Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Smik_2.4111.318ON1051055512e-74
YBR268W (MRPL37)1.318ON1051054932e-65
Skud_2.4001.318ON1051054628e-61
Suva_4.5291.318ON1051054306e-56
Kpol_1035.251.318ON1061102544e-29
TDEL0D018701.318ON1001042483e-28
SAKL0D06952g1.318ON1071012466e-28
KLTH0H10714g1.318ON106992459e-28
ZYRO0G20702g1.318ON1401042471e-27
Ecym_62891.318ON103972441e-27
CAGL0I09372g1.318ON1031052371e-26
KLLA0F01683g1.318ON981042327e-26
Kwal_14.25861.318ON106872301e-25
NCAS0B074401.318ON110802284e-25
TBLA0F013201.318ON111832268e-25
AEL167C1.318ON1011022171e-23
TPHA0O014701.318ON100972162e-23
NDAI0B047701.318ON1131142153e-23
KAFR0C042101.318ON1011002057e-22
KNAG0C017701.318ON101971911e-19
ZYRO0C03740g8.373ON29934651.2
TDEL0D027704.174ON54966651.5
KAFR0A006002.450ON89488632.5
KNAG0A018308.566ON65938622.8
TPHA0M005303.136ON57670622.8
NDAI0D033704.377ON39775604.9
KNAG0B03780singletonON32673597.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Smik_2.411
         (105 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Smik_2.411 Chr2 (727356..727673) [318 bp, 105 aa] {ON} YBR268W (...   216   2e-74
YBR268W Chr2 (741299..741616) [318 bp, 105 aa] {ON}  MRPL37Mitoc...   194   2e-65
Skud_2.400 Chr2 (710286..710603) [318 bp, 105 aa] {ON} YBR268W (...   182   8e-61
Suva_4.529 Chr4 (912965..913282) [318 bp, 105 aa] {ON} YBR268W (...   170   6e-56
Kpol_1035.25 s1035 complement(60631..60951) [321 bp, 106 aa] {ON...   102   4e-29
TDEL0D01870 Chr4 (366206..366508) [303 bp, 100 aa] {ON} Anc_1.31...   100   3e-28
SAKL0D06952g Chr4 complement(576023..576346) [324 bp, 107 aa] {O...    99   6e-28
KLTH0H10714g Chr8 complement(924077..924397) [321 bp, 106 aa] {O...    99   9e-28
ZYRO0G20702g Chr7 complement(1705327..1705749) [423 bp, 140 aa] ...   100   1e-27
Ecym_6289 Chr6 (542978..543289) [312 bp, 103 aa] {ON} similar to...    99   1e-27
CAGL0I09372g Chr9 (901576..901887) [312 bp, 103 aa] {ON} similar...    96   1e-26
KLLA0F01683g Chr6 complement(158967..159263) [297 bp, 98 aa] {ON...    94   7e-26
Kwal_14.2586 s14 complement(823777..824097) [321 bp, 106 aa] {ON...    93   1e-25
NCAS0B07440 Chr2 complement(1405363..1405695) [333 bp, 110 aa] {...    92   4e-25
TBLA0F01320 Chr6 complement(332337..332672) [336 bp, 111 aa] {ON...    92   8e-25
AEL167C Chr5 complement(322363..322668) [306 bp, 101 aa] {ON} Sy...    88   1e-23
TPHA0O01470 Chr15 complement(295860..296162) [303 bp, 100 aa] {O...    88   2e-23
NDAI0B04770 Chr2 complement(1176179..1176520) [342 bp, 113 aa] {...    87   3e-23
KAFR0C04210 Chr3 (839148..839453) [306 bp, 101 aa] {ON} Anc_1.31...    84   7e-22
KNAG0C01770 Chr3 (349006..349311) [306 bp, 101 aa] {ON} Anc_1.31...    78   1e-19
ZYRO0C03740g Chr3 complement(297709..298608) [900 bp, 299 aa] {O...    30   1.2  
TDEL0D02770 Chr4 complement(525103..526752) [1650 bp, 549 aa] {O...    30   1.5  
KAFR0A00600 Chr1 (108157..110841) [2685 bp, 894 aa] {ON} Anc_2.4...    29   2.5  
KNAG0A01830 Chr1 complement(117556..119535) [1980 bp, 659 aa] {O...    28   2.8  
TPHA0M00530 Chr13 complement(95225..96955) [1731 bp, 576 aa] {ON...    28   2.8  
NDAI0D03370 Chr4 complement(796099..797292) [1194 bp, 397 aa] {O...    28   4.9  
KNAG0B03780 Chr2 (725307..726287) [981 bp, 326 aa] {ON}                27   7.7  

