Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Smik_2.1343.188ON59759730540.0
YBR015C (MNN2)3.188ON59759625800.0
Suva_2.1423.188ON60360225730.0
Skud_2.1273.188ON59659524740.0
KLTH0G16038g3.188ON60960918510.0
KAFR0C008703.188ON61261218240.0
SAKL0C10472g3.188ON60861318170.0
TDEL0D043303.188ON59859917750.0
Kwal_56.231173.188ON60760317630.0
NCAS0E015903.188ON60861517130.0
TBLA0F007403.188ON65353016990.0
ZYRO0A04950g3.188ON61852116350.0
KNAG0K012903.188ON61161116330.0
NDAI0G017903.188ON60760116060.0
TPHA0A043803.188ON64252216090.0
CAGL0I04532g3.188ON61260815850.0
NCAS0A03650singletonON60760015470.0
Ecym_53143.188ON61562715300.0
KLLA0E17755g3.188ON63852015290.0
Kpol_1036.503.188ON67652215030.0
AER018C3.188ON60661414500.0
Kpol_1045.703.188ON61762014110.0
KNAG0K01300singletonON59760314040.0
NDAI0A065003.188ON63752414070.0
TPHA0C04560singletonON57359813720.0
KAFR0E01030singletonON64062413001e-172
KAFR0G002801.150ON57954910851e-141
NDAI0A007801.150ON58753410551e-136
SAKL0C04598g1.150ON61153610481e-135
NCAS0B084501.150ON5865479981e-128
Kwal_33.136931.150ON5585369961e-127
TPHA0E034801.150ON70954510001e-126
ZYRO0D17160g1.150ON5795289841e-125
TBLA0D030301.150ON6055479821e-125
Kpol_2002.571.150ON6055339771e-124
KLTH0F03938g1.150ON5625339511e-121
Skud_10.311.150ON5865299481e-120
YJL186W (MNN5)1.150ON5865159461e-120
Smik_10.461.150ON5865439401e-119
AEL148W1.150ON5735289211e-116
Suva_6.2661.150ON5865168981e-112
Ecym_81281.150ON5925398961e-112
TBLA0J011901.150ON6165048871e-111
KNAG0C009001.150ON6235368861e-110
CAGL0M02871g1.150ON6005148721e-108
KLLA0C16467g1.150ON6075058521e-105
SAKL0H22616gsingletonON7415938511e-104
TDEL0C03020na 1ON6605758261e-101
ZYRO0F13244gna 1ON6645718055e-98
TBLA0A002703.188ON9575327886e-93
KLLA0F24574gna 2ON7115967702e-92
SAKL0C08888gna 2ON6795967122e-84
KLTH0C08976gna 2ON7026026872e-80
Kwal_56.22779na 2ON6955996512e-75
Ecym_3545na 2ON6706016232e-71
CAGL0L08096g1.150ON5645315812e-66
AEL082Wna 2ON6815625111e-55
KNAG0G01070singletonON6323211555e-10
NCAS0F007807.123ON6392851466e-09
NDAI0H012707.123ON6562781431e-08
Kwal_55.209847.123ON6193511422e-08
CAGL0C04004gsingletonON6323791314e-07
KLTH0G07986gna 3ON5692251305e-07
KNAG0D05360singletonON5332781296e-07
KNAG0D03070singletonON6502851297e-07
CAGL0C04048gsingletonON6203481289e-07
CAGL0C03938gsingletonON6372801262e-06
TDEL0B00160singletonON5622611233e-06
CAGL0C03916gsingletonON6282841216e-06
AEL345WsingletonON6452661208e-06
KNAG0G010607.123ON6942811209e-06
Suva_5.322na 4ON5532421181e-05
Kwal_23.2926na 3ON5682301181e-05
Kpol_298.4singletonON6312671162e-05
CAGL0C03960gsingletonON6233411135e-05
KNAG0J02990singletonON6442691119e-05
ABR245CsingletonON6412281101e-04
AFL235WsingletonON3812161091e-04
TDEL0H032607.123ON6411431101e-04
CAGL0H09262gsingletonON6252761091e-04
CAGL0C04026gsingletonON6361491092e-04
CAGL0C03982gsingletonON6291321082e-04
KLTH0F13486g7.123ON6232341046e-04
TPHA0L008207.123ON7302981046e-04
CAGL0H09240gsingletonON6422341039e-04
Skud_7.10na 4ON5661711020.001
TBLA0C06250singletonON7362841020.001
CAGL0C03894g7.123ON6271341010.001
TBLA0H00130singletonON6871281010.001
TBLA0A00640singletonON7471441010.001
YER001W (MNN1)na 5ON7622841010.002
TDEL0F05640singletonON554263990.002
NDAI0A085507.123ON664250980.003
Smik_14.393na 6ON580121970.004
Skud_14.395na 6ON580240950.007
AAR183CsingletonON648133940.009
YNR059W (MNT4)na 6ON580228940.009
SAKL0D15180gsingletonON577142940.011
Suva_14.418na 6ON580242940.011
ZYRO0G04048g7.123ON641271920.015
TBLA0G03680singletonON751151910.025
Smik_7.4na 4ON56251890.038
KLLA0E09813gsingletonON746133890.041
Smik_9.1807.123ON630175880.047
TBLA0A011607.123ON66358880.053
CAGL0G04279gsingletonON660132870.059
Kwal_14.2057na 7ON733156870.063
KAFR0K01260singletonON628193870.074
KNAG0E03170singletonON746255850.10
Smik_5.115na 5ON762280850.12
Suva_9.1917.123ON625122840.15
Kpol_1015.13singletonON743305840.15
Kwal_23.5454singletonON583173830.19
KAFR0K012407.123ON666283800.49
NCAS0I004807.123ON657232790.54
Kwal_55.22238singletonON584147790.55
YGL257C (MNT2)na 4ON55851790.56
Skud_9.1587.123ON629131761.5
ADR020Cna 8ON604108733.2
YIL014W (MNT3)7.123ON630175733.2
Suva_2.4048.462ON97398715.1
KLLA0D13376gna 8ON66345715.7
SAKL0H19316gna 7ON797154716.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Smik_2.134
         (597 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Smik_2.134 Chr2 complement(247923..249716) [1794 bp, 597 aa] {ON...  1181   0.0  
YBR015C Chr2 complement(267710..269503) [1794 bp, 597 aa] {ON}  ...   998   0.0  
Suva_2.142 Chr2 complement(246653..248464) [1812 bp, 603 aa] {ON...   995   0.0  
Skud_2.127 Chr2 complement(241232..243022) [1791 bp, 596 aa] {ON...   957   0.0  
KLTH0G16038g Chr7 (1404292..1406121) [1830 bp, 609 aa] {ON} simi...   717   0.0  
KAFR0C00870 Chr3 complement(175651..177489) [1839 bp, 612 aa] {O...   707   0.0  
SAKL0C10472g Chr3 (953238..955064) [1827 bp, 608 aa] {ON} simila...   704   0.0  
TDEL0D04330 Chr4 complement(790232..792028) [1797 bp, 598 aa] {O...   688   0.0  
Kwal_56.23117 s56 complement(407699..409522) [1824 bp, 607 aa] {...   683   0.0  
NCAS0E01590 Chr5 (302992..304818) [1827 bp, 608 aa] {ON} Anc_3.188    664   0.0  
TBLA0F00740 Chr6 (187874..189835) [1962 bp, 653 aa] {ON} Anc_3.1...   659   0.0  
ZYRO0A04950g Chr1 complement(397314..399170) [1857 bp, 618 aa] {...   634   0.0  
KNAG0K01290 Chr11 (254881..256716) [1836 bp, 611 aa] {ON}             633   0.0  
NDAI0G01790 Chr7 (392941..394764) [1824 bp, 607 aa] {ON} Anc_3.188    623   0.0  
TPHA0A04380 Chr1 (982546..984474) [1929 bp, 642 aa] {ON} Anc_3.1...   624   0.0  
CAGL0I04532g Chr9 (404659..406497) [1839 bp, 612 aa] {ON} simila...   615   0.0  
NCAS0A03650 Chr1 complement(729502..731325) [1824 bp, 607 aa] {O...   600   0.0  
Ecym_5314 Chr5 complement(634571..636418) [1848 bp, 615 aa] {ON}...   593   0.0  
KLLA0E17755g Chr5 complement(1572985..1574901) [1917 bp, 638 aa]...   593   0.0  
Kpol_1036.50 s1036 complement(135897..137927) [2031 bp, 676 aa] ...   583   0.0  
AER018C Chr5 complement(661035..662855) [1821 bp, 606 aa] {ON} S...   563   0.0  
Kpol_1045.70 s1045 complement(162608..164461) [1854 bp, 617 aa] ...   548   0.0  
KNAG0K01300 Chr11 (257271..259064) [1794 bp, 597 aa] {ON}             545   0.0  
NDAI0A06500 Chr1 complement(1475305..1477218) [1914 bp, 637 aa] ...   546   0.0  
TPHA0C04560 Chr3 (983249..984970) [1722 bp, 573 aa] {ON}              533   0.0  
KAFR0E01030 Chr5 (212679..214601) [1923 bp, 640 aa] {ON}              505   e-172
KAFR0G00280 Chr7 (92838..94577) [1740 bp, 579 aa] {ON} Anc_1.150...   422   e-141
NDAI0A00780 Chr1 (156271..158034) [1764 bp, 587 aa] {ON} Anc_1.150    410   e-136
SAKL0C04598g Chr3 (447448..449283) [1836 bp, 611 aa] {ON} simila...   408   e-135
NCAS0B08450 Chr2 complement(1614300..1616060) [1761 bp, 586 aa] ...   389   e-128
Kwal_33.13693 s33 (354321..355997) [1677 bp, 558 aa] {ON} YJL186...   388   e-127
TPHA0E03480 Chr5 complement(735664..737793) [2130 bp, 709 aa] {O...   389   e-126
ZYRO0D17160g Chr4 complement(1417469..1419208) [1740 bp, 579 aa]...   383   e-125
TBLA0D03030 Chr4 complement(734007..735824) [1818 bp, 605 aa] {O...   382   e-125
Kpol_2002.57 s2002 (129140..130957) [1818 bp, 605 aa] {ON} (1291...   380   e-124
KLTH0F03938g Chr6 (351536..353224) [1689 bp, 562 aa] {ON} simila...   370   e-121
Skud_10.31 Chr10 (54975..56735) [1761 bp, 586 aa] {ON} YJL186W (...   369   e-120
YJL186W Chr10 (80155..81915) [1761 bp, 586 aa] {ON}  MNN5Alpha-1...   369   e-120
Smik_10.46 Chr10 (78173..79933) [1761 bp, 586 aa] {ON} YJL186W (...   366   e-119
AEL148W Chr5 (351089..352810) [1722 bp, 573 aa] {ON} Syntenic ho...   359   e-116
Suva_6.266 Chr6 complement(467727..469487) [1761 bp, 586 aa] {ON...   350   e-112
Ecym_8128 Chr8 complement(266920..268698) [1779 bp, 592 aa] {ON}...   349   e-112
TBLA0J01190 Chr10 complement(267291..269141) [1851 bp, 616 aa] {...   346   e-111
KNAG0C00900 Chr3 (167471..169342) [1872 bp, 623 aa] {ON} Anc_1.1...   345   e-110
CAGL0M02871g Chr13 (324009..325811) [1803 bp, 600 aa] {ON} simil...   340   e-108
KLLA0C16467g Chr3 (1442002..1443825) [1824 bp, 607 aa] {ON} simi...   332   e-105
SAKL0H22616g Chr8 complement(1966196..1968421) [2226 bp, 741 aa]...   332   e-104
TDEL0C03020 Chr3 (537820..539802) [1983 bp, 660 aa] {ON}              322   e-101
ZYRO0F13244g Chr6 (1084412..1086406) [1995 bp, 664 aa] {ON} simi...   314   5e-98
TBLA0A00270 Chr1 complement(39183..42056) [2874 bp, 957 aa] {ON}...   308   6e-93
KLLA0F24574g Chr6 complement(2285387..2287522) [2136 bp, 711 aa]...   301   2e-92
SAKL0C08888g Chr3 (814687..816726) [2040 bp, 679 aa] {ON} weakly...   278   2e-84
KLTH0C08976g Chr3 (751731..753839) [2109 bp, 702 aa] {ON} weakly...   269   2e-80
Kwal_56.22779 s56 complement(277096..279183) [2088 bp, 695 aa] {...   255   2e-75
Ecym_3545 Chr3 complement(1030762..1032774) [2013 bp, 670 aa] {O...   244   2e-71
CAGL0L08096g Chr12 complement(886827..888521) [1695 bp, 564 aa] ...   228   2e-66
AEL082W Chr5 (474072..476117) [2046 bp, 681 aa] {ON} Non-synteni...   201   1e-55
KNAG0G01070 Chr7 complement(232251..234149) [1899 bp, 632 aa] {O...    64   5e-10
NCAS0F00780 Chr6 (156307..158226) [1920 bp, 639 aa] {ON} Anc_7.123     61   6e-09
NDAI0H01270 Chr8 (306136..308106) [1971 bp, 656 aa] {ON} Anc_7.123     60   1e-08
Kwal_55.20984 s55 complement(634833..636692) [1860 bp, 619 aa] {...    59   2e-08
CAGL0C04004g Chr3 complement(394614..396512) [1899 bp, 632 aa] {...    55   4e-07
KLTH0G07986g Chr7 complement(646652..648361) [1710 bp, 569 aa] {...    55   5e-07
KNAG0D05360 Chr4 (981032..982633) [1602 bp, 533 aa] {ON}               54   6e-07
KNAG0D03070 Chr4 (552018..553970) [1953 bp, 650 aa] {ON}               54   7e-07
CAGL0C04048g Chr3 complement(399734..401596) [1863 bp, 620 aa] {...    54   9e-07
CAGL0C03938g Chr3 complement(386673..388586) [1914 bp, 637 aa] {...    53   2e-06
TDEL0B00160 Chr2 (29809..31497) [1689 bp, 562 aa] {ON}                 52   3e-06
CAGL0C03916g Chr3 complement(383989..385875) [1887 bp, 628 aa] {...    51   6e-06
AEL345W Chr5 (1961..3898) [1938 bp, 645 aa] {ON} Non-syntenic ho...    51   8e-06
KNAG0G01060 Chr7 complement(228987..231071) [2085 bp, 694 aa] {O...    51   9e-06
Suva_5.322 Chr5 (525925..527586) [1662 bp, 553 aa] {ON} YGL257C ...    50   1e-05
Kwal_23.2926 s23 complement(78806..80512) [1707 bp, 568 aa] {ON}...    50   1e-05
Kpol_298.4 s298 (12426..14321) [1896 bp, 631 aa] {ON} (12426..14...    49   2e-05
CAGL0C03960g Chr3 complement(389250..391121) [1872 bp, 623 aa] {...    48   5e-05
KNAG0J02990 Chr10 (576491..578425) [1935 bp, 644 aa] {ON}              47   9e-05
ABR245C Chr2 complement(854587..856512) [1926 bp, 641 aa] {ON} N...    47   1e-04
AFL235W Chr6 (2..1147) [1146 bp, 381 aa] {ON} Non-syntenic homol...    47   1e-04
TDEL0H03260 Chr8 complement(542810..544735) [1926 bp, 641 aa] {O...    47   1e-04
CAGL0H09262g Chr8 complement(908258..910135) [1878 bp, 625 aa] {...    47   1e-04
CAGL0C04026g Chr3 complement(397303..399213) [1911 bp, 636 aa] {...    47   2e-04
CAGL0C03982g Chr3 complement(391909..393798) [1890 bp, 629 aa] {...    46   2e-04
KLTH0F13486g Chr6 complement(1108786..1110657) [1872 bp, 623 aa]...    45   6e-04
TPHA0L00820 Chr12 complement(162210..164402) [2193 bp, 730 aa] {...    45   6e-04
CAGL0H09240g Chr8 complement(905670..907598) [1929 bp, 642 aa] {...    44   9e-04
Skud_7.10 Chr7 complement(16816..18516) [1701 bp, 566 aa] {ON} Y...    44   0.001
TBLA0C06250 Chr3 (1512916..1515126) [2211 bp, 736 aa] {ON}             44   0.001
CAGL0C03894g Chr3 complement(381514..383397) [1884 bp, 627 aa] {...    44   0.001
TBLA0H00130 Chr8 complement(8943..11006) [2064 bp, 687 aa] {ON}        44   0.001
TBLA0A00640 Chr1 (128803..131046) [2244 bp, 747 aa] {ON}               44   0.001
YER001W Chr5 (153520..155808) [2289 bp, 762 aa] {ON}  MNN1Alpha-...    44   0.002
TDEL0F05640 Chr6 complement(1055778..1057442) [1665 bp, 554 aa] ...    43   0.002
NDAI0A08550 Chr1 complement(1967085..1969079) [1995 bp, 664 aa] ...    42   0.003
Smik_14.393 Chr14 (693641..695383) [1743 bp, 580 aa] {ON} YNR059...    42   0.004
Skud_14.395 Chr14 (704847..706589) [1743 bp, 580 aa] {ON} YNR059...    41   0.007
AAR183C Chr1 complement(672091..674037) [1947 bp, 648 aa] {ON} N...    41   0.009
YNR059W Chr14 (736803..738545) [1743 bp, 580 aa] {ON}  MNT4Putat...    41   0.009
SAKL0D15180g Chr4 complement(1259592..1261325) [1734 bp, 577 aa]...    41   0.011
Suva_14.418 Chr14 (721586..723328) [1743 bp, 580 aa] {ON} YNR059...    41   0.011
ZYRO0G04048g Chr7 complement(328792..330717) [1926 bp, 641 aa] {...    40   0.015
TBLA0G03680 Chr7 complement(975688..977943) [2256 bp, 751 aa] {O...    40   0.025
Smik_7.4 Chr7 complement(8045..9733) [1689 bp, 562 aa] {ON} YGL2...    39   0.038
KLLA0E09813g Chr5 (867899..870139) [2241 bp, 746 aa] {ON} simila...    39   0.041
Smik_9.180 Chr9 (300789..302681) [1893 bp, 630 aa] {ON} YIL014W ...    39   0.047
TBLA0A01160 Chr1 complement(267341..269332) [1992 bp, 663 aa] {O...    39   0.053
CAGL0G04279g Chr7 complement(404144..406126) [1983 bp, 660 aa] {...    38   0.059
Kwal_14.2057 s14 complement(590944..593145) [2202 bp, 733 aa] {O...    38   0.063
KAFR0K01260 Chr11 complement(261190..263076) [1887 bp, 628 aa] {...    38   0.074
KNAG0E03170 Chr5 complement(632635..634875) [2241 bp, 746 aa] {O...    37   0.10 
Smik_5.115 Chr5 (157563..159851) [2289 bp, 762 aa] {ON} YER001W ...    37   0.12 
Suva_9.191 Chr9 (314586..316463) [1878 bp, 625 aa] {ON} YIL014W ...    37   0.15 
Kpol_1015.13 s1015 complement(31451..33682) [2232 bp, 743 aa] {O...    37   0.15 
Kwal_23.5454 s23 (1171360..1173111) [1752 bp, 583 aa] {ON} YGL25...    37   0.19 
KAFR0K01240 Chr11 complement(258683..260683) [2001 bp, 666 aa] {...    35   0.49 
NCAS0I00480 Chr9 (77950..79923) [1974 bp, 657 aa] {ON}                 35   0.54 
Kwal_55.22238 s55 complement(1166321..1168075) [1755 bp, 584 aa]...    35   0.55 
YGL257C Chr7 complement(12481..14157) [1677 bp, 558 aa] {ON}  MN...    35   0.56 
Skud_9.158 Chr9 (296090..297979) [1890 bp, 629 aa] {ON} YIL014W ...    34   1.5  
ADR020C Chr4 complement(740413..742227) [1815 bp, 604 aa] {ON} S...    33   3.2  
YIL014W Chr9 (326103..327995) [1893 bp, 630 aa] {ON}  MNT3Alpha-...    33   3.2  
Suva_2.404 Chr2 complement(717797..720718) [2922 bp, 973 aa] {ON...    32   5.1  
KLLA0D13376g Chr4 (1150858..1152849) [1992 bp, 663 aa] {ON} simi...    32   5.7  
SAKL0H19316g Chr8 complement(1705548..1707941) [2394 bp, 797 aa]...    32   6.1  

>Smik_2.134 Chr2 complement(247923..249716) [1794 bp, 597 aa] {ON}
           YBR015C (REAL)
          Length = 597

 Score = 1181 bits (3054), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 577/597 (96%), Positives = 577/597 (96%)

Query: 1   MLLTKRFAKLFKLTFLVLILCGLFVVTNKYMDENTSVKDYKKYLLDNINXXXXXXXXXXX 60
           MLLTKRFAKLFKLTFLVLILCGLFVVTNKYMDENTSVKDYKKYLLDNIN           
Sbjct: 1   MLLTKRFAKLFKLTFLVLILCGLFVVTNKYMDENTSVKDYKKYLLDNINSYSSKHSSSSD 60

Query: 61  XXXXXXXXXLKGNDKVSNEKLKSFYNNVFNFLMLDSPTGKSARKYNEACQLSGDIGDRPD 120
                    LKGNDKVSNEKLKSFYNNVFNFLMLDSPTGKSARKYNEACQLSGDIGDRPD
Sbjct: 61  NAGADDSSSLKGNDKVSNEKLKSFYNNVFNFLMLDSPTGKSARKYNEACQLSGDIGDRPD 120

Query: 121 QYEELYKLSANELSKCLELSQDEVARLTKSHKDYVDHIASLALPKGTYKGSGIATVGGGK 180
           QYEELYKLSANELSKCLELSQDEVARLTKSHKDYVDHIASLALPKGTYKGSGIATVGGGK
Sbjct: 121 QYEELYKLSANELSKCLELSQDEVARLTKSHKDYVDHIASLALPKGTYKGSGIATVGGGK 180

Query: 181 FSLMSFLIIKTLRNMGTTLPVEVLIPPGDEGESEFCNKILPNYNAKCIYVSDILPLETIE 240
           FSLMSFLIIKTLRNMGTTLPVEVLIPPGDEGESEFCNKILPNYNAKCIYVSDILPLETIE
Sbjct: 181 FSLMSFLIIKTLRNMGTTLPVEVLIPPGDEGESEFCNKILPNYNAKCIYVSDILPLETIE 240

Query: 241 KFTFKGYQFKSLALVASSFENLLLLDADNFPIKPLDNIFNEEPYLSTGLVMWPDFWRRTT 300
           KFTFKGYQFKSLALVASSFENLLLLDADNFPIKPLDNIFNEEPYLSTGLVMWPDFWRRTT
Sbjct: 241 KFTFKGYQFKSLALVASSFENLLLLDADNFPIKPLDNIFNEEPYLSTGLVMWPDFWRRTT 300

Query: 301 HPLYYEIADITVNMKNRVRNSQDDLTPPAIYTKNSNDLGGVPLSDLDGTIPDVSTESGQL 360
           HPLYYEIADITVNMKNRVRNSQDDLTPPAIYTKNSNDLGGVPLSDLDGTIPDVSTESGQL
Sbjct: 301 HPLYYEIADITVNMKNRVRNSQDDLTPPAIYTKNSNDLGGVPLSDLDGTIPDVSTESGQL 360

Query: 361 MINKTKHLATALLSLFYNVNGPNWYYPIFSQKAAGEGDKETFIAAANFYGLSFYQVKTRT 420
           MINKTKHLATALLSLFYNVNGPNWYYPIFSQKAAGEGDKETFIAAANFYGLSFYQVKTRT
Sbjct: 361 MINKTKHLATALLSLFYNVNGPNWYYPIFSQKAAGEGDKETFIAAANFYGLSFYQVKTRT 420

Query: 421 GVEGYHDKEGFHGVAMLQHDFVQDYSRYLTASKSITNKYKDIKSSAAIKYDKNYSLEKYT 480
           GVEGYHDKEGFHGVAMLQHDFVQDYSRYLTASKSITNKYKDIKSSAAIKYDKNYSLEKYT
Sbjct: 421 GVEGYHDKEGFHGVAMLQHDFVQDYSRYLTASKSITNKYKDIKSSAAIKYDKNYSLEKYT 480

Query: 481 KEFFDNEDLKAKDHVDVMFIHSNLPKFDPYTLSETNFLTTDDKPARSFTALHKVQNYDIE 540
           KEFFDNEDLKAKDHVDVMFIHSNLPKFDPYTLSETNFLTTDDKPARSFTALHKVQNYDIE
Sbjct: 481 KEFFDNEDLKAKDHVDVMFIHSNLPKFDPYTLSETNFLTTDDKPARSFTALHKVQNYDIE 540

