sequences better than 10.0: 82
Number of HSP's gapped: 3714
Number of HSP's successfully gapped: 82
Length of query: 360
Length of database: 53,481,399
Length adjustment: 111
Effective length of query: 249
Effective length of database: 40,753,473
Effective search space: 10147614777
Effective search space used: 10147614777
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 66 (30.0 bits)