>Smik_2.411 Chr2 (727356..727673) [318 bp, 105 aa] {ON} YBR268W
           (REAL)
          Length = 105

 Score =  216 bits (551), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 105/105 (100%), Positives = 105/105 (100%)

Query: 1   MLARSLGYRFISTSRVLFNKPAVKSVVSSCPAGTSLNLNIWKSGKDAVALEDKEYPNWLW 60
           MLARSLGYRFISTSRVLFNKPAVKSVVSSCPAGTSLNLNIWKSGKDAVALEDKEYPNWLW
Sbjct: 1   MLARSLGYRFISTSRVLFNKPAVKSVVSSCPAGTSLNLNIWKSGKDAVALEDKEYPNWLW 60

Query: 61  GILNNEQTVEHTTKDPEGEALLKRRKNIRKANRQRIKQNNFLSQL 105
           GILNNEQTVEHTTKDPEGEALLKRRKNIRKANRQRIKQNNFLSQL
Sbjct: 61  GILNNEQTVEHTTKDPEGEALLKRRKNIRKANRQRIKQNNFLSQL 105

>YBR268W Chr2 (741299..741616) [318 bp, 105 aa] {ON}
           MRPL37Mitochondrial ribosomal protein of the large
           subunit
          Length = 105

 Score =  194 bits (493), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 90/105 (85%), Positives = 98/105 (93%)

Query: 1   MLARSLGYRFISTSRVLFNKPAVKSVVSSCPAGTSLNLNIWKSGKDAVALEDKEYPNWLW 60
           MLARSLGYR ISTSR+L+NKP VKSVVSSCPAGTSLNLNIWKSGKDAVALEDKEYPNWLW
Sbjct: 1   MLARSLGYRLISTSRILYNKPTVKSVVSSCPAGTSLNLNIWKSGKDAVALEDKEYPNWLW 60

Query: 61  GILNNEQTVEHTTKDPEGEALLKRRKNIRKANRQRIKQNNFLSQL 105
            +L+++  VEH  +DPEG+ALLKRRKNIRKANRQRIKQNNFLSQL
Sbjct: 61  SVLDSDHVVEHAAEDPEGQALLKRRKNIRKANRQRIKQNNFLSQL 105

>Skud_2.400 Chr2 (710286..710603) [318 bp, 105 aa] {ON} YBR268W
           (REAL)
          Length = 105

 Score =  182 bits (462), Expect = 8e-61,   Method: Compositional matrix adjust.
 Identities = 86/105 (81%), Positives = 98/105 (93%)

Query: 1   MLARSLGYRFISTSRVLFNKPAVKSVVSSCPAGTSLNLNIWKSGKDAVALEDKEYPNWLW 60
           MLARS+ YR+ISTSRVL+NK AVK+VVSSCPAGTSLNLNIWKSGKDA+ALE+KEYP+WLW
Sbjct: 1   MLARSVSYRWISTSRVLYNKQAVKTVVSSCPAGTSLNLNIWKSGKDALALEEKEYPSWLW 60

Query: 61  GILNNEQTVEHTTKDPEGEALLKRRKNIRKANRQRIKQNNFLSQL 105
            +L+N+Q VEH  +D EGEALLKRRKNIRKANRQRIKQ+NFLSQL
Sbjct: 61  SVLDNKQDVEHAGQDQEGEALLKRRKNIRKANRQRIKQSNFLSQL 105

>Suva_4.529 Chr4 (912965..913282) [318 bp, 105 aa] {ON} YBR268W
           (REAL)
          Length = 105