Query: 541 LENFKVLKEYVCDKKNPFKYLDDKLGEDKKEWRRMCDYIAKRLQFLESTHDKVIAGN 597
           LENFKVLKEYVCDKKNPFKYLDDKLGEDKKEWRRMCDYIAKRLQFLESTHDKVIAGN
Sbjct: 541 LENFKVLKEYVCDKKNPFKYLDDKLGEDKKEWRRMCDYIAKRLQFLESTHDKVIAGN 597

>YBR015C Chr2 complement(267710..269503) [1794 bp, 597 aa] {ON}
           MNN2Alpha-1,2-mannosyltransferase, responsible for
           addition of the first alpha-1,2-linked mannose to form
           the branches on the mannan backbone of oligosaccharides,
           localizes to an early Golgi compartment
          Length = 597

 Score =  998 bits (2580), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 481/596 (80%), Positives = 524/596 (87%)

Query: 1   MLLTKRFAKLFKLTFLVLILCGLFVVTNKYMDENTSVKDYKKYLLDNINXXXXXXXXXXX 60
           MLLTKRF+KLFKLTF+VLILCGLFV+TNKYMDENTSVK+YK+YL   +            
Sbjct: 1   MLLTKRFSKLFKLTFIVLILCGLFVITNKYMDENTSVKEYKEYLDRYVQSYSNKYSSSSD 60

Query: 61  XXXXXXXXXLKGNDKVSNEKLKSFYNNVFNFLMLDSPTGKSARKYNEACQLSGDIGDRPD 120
                    L+ ND+  NEKLKSFYNNVFNFLM+DSP G +A++YNEAC L GDIGDRPD
Sbjct: 61  AASADDSTPLRDNDEAGNEKLKSFYNNVFNFLMVDSPKGSTAKQYNEACLLKGDIGDRPD 120

Query: 121 QYEELYKLSANELSKCLELSQDEVARLTKSHKDYVDHIASLALPKGTYKGSGIATVGGGK 180
            Y++LYKLSA ELSKCLELS DEVA LTKSHKDYV+HIA+L  PKGTYKGSGIATVGGGK
Sbjct: 121 HYKDLYKLSAKELSKCLELSPDEVASLTKSHKDYVEHIATLVSPKGTYKGSGIATVGGGK 180

Query: 181 FSLMSFLIIKTLRNMGTTLPVEVLIPPGDEGESEFCNKILPNYNAKCIYVSDILPLETIE 240
           FSLM+FLIIKTLRNMGTTLPVEVLIPPGDEGE+EFCNKILP YN+KCIYVSDILP ETIE
Sbjct: 181 FSLMAFLIIKTLRNMGTTLPVEVLIPPGDEGETEFCNKILPKYNSKCIYVSDILPRETIE 240

Query: 241 KFTFKGYQFKSLALVASSFENLLLLDADNFPIKPLDNIFNEEPYLSTGLVMWPDFWRRTT 300
           KF FKGYQFKSLAL+ASSFENLLLLDADNFPIKPLDNIFNEEPY+STGLVMWPDFWRRTT
Sbjct: 241 KFVFKGYQFKSLALIASSFENLLLLDADNFPIKPLDNIFNEEPYVSTGLVMWPDFWRRTT 300

Query: 301 HPLYYEIADITVNMKNRVRNSQDDLTPPAIYTKNSNDLGGVPLSDLDGTIPDVSTESGQL 360
           HPLYY+IA I V+ K RVRNS+DD+TPPA+YTK+  DL  VPLSDLDGTIPDVSTESGQL
Sbjct: 301 HPLYYDIAGIAVDKKKRVRNSRDDITPPAVYTKDLKDLSDVPLSDLDGTIPDVSTESGQL 360

Query: 361 MINKTKHLATALLSLFYNVNGPNWYYPIFSQKAAGEGDKETFIAAANFYGLSFYQVKTRT 420
           MINKTKHLATALLSLFYNVNGP WYYPIFSQKAAGEGDKETFIAAANFYGLSFYQV+TRT
Sbjct: 361 MINKTKHLATALLSLFYNVNGPTWYYPIFSQKAAGEGDKETFIAAANFYGLSFYQVRTRT 420

Query: 421 GVEGYHDKEGFHGVAMLQHDFVQDYSRYLTASKSITNKYKDIKSSAAIKYDKNYSLEKYT 480
           GVEGYHD++GFHGVAMLQHDFVQDY RYL A +SI NKY   KS+ AIK+DKNYSLEKYT
Sbjct: 421 GVEGYHDEDGFHGVAMLQHDFVQDYGRYLNAMESIGNKYGGTKSADAIKFDKNYSLEKYT 480

Query: 481 KEFFDNEDLKAKDHVDVMFIHSNLPKFDPYTLSETNFLTTDDKPARSFTALHKVQNYDIE 540
           +EFFDNEDL AK+HVDVMFIHSN PKFDPY LS++NFLTT+ KPARS+TAL KV+NYDIE
Sbjct: 481 EEFFDNEDLNAKNHVDVMFIHSNFPKFDPYDLSKSNFLTTNGKPARSYTALKKVKNYDIE 540

Query: 541 LENFKVLKEYVCDKKNPFKYLDDKLGEDKKEWRRMCDYIAKRLQFLESTHDKVIAG 596
           LENFKVL EYVC  KNPFKYLDD LG+DK EW+R+C YI  RL FLESTHDK IAG
Sbjct: 541 LENFKVLNEYVCVNKNPFKYLDDLLGQDKTEWKRVCGYITDRLAFLESTHDKAIAG 596

>Suva_2.142 Chr2 complement(246653..248464) [1812 bp, 603 aa] {ON}
           YBR015C (REAL)
          Length = 603

 Score =  995 bits (2573), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 484/602 (80%), Positives = 524/602 (87%), Gaps = 6/602 (0%)

Query: 1   MLLTKRFAKLFKLTFLVLILCGLFVVTNKYMDENTSVKDYKKYLLDNI----NXXXXXXX 56
           MLLTKRF+KLFKL F+ L+LCGLFVVTNKYMDENTSVKDYK +L   I    N       
Sbjct: 1   MLLTKRFSKLFKLAFIALLLCGLFVVTNKYMDENTSVKDYKSHLQSYIDSYANKDSSSPE 60

Query: 57  XXXXXXXXXXXXXLKGNDKVSNEKLKSFYNNVFNFLMLDSPTGKSARKYNEACQLSGDIG 116
                        LKGND  S EKLKSFYNNVFNFLMLDSP+GKS R YNE C L GDIG
Sbjct: 61  DAAAAAAADDAASLKGNDNASTEKLKSFYNNVFNFLMLDSPSGKSKRVYNEKCPLKGDIG 120

Query: 117 DRPDQYEELYKLSANELSKCLELSQDEVARLTKSHKDYVDHIASLALPKGTYKGSGIATV 176
           DRPDQY++LYKLSA EL+KCLELS DEV++L KSHKDYV+HIASL LPKGTYKGSGIATV
Sbjct: 121 DRPDQYKDLYKLSAKELAKCLELSPDEVSKLKKSHKDYVEHIASLILPKGTYKGSGIATV 180

Query: 177 GGGKFSLMSFLIIKTLRNMGTTLPVEVLIPPGDEGESEFCNKILPNYNAKCIYVSDILPL 236
           GGGKFSLM+FLIIKTLRNMGTTLPVEVLIPPGDEGE+EFC+KILP YNAKCIY+SDILP 
Sbjct: 181 GGGKFSLMAFLIIKTLRNMGTTLPVEVLIPPGDEGETEFCSKILPKYNAKCIYISDILPA 240

Query: 237 ETIEKFTFKGYQFKSLALVASSFENLLLLDADNFPIKPLDNIFNEEPYLSTGLVMWPDFW 296
           ETIEKF FKGYQFKSLAL+ SSFENLLLLDADNFPIK LDNIF EEPY+STGLVMWPDFW
Sbjct: 241 ETIEKFVFKGYQFKSLALITSSFENLLLLDADNFPIKSLDNIFLEEPYVSTGLVMWPDFW 300

Query: 297 RRTTHPLYYEIADITVNMKNRVRNSQDDLTPPAIYTKNSNDLGGVPLSDLDGTIPDVSTE 356
           RRTTHPLYY+IA I VN + RVRNSQDD+TPPA+YTK+  DL  VPLSD++G IPDVSTE
Sbjct: 301 RRTTHPLYYDIAGIPVNKERRVRNSQDDITPPAVYTKDLKDLDAVPLSDMEGAIPDVSTE 360

Query: 357 SGQLMINKTKHLATALLSLFYNVNGPNWYYPIFSQKAAGEGDKETFIAAANFYGLSFYQV 416
           SGQLMINK+KHLATALLSLFYNVNG NWYYPIFSQKAAGEGDKETFIAAANFYGL FYQV
Sbjct: 361 SGQLMINKSKHLATALLSLFYNVNGINWYYPIFSQKAAGEGDKETFIAAANFYGLPFYQV 420

Query: 417 KTRTGVEGYHDKEGFHGVAMLQHDFVQDYSRYLTASKSITNKYKD--IKSSAAIKYDKNY 474
           KT+TGVEGYHD +GFHGVAMLQHDFVQDYSRYLTASK+I NKYKD  IKSSA IK+DK+Y
Sbjct: 421 KTKTGVEGYHDSDGFHGVAMLQHDFVQDYSRYLTASKTINNKYKDLIIKSSAPIKFDKDY 480

Query: 475 SLEKYTKEFFDNEDLKAKDHVDVMFIHSNLPKFDPYTLSETNFLTTDDKPARSFTALHKV 534
           SLEKY KEFFDNED  AKDHVDVMFIHSNLPKFDPY LS++NFLTTD+KPARSFT+L K+
Sbjct: 481 SLEKYIKEFFDNEDSHAKDHVDVMFIHSNLPKFDPYDLSKSNFLTTDNKPARSFTSLGKI 540

Query: 535 QNYDIELENFKVLKEYVCDKKNPFKYLDDKLGEDKKEWRRMCDYIAKRLQFLESTHDKVI 594
             YDIELENFK L EYVC  KNPFKYLDD LG+D+K W++MCDYIAKRLQFLESTH+K I
Sbjct: 541 HKYDIELENFKALHEYVCVNKNPFKYLDDALGQDEKGWKKMCDYIAKRLQFLESTHEKAI 600

Query: 595 AG 596
           AG
Sbjct: 601 AG 602

>Skud_2.127 Chr2 complement(241232..243022) [1791 bp, 596 aa] {ON}
           YBR015C (REAL)
          Length = 596

 Score =  957 bits (2474), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 468/595 (78%), Positives = 517/595 (86%), Gaps = 1/595 (0%)

Query: 1   MLLTKRFAKLFKLTFLVLILCGLFVVTNKYMDENTSVKDYKKYLLDNINXXXXXXXXXXX 60
           MLLTKRF+KLFKL F+ LILCGLFV+TNKYMDENTSV++YK YL D ++           
Sbjct: 1   MLLTKRFSKLFKLAFIALILCGLFVITNKYMDENTSVREYKSYLQDYLDSHSNKHPSTDA 60

Query: 61  XXXXXXXXXLKGNDKVSNEKLKSFYNNVFNFLMLDSPTGKSARKYNEACQLSGDIGDRPD 120
                     K ND  +  KLK FY+ VFNFL+LDSPTGKSAR Y +AC L+GDIGDRPD
Sbjct: 61  PVTDDSSSS-KVNDNAATRKLKDFYDKVFNFLILDSPTGKSARNYGKACLLNGDIGDRPD 119

Query: 121 QYEELYKLSANELSKCLELSQDEVARLTKSHKDYVDHIASLALPKGTYKGSGIATVGGGK 180
           QYEEL+KLSA +LSKCLELS DE++RLTKSH+DYV+HIA+L LPKGTYKGSGIATVGGGK
Sbjct: 120 QYEELHKLSAKQLSKCLELSPDEISRLTKSHRDYVEHIATLLLPKGTYKGSGIATVGGGK 179

Query: 181 FSLMSFLIIKTLRNMGTTLPVEVLIPPGDEGESEFCNKILPNYNAKCIYVSDILPLETIE 240
           FSLM+FLIIKTLRN GT LPVEVLIPPGDEGESEFCNKILP YN+KCIYVSDILP+ETI+
Sbjct: 180 FSLMAFLIIKTLRNRGTNLPVEVLIPPGDEGESEFCNKILPKYNSKCIYVSDILPVETIK 239

Query: 241 KFTFKGYQFKSLALVASSFENLLLLDADNFPIKPLDNIFNEEPYLSTGLVMWPDFWRRTT 300
           KF F+GYQFKSLAL+ASSFENLLLLDADNFPIK LDNIFNEEPY+STGLVMWPDFWRRTT
Sbjct: 240 KFHFEGYQFKSLALIASSFENLLLLDADNFPIKSLDNIFNEEPYVSTGLVMWPDFWRRTT 299

Query: 301 HPLYYEIADITVNMKNRVRNSQDDLTPPAIYTKNSNDLGGVPLSDLDGTIPDVSTESGQL 360
           HPLYYEIA I VNM  RVRNSQDD+TPPA+YTK+  +L  VPLSDLDGTIPDVSTESGQL
Sbjct: 300 HPLYYEIAGIPVNMNKRVRNSQDDITPPAVYTKDLKNLDDVPLSDLDGTIPDVSTESGQL 359

Query: 361 MINKTKHLATALLSLFYNVNGPNWYYPIFSQKAAGEGDKETFIAAANFYGLSFYQVKTRT 420
           MINK+K LATALLSLFYNVNGPNWYYPIFSQKAAGEGDKETFIAAANFYG  FYQV+TRT
Sbjct: 360 MINKSKQLATALLSLFYNVNGPNWYYPIFSQKAAGEGDKETFIAAANFYGEPFYQVRTRT 419

Query: 421 GVEGYHDKEGFHGVAMLQHDFVQDYSRYLTASKSITNKYKDIKSSAAIKYDKNYSLEKYT 480
           GVEGYH+ + FHGVAMLQHDFVQDYSRYL ASK   +KY  +KSSA+IK+DK+YS E Y 
Sbjct: 420 GVEGYHENKDFHGVAMLQHDFVQDYSRYLIASKKTNDKYNTMKSSASIKFDKSYSFENYF 479

Query: 481 KEFFDNEDLKAKDHVDVMFIHSNLPKFDPYTLSETNFLTTDDKPARSFTALHKVQNYDIE 540
           +EFF+NED  AK+HVDVMFIHSNLPKFDPY LSETNFLT D KPARS+TALHK+QNYDIE
Sbjct: 480 EEFFENEDTNAKNHVDVMFIHSNLPKFDPYDLSETNFLTIDKKPARSYTALHKIQNYDIE 539

Query: 541 LENFKVLKEYVCDKKNPFKYLDDKLGEDKKEWRRMCDYIAKRLQFLESTHDKVIA 595
           LENFK LKEYVC  KNPFKYLDD LGEDK +W++MCDYI +RL+FLESTHDK IA
Sbjct: 540 LENFKALKEYVCTNKNPFKYLDDALGEDKVKWKKMCDYITERLEFLESTHDKAIA 594

>KLTH0G16038g Chr7 (1404292..1406121) [1830 bp, 609 aa] {ON} similar
           to uniprot|P38069 Saccharomyces cerevisiae YBR015C MNN2
           Alpha-1 2-mannosyltransferase responsible for addition
           of the first alpha-1 2-linked mannose to form the
           branches on the mannan backbone of oligosaccharides
           localizes to an early Golgi compartment
          Length = 609

 Score =  717 bits (1851), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 356/609 (58%), Positives = 431/609 (70%), Gaps = 19/609 (3%)

Query: 1   MLLTKRFAKLFKLTFLVLILCGLFVVTNKYMDENTSVKDYKKYLLD-------NINXXXX 53
           +LLTKRF K+F+ + +  + C +FV++ +Y+D++ S  +Y +YL +       N N    
Sbjct: 2   VLLTKRFNKIFRFSLVAALCCLIFVLSTRYIDQDLSSLEYVRYLQNYHETYSGNGNKVEP 61

Query: 54  XXXXXXXXXXXXXXXX------LKGNDKVSNEKLKSFYNNVFNFLMLDSPTGKSARKYNE 107
                                 L   D+   + L+ FY  VF  L   SPTG S+R+Y+E
Sbjct: 62  EVETPPAPAANDKIKSPSGGPVLSAQDQKRRQALQEFYKQVFKNLRQHSPTGSSSRQYDE 121

Query: 108 ACQLSGDIGDRPDQYEELYKLSANELSKCLELSQDEVARLTKSHKDYVDHIASLALPKGT 167
            CQL+GDIG R + Y    KL++  L  CL+LS  E   L ++H D+V+ + SL LPKGT
Sbjct: 122 KCQLNGDIGARANDYNSWSKLTSKNLGNCLKLSNKEKTMLKETHYDFVESLKSLVLPKGT 181

Query: 168 YKGSGIATVGGGKFSLMSFLIIKTLRNMGTTLPVEVLIPPGDEGESEFCNKILPNYNAKC 227
           YKG GI TVGGGKFS++SFLIIKTLRN+GT LPVEV IPP DEGE EFCN +LP YNAKC
Sbjct: 182 YKGDGIVTVGGGKFSMLSFLIIKTLRNLGTHLPVEVFIPPNDEGEEEFCNTLLPKYNAKC 241

Query: 228 IYVSDILPLETIEKFTFKGYQFKSLALVASSFENLLLLDADNFPIKPLDNIFNEEPYLST 287
           IY+SD+LP + IE F FKGYQFKS++++ASSFENLLLLDADNFPIK LDNIF EEPY ST
Sbjct: 242 IYISDVLPEDIIENFDFKGYQFKSISIIASSFENLLLLDADNFPIKALDNIFEEEPYKST 301

Query: 288 GLVMWPDFWRRTTHPLYYEIADITVNMKNRVRNSQDDLTPPAIYTKNSNDLGGVPLSDLD 347
           G+V+WPDFWRRTT+P YYEIADI VN K RVRN  DD+TPP  YTK+  +L  VPL DL+
Sbjct: 302 GMVLWPDFWRRTTNPAYYEIADIAVNYKKRVRNCMDDITPPQAYTKDMKNLENVPLHDLE 361

Query: 348 GTIPDVSTESGQLMINKTKHLATALLSLFYNVNGPNWYYPIFSQKAAGEGDKETFIAAAN 407
           GTIPDVSTESGQLMI K++HL T LLSL+YNVNGP WYYPIFSQKA+GEGDKETFIAAAN
Sbjct: 362 GTIPDVSTESGQLMIRKSRHLPTILLSLYYNVNGPTWYYPIFSQKASGEGDKETFIAAAN 421

Query: 408 FYGLSFYQVKTRTGVEGYH--DKEGFHGVAMLQHDFVQDYSRYLTASKSITNKYKDIKSS 465
           FYGL FYQVK+ T V+GYH  D +GF GVAMLQHDFVQDYSRY  A   I NKY   K  
Sbjct: 422 FYGLPFYQVKSVTAVDGYHQPDNKGFRGVAMLQHDFVQDYSRYKWAKSDIENKYAG-KVP 480

Query: 466 AAIKYDKNYSLEKYTKEFFDNEDLKAKDHVDVMFIHSNLPKFDPYTLSETNFLTTDDKPA 525
             IK D +YS +   K +F+ EDLK    VD+MF+HSNLPKFDPYTL     L  D K  
Sbjct: 481 QFIKQDTSYSPDAMYKTYFEPEDLK---EVDIMFVHSNLPKFDPYTLWNDKDLIVDGKHI 537

Query: 526 RSFTALHKVQNYDIELENFKVLKEYVCDKKNPFKYLDDKLGEDKKEWRRMCDYIAKRLQF 585
           RS+T L ++ NYD+ELENFKV KEY+C  +  FKYLDD L  D+++W+ MC YI +RL F
Sbjct: 538 RSYTNLRRLNNYDLELENFKVFKEYLCVSRTKFKYLDDSLQGDERQWKSMCGYIKERLNF 597

Query: 586 LESTHDKVI 594
           L+ TH   I
Sbjct: 598 LDQTHSDAI 606

>KAFR0C00870 Chr3 complement(175651..177489) [1839 bp, 612 aa] {ON}
           Anc_3.188 YBR015C
          Length = 612

 Score =  707 bits (1824), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 351/612 (57%), Positives = 445/612 (72%), Gaps = 21/612 (3%)

Query: 2   LLTKRFAKLFKLTFLVLILCGLFVVTNKYM--DENTSVKDYKKYLLDNINXXXXXXXXXX 59
           ++ KRF+KLF    L++ +   F++TN+    +++ SVKDYK+YL   IN          
Sbjct: 3   VVNKRFSKLF---ILLVSIGFFFLLTNRLYINNDSVSVKDYKEYLQSYINNNAGDSTDAQ 59

Query: 60  XXXX--XXXXXXLKGNDKV--------SNEKLKSFYNNVFNFLMLDSPTGKSARKYNEAC 109
                        KG + V        +  +L+ FYN VF + +  SP+GKSAR Y +AC
Sbjct: 60  GTKGGDESVPAASKGKNPVLMSTVESNTKNRLREFYNEVFQYFINYSPSGKSARHYQDAC 119

Query: 110 QLSGDIGDRPDQYEELYKLSANELSKCLELSQDEVARLTKSHKDYVDHIASLALPKGTYK 169
           QLS  +G+RP +Y   YKLS  EL+KCL +S+ +V  L  SHK++V+++  L LPK +YK
Sbjct: 120 QLSEKMGNRPHEYASWYKLSYTELNKCLSISKSDVLNLKTSHKEFVENLGKLVLPKNSYK 179

Query: 170 GSGIATVGGGKFSLMSFLIIKTLRNMGTTLPVEVLIPPGDE-GESEFCNKILPNYNAKCI 228
           G+GI TVGGGKFSLMS L+I+TLRN+GTTLPVEV IPP +E GE EFCNKILP Y+AKCI
Sbjct: 180 GNGIVTVGGGKFSLMSLLVIRTLRNLGTTLPVEVFIPPQEEKGEMEFCNKILPQYHAKCI 239

Query: 229 YVSDILPLETIEKFTFKGYQFKSLALVASSFENLLLLDADNFPIKPLDNIFNEEPYLSTG 288
           Y+SDILP + I+ F F GYQFKSLA++ASSFENLLLLDADNFPIKPLD+IF EEPY+STG
Sbjct: 240 YISDILPQQMIDNFEFAGYQFKSLAIIASSFENLLLLDADNFPIKPLDHIFEEEPYVSTG 299

Query: 289 LVMWPDFWRRTTHPLYYEIADITVNMKNRVRNSQDDLTPPAIYTKNSNDLGGVPLSDLDG 348
           LV+WPDFWRRTT PLYYEIAD++V+ K RVRNS DD+TPP +YTK+ NDL  +PL DL G
Sbjct: 300 LVLWPDFWRRTTQPLYYEIADVSVDFKTRVRNSIDDITPPPVYTKDMNDLSNIPLHDLKG 359

Query: 349 TIPDVSTESGQLMINKTKHLATALLSLFYNVNGPNWYYPIFSQKAAGEGDKETFIAAANF 408
           TIPDVSTESGQLMI+K+KHL T LL+L+YNVNGP+WYYPIFSQKA+GEGDKETF+AAANF
Sbjct: 360 TIPDVSTESGQLMISKSKHLPTVLLALYYNVNGPSWYYPIFSQKASGEGDKETFLAAANF 419

Query: 409 YGLSFYQVKTRTGVEGYHDKE--GFHGVAMLQHDFVQDYSRYLTASKSITNKYKDIKSSA 466
           Y L +YQ++T  GV+GYH  E  GF GVAMLQHDF QDY RY+ A + +  KY   + S+
Sbjct: 420 YDLPYYQIRTEVGVDGYHQPENKGFRGVAMLQHDFAQDYKRYVKAKEEVRLKYGKDRYSS 479

Query: 467 AIKYDKNYSLEKYTKEFFDNEDLKAK---DHVDVMFIHSNLPKFDPYTLSETNFLTTDDK 523
            IKYD NY ++ + + +FD+     +     VDVMFIHSNLPKF+P T  +T+ L  D K
Sbjct: 480 KIKYDPNYDVDSFYRTYFDSGSEPGQGGAQEVDVMFIHSNLPKFEPLTSWKTSDLIIDGK 539

Query: 524 PARSFTALHKVQNYDIELENFKVLKEYVCDKKNPFKYLDDKLGEDKKEWRRMCDYIAKRL 583
             RSFT L +++NYDIELENFK+  E +C++   FKYLDD LG +K +   MC YI+ RL
Sbjct: 540 HIRSFTNLKRLKNYDIELENFKIYHEVLCEQGLHFKYLDDALGNNKNDKSSMCKYISDRL 599

Query: 584 QFLESTHDKVIA 595
            FL+STH+  I+
Sbjct: 600 DFLQSTHEAAIS 611

>SAKL0C10472g Chr3 (953238..955064) [1827 bp, 608 aa] {ON} similar
           to uniprot|P38069 Saccharomyces cerevisiae YBR015C MNN2
           Alpha-1 2-mannosyltransferase responsible for addition
           of the first alpha-1 2-linked mannose to form the
           branches on the mannan backbone of oligosaccharides
           localizes to an early Golgi compartment
          Length = 608

 Score =  704 bits (1817), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 347/613 (56%), Positives = 447/613 (72%), Gaps = 26/613 (4%)

Query: 1   MLLTKRFAKLFKLTFLVLILCGLFVVTNKYMDENTSVKDYKKYLLDNINXXXXXXXXXXX 60
           +LLTKRFAK+FKL  +  + C LF++TNKY+ ++  V +YK YL + I+           
Sbjct: 2   VLLTKRFAKVFKLAAITTLCCLLFILTNKYISQDLPVDEYKSYLQNYIDKYTSGSGNPPA 61

Query: 61  XXXXXXXXXLKGNDK----------------VSNEKLKSFYNNVFNFLMLDSPTGKSARK 104
                     KG D+                   +KL+ FY+ VF +L L SP GKS R 
Sbjct: 62  VVPSPPQ---KGRDREPMTDVSRQPASKKELQRRQKLQDFYSQVFKYLHLYSPKGKSTRV 118

Query: 105 YNEACQLSGDIGDRPDQYEELYKLSANELSKCLELSQDEVARLTKSHKDYVDHIASLALP 164
           Y+  C+L GDIG R D Y+  +KL++ EL +CL LS  E A L ++H  +V++++SL LP
Sbjct: 119 YDPRCKLDGDIGARLDDYDNWFKLTSEELGQCLMLSTREKAMLKENHAKFVENLSSLVLP 178

Query: 165 KGTYKGSGIATVGGGKFSLMSFLIIKTLRNMGTTLPVEVLIPPGDEGESEFCNKILPNYN 224
           K +YKG+GI TVGGGKFSL++FLIIKTLRNM TTLPVEVLIPP DEGE++FC+ +LP YN
Sbjct: 179 KDSYKGNGIVTVGGGKFSLLAFLIIKTLRNMHTTLPVEVLIPPKDEGETDFCDVLLPKYN 238

Query: 225 AKCIYVSDILPLETIEKFTFKGYQFKSLALVASSFENLLLLDADNFPIKPLDNIFNEEPY 284
           AKCIY+SD+LP   ++ F FKGYQFKSL+++ASSFENLLLLDADNFPIKPLD+IF+EEPY
Sbjct: 239 AKCIYISDVLPQSLVDNFEFKGYQFKSLSIIASSFENLLLLDADNFPIKPLDDIFDEEPY 298

Query: 285 LSTGLVMWPDFWRRTTHPLYYEIADITVNMKNRVRNSQDDLTPPAIYTKNSNDLGGVPLS 344
            STG+V+WPDFWRRTT+P YY+IADI ++   RVRN  D++TPP +YT++  DL  VPL 
Sbjct: 299 KSTGMVLWPDFWRRTTNPAYYDIADIPISYNKRVRNCIDNITPPELYTEDMEDLSNVPLH 358

Query: 345 DLDGTIPDVSTESGQLMINKTKHLATALLSLFYNVNGPNWYYPIFSQKAAGEGDKETFIA 404
           DLDGTIPDVSTESGQLMI+K+ HL T LLSL+YNVNGP+WYYPIFSQKAAGEGDKETFIA
Sbjct: 359 DLDGTIPDVSTESGQLMISKSSHLPTVLLSLYYNVNGPSWYYPIFSQKAAGEGDKETFIA 418

Query: 405 AANFYGLSFYQVKTRTGVEGYH--DKEGFHGVAMLQHDFVQDYSRYLTASKSITNKYKDI 462
            ANFYGL FYQVK+ T V+GYH  D +GF GVAMLQHDFVQDY RY  A K I  +Y   
Sbjct: 419 GANFYGLPFYQVKSATAVDGYHQPDGKGFRGVAMLQHDFVQDYQRYQWAFKDIRTQYSG- 477

Query: 463 KSSAAIKYDKNYSLEKYTKEFFDNEDLKAKDHVDVMFIHSNLPKFDPYTLSETNFLTTDD 522
           K+S +I  DK+Y+ E + +++F+ +D+K    VD+MF+HSNLPKFDP TL     L  + 
Sbjct: 478 KTSNSIHLDKDYTPESFYRKYFEGDDIK---EVDIMFVHSNLPKFDPLTLWREKDLIVNG 534

Query: 523 KPARSFTALHKVQNYDIELENFKVLKEYVCDKKNPFKYLDDKLGEDKKEWRRMCDYIAKR 582
           K  RS+T L ++  YD+ELE+FKV ++Y+C +++ FKYLD+ L E+  +W+ MCDYI  R
Sbjct: 535 KHIRSYTNLKRLNGYDLELESFKVFQDYLCVQRSHFKYLDEHLQEE-AQWQSMCDYIHNR 593

Query: 583 LQFLESTHDKVIA 595
           L+FL+STH   ++
Sbjct: 594 LKFLDSTHKDAVS 606

>TDEL0D04330 Chr4 complement(790232..792028) [1797 bp, 598 aa] {ON}
           Anc_3.188 YBR015C
          Length = 598

 Score =  688 bits (1775), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 333/599 (55%), Positives = 429/599 (71%), Gaps = 11/599 (1%)

Query: 2   LLTKRFAKLFKLTFLVLILCGLFVVTNKYMDENTSVKDYKKYLLDNINXXXXXXXXXXXX 61
           L+TKR+ K  KL  +VL+LC  F+ T+++MDE  SV +Y+ Y+   +             
Sbjct: 3   LITKRYRKALKLATVVLVLCVTFIATSRFMDEGLSVSEYQDYIKSYLGNAQPADTISRNP 62

Query: 62  XXXXXXXXLKGNDKVSN---EKLKSFYNNVFNFLMLDSPTGKSARKYNEACQLSGDIGDR 118
                     G + ++N    KLK FY  VF  L   SP+ KSAR+Y++ C LSGDIG R
Sbjct: 63  AVDVGLNA--GREPIANGGNAKLKKFYEQVFEDLKNYSPSSKSAREYSKQCSLSGDIGFR 120

Query: 119 PDQYEELYKLSANELSKCLELSQDEVARLTKSHKDYVDHIASLALPKGTYKGSGIATVGG 178
           P+ Y E +KL+  ELS+CL +S  +VA+L +SH DYV  + SL LPK +YKG GI TVGG
Sbjct: 121 PENYNEWFKLTERELSQCLVVSNADVAKLRQSHSDYVKALGSLVLPKNSYKGQGIVTVGG 180

Query: 179 GKFSLMSFLIIKTLRNMGTTLPVEVLIPPGDEGESEFCNKILPNYNAKCIYVSDILPLET 238
           GKFSLM+ L+IKTLRN+ TTLPVEV IPP DEGE++ C  +   YNAKCI++SDILP  +
Sbjct: 181 GKFSLMALLVIKTLRNLHTTLPVEVFIPPSDEGETDLCETVFSKYNAKCIFLSDILPAPS 240

Query: 239 IEKFTFKGYQFKSLALVASSFENLLLLDADNFPIKPLDNIFNEEPYLSTGLVMWPDFWRR 298
           ++KF F GYQFKSLAL+ASSFE++L LDADNFP+K LD+IF ++PY STGLV+WPDFWRR
Sbjct: 241 LKKFQFTGYQFKSLALIASSFEDVLFLDADNFPVKTLDHIFEQDPYHSTGLVLWPDFWRR 300

Query: 299 TTHPLYYEIADITVNMKNRVRNSQDDLTPPAIYTKNSNDLGGVPLSDLDGTIPDVSTESG 358
           TT PL+Y+IA I V+ K RVRN  DDLTPP +YTKN  DL  VP  DL+G+IP+VSTESG
Sbjct: 301 TTQPLFYDIAGIQVDRKKRVRNCFDDLTPPEVYTKNLGDLSNVPFHDLEGSIPEVSTESG 360

Query: 359 QLMINKTKHLATALLSLFYNVNGPNWYYPIFSQKAAGEGDKETFIAAANFYGLSFYQVKT 418
           QLMI+K+KHL T LL+L+YNVNGP+WYYP+FSQ+A+GEGDKETF+ AA+FYGL +YQ+K+
Sbjct: 361 QLMISKSKHLPTILLALYYNVNGPSWYYPMFSQRASGEGDKETFLTAASFYGLPYYQLKS 420

Query: 419 RTGVEGYH--DKEGFHGVAMLQHDFVQDYSRYLTASKSITNKYKDIKSSAAIKYDKNYSL 476
            TGVEGYH  D +GF GVAMLQHD  QDY RY TA K+I+NKY    + A I YD +YSL
Sbjct: 421 ATGVEGYHRPDGQGFRGVAMLQHDVTQDYMRYKTAQKAISNKY---GAQAKISYDSSYSL 477

Query: 477 EKYTKEFFDNEDLKAKDHVDVMFIHSNLPKFDPYTLSETNFLTTDDKPARSFTALHKVQN 536
            ++ K +F  ++    + VD+MF HS+ PKF+PYTL +   L  + K  RS+TAL K+  
Sbjct: 478 HEFYKTYFGADEPNYPNEVDIMFAHSHAPKFEPYTLWKNQDLIWEGKHIRSYTALSKINR 537

Query: 537 YDIELENFKVLKEYVCDKKNPFKYLDDKLGEDKKEWRRMCDYIAKRLQFLESTHDKVIA 595
           YD+ELENFK + EYVC K+   KYL++ L     EW  MCDYI  RL +L+STH + ++
Sbjct: 538 YDLELENFKAINEYVCVKRTNVKYLNENLATS-AEWASMCDYIRDRLAYLQSTHVQAVS 595

>Kwal_56.23117 s56 complement(407699..409522) [1824 bp, 607 aa] {ON}
           YBR015C (MNN2) - putative Golgi
           alpha-1,2-mannosyltransferase [contig 183] FULL
          Length = 607

 Score =  683 bits (1763), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 337/603 (55%), Positives = 425/603 (70%), Gaps = 17/603 (2%)

Query: 1   MLLTKRFAKLFKLTFLVLILCGLFVVTNKYMDENTSVKDYKK----YLLDNINXXXXXXX 56
           + LTKRF+K+FKL+ +  + C  F+ + KY D++ +  +Y K    ++ D          
Sbjct: 2   VFLTKRFSKIFKLSLVAALCCLAFMFSTKYFDKDLTSLEYGKLVDTFMADAGYGKDAQEV 61

Query: 57  XXXXXXXXXXXXXLKGNDKV---SNEK----LKSFYNNVFNFLMLDSPTGKSARKYNEAC 109
                        +    KV   SNEK    ++ FY +VFN L   SPTG S R+Y   C
Sbjct: 62  AGSSSDGTADNNGIGAGAKVSTSSNEKRKIAMRKFYTDVFNSLKKHSPTGVSKREYGAQC 121

Query: 110 QLSGDIGDRPDQYEELYKLSANELSKCLELSQDEVARLTKSHKDYVDHIASLALPKGTYK 169
           +LSGDIG R D Y+   KL++  L +CL +S  E   L + H+ YV+ + SL LPKG YK
Sbjct: 122 KLSGDIGARADDYDNWSKLTSKNLGQCLIVSDKEKRMLKEKHRGYVESLESLVLPKGAYK 181

Query: 170 GSGIATVGGGKFSLMSFLIIKTLRNMGTTLPVEVLIPPGDEGESEFCNKILPNYNAKCIY 229
           G GI TVGGGKFS+++FLIIKTLRN+ T+LPVEV IPP DEGE+ FCN++LP YNAKCIY
Sbjct: 182 GDGIVTVGGGKFSMLAFLIIKTLRNLHTSLPVEVFIPPADEGETFFCNELLPQYNAKCIY 241

Query: 230 VSDILPLETIEKFTFKGYQFKSLALVASSFENLLLLDADNFPIKPLDNIFNEEPYLSTGL 289
           +SD+LP E I+ F FKGYQFKS+A++ASSF+NLLLLDADNFPIK LDN+FNEEPY S G+
Sbjct: 242 ISDVLPQEIIDNFEFKGYQFKSIAIIASSFDNLLLLDADNFPIKDLDNVFNEEPYKSKGM 301

Query: 290 VMWPDFWRRTTHPLYYEIADITVNMKNRVRNSQDDLTPPAIYTKNSNDLGGVPLSDLDGT 349
           V+WPDFWRRTT+P+YY+IADI VN K RVRN  DD+TPPA+YTK+ +DL  VPL DL+GT
Sbjct: 302 VLWPDFWRRTTNPIYYDIADIEVNYKKRVRNCMDDVTPPAVYTKDMSDLSNVPLHDLEGT 361

Query: 350 IPDVSTESGQLMINKTKHLATALLSLFYNVNGPNWYYPIFSQKAAGEGDKETFIAAANFY 409
           IPDVSTESGQLMI K+ HL T LLSL+YNVNGP+WYYPIFSQKA+GEGDKETFIAAANFY
Sbjct: 362 IPDVSTESGQLMIRKSDHLGTILLSLYYNVNGPSWYYPIFSQKASGEGDKETFIAAANFY 421

Query: 410 GLSFYQVKTRTGVEGYHD--KEGFHGVAMLQHDFVQDYSRYLTASKSITNKYKDIKSSAA 467
            L FYQVK+ T V+GYH    +GF GVAMLQHDFVQDY R + A   I + +   K +  
Sbjct: 422 DLPFYQVKSVTAVDGYHQPHDKGFRGVAMLQHDFVQDYGRQMWAQVEIRSHFAG-KDTQY 480

Query: 468 IKYDKNYSLEKYTKEFFDNEDLKAKDHVDVMFIHSNLPKFDPYTLSETNFLTTDDKPARS 527
            KYD +YS +   K+FF ++++      D+MF+HSNLPKFDPY L     L  D K  RS
Sbjct: 481 AKYDPSYSPDAVYKKFFSDDNIG---ETDIMFVHSNLPKFDPYQLWHDQDLIVDGKHIRS 537

Query: 528 FTALHKVQNYDIELENFKVLKEYVCDKKNPFKYLDDKLGEDKKEWRRMCDYIAKRLQFLE 587
           +  L ++  YD+ELENFK+  EY+C  +  FKYLDDKL  D++ W+ MC YI +RL++LE
Sbjct: 538 YRNLKRLNGYDLELENFKIFNEYLCTTQARFKYLDDKLNGDQRNWKDMCSYIGERLKYLE 597

Query: 588 STH 590
            TH
Sbjct: 598 QTH 600

>NCAS0E01590 Chr5 (302992..304818) [1827 bp, 608 aa] {ON} Anc_3.188
          Length = 608

 Score =  664 bits (1713), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 332/615 (53%), Positives = 429/615 (69%), Gaps = 27/615 (4%)

Query: 1   MLLTKRFAKLFKLTFLVLIL-CGLFVVTNKYMDENTSVKDYKKYLLDNINXXXXXXXXXX 59
           +LL +RF+++FKL  L+ I+  GLF   +    E+ SVKDYK+YL + IN          
Sbjct: 2   VLLRRRFSRVFKLALLLSIVGAGLFFFNSGQYSESISVKDYKEYLQNYINSNSDPTPSSS 61

Query: 60  XXXXXXXXXXLK---------------GNDKVSNEKLKSFYNNVFNFLMLDSPTGKSARK 104
                     LK               G+ K  +EK+K+F+N VF  ++  SP GK+ + 
Sbjct: 62  PNAAKQPAANLKDESNKNNNKKNGGSVGSPKTHDEKMKAFFNTVFQHIIDYSPKGKTKKI 121

Query: 105 YN-EACQLSGDIGDRPDQYEELYKLSANELSKCLELSQDEVARLTKSHKDYVDHIASLAL 163
           YN E C L GD+G RP+ Y++ YKLS   L  CLE+S  E   L  SH  + +++  L L
Sbjct: 122 YNKEKCLLDGDVGSRPENYKDWYKLSYKNLGNCLEVSDTEFTNLKTSHASFTENLNKLVL 181

Query: 164 PKGTYKGSGIATVGGGKFSLMSFLIIKTLRNMGTTLPVEVLIPPGD-EGESEFCNKILPN 222
           PKGTYKG GI  VGGGKFSL+S+L+IKT+RN+GTTLP+EV IPP + EGESEFC++ + +
Sbjct: 182 PKGTYKGDGIVLVGGGKFSLLSYLVIKTIRNLGTTLPIEVFIPPNEVEGESEFCSQTISD 241

Query: 223 YNAKCIYVSDILPLETIEKFTFKGYQFKSLALVASSFENLLLLDADNFPIKPLDNIFNEE 282
            +AKCIY+SDILP + + KF FKGYQFKSLA++ASSFENLLLLDADN PIK L+ IF +E
Sbjct: 242 LDAKCIYISDILPKDMVSKFEFKGYQFKSLAIIASSFENLLLLDADNTPIKNLNTIFKQE 301

Query: 283 PYLSTGLVMWPDFWRRTTHPLYYEIADITVNMKNRVRNSQDDLTPPAIYTKNSNDLGGVP 342
           PY S GLV+WPDFWRRTT P+YY+IA I VN++ RVRN  DDLTP  +YTK   D+  +P
Sbjct: 302 PYASRGLVLWPDFWRRTTQPIYYKIAGIPVNLQKRVRNDIDDLTPVGVYTKP--DMVDIP 359

Query: 343 LSDLDGTIPDVSTESGQLMINKTKHLATALLSLFYNVNGPNWYYPIFSQKAAGEGDKETF 402
             D +GT+PDVSTESGQLM+NK+KHLAT LL+L+YNVNGPNWYYPIFSQKAAGEGDKETF
Sbjct: 360 FHDFEGTMPDVSTESGQLMVNKSKHLATVLLALYYNVNGPNWYYPIFSQKAAGEGDKETF 419

Query: 403 IAAANFYGLSFYQVKTRTGVEGYHDKEGFHGVAMLQHDFVQDYSRYLTASKSITNKYKDI 462
           IA ANFY L +YQVK++ GV+GYH KEGF GVAMLQHDFVQDY+RY  AS  I  +Y + 
Sbjct: 420 IAGANFYDLPYYQVKSKVGVDGYHRKEGFRGVAMLQHDFVQDYNRYKLASADIAREYSN- 478

Query: 463 KSSAAIKYDKNYSLEKYTKEFFDNEDLKAKDHVDVMFIHSNLPKFDPYTLSETNFLTTDD 522
              +++ +DK+Y+++K+  ++FDN D    + +DVMFIHSNLPKFDP  L + N L  D 
Sbjct: 479 --PSSVVFDKSYTVQKFYDKYFDNTD----EDIDVMFIHSNLPKFDPLPLWKDNDLIEDG 532

Query: 523 KPARSFTALHKVQNYDIELENFKVLKEYVCDKKNPFKYLDDKLGEDKKEWRRMCDYIAKR 582
           KP RS+T L K+  +DIE ENFK LKE +C+K   FKYL D+   + +     C YI  R
Sbjct: 533 KPVRSYTNLRKLGYHDIEYENFKTLKELLCEKNVDFKYLADEFKSNPQARMSFCKYITDR 592

Query: 583 LQFLESTHDKVIAGN 597
            ++LE TH + ++ +
Sbjct: 593 YKYLEETHQEALSAS 607

>TBLA0F00740 Chr6 (187874..189835) [1962 bp, 653 aa] {ON} Anc_3.188
           YBR015C
          Length = 653

 Score =  659 bits (1699), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 318/530 (60%), Positives = 392/530 (73%), Gaps = 8/530 (1%)

Query: 73  NDKVSNEKLKSFYNNVFNFLMLDSPTGKSARKYNEACQLSGDIGDRPDQYEELYKLSANE 132
           ++    +K+  FY ++FN L   +  GKS R Y   CQL GD+G RPD Y+E YKL++ E
Sbjct: 122 DEATRKQKVYKFYQDIFNILKNTTIPGKSDRVYKLECQLKGDVGTRPDNYKEWYKLTSKE 181

Query: 133 LSKCLELSQDEVARLTKSHKDYVDHIASLALPKGTYKGSGIATVGGGKFSLMSFLIIKTL 192
           LS CLE+  +    L +SH DYVD I SL LPK  Y G GI TVGGGKFS+++FLII+TL
Sbjct: 182 LSNCLEVPYETAKMLQESHADYVDKIGSLVLPKVAYGGKGIVTVGGGKFSVLAFLIIRTL 241

Query: 193 RNMGTTLPVEVLIPPGDEGESEFCNKILPNYNAKCIYVSDILPLETIEKFTFKGYQFKSL 252
           RN+GT+LPVEV IPP DEGE++FCN +LP YNAKCIY++DILP E +++F FKGYQFKSL
Sbjct: 242 RNLGTSLPVEVFIPPSDEGETDFCNNVLPQYNAKCIYMTDILPKEFVDEFEFKGYQFKSL 301

Query: 253 ALVASSFENLLLLDADNFPIKPLDNIFNEEPYLSTGLVMWPDFWRRTTHPLYYEIADITV 312
           A++ASSF++LL+LDADNFPIK LDNIF +EPY STGLVMWPDFWRRTT+P+YY IAD+ V
Sbjct: 302 AMIASSFDDLLMLDADNFPIKDLDNIFEQEPYTSTGLVMWPDFWRRTTNPVYYSIADVPV 361

Query: 313 NMKNRVRNSQDDLTPPAIYTKNSNDLGGVPLSDLDGTIPDVSTESGQLMINKTKHLATAL 372
           N K RVRN+ DDLTP  IYT++ +DL  VP  DL+GT+PDVSTESGQLMINK KH+AT L
Sbjct: 362 NEKKRVRNTFDDLTPVEIYTEDISDLSDVPFHDLEGTLPDVSTESGQLMINKEKHIATVL 421

Query: 373 LSLFYNVNGPNWYYPIFSQKAAGEGDKETFIAAANFYGLSFYQVKTRTGVEGYH--DKEG 430
           L+L+YN NGP WYYPIFSQKAAGEGDKETFIAAANFYGLS+YQV+T  GV+GYH  D +G
Sbjct: 422 LALYYNFNGPTWYYPIFSQKAAGEGDKETFIAAANFYGLSYYQVRTSVGVDGYHQSDDKG 481

Query: 431 FHGVAMLQHDFVQDYSRYLTASKSITNKYKDIKSSAAIKYDKNYSLEKYTKEFFDNEDLK 490
           F GVAMLQHDFVQDY RY  A   I  KY   K    +KYD NYS + + K +FD+ D  
Sbjct: 482 FRGVAMLQHDFVQDYERYERARNEIDIKYGGAKK--VMKYDYNYSPDDFYKTYFDSGDDS 539

Query: 491 AKDH----VDVMFIHSNLPKFDPYTLSETNFLTTDDKPARSFTALHKVQNYDIELENFKV 546
             +     VD+MF+HSNLPKFDP+TL + N LT D    RS+  L  + +YD+E ENFK+
Sbjct: 540 NVNQPIKEVDIMFVHSNLPKFDPFTLWDENDLTLDGSHFRSYLKLPHLTHYDLEYENFKI 599

Query: 547 LKEYVCDKKNPFKYLDDKLGEDKKEWRRMCDYIAKRLQFLESTHDKVIAG 596
             + +C  KN FKYL+DK    +     MC+YI  RL++L  TH+  + G
Sbjct: 600 FHQSLCVLKNQFKYLEDKFQGKESNRESMCNYIMDRLKYLTDTHEMALKG 649

 Score = 49.3 bits (116), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 25/51 (49%), Positives = 34/51 (66%), Gaps = 2/51 (3%)