 Score =  170 bits (430), Expect = 6e-56,   Method: Compositional matrix adjust.
 Identities = 79/105 (75%), Positives = 92/105 (87%)

Query: 1   MLARSLGYRFISTSRVLFNKPAVKSVVSSCPAGTSLNLNIWKSGKDAVALEDKEYPNWLW 60
           MLARS+  R++STSRV +NK AVK V SSCPAGTSLNLNIWKSGKDA ALED+EYP+WLW
Sbjct: 1   MLARSVSCRWLSTSRVFYNKQAVKVVASSCPAGTSLNLNIWKSGKDAQALEDREYPSWLW 60

Query: 61  GILNNEQTVEHTTKDPEGEALLKRRKNIRKANRQRIKQNNFLSQL 105
            +L+ +Q V+H  KDPEGEAL +R+KNIRKANRQ+IKQNNFLSQL
Sbjct: 61  SVLDAKQAVDHAAKDPEGEALSQRKKNIRKANRQQIKQNNFLSQL 105

>Kpol_1035.25 s1035 complement(60631..60951) [321 bp, 106 aa] {ON}
           complement(60631..60951) [321 nt, 107 aa]
          Length = 106

 Score =  102 bits (254), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 54/110 (49%), Positives = 71/110 (64%), Gaps = 9/110 (8%)

Query: 1   MLARSLGYRFISTSRVLFNKPAVKS-----VVSSCPAGTSLNLNIWKSGKDAVALEDKEY 55
           ML +    R +S+SR+L+ +    S     + SSCPAG+ L LNI K+GKD VALED EY
Sbjct: 1   MLKQIFQKRLLSSSRLLWQETVKTSGQSLKIQSSCPAGSVLTLNIKKAGKDPVALEDAEY 60

Query: 56  PNWLWGILNNEQTVEHTTKDPEGEALLKRRKNIRKANRQRIKQNNFLSQL 105
           P WLW +L+ E   E  +KDP    L  R+K +R+ANR+ IKQNNFL Q+
Sbjct: 61  PTWLWTVLDKEAQAEALSKDP----LALRKKKLRQANRKNIKQNNFLKQI 106

>TDEL0D01870 Chr4 (366206..366508) [303 bp, 100 aa] {ON} Anc_1.318
           YBR268W
          Length = 100

 Score =  100 bits (248), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 52/104 (50%), Positives = 64/104 (61%), Gaps = 4/104 (3%)

Query: 2   LARSLGYRFISTSRVLFNKPAVKSVVSSCPAGTSLNLNIWKSGKDAVALEDKEYPNWLWG 61
           + R +  R  S  RV   +     V SSCPAGT L++N+ KSGKD VALED EYP WLW 
Sbjct: 1   MFRFVPKRLFSNCRVFLQETPSTIVKSSCPAGTVLSVNVKKSGKDPVALEDSEYPAWLWE 60

Query: 62  ILNNEQTVEHTTKDPEGEALLKRRKNIRKANRQRIKQNNFLSQL 105
           +L+ E       +DP    +  R+K IRKANR +IKQNNFL QL
Sbjct: 61  VLDPEARARKLAEDP----MKLRKKQIRKANRMQIKQNNFLQQL 100

>SAKL0D06952g Chr4 complement(576023..576346) [324 bp, 107 aa] {ON}
           similar to uniprot|P36532 Saccharomyces cerevisiae
           YBR268W MRPL37 Mitochondrial ribosomal protein of the
           large subunit
          Length = 107

 Score = 99.4 bits (246), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 52/101 (51%), Positives = 68/101 (67%), Gaps = 8/101 (7%)

Query: 9   RFISTSRVLFNKPA----VKSVVSSCPAGTSLNLNIWKSGKDAVALEDKEYPNWLWGILN 64
           RF+ST+R+   + A    V  V SSCPAGT LNL I KSGK+ VALED EYP WLW +L+
Sbjct: 11  RFLSTTRITLQQQAATATVSKVKSSCPAGTPLNLQIKKSGKETVALEDHEYPEWLWTVLD 70