Query: 1  MLLTKRFAKLFKLTFLVLILCGLFVVTNKYMDE--NTSVKDYKKYLLDNIN 49
          M+LT+RF KL KL   V++L GLF+ TN Y+D+  + SV DY + L   IN
Sbjct: 1  MILTRRFFKLLKLISAVIVLTGLFIATNNYLDDAVSVSVSDYTQRLQSYIN 51

>ZYRO0A04950g Chr1 complement(397314..399170) [1857 bp, 618 aa] {ON}
           similar to uniprot|P38069 Saccharomyces cerevisiae
           YBR015C MNN2 Alpha-1 2-mannosyltransferase responsible
           for addition of the first alpha-1 2-linked mannose to
           form the branches on the mannan backbone of
           oligosaccharides localizes to an early Golgi compartment
          Length = 618

 Score =  634 bits (1635), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 307/521 (58%), Positives = 385/521 (73%), Gaps = 5/521 (0%)

Query: 77  SNEKLKSFYNNVFNFLMLDSPTGKSARKYNEACQLSGDIGDRPDQYEELYKLSANELSKC 136
           S  KLK FY  VF  L   SP GKS R Y E C L GDIG RP+ Y+E   L+ + L  C
Sbjct: 100 STAKLKRFYEEVFTHLKNFSPEGKSQRIYKEDCPLHGDIGFRPENYDEWPTLAHDSLENC 159

Query: 137 LELSQDEVARLTKSHKDYVDHIASLALPKGTYKGSGIATVGGGKFSLMSFLIIKTLRNMG 196
           LE+S +EV  L K+H  YVD + SL LPK  YKG GI TVGGGKFSL++ L+I+++R +G
Sbjct: 160 LEISPEEVTMLKKNHAAYVDVLGSLRLPKNVYKGKGIVTVGGGKFSLLALLVIRSMRELG 219

Query: 197 TTLPVEVLIPPGDEGESEFCNKILPNYNAKCIYVSDILPLETIEKFTFKGYQFKSLALVA 256
           TTLPVEV IPP D GE++FC++ILP YNAKC+Y+SD+LP   I    F GYQFKSL+L+A
Sbjct: 220 TTLPVEVFIPPSDLGENQFCDEILPQYNAKCVYLSDVLPPNVIANSQFTGYQFKSLSLIA 279

Query: 257 SSFENLLLLDADNFPIKPLDNIFNEEPYLSTGLVMWPDFWRRTTHPLYYEIADITVNMKN 316
           SSFE++L LDADNFP+K L+++F+  PY +TG V+WPDFWRRTT P+YY+IADITVN + 
Sbjct: 280 SSFEDVLFLDADNFPVKRLNDVFDLAPYKTTGFVLWPDFWRRTTQPIYYDIADITVNRRK 339

Query: 317 RVRNSQDDLTPPAIYTKNSNDLGGVPLSDLDGTIPDVSTESGQLMINKTKHLATALLSLF 376
           R+RN  DDLTPP +YTKN+  +  +P  D +GTIPDVSTESGQLMI+K+ HL T LL+L+
Sbjct: 340 RIRNCFDDLTPPEVYTKNTKSMDDIPFHDFEGTIPDVSTESGQLMISKSTHLPTILLALY 399

Query: 377 YNVNGPNWYYPIFSQKAAGEGDKETFIAAANFYGLSFYQVKTRTGVEGYH--DKEGFHGV 434
           YNVNGP+WYYP+FSQ+AAGEGDKETF+AAANFYGL FYQVKT TGVEGYH  + EGF GV
Sbjct: 400 YNVNGPSWYYPMFSQRAAGEGDKETFLAAANFYGLPFYQVKTATGVEGYHRANNEGFRGV 459

Query: 435 AMLQHDFVQDYSRYLTASKSITNKYKDIKSSAAIKYDKNYSLEKYTKEFFDNEDLKAKDH 494
           AMLQHD  QDY RY  A+ +I  KY   K++ +IKYDK YSL+ + K FF +E+   K+ 
Sbjct: 460 AMLQHDLNQDYLRYQAAADAIEAKYGG-KTAKSIKYDKLYSLDNFYKTFFGSENSALKE- 517

Query: 495 VDVMFIHSNLPKFDPYTLSETNFLTTDDKPARSFTALHKVQNYDIELENFKVLKEYVCDK 554
            DVMF HS+ PKFDPY L   N L  D K  RS+T+L K+ NYD+EL     + ++VC  
Sbjct: 518 CDVMFAHSHAPKFDPYGLWTQNELVQDGKHFRSYTSLEKINNYDLELSAIDSIHKFVCLD 577

Query: 555 KNPFKYLDDKLGEDKKEWRRMCDYIAKRLQFLESTHDKVIA 595
           K  FKYL +K+ + K+E + MCDYI+KR +FL STH + I+
Sbjct: 578 KVNFKYLSEKI-QSKQEHQEMCDYISKRREFLLSTHQQAIS 617

>KNAG0K01290 Chr11 (254881..256716) [1836 bp, 611 aa] {ON} 
          Length = 611

 Score =  633 bits (1633), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 326/611 (53%), Positives = 409/611 (66%), Gaps = 24/611 (3%)

Query: 2   LLTKRFAKLFKLTFLVLILCGLFVVTNKYM-DENTSVKDYKKYLLDNINXXXXXXXXXXX 60
            + +RF KL ++   V+  C LF+    Y+ D   SV  Y K+L ++++           
Sbjct: 3   FVNRRFVKLLRVAVFVVFGCVLFIAATHYVYDGANSVSGYGKHLQEHLSGTATVSAPSAK 62

Query: 61  XXXXXXXXXLKGNDK---------VSNEKLKSFYNNVFNFLMLDSPTGKSARKYNEACQL 111
                      G            + + KLK FY+ VF  ++  SP+G + ++Y   C+L
Sbjct: 63  TAASAVAGGAGGGVPAAAGAAAAALDSMKLKKFYSRVFQNIIDFSPSGATKKQYKPECRL 122

Query: 112 SGDIGDRPDQYEELYKLSANELSKCLELSQDEVARLTKSHKDYVDHIASLALPKGTYKGS 171
            GDIG RPD Y    +L  + L  CL LS  +++ L  SHK +VD +  + LP  +YKGS
Sbjct: 123 EGDIGSRPDDYSNFDRLGYDNLVNCLNLSGADISNLRHSHKSFVDSL-DVTLPSNSYKGS 181

Query: 172 GIATVGGGKFSLMSFLIIKTLRNMGTTLPVEVLIPPGDEGESEFCNKILPNYNAKCIYVS 231
           GI TVGGGKFSLM+FLI++ +R MGTTLPVEV IPP +  E+EFC ++LP YNAKCI++ 
Sbjct: 182 GIVTVGGGKFSLMAFLIVQNIRRMGTTLPVEVFIPPNEGPETEFCTELLPKYNAKCIFID 241

Query: 232 DILPLETIEKFTFKGYQFKSLALVASSFENLLLLDADNFPIKPLDNIFNEEPYLSTGLVM 291
            ILP E I+KF F+GYQFKSLALVASSFEN LLLDADNFP+KPL++IFNEEP+ S GLV+
Sbjct: 242 RILPDEMIQKFDFRGYQFKSLALVASSFENTLLLDADNFPVKPLNSIFNEEPFKSKGLVL 301

Query: 292 WPDFWRRTTHPLYYEIADITVNMKNRVRNSQDDLTPPAIYTKNSNDLGGVPLSDLDGTIP 351
           WPDFWRRTT PLYY+IA + VN+KNRVRNS DDLTPP +YT+N NDL GVP  DL+GT+P
Sbjct: 302 WPDFWRRTTQPLYYDIAGVPVNLKNRVRNSFDDLTPPEVYTENMNDLSGVPFHDLEGTMP 361

Query: 352 DVSTESGQLMINKTKHLATALLSLFYNVNGPNWYYPIFSQKAAGEGDKETFIAAANFYGL 411
           DVSTESGQLM+NK KHL T LL+L+YNVNGP WYYPIFSQKAAGEGDKETFIAAANFYGL
Sbjct: 362 DVSTESGQLMVNKNKHLGTILLALYYNVNGPTWYYPIFSQKAAGEGDKETFIAAANFYGL 421

Query: 412 SFYQVKTRTGVEGYHDKEGFHGVAMLQHDFVQDYSRYLTASKSITNKY--KDIKSSAA-- 467
            FYQVK+ T V+GY +   FHGVAMLQ+D VQDY  Y  A   I  KY    + +SA+  
Sbjct: 422 PFYQVKSSTSVDGYFENGEFHGVAMLQYDCVQDYKLYQIAKDDIDVKYGLSRVGNSASQK 481

Query: 468 -IKYDKNYSLEKYTKEFFDNEDLKAKDHVDVMFIHSNLPKFDPYTLSETNFLT-TDDKPA 525
            I +DK+YSLE +  ++F     +   H DVMFIHSN PKFDP +L +   L   D    
Sbjct: 482 RISFDKSYSLEDFKNKYF-----REDSHNDVMFIHSNFPKFDPLSLWKNRQLVDKDGNHF 536

Query: 526 RSFTALHKVQNYDIELENFKVLKEYVC--DKKNPFKYLDDKLGEDKKEWRRMCDYIAKRL 583
           RS+T L K  ++DIELENFK+ K + C   K + F YL D L +    W  MC+YI KRL
Sbjct: 537 RSYTNLRKFGDFDIELENFKIFKNFFCGDQKVSYFSYLYDALEKTPTGWNDMCEYINKRL 596

Query: 584 QFLESTHDKVI 594
            FLE TH + +
Sbjct: 597 VFLEKTHLEAV 607

>NDAI0G01790 Chr7 (392941..394764) [1824 bp, 607 aa] {ON} Anc_3.188
          Length = 607

 Score =  623 bits (1606), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 313/601 (52%), Positives = 408/601 (67%), Gaps = 15/601 (2%)

Query: 1   MLLTKRFAKLFKLTFLVLILC--GLFVVTNKYMDENTSVKDYKKYLLDNINXXXXXXXXX 58
           M  T++FA+L K+T ++ +LC   +++ +    + + SV++YK+YL   IN         
Sbjct: 1   MFFTRKFARLLKITTILCLLCFFCIWIPSEYSTNSSISVQEYKEYLQGYINKLPIQSNSN 60

Query: 59  XXXXXXXXXXXL-KGNDK-----VSNEKLKSFYNNVFNFLMLDSPTGKSARKYNEACQLS 112
                      L  G +K     +    ++ FYN VF  ++  SP+GK+AR Y+  C+L 
Sbjct: 61  VNDDTQKEFQHLVSGENKEDIPSIKKNTVEDFYNVVFQNIIDYSPSGKTARNYSSKCKLD 120

Query: 113 GDIGDRPDQYEELYKLSANELSKCLELSQDEVARLTKSHKDYVDHIASLALPKGTYKGSG 172
             I  RPD Y++  KLS   L  CLE+S +E   L+ SH ++V+H+  L LPKGTY   G
Sbjct: 121 QGIASRPDSYKDWEKLSMQNLLNCLEVSPEEFTNLSTSHHNFVEHVNKLVLPKGTYNNDG 180

Query: 173 IATVGGGKFSLMSFLIIKTLRNMGTTLPVEVLIPPGDEGESE-FC-NKILPNYNAKCIYV 230
           I  VGGGKF+ M++L++KTLRN GTTLPVE+ IPP D  + E FC +++L   +AKCIY+
Sbjct: 181 IVMVGGGKFTFMAYLVLKTLRNQGTTLPVEIFIPPIDTVKEETFCKSEMLSELSAKCIYM 240

Query: 231 SDILPLETIEKFTFKGYQFKSLALVASSFENLLLLDADNFPIKPLDNIFNEEPYLSTGLV 290
           S+ILP E IEKF FKGYQFKSLA++ASSFENLLLLDADNFPIK LD IF  EPY STGLV
Sbjct: 241 SNILPQEMIEKFDFKGYQFKSLAIIASSFENLLLLDADNFPIKSLDKIFKHEPYNSTGLV 300

Query: 291 MWPDFWRRTTHPLYYEIADITVNMKNRVRNSQDDLTPPAIYTKNSNDLGGVPLSDLDGTI 350
           MWPDFWRRTT P+YY++ADI VN+  RVRN  DD+TP  +Y+ ++ D   +P  D +GT+
Sbjct: 301 MWPDFWRRTTQPIYYKLADIYVNVLKRVRNDIDDITPTKVYSDDNFDFTKIPFHDFEGTM 360

Query: 351 PDVSTESGQLMINKTKHLATALLSLFYNVNGPNWYYPIFSQKAAGEGDKETFIAAANFYG 410
           PD STESGQLMINK+KHL T LL+L+YNVNGPNWYYPIFSQ A GEGDKETFIAAA FY 
Sbjct: 361 PDDSTESGQLMINKSKHLPTVLLALYYNVNGPNWYYPIFSQNAHGEGDKETFIAAATFYR 420

Query: 411 LSFYQVKTRTGVEGYHDKEGFHGVAMLQHDFVQDYSRYLTASKSITNKYKDIKSSAAIKY 470
           L FYQV+T+ G +GYH K+ F GVAM QHDF+QDY  Y  A + I  +Y ++K    IKY
Sbjct: 421 LPFYQVRTKVGADGYHTKDRFQGVAMAQHDFIQDYEHYQIAQREIKKRYSNVKD---IKY 477

Query: 471 DKNYSLEKYTKEFFDNEDLKAKDHVDVMFIHSNLPKFDPYTLSETNFLTTDD-KPARSFT 529
           D  Y+++K+  EFF N+D      +D+MF+HSNLPKFDP  L E + L  +  K  RSF+
Sbjct: 478 DAEYAVQKFYDEFF-NKDTTKYGEIDIMFLHSNLPKFDPLKLWEDSALIDETGKHFRSFS 536

Query: 530 ALHKVQNYDIELENFKVLKEYVCDKKNPFKYLDDKLGEDKKEWRRMCDYIAKRLQFLEST 589
               V+ YDIE ENFK++K+ +CDK   F YLD++L E  ++W  MC YI  R  FL+ T
Sbjct: 537 DPKIVKKYDIEYENFKIIKDVICDKGIHFSYLDEELQEKPQDWVSMCQYIKDRYIFLKDT 596

Query: 590 H 590
           H
Sbjct: 597 H 597

>TPHA0A04380 Chr1 (982546..984474) [1929 bp, 642 aa] {ON} Anc_3.188
           YBR015C
          Length = 642

 Score =  624 bits (1609), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 306/522 (58%), Positives = 386/522 (73%), Gaps = 19/522 (3%)

Query: 81  LKSFYNNVFNFLMLDSPTGKSARKYNEACQLSGDIGDRPDQYEELYKLSANELSKCLELS 140
           LK FY+ VF+ +   SP GK ARKY E+C L+ +I DRP+  E  +KL+   L  CLE +
Sbjct: 127 LKEFYSQVFDSIRKYSPVGKCARKYKESCILTDNIPDRPENSEHWFKLTKKALENCLEFT 186

Query: 141 QDEVARLTKSHKDYVDHIASLALPKGTYKGSGIATVGGGKFSLMSFLIIKTLRNMGTTLP 200
            DE   L  +H ++V+ I+ L LPK  Y   GI  VGGGKFS+++FLIIKTLRN+GTTLP
Sbjct: 187 PDEFKMLKSTHDNFVNSISKLTLPKQGYSKQGIVMVGGGKFSMLAFLIIKTLRNLGTTLP 246

Query: 201 VEVLIPPGDEGESE-FCNKILPNYNAKCIYVSDILPLETIEKFTFKGYQFKSLALVASSF 259
           VEV IPP DE E + FC  +LPN+NAKCI++SD+LP E I+ F FKGYQFKSLAL++SSF
Sbjct: 247 VEVFIPPVDEAEKDDFCKDVLPNFNAKCIFISDVLPEEQIKTFDFKGYQFKSLALISSSF 306

Query: 260 ENLLLLDADNFPIKPLDNIFNEEPYLSTGLVMWPDFWRRTTHPLYYEIADITVNMKNRVR 319
           E+LLLLDADNFP+K LDNIF++EPY S GL++WPDFWRRTT P+YY+IAD+ V+   RVR
Sbjct: 307 EDLLLLDADNFPVKNLDNIFDQEPYKSKGLILWPDFWRRTTTPVYYQIADVPVDYTKRVR 366

Query: 320 NSQDDLTPPAIYTKNSNDLGGVPLSDLDGTIPDVSTESGQLMINKTKHLATALLSLFYNV 379
           NS DDLTPP IYT+N   L  VPL DL GTIPD STESGQL+INK +H+ T LLSL+YN+
Sbjct: 367 NSIDDLTPPEIYTEN---LDTVPLHDLQGTIPDPSTESGQLLINKKQHVPTLLLSLYYNI 423

Query: 380 NGPNWYYPIFSQKAAGEGDKETFIAAANFYGLSFYQVKTRTGVEGYH--DKEGFHGVAML 437
           NGPNWYYP+F+QKAAGEGDKETFIAAA +Y L FYQVKT+TGV+GYH  D +GF GVAML
Sbjct: 424 NGPNWYYPMFTQKAAGEGDKETFIAAAVYYDLPFYQVKTKTGVDGYHQADNKGFRGVAML 483

Query: 438 QHDFVQDYSRYLTASKSITNKYKDIKSSAAIKYDKNYSLEKYTKEF------FDNEDLKA 491
           QHDFVQDY R+L A   I + YK ++S     +DKNYSLE Y K +      FD  D   
Sbjct: 484 QHDFVQDYKRFLKAKDKIQSIYKTVESRI---FDKNYSLEDYYKNYILKTNSFDKND--- 537

Query: 492 KDHVDVMFIHSNLPKFDPYTLSETNFLTTDDKPARSFTALHKVQNYDIELENFKVLKEYV 551
           +  VD+MF+HSNLPKFDP +L + N L  + +  R + A+ K+ NYDIELENFK   +Y+
Sbjct: 538 EGEVDIMFVHSNLPKFDPISLWKQNELIVNGEHIRGYRAIEKLNNYDIELENFKTFNQYL 597

Query: 552 CDKKNPFKYLDDKLGEDKKEWRRMCDYIAKRLQFLESTHDKV 593
           C +K  F +++  L E++++ + MCDYI  RL++LE THD +
Sbjct: 598 CVEKTKFVHVEKHL-ENEQDRKSMCDYIKSRLEYLEKTHDSI 638

>CAGL0I04532g Chr9 (404659..406497) [1839 bp, 612 aa] {ON} similar
           to uniprot|P38069 Saccharomyces cerevisiae YBR015c TTP1
           type II membrane protein
          Length = 612

 Score =  615 bits (1585), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 311/608 (51%), Positives = 405/608 (66%), Gaps = 17/608 (2%)

Query: 2   LLTKRFAKLFKLTFLVLILCGLFVVTNKYMDENTSV---KDYKKYLLDNINXXXXXXXXX 58
           +  +RFAKL KL  + + + G     + ++D +TS        +  +D+           
Sbjct: 1   MFNRRFAKLVKLVLITVSIVGGLYYLSGFIDGDTSTALGNRLSQEYMDSFWKTYDSSKSS 60

Query: 59  XXXXXXXXXXXLKGNDKVSNE---KLKSFYNNVFNFLMLDSPTGKSARKYNEACQLSGDI 115
                          D  S E   K+K FY  VF  ++  SP GK+AR+++++C  SGDI
Sbjct: 61  YGSSLLGGSGEKGETDFRSPEAKLKIKDFYKTVFEHILDYSPAGKTAREFDDSCFDSGDI 120

Query: 116 GDRPDQYEELYKLSANELSKCLELSQDEVARLTKSHKDYVDHIASLALPKGTYKGSGIAT 175
             RPD Y+   KLS ++LS C+++S  E+  L  +HK YVD I  L LPKG+YKG GI T
Sbjct: 121 STRPDSYKNWKKLSYHQLSHCMKISPSEINHLRGNHKSYVDKINELVLPKGSYKGEGIVT 180

Query: 176 VGGGKFSLMSFLIIKTLRNMGTTLPVEVLIPPGDEGESEFCNKILPNYNAKCIYVSDILP 235
           VGGGKF+LM+  +IK LR +GTTLPVEV IPP DEGES FC  +LP YNAKCIY+SDILP
Sbjct: 181 VGGGKFTLMALTMIKALRTLGTTLPVEVFIPP-DEGESTFCESVLPQYNAKCIYISDILP 239

Query: 236 LETIEKFTFKGYQFKSLALVASSFENLLLLDADNFPIKPLDNIFNEEPYLSTGLVMWPDF 295
            + I+KFTFKGYQFKSLA++ SSFENLLLLDADN P+K +D+IF  + + S GL++WPDF
Sbjct: 240 DDMIQKFTFKGYQFKSLAMITSSFENLLLLDADNIPVKKIDHIFESQIFRSAGLILWPDF 299

Query: 296 WRRTTHPLYYEIADITVNMKNRVRNSQDDLTPPAIYTKNSNDLGGVPLSDLDGTIPDVST 355
           WRRTT P YYEIA++  N   RVRN+ DD+TPP +YTK   DL  VP  D++GT+PD ST
Sbjct: 300 WRRTTMPAYYEIANLPYNQNKRVRNAFDDITPPEVYTKPDGDLSEVPFHDMEGTLPDPST 359

Query: 356 ESGQLMINKTKHLATALLSLFYNVNGPNWYYPIFSQKAAGEGDKETFIAAANFYGLSFYQ 415
           ESGQL+I+K KHL T LLSL+YNVNGPNWYYPIFSQ+ AGEGDKETFI+AA+FY LS+YQ
Sbjct: 360 ESGQLLISKAKHLPTLLLSLYYNVNGPNWYYPIFSQRTAGEGDKETFISAASFYSLSYYQ 419

Query: 416 VKTRTGVEGY--HDKEGFHGVAMLQHDFVQDYSRYLTASKSITNKYKDIKSS-AAIKYDK 472
           VKT  GV+GY  HD  G+ GV MLQHDF+QD  +Y+ A +    KY +++S   +I YD 
Sbjct: 420 VKTSVGVDGYFRHDGSGYRGVGMLQHDFIQDSKQYMEAFEYSNTKYNNLRSEKGSISYDP 479

Query: 473 NYSLEKYTKEFFDNEDLKAKDH--VDVMFIHSNLPKFDPYTLSETNFLTTDDKPARSFTA 530
           +Y   ++  +FF  +     D    DVMF+H NLPKFDPY   +TN L    K  RSF  
Sbjct: 480 SYDPNEFFDKFFSRKKPDGGDESKADVMFVHCNLPKFDPYVSWDTNDLVYQTKHFRSFNN 539

Query: 531 LHKVQNYDIELENFKVLKEYVC---DKKNPFKYLDDKLGEDKKEWRRMCDYIAKRLQFLE 587
              +  +DIELENFK   E +C   + K  FKYLD+KL E++  W +MCDYI+KRLQ+L+
Sbjct: 540 KKVIAQFDIELENFKFFNETLCPYENGKGKFKYLDNKLSEER--WPQMCDYISKRLQYLK 597

Query: 588 STHDKVIA 595
            +H++ + 
Sbjct: 598 ESHNEALG 605

>NCAS0A03650 Chr1 complement(729502..731325) [1824 bp, 607 aa] {ON} 
          Length = 607

 Score =  600 bits (1547), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 308/600 (51%), Positives = 400/600 (66%), Gaps = 24/600 (4%)

Query: 2   LLTKRFAKLFKLTFL-VLILCGL-FVVTNKYMDE-NTSVKDY-KKYLLDNINXXXXXXXX 57
           +L +RF+K+FKLT L  LI  GL F    +Y D   T  KDY K Y+  N          
Sbjct: 25  VLRRRFSKVFKLTLLFCLIAVGLIFFHLGQYSDAVPTQYKDYLKSYITSN---------- 74

Query: 58  XXXXXXXXXXXXLKGNDKVSNEKLKSFYNNVFNFLMLDSPTGKSARKYN-EACQLSGDIG 116
                        + +   ++  +KSF++ VF  ++  SPTGKS R YN E C L+  +G
Sbjct: 75  STSSVSAEHDIEQENSSSYNDNNIKSFFDTVFQHILDYSPTGKSERIYNKEKCLLNSVVG 134

Query: 117 DRPDQYEELYKLSANELSKCLELSQDEVARLTKSHKDYVDHIASLALPKGTYKGSGIATV 176
             PD Y++ YKLS   L  CLE+S DE   L  +H  +++ +  L LP   Y+G GI  V
Sbjct: 135 YSPDNYKDWYKLSYENLGNCLEISDDEYTNLQSNHASFIEEMDKLTLPNDIYQGDGIVLV 194

Query: 177 GGGKFSLMSFLIIKTLRNMGTTLPVEVLIPPGD-EGESEFCNKILPNYNAKCIYVSDILP 235
            GGKFSL+S+L++KT+R  GTTLPVEV IPP + E E+EFC  +L  ++AKC+Y+SDILP
Sbjct: 195 AGGKFSLLSYLVVKTIRKFGTTLPVEVFIPPDEVEEEAEFCKTMLNEFDAKCVYISDILP 254

Query: 236 LETIEKFTFKGYQFKSLALVASSFENLLLLDADNFPIKPLDNIFNEEPYLSTGLVMWPDF 295
              I  F FKGYQFKSLA++ASSFENLLLLDADNFP+K LDNIF +EPY +TGL++WPDF
Sbjct: 255 ESMISHFDFKGYQFKSLAIIASSFENLLLLDADNFPVKNLDNIFQQEPYTTTGLILWPDF 314

Query: 296 WRRTTHPLYYEIADITVNMKNRVRNSQDDLTPPAIYTKNSNDLGGVPLSDLDGTIPDVST 355
           WRRTT P++YEIA I+VN++ RVRN+ D+LTP  +Y K+  ++  VP  D +G +PDVST
Sbjct: 315 WRRTTQPMFYEIAGISVNLQKRVRNAIDNLTPVQVYDKSDQEM-DVPYHDFEGAMPDVST 373

Query: 356 ESGQLMINKTKHLATALLSLFYNVNGPNWYYPIFSQKAAGEGDKETFIAAANFYGLSFYQ 415
           ESG+LM+NK +HL T LL+L+YNVNGPNWYYPIFSQ  AGEGDKETFIA A FY L FYQ
Sbjct: 374 ESGELMVNKVEHLKTVLLALYYNVNGPNWYYPIFSQGLAGEGDKETFIAGATFYNLPFYQ 433

Query: 416 VKTRTGVEGYHDKEGFHGVAMLQHDFVQDYSRYLTASKSITNKYKDIKSSAAIKYDKNYS 475
           VKT+ GV+GYH ++GF GVAMLQHDFVQDY RY  A   I  KY     S  + YDK+Y+
Sbjct: 434 VKTKVGVDGYHKEDGFRGVAMLQHDFVQDYDRYKLAQLKIDKKY---LPSNEVLYDKDYT 490

Query: 476 LEKYTKEFFDNEDLKAKDHVDVMFIHSNLPKFDPYTLSETNFLTTDDKPARSFTALHKVQ 535
           ++K+  E+F+ E     +  DV+F+HS+LPKFDP +L + N L  D K  RS+T L+K  
Sbjct: 491 VQKFYDEYFNIE----GNETDVLFVHSHLPKFDPVSLWKDNDLIKDGKHLRSYTNLNKFG 546

Query: 536 NYDIELENFKVLKEYVCDKKNPFKYLDDKLGEDKKEWRRMCDYIAKRLQFLESTHDKVIA 595
            YDIE ENFK +KE +C+    F Y+D+   +  +E    C YI  R +FL  THD V +
Sbjct: 547 YYDIEYENFKTMKELLCESDTHFYYIDEAFKDKPEEKADFCKYIVDRYEFLNETHDAVTS 606

>Ecym_5314 Chr5 complement(634571..636418) [1848 bp, 615 aa] {ON}
           similar to Ashbya gossypii AER018C
          Length = 615

 Score =  593 bits (1530), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 310/627 (49%), Positives = 405/627 (64%), Gaps = 43/627 (6%)

Query: 2   LLTKRFAKLFKLTFLVLILCGLFVVTNKYMDENTSVKDYKKYLLDNINXXXXXXXXXXXX 61
           +LT+RF+K  +LT L LI+C LF+++N+ +    S +    YL D I             
Sbjct: 1   MLTRRFSKTLRLTVLTLIVCSLFLISNRTITGELS-QSIHAYLEDWI--VLNGGDGKDRQ 57

Query: 62  XXXXXXXXLKGNDKVSNE-------------------------------KLKSFYNNVFN 90
                   + G D+   E                               KL+ FY  VFN
Sbjct: 58  ILQEVIDAINGEDETHRESASRSDNAEKSIPDKLLSHSTPTAEEESRQAKLRGFYEKVFN 117

Query: 91  FLMLDSPTGKSARKYNEACQLSGDIGDRPDQYEELYKLSANELSKCLELSQDEVARLTKS 150
            L   +P+G S++   E CQL+ DIG R +  +  YKLS   LSKCL++S+ +   L K 
Sbjct: 118 MLSKHAPSGSSSKIRGENCQLTKDIGGRLEDQKWWYKLSYEHLSKCLQVSRKDRKMLKKK 177

Query: 151 HKDYVDHIASLALPKGTYKGSGIATVGGGKFSLMSFLIIKTLRNMGTTLPVEVLIPPGDE 210
           H DYV  +ASL LP  +Y G+GI TVGGGKFS+++FL+I TLRN+GTTLPVEVLIPP +E
Sbjct: 178 HSDYVADLASLVLPLDSYTGNGIVTVGGGKFSVLAFLMITTLRNVGTTLPVEVLIPPNEE 237

Query: 211 GESEFCNKILPNYNAKCIYVSDILPLETIEKFTFKGYQFKSLALVASSFENLLLLDADNF 270
            E EFCN +LP +NAKCIY+SD+LP   +  F  KGYQ KS A++ASSF+NLLLLDADN 
Sbjct: 238 SEHEFCNNVLPEFNAKCIYLSDVLPKSVLTSFEVKGYQLKSFAIIASSFQNLLLLDADNL 297

Query: 271 PIKPLDNIFNEEPYLSTGLVMWPDFWRRTTHPLYYEIADITVNMKNRVRNSQDDLTPPAI 330
           PIK LD+IF  +PY STGLV+WPDFWRRTT P+YYE+A I +N   RVRNS DD+TP ++
Sbjct: 298 PIKNLDDIFESKPYKSTGLVLWPDFWRRTTSPIYYEVAGIPINYNKRVRNSIDDVTPASV 357

Query: 331 YTKNSNDLGGVPLSDLDGTIPDVSTESGQLMINKTKHLATALLSLFYNVNGPNWYYPIFS 390
           YT N   L  VP+ DL+G IPD+STESGQLMI+K  HL TALLSL+YNVNGP WYYP+FS
Sbjct: 358 YTSNPYSLSTVPMHDLEGAIPDMSTESGQLMISKRTHLGTALLSLYYNVNGPTWYYPLFS 417

Query: 391 QKAAGEGDKETFIAAANFYGLSFYQVKTRTGVEGYHDKEGFHGVAMLQHDFVQDYSRYLT 450
           Q A+GEGDKETFIAAA+FY L FYQV+T TGV+GYH   G+ GVAMLQHDF QDY RY  
Sbjct: 418 QGASGEGDKETFIAAASFYQLPFYQVRTVTGVDGYHRSSGYRGVAMLQHDFRQDYERYTH 477

Query: 451 ASKSITNKYKDIKSSAAIKYDKNYSLEKYTKEFFDNEDLKAKDHVDVMFIHSNLPKFDPY 510
           + +    KY    ++ +  Y+ +Y++  +   +F   +  +++ +DVMF+HSNLPK +P 
Sbjct: 478 SKEDTEAKY----AAGSAAYESSYNVNDFYNTYFGTYN--SQEPLDVMFVHSNLPKLEPL 531

Query: 511 TLSETNFLTTDDKPARSFTALHKVQNYDIELENFKVLKEYVCDKKNPFKYLDDKLGEDKK 570
           +LS    L  D +  RS++ L ++  YDIEL +F+   EY+CDK+  FKY +  L  D++
Sbjct: 532 SLSTD--LMEDGQHIRSYSNLKRLHGYDIELRSFQTFNEYLCDKRVKFKYYEKTL-IDEE 588

Query: 571 EWRRMCDYIAKRLQFLESTHDKVIAGN 597
            W  MCDYI  RL FLE THD+ +  N
Sbjct: 589 SWTSMCDYIKGRLSFLERTHDEALNKN 615

>KLLA0E17755g Chr5 complement(1572985..1574901) [1917 bp, 638 aa]
           {ON} similar to uniprot|P38069 Saccharomyces cerevisiae
           YBR015C MNN2 Alpha-1 2-mannosyltransferase responsible
           for addition of the first alpha-1 2-linked mannose to
           form the branches on the mannan backbone of
           oligosaccharides localizes to an early Golgi compartment
          Length = 638

 Score =  593 bits (1529), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 292/520 (56%), Positives = 370/520 (71%), Gaps = 13/520 (2%)

Query: 79  EKLKSFYNNVFNFLMLDSPTGKSARKYNEACQLSGDIGDRPDQYEELYKLSANELSKCLE 138
           ++++ FY  VF +L    P G +   YN+ C L+GDIG R +  ++ +KL+  EL+ CL+
Sbjct: 128 KQVQGFYGQVFKYLKEFGPVGVNIATYNQKCSLNGDIGYRQENTDQWWKLTTEELNNCLQ 187

Query: 139 LSQDEVARLTKSHKDYVDHIASLALPKGTYKGSGIATVGGGKFSLMSFLIIKTLRNMGTT 198
           LSQ++   L ++H +YV  ++ L LPK TY G GI TVGGGKFS+M+FLIIKT+RN GTT
Sbjct: 188 LSQEQRLMLKEAHSNYVHALSKLVLPKDTYSGDGIVTVGGGKFSMMAFLIIKTVRNFGTT 247

Query: 199 LPVEVLIPPGDEGESEFCNKILPNYNAKCIYVSDILPLETIEKFTFKGYQFKSLALVASS 258
           LPVEV IPP DEG+ EFCN +LP YNAKCIY+SD  P + IEK  FKGYQFKSLA++ASS
Sbjct: 248 LPVEVFIPPSDEGDDEFCNVLLPQYNAKCIYLSDAFPPDLIEKSDFKGYQFKSLAIIASS 307

Query: 259 FENLLLLDADNFPIKPLDNIFNEEPYLSTGLVMWPDFWRRTTHPLYYEIADITVNMKNRV 318
           F+NLLLLDADNFPIKPLD IF E+ Y  TGL++WPDFWRRTTHP YY IA+  ++ + R+
Sbjct: 308 FKNLLLLDADNFPIKPLDGIFEEKSYKDTGLILWPDFWRRTTHPSYYSIANTPISSE-RI 366

Query: 319 RNSQDDLTPPAIYTKNSNDLGGVPLSDLDGTIPDVSTESGQLMINKTKHLATALLSLFYN 378
           RN+ DD+TPP++YTK+  DL  VPL DLDGTIPD STESGQLMINK KH  T LLSL+YN
Sbjct: 367 RNTMDDVTPPSVYTKDLKDLSDVPLHDLDGTIPDASTESGQLMINKLKHFPTVLLSLYYN 426

Query: 379 VNGPNWYYPIFSQKAAGEGDKETFIAAANFYGLSFYQVKTRTGVEGY--HDKEGFHGVAM 436
           V GP+WYY IFSQ+++GEGDKETFIAAA+FY L FYQV++   V+GY  H+ EGF GV M
Sbjct: 427 VYGPSWYYSIFSQRSSGEGDKETFIAAAHFYDLPFYQVRSEPRVDGYHRHNNEGFRGVCM 486

Query: 437 LQHDFVQDYSRYLTASKSITNKYKDIKSSAAIKYDKNYSLEKYTKEFFDNEDLKAKDHVD 496
           LQHDF QDY RY  A   I  KY +       KY  NY  E Y  ++F N      D VD
Sbjct: 487 LQHDFAQDYKRYRQAQNEIGTKYTNEPDDYDPKY--NYQ-ENYLGKYFTN------DPVD 537

Query: 497 VMFIHSNLPKFDPYTLSETNFLTTDDKPARSFTALHKVQNYDIELENFKVLKEYVCDKKN 556
           VMF+HS+LPKFDP  L+ +  L  D K  RS+  L ++  YD+ELE FK  KEYVCDK+ 
Sbjct: 538 VMFVHSHLPKFDPVELALSQDLIQDGKHIRSYRNLKRMNGYDLELEVFKTFKEYVCDKRV 597

Query: 557 PFKYLDDKLGEDKKEWRRMCDYIAKRLQFLESTHDKVIAG 596
            FKY  +K  + +  W  +C+Y+ +RL +L  +H + + G
Sbjct: 598 HFKYF-EKAVKLESNWGIICNYVNERLVYLIESHSEAMEG 636

>Kpol_1036.50 s1036 complement(135897..137927) [2031 bp, 676 aa]
           {ON} complement(135897..137927) [2031 nt, 677 aa]
          Length = 676

 Score =  583 bits (1503), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 313/522 (59%), Positives = 382/522 (73%), Gaps = 10/522 (1%)

Query: 81  LKSFYNNVFNFLMLDSPTGKSARKYNEACQLSGDIGDRPDQYEELYKLSANELSKCLELS 140
           LK FY  VF  +   SP GKS R Y EAC L+GDIGDRP+ YE  YKLS  EL  CLE+S
Sbjct: 158 LKQFYGRVFELIQAHSPLGKSKRNYKEACLLNGDIGDRPEFYEVWYKLSMKELGNCLEIS 217

Query: 141 QDEVARLTKSHKDYVDHIASLALPKGTYKGSGIATVGGGKFSLMSFLIIKTLRNMGTTLP 200
           + E+++L   H  Y+  I+SL+LP+ +++G GI  VGGGKFSL+SFLII  +RN GTTLP
Sbjct: 218 KAEMSKLKAKHAKYIADISSLSLPRNSFRGKGIVIVGGGKFSLLSFLIINAIRNQGTTLP 277

Query: 201 VEVLIPPGDEGE-SEFCNKILPNYNAKCIYVSDILPLETIEKFTFKGYQFKSLALVASSF 259
           VEV +P  D+GE +EFC K+LP  NAKCIY+SD+LP ETI++F F GYQFKS+AL+ SSF
Sbjct: 278 VEVFMP-NDKGEDAEFC-KLLPELNAKCIYLSDVLPEETIDQFKFGGYQFKSIALLLSSF 335

Query: 260 ENLLLLDADNFPIKPLDNIFNEEPYLSTGLVMWPDFWRRTTHPLYYEIADITVNMKNRVR 319
           ++LLLLDADN+PIK LD IF +EPY STGLV+WPDFWRRTT P YY+IA ITVN K RVR
Sbjct: 336 DDLLLLDADNYPIKNLDEIFTKEPYKSTGLVLWPDFWRRTTTPFYYKIAGITVNSKKRVR 395

Query: 320 NSQDDLTPPAIYTKNSNDLGGVPLSDLDGTIPDVSTESGQLMINKTKHLATALLSLFYNV 379
           NS DD+TPP +YT+N  +L  VPL DL+G+IPD STESGQLMINK+KHLAT LLSL+YNV
Sbjct: 396 NSIDDITPPEVYTENMGNLVNVPLHDLEGSIPDGSTESGQLMINKSKHLATILLSLYYNV 455

Query: 380 NGPNWYYPIFSQKAAGEGDKETFIAAANFYGLSFYQVKTRTGVEGYH--DKEGFHGVAML 437
           NGPNWYYP+FSQKAAGEGDKETF+AAA F  L FYQVKT TGV+GYH  D +GF GVAML
Sbjct: 456 NGPNWYYPMFSQKAAGEGDKETFVAAAVFNKLPFYQVKTNTGVDGYHQADNKGFRGVAML 515

Query: 438 QHDFVQDYSRYLTASKSITNKYKDIKSSAAIKYDKNYSLEK-YTKEFFDNEDLK-AKDHV 495
           Q DF QDY RY  A ++I  +Y+D        YDK YSL   Y K    N+D        
Sbjct: 516 QFDFHQDYLRYKRAKEAIEYQYQDKNLRT---YDKRYSLNDFYRKYIMINDDRNGGTSEA 572

Query: 496 DVMFIHSNLPKFDPYTLSETNFLTTDDKPARSFTALHKVQNYDIELENFKVLKEYVCDKK 555
           DVMF+HSNLPKFDP  L     L    K  RSF  L ++ NYDIELENF +  +++C K+
Sbjct: 573 DVMFVHSNLPKFDPVGLWRGQDLIEHGKHIRSFRNLQRLNNYDIELENFTIFYKHLCLKR 632

Query: 556 NPFKYLDDKLGEDKKEWRRMCDYIAKRLQFLESTHDKVIAGN 597
             FKYL+D+LG+++++W+ MC YI  R+ FL  +H + I  N
Sbjct: 633 RSFKYLEDELGDNEEDWKDMCKYIKDRVTFLNMSHQRAITPN 674

>AER018C Chr5 complement(661035..662855) [1821 bp, 606 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBR015C
           (MNN2)
          Length = 606

 Score =  563 bits (1450), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 282/614 (45%), Positives = 396/614 (64%), Gaps = 32/614 (5%)

Query: 2   LLTKRFAKLFKLTFLVLILCGLFVVTNKYM-DENTSVKDYKKYLLDNINXXXXXXXXXXX 60
           +L ++++K  KL+ + + L  LF+VTN+++  E  SV  Y +YL + +            
Sbjct: 1   MLRRKYSKTLKLSLITVALGALFLVTNRWLPGEFPSV--YTEYLQNRLPNLGSFGKQQHM 58

Query: 61  XXXXXXXXXL--------KGNDKVSNEKLK-----------SFYNNVFNFLMLDSPTGKS 101
                    +        K ++ +  E  +           +FY  VF  L   SP+G+ 
Sbjct: 59  EEQESQTRQMIEEGEMRSKPSELLEEEAARTEQAERKSQIFAFYQKVFELLAEHSPSGQI 118

Query: 102 ARKYNEACQLSGDI-GDRPDQYEELYKLSANELSKCLELSQDEVARLTKSHKDYVDHIAS 160
           + K    CQ+S  +     D       L+   LSKCL+++Q +   ++  H  YVD +++
Sbjct: 119 SHKSGRQCQVSQVVLQGHLDDTSHWPLLTREHLSKCLKMTQKDKQMVSDKHMHYVDALSN 178

Query: 161 LALPKGTYKGSGIATVGGGKFSLMSFLIIKTLRNMGTTLPVEVLIPPGDEGESEFCNKIL 220
           L L K  Y G+GI TVGGGKFS+++ L+IK+LR +GT+LPVEVLIPPG+E E ++C+K+L
Sbjct: 179 LKLSKRAYSGAGIVTVGGGKFSMLALLLIKSLRKVGTSLPVEVLIPPGEEEEYDYCSKLL 238

Query: 221 PNYNAKCIYVSDILPLETIEKFTFKGYQFKSLALVASSFENLLLLDADNFPIKPLDNIFN 280
           P   AKCIY+ D+LP   I    F+GYQ KS A++ASSF++LLLLDADN PI  LD+IF 
Sbjct: 239 PEVGAKCIYLKDVLPPAVINNHYFEGYQLKSAAIIASSFKDLLLLDADNIPILNLDDIFQ 298

Query: 281 EEPYLSTGLVMWPDFWRRTTHPLYYEIADITVNMKNRVRNSQDDLTPPAIYTKNSNDLGG 340
            +PY+  GLV+WPDFWRR+T P YYEIA + V+   RVRN  D+LTP ++YT+N  DL  
Sbjct: 299 SKPYVEHGLVLWPDFWRRSTSPDYYEIARVQVDYNRRVRNHIDNLTPASVYTQNMKDLSS 358

Query: 341 VPLSDLDGTIPDVSTESGQLMINKTKHLATALLSLFYNVNGPNWYYPIFSQKAAGEGDKE 400
           +P+ D++GT+PD STESGQL+I+K +HL+T LLSL+YNVNG  WYYP+FSQ A GEGDKE
Sbjct: 359 IPMHDMEGTLPDPSTESGQLLIDKERHLSTVLLSLYYNVNGETWYYPLFSQGAPGEGDKE 418

Query: 401 TFIAAANFYGLSFYQVKTRTGVEGYHDKEGFHGVAMLQHDFVQDYSRYLTASKSITNKYK 460
           TFIAAANFY   +YQV+T TG EGYH K+GF GVAMLQHDF +DY RY  A + +  KY 
Sbjct: 419 TFIAAANFYRKPYYQVRTSTGAEGYHTKKGFSGVAMLQHDFREDYRRYEAAREDVKTKY- 477

Query: 461 DIKSSAAIKYDKNYSLEKYTKEFFDNEDLKAKDHVDVMFIHSNLPKFDPYTLSETNFLTT 520
               + + +YD  Y++E + K++F++ +   +  VDVMF+H+NLPKF+P  +SE   L  
Sbjct: 478 ----AKSQQYDPEYTVEGFYKKYFEDPN---QPPVDVMFVHANLPKFEPLKMSEKQLLME 530

Query: 521 DDKPARSFTALHKVQNYDIELENFKVLKEYVCDKKNPFKYLDDKLGEDKKEWRRMCDYIA 580
           +    RS++ L K+ NYDIELE+F+VL EY+C +K   K+  DKL    K W  MC Y+ 
Sbjct: 531 NGSHFRSYSHLDKLHNYDIELESFRVLNEYLCVRKVQLKFYKDKLSRPAK-WNSMCKYVE 589

Query: 581 KRLQFLESTHDKVI 594
            RL+FLESTH++ +
Sbjct: 590 DRLKFLESTHEEAL 603

>Kpol_1045.70 s1045 complement(162608..164461) [1854 bp, 617 aa]
           {ON} complement(162610..164463) [1854 nt, 618 aa]
          Length = 617

 Score =  548 bits (1411), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 283/620 (45%), Positives = 387/620 (62%), Gaps = 34/620 (5%)

Query: 1   MLLTKRFAKLFKLTFLVLILCGLFVVTNKYMDENTSV-KDY----KKYLLDNI------- 48
           M+  +RF+KLFK++ LVL+    FV+   + DE   V ++Y      Y+ D+I       
Sbjct: 1   MVSNRRFSKLFKVS-LVLVAVLTFVILRHHKDETAKVLQNYTDAVSSYIGDSIGSLTGSS 59

Query: 49  --------------NXXXXXXXXXXXXXXXXXXXXLKGNDKVSNEKLKSFYNNVFNFLML 94
                         +                    ++  +K   E +K+FY+ V++ L  
Sbjct: 60  TDTASSSSSTTTNDDNKETQLEDADDDDDDDELNFVQMEEKRLRENMKTFYSKVYDLLRS 119

Query: 95  DSPTGKSARKYNEACQLSGDIGDRPDQYEELYKLSANELSKCLELSQDEVARLTKSHKDY 154
             P G S RKY + C L  DIG R +   +   L+ + LSKCL++ ++ +A L  SH+ Y
Sbjct: 120 AGPEGTSDRKYGQDCPLDSDIGQRKNDVHKWNVLTQDNLSKCLQIDEESLAMLKNSHRKY 179

Query: 155 VDHIASLALPKGTYKGSGIATVGGGKFSLMSFLIIKTLRNMGTTLPVEVLIPPGDEGESE 214
           +D +  L      Y G GI  V GGKFSL+S L+IKT+RN+   LP+EV IPP DEG+ E
Sbjct: 180 IDGLKELGSSPDMYSGDGIVLVAGGKFSLLSTLVIKTIRNLKINLPIEVFIPPMDEGDDE 239

Query: 215 FCNKILPNYNAKCIYVSDILPLETI-EKFTFKGYQFKSLALVASSFENLLLLDADNFPIK 273
            CN +LP YNAKCI++SD LP + I E     GYQ K +A+ ASSF+N+LLLDADN+PIK
Sbjct: 240 LCNTLLPKYNAKCIFLSDFLPEDKINEDIKIDGYQTKVVAIAASSFKNVLLLDADNYPIK 299

Query: 274 PLDNIFNEEPYLSTGLVMWPDFWRRTTHPLYYEIADITVNMKNRVRNSQDDLTPPAIYTK 333
            +D+IF  EPY S GL+ WPD+WRR+T P YY+I D  ++   RVRN+ DD+TPP++YT+
Sbjct: 300 NIDDIFYSEPYSSRGLIFWPDYWRRSTSPSYYDILDRDISQNERVRNNLDDITPPSVYTE 359

Query: 334 NSNDLGGVPLSDLDGTIPDVSTESGQLMINKTKHLATALLSLFYNVNGPNWYYPIFSQKA 393
           +  +   +P+ D +GT+PDVSTESGQLMINK KHL + LL+++YN+ GPNWYYPI +QKA
Sbjct: 360 DLKNHKDIPMHDFEGTLPDVSTESGQLMINKEKHLKSLLLAMYYNMYGPNWYYPILTQKA 419