Query: 65  NEQTVEHTTKDPEGEALLKRRKNIRKANRQRIKQNNFLSQL 105
            +       +DP   A LK +K +RK NR++IKQNNFL+++
Sbjct: 71  EKAQSAKLAQDP---AKLK-KKQLRKMNREKIKQNNFLTKI 107

>KLTH0H10714g Chr8 complement(924077..924397) [321 bp, 106 aa] {ON}
           similar to uniprot|P36532 Saccharomyces cerevisiae
           YBR268W MRPL37 Mitochondrial ribosomal protein of the
           large subunit
          Length = 106

 Score = 99.0 bits (245), Expect = 9e-28,   Method: Compositional matrix adjust.
 Identities = 52/99 (52%), Positives = 66/99 (66%), Gaps = 6/99 (6%)

Query: 9   RFISTSRVLFN--KPAVKSVVSSCPAGTSLNLNIWKSGKDAVALEDKEYPNWLWGILNNE 66
           R +S SR  F   K +   VVSSCPAGT LNL I KSGK+ VALED EYP WLW +L++ 
Sbjct: 12  RALSVSRATFQGQKASPSGVVSSCPAGTPLNLQIKKSGKEPVALEDHEYPEWLWTVLDSR 71

Query: 67  QTVEHTTKDPEGEALLKRRKNIRKANRQRIKQNNFLSQL 105
             ++   +DP    L  R+K +R ANR +IKQNNFLS++
Sbjct: 72  AQLKKLQEDP----LKLRKKQLRSANRNKIKQNNFLSEI 106

>ZYRO0G20702g Chr7 complement(1705327..1705749) [423 bp, 140 aa]
           {ON} similar to uniprot|P36532 Saccharomyces cerevisiae
           YBR268W MRPL37 Mitochondrial ribosomal protein of the
           large subunit
          Length = 140

 Score = 99.8 bits (247), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 53/104 (50%), Positives = 69/104 (66%), Gaps = 9/104 (8%)

Query: 2   LARSLGYRFISTSRVLFNKPAVKSVVSSCPAGTSLNLNIWKSGKDAVALEDKEYPNWLWG 61
           L R    RF+STS VL      ++V SSCPAGT +N+N  KSGKD VALED EYP+WLW 
Sbjct: 46  LLRLFPRRFVSTSPVL-----GQAVKSSCPAGTIINVNTKKSGKDPVALEDNEYPDWLWE 100

Query: 62  ILNNEQTVEHTTKDPEGEALLKRRKNIRKANRQRIKQNNFLSQL 105
           +L+ E  ++    DP    +  R+K +RK NR++IKQNNFL Q+
Sbjct: 101 VLDPEAQMKKLQADP----MKLRKKQLRKDNREKIKQNNFLKQI 140

>Ecym_6289 Chr6 (542978..543289) [312 bp, 103 aa] {ON} similar to
           Ashbya gossypii AEL167C
          Length = 103

 Score = 98.6 bits (244), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 47/97 (48%), Positives = 65/97 (67%), Gaps = 4/97 (4%)

Query: 9   RFISTSRVLFNKPAVKSVVSSCPAGTSLNLNIWKSGKDAVALEDKEYPNWLWGILNNEQT 68
           R IST+  L  +   K+++SSCPAGT LNL I K+GK+ VAL + EYP WLWG+L+ +  
Sbjct: 11  RLISTTLRLAEQKGSKAIISSCPAGTPLNLQIKKTGKEPVALHESEYPEWLWGVLDPQVE 70

Query: 69  VEHTTKDPEGEALLKRRKNIRKANRQRIKQNNFLSQL 105
                +DP       R+K +RK NR++IKQNNFLS++
Sbjct: 71  AAKLNEDP----FAARKKQLRKMNREKIKQNNFLSRI 103

>CAGL0I09372g Chr9 (901576..901887) [312 bp, 103 aa] {ON} similar to
           uniprot|P36532 Saccharomyces cerevisiae YBR268w MRPL37
          Length = 103

 Score = 95.9 bits (237), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 51/105 (48%), Positives = 67/105 (63%), Gaps = 2/105 (1%)