Query: 394 AGEGDKETFIAAANFYGLSFYQVKTRTGVEGYHDKEGFHGVAMLQHDFVQDYSRYLTASK 453
           +GEGDKETFIA ANF+ L FYQVK   G +GY    G+ GVAM QHDF+QDY+ Y  A  
Sbjct: 420 SGEGDKETFIAGANFFNLPFYQVKKHVGTDGYTRPGGYRGVAMFQHDFIQDYTAYENAKT 479

Query: 454 SITNKYKDIKSSAAIKYDKNYSLEKYTKEFFDNEDLKAKDHVDVMFIHSNLPKFDPYTLS 513
            I  KY + K     K DK YS   +T +FF  ED  A   +DVMF+H++LPKF+P  L 
Sbjct: 480 FIEKKYPNTKQD---KIDKEYSPFDFTDKFF--EDEHADPVIDVMFVHAHLPKFEPVALW 534

Query: 514 ETNFLTTDDKPARSFTALHKVQNYDIELENFKVLKEYVC-DKKNPFKYLDDKLGEDKKEW 572
           E N L  D    RS+T   K+ +YD+E+ENFK L+E +C +K   FKYL DKL +DK++W
Sbjct: 535 EENDLMQDGSHVRSYTKYDKLNHYDLEMENFKALEELLCLEKPFEFKYLKDKLSDDKEKW 594

Query: 573 RRMCDYIAKRLQFLESTHDK 592
           + +C YI  R  F+E TH++
Sbjct: 595 QGLCKYIKDRHIFMEKTHEE 614

>KNAG0K01300 Chr11 (257271..259064) [1794 bp, 597 aa] {ON} 
          Length = 597

 Score =  545 bits (1404), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 282/603 (46%), Positives = 385/603 (63%), Gaps = 32/603 (5%)

Query: 2   LLTKRFAKLFKLTFLVLILCGLFV-VTNKYMDENTSVKDYKKYLLDNINXXXXXXXXXXX 60
           +L +R AKLFK  F ++I+C +   +T+ + D   +V +YK++L   +            
Sbjct: 9   MLNRRLAKLFKAVFFLVIVCLVCAGLTHHFHDGPKTVDEYKEFLQGYLGGNANTTVTVV- 67

Query: 61  XXXXXXXXXLKGNDKVSNEKLKSFYNNVFNFLMLDSPTGKSARKYNEACQLSGDIGDRPD 120
                       ND    +K+KS+YN VF  L+L SP G++AR Y + C L+  IG   D
Sbjct: 68  ------------NDA---DKIKSYYNTVFENLLLFSPKGETARAYGDKCILNEAIGTTSD 112

Query: 121 QYEELYKLSANELSKCLELSQDEVARLTKSHKDYVDHIASLALPKGTYKGSGIATVGGGK 180
              +  +LS   L  CL+LS +E++ L  SH  +V  +  +  PKG Y+G GI  VGGGK
Sbjct: 113 NIPKFERLSYENLLDCLKLSNEELSALKLSHNFFVQSL-DVKYPKGMYQGDGIVMVGGGK 171

Query: 181 FSLMSFLIIKTLRNMGTTLPVEVLIPPGDEGESEFCNKILPNYNAKCIYVSDILPLETIE 240
           +SLM++L+IK LR+ GT+LPVEV IPP +E E+EFC   LP  NA+CI++  ILP   I+
Sbjct: 172 YSLMAYLVIKHLRSSGTSLPVEVFIPPNEEDETEFCETALPELNAQCIFIDRILPSAMIK 231

Query: 241 KFTFKGYQFKSLALVASSFENLLLLDADNFPIKPLDNIFNEEPYLSTGLVMWPDFWRRTT 300
            F FKGYQFKSLALV+SSFEN+LLLDADN+P++ LD+IF +EP+ STGL++WPDFWRRTT
Sbjct: 232 TFHFKGYQFKSLALVSSSFENVLLLDADNYPVRRLDDIFKQEPFKSTGLILWPDFWRRTT 291

Query: 301 HPLYYEIADITVNMKNRVRNSQDDLTPPAIYTKNSNDLGGVPLSDLDGTIPDVSTESGQL 360
            PL+Y I+ + +++ + VR S DDLTPP +Y  ++ D   +P++D  G +PDVSTESGQL
Sbjct: 292 TPLFYNISGVAIDLTSPVRYSFDDLTPPEVYFNSTMDRSKIPVNDFAGAMPDVSTESGQL 351

Query: 361 MINKTKHLATALLSLFYNVNGPNWYYPIFSQKAAGEGDKETFIAAANFYGLSFYQVKTRT 420
           +INK  HL T LLSL+YNVNGP WYYPI +Q+A GEGDK+TFIAAANFYGL +YQVKTR 
Sbjct: 352 LINKRTHLKTILLSLYYNVNGPAWYYPIIAQRAPGEGDKDTFIAAANFYGLPWYQVKTRV 411

Query: 421 GVEGYHDKEGFHGVAMLQHDFVQDYSRYLTASKSITNKY------KDIKSSAAIKYDKNY 474
           G++GY +   +HGV MLQ+DFVQDY  Y +A + IT KY      K  +  + I YD+NY
Sbjct: 412 GIDGYSEDGQYHGVGMLQYDFVQDYELYQSARRDITAKYGVAGPSKTGQLRSEIAYDENY 471

Query: 475 SLEKYTKEFFDNEDLKAKDHVDVMFIHSNLPKFDPYTL-SETNFLTTDDKPARSFTALHK 533
           SL+ + +++F+ E    K    VMFIH+N PKFDP +L  +  F+       R++  L K
Sbjct: 472 SLDTFEEKYFNKE----KSGHKVMFIHANFPKFDPLSLWQDKKFINKQGSTYRTYNNLGK 527

Query: 534 VQNYDIELENFKVLKEYVC---DKKNPFKYLDDKLGEDKKEWRRMCDYIAKRLQFLESTH 590
              +DIEL NF   +   C   D    F Y++  L  +  +   MC YI  RL  LE TH
Sbjct: 528 FNYWDIELYNFNSFETLFCSGADSVTWFPYMNRALQGNTNDRESMCSYIRMRLDHLEQTH 587

Query: 591 DKV 593
            + 
Sbjct: 588 HEA 590

>NDAI0A06500 Chr1 complement(1475305..1477218) [1914 bp, 637 aa]
           {ON} Anc_3.188
          Length = 637

 Score =  546 bits (1407), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 275/524 (52%), Positives = 359/524 (68%), Gaps = 10/524 (1%)

Query: 74  DKVSNEKLKSFYNNVFNFLMLDSPTGKSARKYNEACQLSGDIGDRPDQYEELYKLSANEL 133
           +K S E +  F++ VFN++   SP  K   KYN +  ++  IG R +  +  +KLS N L
Sbjct: 119 EKPSTETIHKFFDQVFNYINEFSPETKLDIKYNPSRLVTDAIGSRRNDVKNFFKLSRNSL 178

Query: 134 SKCLELSQDEVARLTKSHKDYVDHIASLALPKGTYKGSGIATVGGGKFSLMSFLIIKTLR 193
             CL++S  E+  L   H+ + + IA L LPK TY+  GI  VGGGK+SL+S L IKTLR
Sbjct: 179 YDCLQISDQEIDMLKNYHQGFTNSIAPLELPKNTYQNDGIVIVGGGKYSLLSLLAIKTLR 238

Query: 194 NMGTTLPVEVLIPPGDEGESEFCNKILPNYNAKCIYVSDILPLETIEKFTFKGYQFKSLA 253
              TTLPVEV I   +EG+ EFC++ILP YNAKCI + +IL  + I  F F GYQ+KSLA
Sbjct: 239 KFNTTLPVEVYISQDEEGDLEFCDEILPQYNAKCISIKNILSNDLINTFKFAGYQYKSLA 298

Query: 254 LVASSFENLLLLDADNFPIKPLDNIFNEEPYLSTGLVMWPDFWRRTTHPLYYEIADITVN 313
           +++SSFENLLLLDADNFPIKPLD+IF +EPYLS  +VMWPDFWRRTTHP YY+IA I VN
Sbjct: 299 VLSSSFENLLLLDADNFPIKPLDDIFKQEPYLSKRMVMWPDFWRRTTHPSYYDIAHIFVN 358

Query: 314 MKNRVRNSQDDLTPPAIYTKNSNDLGGVPLSDLDGTIPDVSTESGQLMINKTKHLATALL 373
             +R+RNS DD+TP  +YT  S  L  +P  D +GT+PD+STESGQL++NK +HL   LL
Sbjct: 359 KSSRIRNSYDDVTPSNVYTDYSKSLDEIPFHDFEGTLPDLSTESGQLLLNKKEHLKAILL 418

Query: 374 SLFYNVNGPNWYYPIFSQKAAGEGDKETFIAAANFYGLSFYQVKTRTGVEGYHDKE--GF 431
           +L+YNVNGPNWYYPIFSQ  AGEGDKETF+A ANFY L++YQVKT   V G+ +KE   +
Sbjct: 419 ALYYNVNGPNWYYPIFSQGVAGEGDKETFLAGANFYNLTYYQVKTYPRVSGHFNKEDGSY 478

Query: 432 HGVAMLQHDFVQDYSRYLTASKSITNKYKDIKSSAAIKYDKNYSLEKYTKEFFDNEDLKA 491
            GVA+LQ DFV DY RY  A   I +KYKD+ S   IK D++Y L+ +  ++F+ E  +A
Sbjct: 479 RGVAILQSDFVDDYKRYSHAMDDINSKYKDL-SPNEIKLDEDYDLQNFLDKYFELEGKQA 537

Query: 492 KDHVDVMFIHSNLPKFDPYTLSETNFLTTDDKPARSFTALHKVQNYDIELENFKVLKEYV 551
               DVMFIH+N PKFDP  L   +    + K  RSF  L  ++ YD+ELE FK+L   +
Sbjct: 538 ----DVMFIHANFPKFDPVDLESGSSFIHEGKHFRSFDNLKDIKYYDLELETFKILNNII 593

Query: 552 CDKKNPFKYLDDKLGEDKKEWRRMCDYIAKRLQFLESTHDKVIA 595
           C ++  FKY+DDK  E++    ++C YI  RL+FLE TH++ I 
Sbjct: 594 CVERKHFKYIDDKGVEERG---KVCKYIEDRLKFLEETHEEAIT 634

>TPHA0C04560 Chr3 (983249..984970) [1722 bp, 573 aa] {ON} 
          Length = 573

 Score =  533 bits (1372), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 273/598 (45%), Positives = 392/598 (65%), Gaps = 40/598 (6%)

Query: 5   KRFAKLFKLTFLVLILCGLFVVTNKYMDENTSVKDYKKYLLDNINXXXXXXXXXXXXXXX 64
           +RF++LFK++   ++LC +F+++  ++  N  +  Y    L+N N               
Sbjct: 7   RRFSRLFKIS--AIVLC-VFIISAVFLSSNRGL--YNVTGLENNNEPSF----------- 50

Query: 65  XXXXXLKGNDKVSNEKLKSFYNNVFNFLMLDSPTGKSARKYNEACQLSGDIGDRPDQYEE 124
                       S+  +K  ++++F+ +   SP  +  RK N+ C L G +G   +  + 
Sbjct: 51  -----------ASDPSIKKTFSSIFDAIKKHSPDKEVVRKKNDNCLLDGTVGTGNNDVKN 99

Query: 125 LYKLSANELSKCLELSQDEVARLTKSHKDYVDHIASLALPKGTYKGSGIATVGGGKFSLM 184
            ++LS   +  CLELS  E+  L   H  Y+  +  +A+ K  YKG GIA VGGGKFSL+
Sbjct: 100 WHRLSQKSMEGCLELSDSEINTLKSKHDAYIQSLEEIAVEKIHYKGKGIAIVGGGKFSLL 159

Query: 185 SFLIIKTLRNMGTTLPVEVLIPPGD-EGESEFCNKILPNYNAKCIYVSDILPLETIEKFT 243
           +FL++KT+R   TTLP+E+ IPP D E E EFC ++LP  NAKCIY+SDILP + I+K+ 
Sbjct: 160 AFLVVKTIRKFETTLPIEIFIPPQDVEDELEFCQQLLPEDNAKCIYLSDILPSQDIKKYE 219

Query: 244 FKGYQFKSLALVASSFENLLLLDADNFPIKPLDNIFNEEPYLSTGLVMWPDFWRRTTHPL 303
           FK YQ+KSLA++ASSF++LLL+DADNFPIK LD IF+ EPY STGL++WPDFWRR+ +P 
Sbjct: 220 FKRYQYKSLAILASSFDDLLLIDADNFPIKNLDGIFDNEPYTSTGLILWPDFWRRSANPK 279

Query: 304 YYEIADITVNMKNRVRNSQDDLTPPAIYTKNSNDLGGVPLSDLDGTIPDVSTESGQLMIN 363
           +YEI  I ++ K RVRN+ DDLTPP +YT++ + L  VP  D  GT+PD STESGQ+MIN
Sbjct: 280 FYEITGIELDTKKRVRNAIDDLTPPEVYTEDFSKLADVPFHDFSGTLPDPSTESGQMMIN 339

Query: 364 KTKHLATALLSLFYNVNGPNWYYPIFSQKAAGEGDKETFIAAANFYGLSFYQVKTRTGVE 423
           K KH+ T LL+L+YNVNGP+WYYPI SQ AAGEGDKET IAAA      FYQVK +TGVE
Sbjct: 340 KGKHMKTLLLALYYNVNGPSWYYPILSQGAAGEGDKETVIAAALHNKAKFYQVKFKTGVE 399

Query: 424 GYH--DKEGFHGVAMLQHDFVQDYSRYLTASKSITNKYKDIKSSAAIK-YDKNYSLEKYT 480
           GYH  +  GF GVAMLQHDFVQD++RY  A+  I    K++ S+ + K +D  YS++ + 
Sbjct: 400 GYHQSNGRGFRGVAMLQHDFVQDFARYEDATARI----KELYSTESFKQFDSGYSIDAFY 455

Query: 481 KEFFD--NEDL-KAKDHVDVMFIHSNLPKFDPYTLSETNFLTTDDKPARSFTALHKVQNY 537
           +++    N D+ + K  +DV+F+HS+LPKFDP  L ++  L  D K  RS+T+L K+  +
Sbjct: 456 EKYISQVNTDIPEEKRKIDVLFVHSHLPKFDPVPLWQSQDLIEDGKHFRSYTSLKKINYF 515

Query: 538 DIELENFKVLKEYVCDKKNPFKYLDDKLGEDKKEWRRMCDYIAKRLQFLESTHDKVIA 595
           DIEL+NF++  +Y+C     F Y+ +++ +   +   +C+YI  RL +L+ TH+ V +
Sbjct: 516 DIELQNFEIFDKYICQDTIAFPYIKNEVKD--ADMPDLCNYIKNRLSYLQETHESVTS 571

>KAFR0E01030 Chr5 (212679..214601) [1923 bp, 640 aa] {ON} 
          Length = 640

 Score =  505 bits (1300), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 272/624 (43%), Positives = 380/624 (60%), Gaps = 44/624 (7%)

Query: 1   MLLTKRFAKLFKLTFLVLILCGLFVVTNKYMDENT------SVKDYKKYLLDN------- 47
           + ++++F+++ KLT L L L  +F+VT     ++T       VK Y  Y  +        
Sbjct: 2   LRISRKFSRVAKLTVLFLCLLTIFIVTTSNYQQDTLDSYKSKVKSYLNYYTNGNMPTTHV 61

Query: 48  -----------INXXXXXXXXXXXXXXXXXXXXLKGNDKVSN-EKLKSFYNNVFNFLMLD 95
                      +                     ++  ++V   + ++ FY+ +FN ++ +
Sbjct: 62  AEEEEEEEEEEVAPSSQEAPLFDNDDDDNNDELVEVQEQVEKFDTIQEFYDEIFNAIISN 121

Query: 96  SPTGKSARKYNEACQLSGDIGDRPDQYEELYKLSANELSKCLELSQDEVARLTKSHKDYV 155
           SPT +S + Y + C +   IG RP  +++ +KL+ + LSKCL+LS +EV  L   HK YV
Sbjct: 122 SPTEESKKVYGKECIVDTSIGGRPGDHKDWHKLTYDNLSKCLQLSDEEVDMLHTKHKSYV 181

Query: 156 DHIASLA------LPKGTYKGSGIATVGGGKFSLMSFLIIKTLRNMGTTLPVEVLIPPGD 209
             I  +       L     K +GI  VGGGK+SL+S L + T+R  GTTLPVEV IP  D
Sbjct: 182 SAINQIVEDSKELLNGQRTKKNGIVMVGGGKYSLLSLLSVMTIRKFGTTLPVEVFIPRDD 241

Query: 210 EGESEF---CNKILPNYNAKCIYVSDILPLETIEKFTFKGYQFKSLALVASSFENLLLLD 266
           E + +F   CN++LP YNAKCI+ S++L  + IE F F GYQ KSLAL+ASSF+N+LLLD
Sbjct: 242 ELKGDFQSFCNELLPQYNAKCIFTSNVLSEKLIENFHFNGYQHKSLALLASSFDNILLLD 301

Query: 267 ADNFPIKPLDNIFNEEPYLSTGLVMWPDFWRRTTHPLYYEIADITVNMKNRVRNSQDDLT 326
           +DN PIK LD+IF  EP++  G+V+WPDFWRRTT P +Y+IA I +N   RVRN  DDLT
Sbjct: 302 SDNHPIKNLDSIFKAEPFVKNGMVLWPDFWRRTTSPKFYQIAGIPINKNTRVRNCIDDLT 361

Query: 327 PPAIYTKNSNDLGGVPLSDLDGTIPDVSTESGQLMINKTKHLATALLSLFYNVNGPNWYY 386
           P  +Y     ++  VP  D +GT PD+S+ESGQL+IN+ +HL + LL+L+YN NGP WYY
Sbjct: 362 PLEVYNNEEINIYDVPFHDTEGTFPDMSSESGQLLINRNRHLKSILLALYYNYNGPAWYY 421

Query: 387 PIFSQKAAGEGDKETFIAAANFYGLSFYQVKTRTGVEGYHD--KEGFHGVAMLQHDFVQD 444
            IFSQ AAGEGDKETFIA A+FYGL +YQVKT   V GYH      F GVA+LQHD VQD
Sbjct: 422 SIFSQGAAGEGDKETFIAGAHFYGLPYYQVKTFPSVSGYHQPGNSEFRGVAILQHDLVQD 481

Query: 445 YSRYLTASKSITNKYKDIKSSAAIKYDKNYSLEKYTKEFFD--NEDLKAKDHVDVMFIHS 502
           Y RY  AS  +   Y+  ++   + YD+NYSL  +  ++FD  N +   K+ VD  F+H+
Sbjct: 482 YQRYQEASIGLGKTYEFPEN---VTYDENYSLGTFYNKYFDGGNNEPDVKE-VDFAFVHA 537

Query: 503 NLPKFDPYTLSETNFLTTDDKPARSFTALHKVQNYDIELENFKVLKEYVCDKKNPFKYLD 562
           N PKFDP +L+E +    + +  RSFT L K+  YDIE ENF  L ++VC  +  F Y++
Sbjct: 538 NFPKFDPVSLAEGSSFIFEGQHFRSFTDLTKLNGYDIEYENFVTLHDFVCVNRKYFPYIE 597

Query: 563 DKLGEDKKEWRRMCDYIAKRLQFL 586
             +   K+E+ +MC YI+ RLQFL
Sbjct: 598 KSIS--KEEYEKMCRYISDRLQFL 619

>KAFR0G00280 Chr7 (92838..94577) [1740 bp, 579 aa] {ON} Anc_1.150
           YJL186W
          Length = 579

 Score =  422 bits (1085), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 232/549 (42%), Positives = 337/549 (61%), Gaps = 45/549 (8%)

Query: 76  VSNEKLKSFYNNVFNFLM----LDSPTGKSARKYNEACQLSGDIG-DRPDQYEELYKLSA 130
           V +    +FY+ V+  L+    +D P+ K++ +   +C L  D+G +  D++E   KLS 
Sbjct: 40  VKSNAYDAFYSEVYELLISSKPMDPPSDKNSFRLT-SCDLPKDVGINDLDRFE---KLSF 95

Query: 131 NELSKCLELSQDEVARLTKSHKDYVDHIASLA------LPKGTYKGSGIATVGGGKFSLM 184
           + L +C  LS ++   L K+H  YV  I  L       + K   K  GI TVGGG++S++
Sbjct: 96  DNLQRCYHLSNEQAQDLQKAHSSYVKSIKDLIDNHSNIISKDDEKKKGILTVGGGRYSVL 155

Query: 185 SFLIIKTLRNMGTTLPVEVLIPPGDEGESEFCNKILPNYNAKCIYVSDILPLETIEKFTF 244
            F +I+ LR  GTTLPVEVLIPP DEG+ EFCN ILP +NAKCIY  D LP   ++K   
Sbjct: 156 LFTMIQKLRETGTTLPVEVLIPPQDEGDDEFCNVILPQFNAKCIYFKDYLPPNLLDKLVL 215

Query: 245 KGYQFKSLALVASSFENLLLLDADNFPIKPLDNIFNEEPYLSTGLVMWPDFWRRTTHPLY 304
           K YQ K+L L+ +SF  +L LDADN+P+K L+ IF  E +   GL+ WPD WRR T P Y
Sbjct: 216 KSYQIKALGLLMTSFNQILFLDADNYPMKNLNYIFETESFQKYGLITWPDIWRRYTPPAY 275

Query: 305 YEIADITVNMKNRVRNSQDDLTPPA----IYTKNSND--------LGGVPLSDLDGTIPD 352
           Y IADI  N++ RVR   DD++P +    I+    ND           VP  DL+GTI D
Sbjct: 276 YNIADIDFNLEKRVRFETDDISPVSRYDDIFPTLLNDERKLTEYTSSKVPFHDLEGTISD 335

Query: 353 VSTESGQLMINKTKHLATALLSLFYNVNGPNWYYPIFSQKAAGEGDKETFIAAANFYGLS 412
           ++TESGQ++I+K KHL T LL+ +YN  GP+WYY +FS  ++GEGDKETFI+AA+  G  
Sbjct: 336 LTTESGQMLIDKKKHLDTLLLAFYYNFYGPSWYYNMFSLGSSGEGDKETFISAAHALGKP 395

Query: 413 FYQVKTRTGVEG-YHDKEGFHGVAMLQHDFVQDYSRYLTASKSIT---NKYKDIKSSAAI 468
           +YQVK++   +G +HDK+GF G+ ++QHDF QDY  +  A   +    +KY         
Sbjct: 396 YYQVKSKVEFDGFFHDKDGFQGLGLMQHDFEQDYQVHKNAMLEVAGNPDKYS-------- 447

Query: 469 KYDKNYSLE-KYTKEFFDNEDLKAKDHVDVMFIHSNLPKFDPYTL-SETNFLTTDDKPAR 526
           KY+ +Y LE  +T +F    + K KD VD+MF+H++  KF+P  L S+  +  +D+ P R
Sbjct: 448 KYESDYKLETSFTDQFLRKYNNK-KDLVDIMFVHASFFKFEPLELHSKNRYYMSDNSPLR 506

Query: 527 SFTALHKVQNYDIELENFKVLKEYVCDKKN-PFKYLDDKLGEDKKEWRRMCDYIAKRLQF 585
            F  + ++ N+D+EL NF++L++ +C  K   FK  +DK   D  EW+ +C+Y+ KR+ F
Sbjct: 507 GFKRMDRMNNFDLELFNFQILRDNLCSTKPVAFKVYEDKYDTD--EWKSVCEYLDKRVTF 564

Query: 586 LESTHDKVI 594
           L+ TH++ I
Sbjct: 565 LKKTHEEAI 573

>NDAI0A00780 Chr1 (156271..158034) [1764 bp, 587 aa] {ON} Anc_1.150
          Length = 587

 Score =  410 bits (1055), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 225/534 (42%), Positives = 330/534 (61%), Gaps = 31/534 (5%)

Query: 81  LKSFYNNVFN----FLMLDSPTGKSARKYNEACQLSGDIGDRP-DQYEELYKLSANELSK 135
           ++ FY ++FN    +  L+ P+     +  E C+  GDI     D++ E   LS N L++
Sbjct: 62  VERFYIDLFNSINQYRPLNPPSNPDDLRDTEKCKWHGDISVHDFDKFNEY--LSYNNLNE 119