Query: 1   MLARSLGYRFISTSRVLFNKPAVKSVVSSCPAGTSLNLNIWKSGKDAVALEDKEYPNWLW 60
           ML      R +S+S VL N+   K + SSC AGT L+LN+ K+GKD VALED EYP WLW
Sbjct: 1   MLRLLFTKRLLSSSVVLRNE--AKQIKSSCLAGTPLSLNVKKTGKDPVALEDSEYPEWLW 58

Query: 61  GILNNEQTVEHTTKDPEGEALLKRRKNIRKANRQRIKQNNFLSQL 105
            +L+   T          E+L  R+K IR++NR++IKQ NFL+QL
Sbjct: 59  TVLDQTNTAAAAKAPVSEESLKARKKQIRQSNREKIKQRNFLNQL 103

>KLLA0F01683g Chr6 complement(158967..159263) [297 bp, 98 aa] {ON}
           similar to uniprot|P36532 Saccharomyces cerevisiae
           YBR268W MRPL37 Mitochondrial ribosomal protein of the
           large subunit
          Length = 98

 Score = 94.0 bits (232), Expect = 7e-26,   Method: Compositional matrix adjust.
 Identities = 52/104 (50%), Positives = 65/104 (62%), Gaps = 14/104 (13%)

Query: 10  FISTSRVLFNKPAVKS--------VVSSCPAGTSLNLNIWKSGKDAVALEDKEYPNWLWG 61
            +  +RVLFN+  VKS        +VSSCPAGT LNL I KSGK+ VALED EYP WLW 
Sbjct: 1   MLRVTRVLFNQ--VKSEASGQAAKIVSSCPAGTPLNLQIKKSGKEPVALEDSEYPEWLWT 58

Query: 62  ILNNEQTVEHTTKDPEGEALLKRRKNIRKANRQRIKQNNFLSQL 105
           +L+     E    DP    +  R+K +R ANR  IKQNNFL+++
Sbjct: 59  VLDANVQAEKLAADP----IKLRKKQLRIANRANIKQNNFLAKI 98

>Kwal_14.2586 s14 complement(823777..824097) [321 bp, 106 aa] {ON}
           YBR268W (MRPL37) - Probable mitochondrial protein L37
           [contig 224] FULL
          Length = 106

 Score = 93.2 bits (230), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 46/87 (52%), Positives = 61/87 (70%), Gaps = 4/87 (4%)

Query: 19  NKPAVKSVVSSCPAGTSLNLNIWKSGKDAVALEDKEYPNWLWGILNNEQTVEHTTKDPEG 78
            K +V  + SSC AGT LNL I KSGK+ VALED EYP WLW +L+++  ++   +DP  
Sbjct: 24  QKGSVSGIKSSCIAGTPLNLQIKKSGKEPVALEDHEYPEWLWSVLDDKAQLKKLQEDP-- 81

Query: 79  EALLKRRKNIRKANRQRIKQNNFLSQL 105
             L  R+K +R ANRQ+IKQNNFLS++
Sbjct: 82  --LKLRKKQLRSANRQKIKQNNFLSEI 106

>NCAS0B07440 Chr2 complement(1405363..1405695) [333 bp, 110 aa] {ON}
           Anc_1.318 YBR268W
          Length = 110

 Score = 92.4 bits (228), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 47/80 (58%), Positives = 58/80 (72%), Gaps = 1/80 (1%)

Query: 26  VVSSCPAGTSLNLNIWKSGKDAVALEDKEYPNWLWGILNNEQTVEHTTKDPEGEALLKRR 85
           + SSC AGTSLNLNI K+GKD +ALED EYP WLW +L ++   E +    E E L  R+
Sbjct: 31  IKSSCLAGTSLNLNIKKNGKDPIALEDNEYPAWLWKVLESKAPKEASDLS-EQEVLAMRK 89

Query: 86  KNIRKANRQRIKQNNFLSQL 105
           K +RK NR++IKQNNFLSQL
Sbjct: 90  KQLRKENRKKIKQNNFLSQL 109

>TBLA0F01320 Chr6 complement(332337..332672) [336 bp, 111 aa] {ON}
           Anc_1.318 YBR268W
          Length = 111

 Score = 91.7 bits (226), Expect = 8e-25,   Method: Compositional matrix adjust.
 Identities = 46/83 (55%), Positives = 58/83 (69%), Gaps = 6/83 (7%)

Query: 24  KSVVSSCPAGTSLNLNIWKSGKDAVALEDKEYPNWLWGILNNEQTVEHTTKDPEG-EALL 82
           +++ SSCPAGT L LN++K GKD VALED++YP WLW IL          K+P   EA+ 
Sbjct: 33  QAIKSSCPAGTELRLNVYKDGKDPVALEDEKYPPWLWSIL-----TPSNNKNPSPMEAIA 87

Query: 83  KRRKNIRKANRQRIKQNNFLSQL 105
           +R+K +RK NR RIKQNNFL QL
Sbjct: 88  QRKKVLRKNNRDRIKQNNFLKQL 110

>AEL167C Chr5 complement(322363..322668) [306 bp, 101 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBR268W
           (MRPL37)
          Length = 101

 Score = 88.2 bits (217), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 46/102 (45%), Positives = 65/102 (63%), Gaps = 5/102 (4%)

Query: 4   RSLGYRFISTSRVLFNKPAVKSVVSSCPAGTSLNLNIWKSGKDAVALEDKEYPNWLWGIL 63
           RS   R  S S  ++++ A K+V SSCPAGT LNL I K GK+ +ALED +YP WLW +L
Sbjct: 5   RSSFRRLFSVSCRVYDQQAQKAV-SSCPAGTPLNLLIKKGGKEPLALEDSDYPEWLWKVL 63

Query: 64  NNEQTVEHTTKDPEGEALLKRRKNIRKANRQRIKQNNFLSQL 105
           + E       +DP    +  R+K +R+ NR+ IKQ NFL+++
Sbjct: 64  DPEAQAAKLAEDP----IKARKKALRRMNREHIKQQNFLAKM 101

>TPHA0O01470 Chr15 complement(295860..296162) [303 bp, 100 aa] {ON}
           Anc_1.318 YBR268W
          Length = 100

 Score = 87.8 bits (216), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 44/97 (45%), Positives = 56/97 (57%), Gaps = 4/97 (4%)

Query: 9   RFISTSRVLFNKPAVKSVVSSCPAGTSLNLNIWKSGKDAVALEDKEYPNWLWGILNNEQT 68
           RF S   +L  +     + SSC AGT L +N+ K+GKD +ALED EYP WLW +L+    
Sbjct: 8   RFFSRGSILLQESQANVLKSSCKAGTPLQINVLKTGKDPIALEDSEYPPWLWTVLDKGAQ 67

Query: 69  VEHTTKDPEGEALLKRRKNIRKANRQRIKQNNFLSQL 105
                 DP    L  RRK +R+ NR  IKQNNFL Q+
Sbjct: 68  AARLENDP----LKLRRKELRRKNRANIKQNNFLKQI 100

>NDAI0B04770 Chr2 complement(1176179..1176520) [342 bp, 113 aa] {ON}
           Anc_1.318 YBR268W
          Length = 113

 Score = 87.4 bits (215), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 51/114 (44%), Positives = 71/114 (62%), Gaps = 10/114 (8%)

Query: 1   MLARSLGYRFISTSRVLFNKPAVKSVV-----SSCPAGTSLNLNIWKSGKDAVALEDKEY 55
           ML   +   F ++ +VL  +  V S +     SSC AGT LNLNI K+GK+ +ALEDKEY
Sbjct: 1   MLRLFVKRSFSTSIKVLNAEVKVASTIASEIKSSCLAGTPLNLNIKKTGKEPIALEDKEY 60

Query: 56  PNWLWGILNNEQTVEHTTKDPEG----EALLKRRKNIRKANRQRIKQNNFLSQL 105
           P WLW +L+  +T     K  +G    E+LL R++ +R   R++IKQNNFLSQ+
Sbjct: 61  PEWLWTVLDT-KTANGRAKSGKGTSVEESLLARKRQLRVETRKKIKQNNFLSQI 113

>KAFR0C04210 Chr3 (839148..839453) [306 bp, 101 aa] {ON} Anc_1.318
           YBR268W
          Length = 101