Query: 136 CLELSQDEVARLTKSHKDYVDHIASL------ALPKGTYKGS-GIATVGGGKFSLMSFLI 188
           C +LS  ++  L +SH  +V+ I S        L  G +  + GI TVGGGK++++   +
Sbjct: 120 CYKLSNIQLNNLKRSHSGFVESILSEFSTKDDKLTSGLFPNNEGIVTVGGGKYTVLLMTM 179

Query: 189 IKTLRNMGTTLPVEVLIPPGDEGESEFCNKILPNYNAKCIYVSDILPLETIEKFTFKGYQ 248
           I+ LR  GTTLP+EV+IPP DEG+ EFCN +LPNYN KCIY  D+LP +  +K   KG+Q
Sbjct: 180 IEKLRQSGTTLPLEVIIPPQDEGDDEFCNNVLPNYNGKCIYFKDVLPDQLSDKLVIKGFQ 239

Query: 249 FKSLALVASSFENLLLLDADNFPIKPLDNIFNEEPYLSTGLVMWPDFWRRTTHPLYYEIA 308
            K LA++ SSF+  L LDADN  +K LDNIFN + +    L++WPD WRR T P YY+IA
Sbjct: 240 LKPLAILLSSFKKALFLDADNLAMKDLDNIFNTQAFKQKRLIVWPDVWRRFTAPAYYKIA 299

Query: 309 DITVNMKNRVRNSQDDLTPPAIYTKNSND----LGGVPLSDLDGTIPDVSTESGQLMINK 364
           +I +++  R+RN  DD++PP+ Y  NS +    L  VP  DL GTIPD ++ESGQ++I+K
Sbjct: 300 NIKLDLGKRIRNLNDDVSPPSRYDDNSENSAQYLENVPFHDLKGTIPDPTSESGQMVIDK 359

Query: 365 TKHLATALLSLFYNVNGPNWYYPIFSQKAAGEGDKETFIAAANFYGLSFYQVKTRTGVEG 424
            +H  T +LSL+YN+ GP WYY +FSQ  +G+GDKETFIAAA+  G  +YQV T+ G +G
Sbjct: 360 IEHFHTLILSLYYNLYGPPWYYRMFSQGTSGQGDKETFIAAAHALGKPYYQVHTKMGFKG 419

Query: 425 YHD-KEGFHGVAMLQHDFVQDYSRYLTASKSITNKYKDIKSSAAIKYDKNYSLEKYTKEF 483
           Y+D K GF GV +LQHDF QD+ +   ASK+I         S   K+ ++Y   K T +F
Sbjct: 420 YNDEKLGFQGVGLLQHDFEQDFKQLQLASKTINE-----NESEYSKFKQDY---KATVDF 471

Query: 484 FDNEDLKAKDHVDVMFIHSNLPKFDPYTL-SETNFLTTDDKPARSFTALHKVQNYDIELE 542
            D+        +D+MF+H++  K++P  L  E  ++  D    R F+ L ++  +D+EL 
Sbjct: 472 DDSLMKPIDGPIDIMFLHASFFKYEPLDLIREHRYVKEDGSHFRVFSGLERLNYFDLELF 531

Query: 543 NFKVLKEYVCDKKN-PFKYLDDKLGEDKKEWRRMCDYIAKRLQFLESTHDKVIA 595
           NFK+L +++C ++   FKY   K  E K EW  MC ++ +  ++LESTH +  A
Sbjct: 532 NFKILNKFLCTEEMIHFKYY--KNVESKPEWSDMCKFLKEHTEYLESTHKEATA 583

>SAKL0C04598g Chr3 (447448..449283) [1836 bp, 611 aa] {ON} similar
           to uniprot|P46982 Saccharomyces cerevisiae YJL186W MNN5
           Alpha-1 2-mannosyltransferase responsible for addition
           of the second alpha-1 2-linked mannose of the branches
           on the mannan backbone of oligosaccharides localizes to
           an early Golgi compartment
          Length = 611

 Score =  408 bits (1048), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 231/536 (43%), Positives = 320/536 (59%), Gaps = 39/536 (7%)

Query: 84  FYNNVFNFLMLDSPTGKSARKYNEACQLSG----DIGDRPDQYEELYKLSANELSKCLEL 139
            Y+ +F +L    P      K   A + SG    D+G   D       L+ N L +C  L
Sbjct: 89  LYSKLFGYLQRYKPVAPPKDK--AALRQSGCVMRDVGLADDS--RFSNLAYNNLDRCYNL 144

Query: 140 SQDEVARLTKSHKDYVDHIA--------SLALPKGTYKGSGIATVGGGKFSLMSFLIIKT 191
           S ++   L  +H  YV  +         S  L K      GI TVGGG+FSL+S  +I+ 
Sbjct: 145 SPEQFDSLHSNHAKYVSKLKKEFELGPDSPLLDKLFPNEKGIVTVGGGRFSLLSLTMIRV 204

Query: 192 LRNMGTTLPVEVLIPPGDEGESEFCNKILPNYNAKCIYVSDILPLETIEKFTFKGYQFKS 251
           LR  GTTLPVEV+IPP DEGE +FCN +LP  N  C+Y SD+L   T+ + TF+ YQ K 
Sbjct: 205 LRERGTTLPVEVVIPPADEGEDDFCNNVLPALNGTCVYFSDVLSKSTLNQVTFERYQIKG 264

Query: 252 LALVASSFENLLLLDADNFPIKPLDNIFNEEPYLSTGLVMWPDFWRRTTHPLYYEIADIT 311
           +AL+ SSF+N + LDADNF IKPLDNIF  E YL  GLV+WPD WRR T P++Y ++D+ 
Sbjct: 265 VALLLSSFKNTIFLDADNFAIKPLDNIFESEAYLEHGLVLWPDLWRRVTAPVFYNVSDVE 324

Query: 312 VNMKNRVRNSQDDLTPPAIYTKNSNDL----GGVPLSDLDGTIPDVSTESGQLMINKTKH 367
           +++  R R   DD+TP + Y K   DL      VPL DLDG IPD S+ESGQ++++K +H
Sbjct: 325 LDLTKRARFIGDDVTPASKYHKPDADLAYNKAEVPLHDLDGAIPDPSSESGQMIVDKREH 384

Query: 368 LATALLSLFYNVNGPNWYYPIFSQKAAGEGDKETFIAAANFYGLSFYQVKTRTGVEGYHD 427
             T LL+L+YN  GP+WYY +FSQ  +GEGDKETF+AAA+     +YQVK++ G  GY D
Sbjct: 385 FQTLLLALYYNYYGPDWYYRMFSQGTSGEGDKETFVAAAHVLSKPYYQVKSKLGFAGYWD 444

Query: 428 K---EGFHGVAMLQHDFVQDYSRYLTASKSITNKYKDIKSSAAIKYDKNYSLEK--YTKE 482
           +    GF G A+LQHDFVQDY ++  A + + + Y +       ++D NY+ EK  Y K 
Sbjct: 445 EYTDGGFKGAALLQHDFVQDYGQHKKALEVVRSNYDEY-----TRFDPNYNSEKDFYKKL 499

Query: 483 FFDNEDLKAKDHVDVMFIHSNLPKFDPYTL-SETNFLTTDDKPA-RSFTALHKVQNYDIE 540
              +     K+  DVMF+H++  KFDP+ L     +L  D K   RS+  L ++  +D+E
Sbjct: 500 MVPD----GKEETDVMFVHASFHKFDPWDLYRRKTYLKPDGKSQFRSYRDLKRLGGFDLE 555

Query: 541 LENFKVLKEYVCDKKN-PFKYLDDKLGEDKKEWRRMCDYIAKRLQFLESTHDKVIA 595
           L NF+VL++ +C  K   FKYL DK+    +EW  MC+Y+  R+QFL+ TH + + 
Sbjct: 556 LFNFEVLEDALCAGKQIGFKYLQDKV--TSQEWPGMCEYVHDRVQFLKETHAEALG 609

>NCAS0B08450 Chr2 complement(1614300..1616060) [1761 bp, 586 aa]
           {ON} Anc_1.150
          Length = 586

 Score =  389 bits (998), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 214/547 (39%), Positives = 330/547 (60%), Gaps = 53/547 (9%)

Query: 80  KLKSFYNNVFN----FLMLDSPTGKSARKYNEACQLSGDIGDRPDQYEELYKLSANELSK 135
           ++++FY ++FN    +  L+ P      +  + C+ SGDI    D  +   +LS   L +
Sbjct: 56  QVEAFYLDLFNSINQYRPLNPPGNWEDLRDKDKCKWSGDISVNDDGRDANERLSMENLDE 115

Query: 136 CLELSQDEVARLTKSHKDYVDHI------ASLALPKGTYKGS-GIATVGGGKFSLMSFLI 188
           C +LS  ++  L ++H  YV +I       +  L    +  + GI T+GGG+++++   +
Sbjct: 116 CFKLSSIQLNNLKRAHSGYVKNIRDKFDDKNERLTNSLFPNNVGIVTIGGGRYTVLLMTM 175

Query: 189 IKTLRNMGTTLPVEVLIPPGDEGESEFCNKILPNYNAKCIYVSDILPLETIEKFTFKGYQ 248
           I  LR+ GT+LP+EV+IPP DEG+ +FCN ILP +N KC++  D+LP E  +K   + YQ
Sbjct: 176 IAKLRDTGTSLPIEVIIPPEDEGDDDFCNVILPKWNGKCVFFKDVLPDELNKKLMLQSYQ 235

Query: 249 FKSLALVASSFENLLLLDADNFPIKPLDNIFNEEPYLSTGLVMWPDFWRRTTHPLYYEIA 308
            K LA++ SSF+ +L LDADN+ +K LD+IF  EP++  GL++WPD+WRR T P YY+IA
Sbjct: 236 IKPLAVLLSSFKKILFLDADNYAMKDLDHIFESEPFIENGLIVWPDYWRRVTPPAYYKIA 295

Query: 309 DITVNMKNRVRNSQDDLTPPAIYTKNSND----LGGVPLSDLDGTIPDVSTESGQLMINK 364
           DI ++ K R+RN  DD+TPP+ Y     D    L  VP+ DL+GTIPD ++ESGQ++I+K
Sbjct: 296 DINISKKKRIRNINDDITPPSYYDNKLKDRDHLLKEVPMHDLEGTIPDPTSESGQMVIDK 355

Query: 365 TKHLATALLSLFYNVNGPNWYYPIFSQKAAGEGDKETFIAAANFYGLSFYQVKTRTGVEG 424
            KH  T LLSL+YN+ GP+WYY IFSQ  +G+GDKETFIAAA+     +YQV T  G++G
Sbjct: 356 VKHFHTLLLSLYYNLYGPSWYYQIFSQGTSGQGDKETFIAAAHALNKPYYQVTTSLGLKG 415

Query: 425 YHDKEGFHGVAMLQHDFVQDYSRYLTASKSITNKYKDIKSSAAIKYDKNYSLEKYTKEFF 484
           +  +  F G+ +LQ DF QDY+++    ++I +                  LE+Y+ EF 
Sbjct: 416 FFYENEFRGIGLLQRDFQQDYAQHQLVKQTIQD-----------------HLEEYS-EF- 456

Query: 485 DNEDLKAKDH-------------VDVMFIHSNLPKFDPYTL-SETNFLTTDDKPARSFTA 530
             ED K  D              +DVMF+H++  K++P+ L +E  ++ +D    R F+ 
Sbjct: 457 -KEDYKVADEFNKKLMIPPNGQPLDVMFVHASFYKYEPWDLYNERRYVNSDGTHFRGFSD 515

Query: 531 LHKVQNYDIELENFKVLKEYVC--DKKNPFKYLDDKLGEDKKEWRRMCDYIAKRLQFLES 588
           L +   +D+EL NFK+L++ +C  +KK  FK+ +DK+     EW  MC Y+   + FL+ 
Sbjct: 516 LKEFNYFDMELFNFKILRDTLCSPNKKVEFKFYNDKVFS--PEWDNMCTYLKDHVNFLQE 573

Query: 589 THDKVIA 595
           TH + +A
Sbjct: 574 THSEAVA 580

>Kwal_33.13693 s33 (354321..355997) [1677 bp, 558 aa] {ON} YJL186W
           (MNN5) - putative Golgi alpha-1,2-mannosyltransferase
           [contig 114] FULL
          Length = 558

 Score =  388 bits (996), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 211/536 (39%), Positives = 313/536 (58%), Gaps = 46/536 (8%)

Query: 85  YNNVFNFLM----LDSPTGKSARKYNEACQLSG---DIGD--RPDQYEELYKLSANELSK 135
           Y+++F+ L     +D+P         + C + G   + GD   P  YE L          
Sbjct: 40  YSDLFSALEKHKPIDAPKNMREAVKQQGCNMKGVGVNKGDDVSPTVYENL--------DA 91

Query: 136 CLELSQDEVARLTKSHKDYVDHIASL---ALPKGTYK-----GSGIATVGGGKFSLMSFL 187
           C   S+ +   L   H  Y+  + S        G +        G  TVGGG+FSL+S+ 
Sbjct: 92  CFRPSKAQFEGLQAPHTAYLAALRSTFNYQNEPGVFNELFPNDKGFVTVGGGRFSLLSYT 151

Query: 188 IIKTLRNMGTTLPVEVLIPPGDE-GESEFCNKILPNYNAKCIYVSDILPLETIEKFTFKG 246
           +I+T+R  G+TLP+EV+IPP DE GE  FC +ILP  N +C++  D LP   +E + FK 
Sbjct: 152 MIRTMRERGSTLPIEVVIPPQDEKGEEHFCQEILPKLNGRCVFFGDTLPPSIVEDWKFKS 211

Query: 247 YQFKSLALVASSFENLLLLDADNFPIKPLDNIFNEEPYLSTGLVMWPDFWRRTTHPLYYE 306
           YQ K +AL+ SSF+ ++ +DAD+ P+K LD++F  + +   GLV+WPD WRR T P++Y 
Sbjct: 212 YQIKVMALLLSSFKKIVFIDADDLPLKNLDDVFESKVFKKNGLVLWPDLWRRMTAPVFYR 271

Query: 307 IADITVNMKNRVRNSQDDLTPPAIY-TKNSNDLGGVPLSDLDGTIPDVSTESGQLMINKT 365
           +A+I  ++  RVRN  DD++P + Y   N+ +   +P  D  GTIPD +TESGQ++I+K 
Sbjct: 272 LANIDTDLTKRVRNLGDDISPVSRYLNPNAKEQKPIPFHDFAGTIPDPTTESGQMVIDKV 331

Query: 366 KHLATALLSLFYNVNGPNWYYPIFSQKAAGEGDKETFIAAANFYGLSFYQVKTRTGVEGY 425
           +H  T LL+L+YNV GP+WYY +FSQ  AGEGDKETF +AA+   L +YQV+T+   +GY
Sbjct: 332 RHFQTLLLALYYNVYGPDWYYALFSQGTAGEGDKETFASAAHVLELPYYQVRTKLSFDGY 391

Query: 426 HDKE--GFHGVAMLQHDFVQDYSRYLTAS---KSITNKYKDIKSSAAIKYDKNYSLEKYT 480
            D +  GF GVA+ QHD  QDY  Y  A    KS  +KY   K     + D   SL K  
Sbjct: 392 SDPKDGGFRGVALYQHDCTQDYETYEQARELVKSQPDKYSAFKEDYDSEPDFYQSLMK-- 449

Query: 481 KEFFDNEDLKAKDHVDVMFIHSNLPKFDPYTL-SETNFLTTDDKPARSFTALHKVQNYDI 539
                    + K  V+VMF H++  KFDP+ L  E  +L  D    RSF  LH+++++DI
Sbjct: 450 --------PEGKPEVEVMFAHASFHKFDPWQLFKEKVYLNEDGTQFRSFRRLHRIKHFDI 501

Query: 540 ELENFKVLKEYVCDKKN-PFKYLDDKLGEDKKEWRRMCDYIAKRLQFLESTHDKVI 594
           EL NF+VL+E +C ++   F+Y +DK    ++EW ++C Y+  R+++L+ THD+ +
Sbjct: 502 ELFNFEVLEEAMCSEQPIRFRYFEDKF--KREEWPKVCQYVKDRVEYLKKTHDEAV 555

>TPHA0E03480 Chr5 complement(735664..737793) [2130 bp, 709 aa] {ON}
           Anc_1.150 YJL186W
          Length = 709

 Score =  389 bits (1000), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 218/545 (40%), Positives = 318/545 (58%), Gaps = 34/545 (6%)

Query: 73  NDKVSNEKLKS---FYNNVFNFLM----LDSPTGKSARKYNEACQLSGDIGDRPDQYEEL 125
           N   +N K+K+   FY  +FN +     +  P  K A    E C++  D+    D+ E  
Sbjct: 85  NGYFANAKIKNVHDFYYKLFNAISKARPVTPPKDKMAAYRKEGCKIK-DVASY-DKKENF 142

Query: 126 YKLSANELSKCLELSQDEVARLTKSHKDYVDHIAS------LALPKGTYKGS-GIATVGG 178
             LS + L +C +LS  +   L  +H+ +V+ I +       A+ +  +    GI  VGG
Sbjct: 143 SLLSYSNLDECFKLSDSQTKDLQVNHERFVNFIDTDIAEMDPAIKEQLWPNEKGIVIVGG 202

Query: 179 GKFSLMSFLIIKTLRNMGTTLPVEVLIPPGDEGESEFCNKILPNYNAKCIYVSDILPLET 238
           GKFS++S   IK +R  G+TLP+EV+IP     E E+CN+ LP++NAKC+Y+ D LP E 
Sbjct: 203 GKFSIISINTIKAIRERGSTLPIEVIIPRSSVPEEEYCNRFLPSFNAKCVYLDDTLPNEF 262

Query: 239 IEKFTFKGYQFKSLALVASSFENLLLLDADNFPIKPLDNIFNEEPYLSTGLVMWPDFWRR 298
            E+ T K YQ+KS AL+ SSF+N+L +DADN P+  LDNIF+ + Y   GL+ WPD WRR
Sbjct: 263 KERLTLKKYQYKSFALLVSSFKNVLYIDADNIPLVNLDNIFDSKAYKDNGLITWPDIWRR 322

Query: 299 TTHPLYYEIADITVNMKNRVRNSQDDLTPPAIYTK-----NSNDLGGVPLSDLDGTIPDV 353
            T P YY+IA+I  N+ NRVR   DD+TP + Y       N+  L   P  D +GT+PD+
Sbjct: 323 VTAPAYYKIANINYNLDNRVRYMADDVTPTSYYDNIVNPGNNYKLRRTPFHDFEGTLPDL 382

Query: 354 STESGQLMINKTKHLATALLSLFYNVNGPNWYYPIFSQKAAGEGDKETFIAAANFYGLSF 413
           ++ESGQLM+NK  H  T LL+ +YN  GP WYY IFSQ  +GEGDKETF+AAA+  G  +
Sbjct: 383 TSESGQLMVNKETHFRTLLLAFYYNYYGPRWYYTIFSQGTSGEGDKETFLAAAHALGEPY 442

Query: 414 YQVKTRTGVEGYHD-KEGFHGVAMLQHDFVQDYSRYLTASKSITNKYKDIKSSAAIKYDK 472
           YQVK+    +GY D K+GF G+ + Q DF +DY  YL A   +    KD K     +Y+ 
Sbjct: 443 YQVKSTIEFDGYFDHKDGFQGIGLYQKDFNKDYENYLAAKAKVE---KDKKYG---EYNP 496

Query: 473 NYSLEKYTKEFFDNEDLKAKDHVDVMFIHSNLPKFDPYTLSETNFLTTDDKPARSFTALH 532
           NY  +   ++   N      + V+ MFIH +  KFDP+ L++        K  R F+   
Sbjct: 497 NYDFDADFEKALMNP---PGNEVEAMFIHVSFHKFDPHNLAKNKRYILQGKQYRVFSKFK 553

Query: 533 KVQNYDIELENFKVLKEYVC-DKKNPFKYLDDKLGEDKKEWRRMCDYIAKRLQFLESTHD 591
            ++N+D+ELE  + +  Y+C D    F +  D  G+D   W+ MC+Y+++R+++L STHD
Sbjct: 554 NLRNWDLELEANRNMHFYLCTDNAVEFIFYKDLQGKD--SWKDMCNYLSERVEYLASTHD 611

Query: 592 KVIAG 596
             ++G
Sbjct: 612 AALSG 616

>ZYRO0D17160g Chr4 complement(1417469..1419208) [1740 bp, 579 aa]
           {ON} similar to uniprot|P46982 Saccharomyces cerevisiae
           YJL186W MNN5 Alpha-1 2-mannosyltransferase responsible
           for addition of the second alpha-1 2-linked mannose of
           the branches on the mannan backbone of oligosaccharides
           localizes to an early Golgi compartment
          Length = 579

 Score =  383 bits (984), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 199/528 (37%), Positives = 319/528 (60%), Gaps = 28/528 (5%)

Query: 82  KSFYNNVFNFLMLDSPTGK---SARKYNEACQLSGDIGDRPDQYEELYKLSANELSKCLE 138
           ++FY+ +F  +   +P G+    + +  E C+  GDI      +E   K S   L  C  
Sbjct: 65  RNFYSALFQAIQDGTPEGQLIMDSVRDKEKCR-DGDISAFSTDFE---KSSYENLDACFH 120

Query: 139 LSQDEVARLTKSHKDYVDHIASLALPKGTY-----KGSGIATVGGGKFSLMSFLIIKTLR 193
           LS D +  L   H+ +V+ I S    K          SGI T+GG K+S++S  +++TLR
Sbjct: 121 LSDDRLGMLASKHEKFVEAINSWKFSKSDIDKLFPNESGIVTIGGSKYSVISLTMLETLR 180

Query: 194 NMGTTLPVEVLIPPGDEGESEFCNKILPNYNAKCIYVSDILPLETIEKFTFKGYQFKSLA 253
           + G+ LPVEV+IPPGDEG+ ++CN +LP   AKC+Y+++ LP + ++    + YQ K + 
Sbjct: 181 DRGSKLPVEVMIPPGDEGDEDYCNVVLPKLGAKCVYMAEKLPPDVVKNVKIERYQNKIVG 240

Query: 254 LVASSFENLLLLDADNFPIKPLDNIFNEEPYLSTGLVMWPDFWRRTTHPLYYEIADITVN 313
           L+ SSF+N++ +DAD  P+KPLD++FN   Y   GL++WPD W+R T P +Y++A+I ++
Sbjct: 241 LLLSSFKNVVYIDADCLPLKPLDDVFNSPAYKKHGLILWPDIWKRVTAPAFYKLANIPLD 300

Query: 314 MKNRVRNSQDDLTPPAIYTKNSND-----LGGVPLSDLDGTIPDVSTESGQLMINKTKHL 368
           +K RVR   DD++P + Y  +S       L  VP  DL+GT+ D +TESGQ++INK  HL
Sbjct: 301 LKKRVRFGADDVSPLSRYEPSSEASEVRMLKKVPFHDLEGTMSDPTTESGQMLINKVDHL 360

Query: 369 ATALLSLFYNVNGPNWYYPIFSQKAAGEGDKETFIAAANFYGLSFYQVKTRTGVEGYHDK 428
            + LLS +YN++G  WYY + SQ  +GEGDKET IAAA+   L +YQVKT    +G+ D 
Sbjct: 361 RSLLLSAYYNIHG-KWYYKMLSQGTSGEGDKETLIAAAHALKLPYYQVKTDVRFDGFSDH 419

Query: 429 EGFHGVAMLQHDFVQDYSRYLTASKSITNKYKDIKSSAAIKYDKNYSLEKYTKEFFDNED 488
           EGFHG+++ Q DF QDY  Y  A + +     ++ +     Y++NY ++   K+F++   
Sbjct: 420 EGFHGISLYQQDFQQDYEAYKKAIRWVRRHKSELSA-----YEQNYDVK---KQFYEKLL 471

Query: 489 LKAKDHVDVMFIHSNLPKFDPYTLSETN-FLTTDDKPARSFTALHKVQNYDIELENFKVL 547
                 V+ +F H +  KF+P  L+E + ++    K  R F     ++++D+E+ NF+VL
Sbjct: 472 KPGDKEVESLFGHISYHKFEPIELAEKSIYIDEKGKHFRGFRRKEVIRHFDLEMFNFEVL 531