 Score = 83.6 bits (205), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 47/100 (47%), Positives = 57/100 (57%), Gaps = 2/100 (2%)

Query: 6   LGYRFISTSRVLFNKPAVKSVVSSCPAGTSLNLNIWKSGKDAVALEDKEYPNWLWGILNN 65
           L  RF S SR +        +VSSCP GT L L + K  K  +AL+D+EYP WLW +LN 
Sbjct: 4   LSRRFFSHSRSVLQSTKC-LLVSSCPEGTPLKLGVRKGQKPPLALKDEEYPGWLWSVLNE 62

Query: 66  EQTVEHTTKDPEGEALLKRRKNIRKANRQRIKQNNFLSQL 105
           E         P  E  L RRK +RK NR +IKQ NFLS+L
Sbjct: 63  ESANTQKELSPIQELEL-RRKQLRKLNRDKIKQKNFLSEL 101

>KNAG0C01770 Chr3 (349006..349311) [306 bp, 101 aa] {ON} Anc_1.318
           YBR268W
          Length = 101

 Score = 78.2 bits (191), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 41/97 (42%), Positives = 56/97 (57%), Gaps = 3/97 (3%)

Query: 9   RFISTSRVLFNKPAVKSVVSSCPAGTSLNLNIWKSGKDAVALEDKEYPNWLWGILNNEQT 68
           R     RVL       +V SSC AGT L L+I K G+D VA+ D+EYP WLW +L     
Sbjct: 8   RMWHGGRVLGQTAQGPAVKSSCLAGTPLKLDIRKDGRDPVAMRDEEYPEWLWHVLEPATG 67

Query: 69  VEHTTKDPEGEALLKRRKNIRKANRQRIKQNNFLSQL 105
            + + +    + L  RRK +R+ +R  IKQ+N+LSQL
Sbjct: 68  GDASAR---ADPLAARRKELRRKHRNEIKQSNYLSQL 101

>ZYRO0C03740g Chr3 complement(297709..298608) [900 bp, 299 aa]
          {ON} similar to uniprot|Q03976 Saccharomyces cerevisiae
          YDR175C RSM24 Mitochondrial ribosomal protein of the
          small subunit
          Length = 299

 Score = 29.6 bits (65), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 15/34 (44%), Positives = 20/34 (58%), Gaps = 1/34 (2%)

Query: 9  RFISTSRVLFNKPAVKSVVSSCPAGTSLNLNIWK 42
          R + +SRVL NKPA + VV + P    L  + WK
Sbjct: 7  RLLCSSRVLLNKPAAQ-VVQNTPTNLYLEPSKWK 39

>TDEL0D02770 Chr4 complement(525103..526752) [1650 bp, 549 aa] {ON}
           Anc_4.174 YLR343W
          Length = 549

 Score = 29.6 bits (65), Expect = 1.5,   Method: Composition-based stats.
 Identities = 23/66 (34%), Positives = 31/66 (46%), Gaps = 3/66 (4%)

Query: 27  VSSCPAGTSLNLNIWKSGKDAVALEDKEYPNWLWGILNNEQTVEHTTKD--PEGEALLKR 84
           VS C    + ++NIW   KD V +    YPN L     NE T + T  D  P  +A ++ 
Sbjct: 138 VSICRNKPTWDVNIWNRYKDVVDVM-HNYPNVLGFFAGNEVTNDKTNTDASPFVKAAIRD 196

Query: 85  RKNIRK 90
            KN  K
Sbjct: 197 VKNYIK 202

>KAFR0A00600 Chr1 (108157..110841) [2685 bp, 894 aa] {ON} Anc_2.450
           YMR102C
          Length = 894

 Score = 28.9 bits (63), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 25/88 (28%), Positives = 39/88 (44%), Gaps = 12/88 (13%)

Query: 17  LFNKPAVKSVVSSCPAGTSLNLNIWKSGKDAVALE------DKEYPNWLWGILNNEQTVE 70
           +F  PA  S +   P  T     +WK+ +             K  P+ L+  ++ EQ  E
Sbjct: 61  MFKDPASSSPLDDHPEHT-----LWKTKQQLRKTHKNNSKGQKLVPSSLFNSIDIEQ-FE 114

Query: 71  HTTKDPEGEALLKRRKNIRKANRQRIKQ 98
              K+PE   +LKR KNI++  R  + Q
Sbjct: 115 KYLKEPEHIKMLKRAKNIKQFRRLFLAQ 142

>KNAG0A01830 Chr1 complement(117556..119535) [1980 bp, 659 aa]
          {ON} Anc_8.566 YBR182C
          Length = 659

 Score = 28.5 bits (62), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 13/38 (34%), Positives = 21/38 (55%), Gaps = 3/38 (7%)

Query: 56 PNWLWGILNNEQTVEHTTKDPEGEALLKRRK---NIRK 90
          P+ L  +  N+ T+ H TKDP     + R+K   N+R+
Sbjct: 62 PDQLINLYQNDHTLPHDTKDPADYGPMYRKKQTINLRR 99

>TPHA0M00530 Chr13 complement(95225..96955) [1731 bp, 576 aa] {ON}
           Anc_3.136 YGR077C
          Length = 576

 Score = 28.5 bits (62), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 19/70 (27%), Positives = 32/70 (45%), Gaps = 1/70 (1%)

Query: 16  VLFNKPAVKSVVS-SCPAGTSLNLNIWKSGKDAVALEDKEYPNWLWGILNNEQTVEHTTK 74
           ++++ P V+ V    C A   LN  IW +G  A+ L D       W +  +E T+  +T 
Sbjct: 35  IVYHVPRVQCVQDLYCLANAILNSRIWGNGDAALKLYDMSRSFMHWKLQMSEPTISISTF 94

Query: 75  DPEGEALLKR 84
               +  +KR
Sbjct: 95  YETWDTCIKR 104

>NDAI0D03370 Chr4 complement(796099..797292) [1194 bp, 397 aa] {ON}
           Anc_4.377 YHR201C
          Length = 397

 Score = 27.7 bits (60), Expect = 4.9,   Method: Composition-based stats.
 Identities = 23/75 (30%), Positives = 35/75 (46%), Gaps = 6/75 (8%)

Query: 20  KPAVKSVVSSCPAGTSLNLNIWKS--GKDAVALEDKEYPNWLWGILNNEQTVEHTTKDPE 77
           KP +     SC   TSL  N W    GK    + D   P  L GIL +   ++H  +DP+
Sbjct: 152 KPRIIRPTGSC---TSLVFNYWYDMLGKSLEKIIDI-IPLCLGGILLDTSNLKHKVEDPD 207

Query: 78  GEALLKRRKNIRKAN 92
            EA+   ++ + + N
Sbjct: 208 LEAMAHLKEGLIQYN 222

>KNAG0B03780 Chr2 (725307..726287) [981 bp, 326 aa] {ON} 
          Length = 326

 Score = 27.3 bits (59), Expect = 7.7,   Method: Composition-based stats.
 Identities = 20/73 (27%), Positives = 31/73 (42%), Gaps = 2/73 (2%)

Query: 17  LFNKPAVKSVVSSCPAGTSLNLNIWKSGKDAVALEDKEYPNWLWGILNNEQTVEHTTKDP 76
           LF+ P +K +       TS  +  W + +    +    +   L G L  +Q V  T KD 
Sbjct: 240 LFDHPVIKKIAQEHKVTTSQVILRWATQRGIAVIPKSAHKGRLLGNLQIDQAVTLTPKDL 299

Query: 77  EGEALLKRRKNIR 89
           E  + L   KN+R
Sbjct: 300 EEISSLN--KNLR 310

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.315    0.130    0.382 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 11,393,484
Number of extensions: 459139
Number of successful extensions: 1464
Number of sequences better than 10.0: 34
Number of HSP's gapped: 1448
Number of HSP's successfully gapped: 34
Length of query: 105
Length of database: 53,481,399
Length adjustment: 75
Effective length of query: 30
Effective length of database: 44,881,449
Effective search space: 1346443470
Effective search space used: 1346443470
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 59 (27.3 bits)