Query: 548 KEYVCDKKNPFKYLDDKLGEDKKEWRRMCDYIAKRLQFLESTHDKVIA 595
           ++Y+C K+NP K++  K   D  EW RMC+Y+   + +L+ TH+++ +
Sbjct: 532 EKYLC-KENPVKFVYYKDRMDTPEWERMCNYLKSHVSYLQDTHEELFS 578

>TBLA0D03030 Chr4 complement(734007..735824) [1818 bp, 605 aa] {ON}
           Anc_1.150 YJL186W
          Length = 605

 Score =  382 bits (982), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 205/547 (37%), Positives = 320/547 (58%), Gaps = 39/547 (7%)

Query: 70  LKGNDKVSNEKLKSFYNNVFNFLMLDSPTGKSARKYNEA----CQLSGDIGDRPDQYEEL 125
           L   D  SN    +FY  +F+ +    P   S +   ++    C+L  DI    +    L
Sbjct: 62  LAALDNSSNNFRDNFYTFMFSAIARGKPVNPSVKDLKQSKRSECKLESDISMTDNSPGSL 121

Query: 126 YKLSANELSKCLELSQDEVARLTKSHKDYVD----HIASLALPKGTYK----GSGIATVG 177
            ++S N L  CL +S+ ++  L   H +++      ++ L  P+   +    G GI T+G
Sbjct: 122 SRVSFNSLLNCLSISRPQLDNLKYVHSNFIQLLEAKMSELTKPEFLDQIFPNGRGIVTIG 181

Query: 178 GGKFSLMSFLIIKTLRNMGTTLPVEVLIPPGDE-GESEFCNKILPNYNAKCIYVSDILPL 236
           GGKFS+++  +IK LR  G+TLPVEV+IPP DE  E +FCN  LPNYNAKC++  D+LP 
Sbjct: 182 GGKFSVLAMNVIKVLRKTGSTLPVEVVIPPQDEKNEVDFCNNFLPNYNAKCVFFKDVLPK 241

Query: 237 ETIEKFTFKGYQFKSLALVASSFENLLLLDADNFPIKPLDNIFNEEPYLSTGLVMWPDFW 296
              E    KGYQ K +AL+ SSF+ ++ LD+DN+P+K LD++F+ + Y   GL++WPD W
Sbjct: 242 HYAENLRLKGYQIKVMALLISSFKEIIFLDSDNYPLKSLDHVFDADIYKEAGLILWPDIW 301

Query: 297 RRTTHPLYYEIADITVNMKNRVRNSQDDLTPPAIYT---------KNSNDLGGVPLSDLD 347
           RR T+P+YY+IA+++V++  RVR   DD++PP  YT         K   +   +P  DL 
Sbjct: 302 RRVTNPMYYDIANVSVDINQRVRYGTDDISPPNRYTIPRVHKNNEKEIENKNTIPFHDLL 361

Query: 348 GTIPDVSTESGQLMINKTKHLATALLSLFYNVNGPNWYYPIFSQKAAGEGDKETFIAAAN 407
           GT+PD STESGQ+++NK KHL T LL+ +YN  GP WYY +FSQ  AGEGDKETFI+AA+
Sbjct: 362 GTVPDASTESGQMIVNKAKHLDTLLLAAYYNFYGPAWYYRLFSQGTAGEGDKETFISAAH 421

Query: 408 FYGLSFYQVKTRTGVEGYHD-KEGFHGVAMLQHDFVQDYSRYLTASKSITNKYKDIKSSA 466
                +YQVK++ G +G+ D K GF G+ +LQHDF+QDY  Y  A   + + Y D     
Sbjct: 422 TLNKPYYQVKSKVGFDGFWDSKLGFQGIMLLQHDFIQDYEHYSKAKNQVIDHYDDY---- 477

Query: 467 AIKYDKNYSLEKYTKEFFDNEDLKAKDHVDVMFIHSNLPKFDPYTL-SETNFLTTD-DKP 524
              +  +Y+L+   ++F+DN  L  +  + +MF H++  K++P+ L  E  ++  +  + 
Sbjct: 478 -YHFKSDYNLD---RDFYDN--LIHEKDISIMFGHTSFFKYEPWVLYHERRYIDHETQQH 531

Query: 525 ARSFTALHKVQNYDIELENFKVLKEYVC----DKKNPFKYLDDKLGEDKKEWRRMCDYIA 580
            R   ++ +  ++D+EL  F  L + +C    + K+  ++   K  +    W  MC+Y+ 
Sbjct: 532 VRGLRSIGRALDFDLELFCFDNLLQTLCKGNANDKSSIRFAFYKDIQGTPLWDSMCEYLD 591

Query: 581 KRLQFLE 587
            R+ +L+
Sbjct: 592 NRVSYLQ 598

>Kpol_2002.57 s2002 (129140..130957) [1818 bp, 605 aa] {ON}
           (129140..130957) [1818 nt, 606 aa]
          Length = 605

 Score =  380 bits (977), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 212/533 (39%), Positives = 304/533 (57%), Gaps = 33/533 (6%)

Query: 82  KSFYNNVFNFLMLDSPT--GKSARKYNE-ACQLSGDIGDRPDQYEELYKLSANELSKCLE 138
           K FY  +F+ L    P    K A   +E  C L  DI     + + L   S   LS C  
Sbjct: 78  KDFYYKLFDALAASKPVRPPKDANFRDEDKCNLK-DIASYSSKEDHLL-TSYESLSNCYN 135

Query: 139 LSQDEVARLTKSHKDYVDHIA-SLALPKGTYKG-----SGIATVGGGKFSLMSFLIIKTL 192
           L+Q +   L  SH+ + +H+  S  L     K       GI  +GGGKFS+    +IKTL
Sbjct: 136 LTQSQYDDLHNSHELFTEHVEKSFQLSNSAAKSMWPNDKGIVAIGGGKFSVYILSMIKTL 195

Query: 193 RNMGTTLPVEVLIPPGDEGESEFCNKILPNYNAKCIYVSDILPLETIEKFTFK--GYQFK 250
           R  GT LPVE+L+P     + EFC+K LP  NAKC+Y  D+LP E   K+  K   +Q+K
Sbjct: 196 RAKGTHLPVEILMPLASPEDKEFCDKFLPPLNAKCVYFKDVLPKEFTGKYPIKISRFQYK 255

Query: 251 SLALVASSFENLLLLDADNFPIKPLDNIFNEEPYLSTGLVMWPDFWRRTTHPLYYEIADI 310
             +++ SSF N++ +D+DN  +K LD +F+   Y   GL++WPD WRR T P+YY +A +
Sbjct: 256 VFSILFSSFRNVMYIDSDNLALKSLDKVFDTVAYRENGLILWPDIWRRVTAPIYYSVAGV 315

Query: 311 TVNMKNRVRNSQDDLTPPAIYTKNSND-----LGGVPLSDLDGTIPDVSTESGQLMINKT 365
             N++ RVRN  DDL+P + Y    N         VP  D +GT+PD++TESGQL+++K 
Sbjct: 316 PYNLEKRVRNMVDDLSPVSRYDNVENPGNDYRTRKVPFHDFEGTLPDLTTESGQLVVDKV 375

Query: 366 KHLATALLSLFYNVNGPNWYYPIFSQKAAGEGDKETFIAAANFYGLSFYQVKTRTGVEGY 425
           +H  T LL+ +YN  GP+WYY IFSQ  AGEGDKETFIAAA+ +GL +YQVKT    +GY
Sbjct: 376 RHFKTLLLATYYNFYGPDWYYRIFSQGGAGEGDKETFIAAAHKFGLPYYQVKTNLKFDGY 435

Query: 426 HD-KEGFHGVAMLQHDFVQDYSRYLTASKSITNKYKDIKSSAAIKYDKNYSLEKYTKEFF 484
           +D KEGF G+ + QHDF QDY +Y  A   ++  Y  +      +YD  YS EK     F
Sbjct: 436 NDAKEGFRGIGLYQHDFDQDYKQYQAAKSYVSRNYAKLS-----QYDPEYSSEKS----F 486

Query: 485 DNEDLKAKD--HVDVMFIHSNLPKFDPYTLSETNFLTTDDKPARSFTALHKVQNYDIELE 542
           + E +K  +   +D MF+H +  KFDP+ L++      D K  R F     ++ +D+EL+
Sbjct: 487 EKELMKPSNGKDIDAMFVHVSFYKFDPFVLAKEKRYMRDGKHFRGFGRFELLKGWDLELD 546

Query: 543 NFKVLKEYVC-DKKNPFKYLDDKLGEDKKEWRRMCDYIAKRLQFLESTHDKVI 594
            F + ++  C D    F Y   K+ +   EW+ MC+Y++ R+ FLE TH++ +
Sbjct: 547 TFTLFRDTFCSDNVIEFSYYKPKMSQ--PEWKDMCNYLSSRVAFLEETHEEAV 597

>KLTH0F03938g Chr6 (351536..353224) [1689 bp, 562 aa] {ON} similar
           to uniprot|P46982 Saccharomyces cerevisiae YJL186W MNN5
           Alpha-1 2-mannosyltransferase responsible for addition
           of the second alpha-1 2-linked mannose of the branches
           on the mannan backbone of oligosaccharides localizes to
           an early Golgi compartment
          Length = 562

 Score =  370 bits (951), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 203/533 (38%), Positives = 308/533 (57%), Gaps = 35/533 (6%)

Query: 85  YNNVFNFLM----LDSPTGKSARKYNEACQLSGDIGDRPDQYEELYKLSANELSKCLELS 140
           Y++VF+ L+    +  P  + A      C++ G   +R D  + +  L  N L +C   +
Sbjct: 41  YSDVFDALLQYRPVRPPKDRQAAVRQAGCEMKGVGVNRGDAVDAM--LYEN-LDRCYRPT 97

Query: 141 QDEVARLTKSHKDYVDHIA--------SLALPKGTYKGSGIATVGGGKFSLMSFLIIKTL 192
           + +   L   H  ++  +         S    +   +  G  TVGGG+FSL+++ +++ L
Sbjct: 98  KAQFEGLQAPHSAFLTQLRTTFAYEADSPVFERLFPRERGFVTVGGGRFSLLAYSMLRAL 157

Query: 193 RNMGTTLPVEVLIPPGDE-GESEFCNKILPNYNAKCIYVSDILPLETIEKFTFKGYQFKS 251
           R  G+ LP EV+IPP D  GE  FCN++LP  NA+C++  D LP   +E + F+ YQ K+
Sbjct: 158 RARGSKLPAEVVIPPQDAAGEEHFCNEVLPELNARCVFFEDALPRALVETWDFERYQIKA 217

Query: 252 LALVASSFENLLLLDADNFPIKPLDNIFNEEPYLSTGLVMWPDFWRRTTHPLYYEIADIT 311
           +AL+ SSF+ ++ +DAD+FPI+ LD++F+ E     GLV+WPD WRR T P++Y +A+I 
Sbjct: 218 VALLLSSFKKIVFIDADDFPIQNLDSLFDSEVLREHGLVLWPDLWRRATAPVFYRLANID 277

Query: 312 VNMKNRVRNSQDDLTPPAIYTKNSNDLGGV----PLSDLDGTIPDVSTESGQLMINKTKH 367
           V+++ RVRN  D+L+P + YT    D   +    P  D  GT+PD +TESGQ++I+K +H
Sbjct: 278 VDLRRRVRNMGDNLSPASRYTDPDQDPEQLQKIAPFHDFAGTVPDPTTESGQMVIDKVRH 337

Query: 368 LATALLSLFYNVNGPNWYYPIFSQKAAGEGDKETFIAAANFYGLSFYQVKTRTGVEGYH- 426
             T LL+L+YNV GP WYY +FSQ  AGEGDKETF  AA+  GL FYQVK +   +GY  
Sbjct: 338 FQTLLLALYYNVYGPEWYYSLFSQGTAGEGDKETFATAAHVLGLPFYQVKNKLAFDGYFH 397

Query: 427 -DKEGFHGVAMLQHDFVQDYSRYLTASKSITNKYKDIKSSAAIKYDKNYSLEKYTKEFFD 485
            + +GF GVA+ QHD V+DY  Y  A + I  + +D  S+    YD       + K    
Sbjct: 398 PNGDGFRGVALYQHDCVEDYLLYCRA-RDIIKENQDSFSAYKPDYDPE---PDFYKSLMA 453

Query: 486 NEDLKAKDHVDVMFIHSNLPKFDPYTL-SETNFLTTDDKPARSFTALHKVQNYDIELENF 544
            E       + VMF H++  KFDP+ L  E  +L  D    RSF  + ++ N+DIEL  F
Sbjct: 454 PE---GHPEIPVMFAHASFHKFDPWQLYHEKVYLDNDGAHFRSFHNIKRIGNFDIELFVF 510

Query: 545 KVLKEYVCDKKNP--FKYLDDKLGEDKKEWRRMCDYIAKRLQFLESTHDKVIA 595
           + L++ +C   NP  FKYL+DK      +W ++C Y+  R+++L+ THD  + 
Sbjct: 511 EGLQKAIC-SDNPIRFKYLEDKFIH--ADWPKVCQYVEDRVKYLQDTHDPAVG 560

>Skud_10.31 Chr10 (54975..56735) [1761 bp, 586 aa] {ON} YJL186W
           (REAL)
          Length = 586

 Score =  369 bits (948), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 208/529 (39%), Positives = 301/529 (56%), Gaps = 39/529 (7%)

Query: 94  LDSPTGKSARKYNEACQLSGDIGDRPDQYEELYKLSANELSKCLELSQDEVARLTKSHKD 153
           + SP   +     E C  +G++     + +   +LS   L+KC  L+      LT  H  
Sbjct: 69  MGSPPDLAKLHDAEGCTFAGNVAAHTSERDS--ELSYESLNKCYRLNTTVQEGLTAMHNK 126

Query: 154 YVDHIA-----SLALPKGTYKGS-GIATVGGGKFSLMSFLIIKTLRNMGTTLPVEVLIPP 207
           + D ++     S A  +  +  S GI T+GGGK+S++++ +IK LR  GTTLP+EV+IPP
Sbjct: 127 FTDILSGKLNFSFAQREALFPESEGIVTIGGGKYSVLAYTMIKKLRETGTTLPIEVIIPP 186

Query: 208 GDEGESEFCNKILPNYNAKCIYVSDILPLETIEKFTFKGYQFKSLALVASSFENLLLLDA 267
            DEG+ +FC   LP +N KCIY SDI+P +++       +Q K   L+ S+F+ ++ +DA
Sbjct: 187 QDEGDDDFCKNWLPKHNGKCIYFSDIVPAKSLRDLELTHFQLKVFGLIISNFKRIIFIDA 246

Query: 268 DNFPIKPLDNIFNEEPYLSTGLVMWPDFWRRTTHPLYYEIADITVNMKNRVRNSQDDLTP 327
           DN+ +K LD  FN   +  TGL++WPDFWRR T P++Y I   T+N   RVR   DD++P
Sbjct: 247 DNYAVKNLDLAFNTTSFEDTGLILWPDFWRRVTPPVFYNIIGSTINTGKRVRFVSDDVSP 306

Query: 328 PAIYTKNSND-------------LGGVPLSDLDGTIPDVSTESGQLMINKTKHLATALLS 374
            + Y    +D             L  VPL D+DGT+PD++TESGQ++I+K +H  T LL+
Sbjct: 307 VSRYDPFVSDSKDYNPEEIQNHFLRHVPLHDMDGTMPDLTTESGQMVIDKIRHFHTLLLA 366

Query: 375 LFYNVNGPNWYYPIFSQKAAGEGDKETFIAAANFYGLSFYQVKTRTGVEG-YHDKEGFHG 433
           L+YNV GP WYY + SQ  AGEGDKETFIAAA+   + +YQVKT+   +G Y+ K+ F G
Sbjct: 367 LYYNVYGPTWYYKMLSQGTAGEGDKETFIAAAHALNVPYYQVKTKFEFDGFYYKKDDFKG 426

Query: 434 VAMLQHDFVQDYSRYLTASKSITNKYKDIKSSAAIKYDKNYSLEK-YTKEFFDNEDLKAK 492
           +A+LQHDF QDY  Y TA + +     +       K +  Y+L+K + K    N+D    
Sbjct: 427 LALLQHDFEQDYRHYQTAQQKVKANIGEFS-----KLNPEYTLDKGFLKNLMLNDD---G 478

Query: 493 DHVDVMFIHSNLPKFDPYTL-SETNFLTTDDKPARSFTALHKVQNYDIELENFKVLKEYV 551
             +D+MFIH++  K DP+ L  E  F+  D K  R F  L +    D EL  F  +K+  
Sbjct: 479 SDLDIMFIHASFYKADPWNLYHEKRFIGPDGKQLRGFKKLGRY-GMDFELFLFDDMKKSF 537

Query: 552 CDK-KNP---FKYLDDKLGEDKKEWRRMCDYIAKRLQFLESTHDKVIAG 596
           C   KN    FKY +DK+     EW  MC Y+A  + +LE TH   + G
Sbjct: 538 CTTPKNQVLRFKYFEDKI--TTPEWDAMCKYLADHVDYLERTHKDAMLG 584

>YJL186W Chr10 (80155..81915) [1761 bp, 586 aa] {ON}
           MNN5Alpha-1,2-mannosyltransferase, responsible for
           addition of the second alpha-1,2-linked mannose of the
           branches on the mannan backbone of oligosaccharides,
           localizes to an early Golgi compartment
          Length = 586

 Score =  369 bits (946), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 200/515 (38%), Positives = 300/515 (58%), Gaps = 39/515 (7%)

Query: 107 EACQLSGDIGDRPDQYEELYKLSANELSKCLELSQDEVARLTKSHKDYVDHIA---SLAL 163
           E C  + ++      ++    LS   LSKC  L++     L + H  + D ++   + ++
Sbjct: 82  EGCSFANNVAAHDSGHDS--DLSYESLSKCYNLNKTVQESLREVHSKFTDTLSGKLNFSI 139

Query: 164 PK--GTYKGS-GIATVGGGKFSLMSFLIIKTLRNMGTTLPVEVLIPPGDEGESEFCNKIL 220
           P+    + GS GI T+GGGK+S++++ +IK LR+ GTTLP+EV+IPP DEGE +FC   L
Sbjct: 140 PQREALFSGSEGIVTIGGGKYSVLAYTMIKKLRDTGTTLPIEVIIPPQDEGEDDFCKNWL 199

Query: 221 PNYNAKCIYVSDILPLETIEKFTFKGYQFKSLALVASSFENLLLLDADNFPIKPLDNIFN 280
           P +N KCIY SDI+P + +       +Q K   L+ SSF+ ++ LDADN+ +K LD  FN
Sbjct: 200 PKFNGKCIYFSDIVPSKPLSDLKLTHFQLKVFGLIISSFKRIIFLDADNYAVKNLDLAFN 259

Query: 281 EEPYLSTGLVMWPDFWRRTTHPLYYEIADITVNMKNRVRNSQDDLTPPAIY---TKNSND 337
              +  TGL++WPDFWRR T P +Y I   ++N+  RVR   DD++P + Y     NSND
Sbjct: 260 TTSFNDTGLILWPDFWRRVTPPAFYNIIGSSINIGKRVRFVSDDISPVSRYDPFVSNSND 319

Query: 338 ----------LGGVPLSDLDGTIPDVSTESGQLMINKTKHLATALLSLFYNVNGPNWYYP 387
                     L  VPL DLDGT+PD+S+ESGQ++I+K +H  T LL+L+YNV GP WYY 
Sbjct: 320 YTPKERQEHFLKHVPLHDLDGTMPDLSSESGQMVIDKIRHFNTLLLALYYNVYGPTWYYK 379

Query: 388 IFSQKAAGEGDKETFIAAANFYGLSFYQVKTRTGVEG-YHDKEGFHGVAMLQHDFVQDYS 446
           + SQ  AGEGDK+TF+AAA+   + +YQV+T    +G ++ K+ + G+A+LQHDF QDY 
Sbjct: 380 MISQGTAGEGDKDTFVAAAHALNMPYYQVRTNFEFDGFFYQKDDYKGLALLQHDFEQDYK 439

Query: 447 RYLTASKSITNKYKDIKSSAAIKYDKNYSLEK-YTKEFFDNEDLKAKDHVDVMFIHSNLP 505
           +Y  A + +    ++       K D +Y+L+  + K    N+D      +D+MFIH++  
Sbjct: 440 QYQKAQQKVKANIEEFS-----KLDPDYTLDNGFLKTLMVNDD---GSDLDIMFIHASFY 491

Query: 506 KFDPYTL-SETNFLTTDDKPARSFTALHKVQNYDIELENFKVLKEYVCDKKNP----FKY 560
           K DP+TL  E  F+  + +  R F   H+    D EL  F  ++   C         FKY
Sbjct: 492 KADPWTLYHENRFIGPNGEQVRGFRKPHRY-GMDFELFLFNDMRGSFCTTPKSQVIKFKY 550

Query: 561 LDDKLGEDKKEWRRMCDYIAKRLQFLESTHDKVIA 595
             DK+  +  EW  MC+Y+   + +LESTH + + 
Sbjct: 551 FTDKV--NTPEWDAMCEYLTNHVNYLESTHKEAMG 583

>Smik_10.46 Chr10 (78173..79933) [1761 bp, 586 aa] {ON} YJL186W
           (REAL)
          Length = 586

 Score =  366 bits (940), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 208/543 (38%), Positives = 313/543 (57%), Gaps = 43/543 (7%)

Query: 82  KSFYNNVFNFLMLDSPTGKSA---RKYN-EACQLSGDIGDRPDQYEELYKLSANELSKCL 137
           K+FY  +   ++   P G      + +N E C  + ++       +    LS   LSKC 
Sbjct: 53  KNFYTALIQAIVQAKPAGSPPDLNKLHNAEGCTFADNVAAHDSGRDG--DLSYESLSKCY 110

Query: 138 ELSQDEVARLTKSHKDYVDHIA---SLALPKGTY---KGSGIATVGGGKFSLMSFLIIKT 191
            L       L + H  + D ++   + ++P+      +  GI T+GGGK+S++++ +IK 
Sbjct: 111 RLDSTVQENLVEMHNQFTDVLSGRLNFSIPQREALFPESEGIVTIGGGKYSVLAYTMIKN 170

Query: 192 LRNMGTTLPVEVLIPPGDEGESEFCNKILPNYNAKCIYVSDILPLETIEKFTFKGYQFKS 251
           LR  GTTLP+EV+IPP DEG+ EFCN  LPN+N +C+Y SDI+P + +       +Q K 
Sbjct: 171 LRKTGTTLPIEVIIPPQDEGDDEFCNNWLPNFNGRCLYFSDIVPPKPLGDLKLTHFQLKV 230

Query: 252 LALVASSFENLLLLDADNFPIKPLDNIFNEEPYLSTGLVMWPDFWRRTTHPLYYEIADIT 311
             L+ S+F+ ++ +DADN+ +K LD  FN   +  TGL++WPD+WRR T P +Y I   +
Sbjct: 231 FGLLISNFKRIIFMDADNYAVKNLDLAFNATSFQDTGLILWPDYWRRVTPPAFYNIIGSS 290

Query: 312 VNMKNRVRNSQDDLTPPAIY---TKNSND----------LGGVPLSDLDGTIPDVSTESG 358
           +N   RVR   DD++P + Y     NS D          L  VPL DLDGT+ D+++ESG
Sbjct: 291 INTGKRVRFISDDISPVSRYDSFISNSEDYTSEEMQDHFLRHVPLHDLDGTMSDLTSESG 350

Query: 359 QLMINKTKHLATALLSLFYNVNGPNWYYPIFSQKAAGEGDKETFIAAANFYGLSFYQVKT 418
           Q++I+K +H  T LL+L+YNV GP WYY I SQ  AGEGDK+TFIAAA+    S+YQVKT
Sbjct: 351 QMVIDKIRHFHTLLLALYYNVYGPTWYYNIISQGTAGEGDKDTFIAAAHALNASYYQVKT 410

Query: 419 RTGVEG-YHDKEGFHGVAMLQHDFVQDYSRYLTASKSITNKYKDIKSSAAIKYDKNYSLE 477
           +   +G ++ K  + G+A+LQHDF QDY +Y  A + +     D++  +  K D +Y+L+
Sbjct: 411 KFEFDGFFYKKNDYKGIALLQHDFEQDYKQYQKAQQKVK---ADVEKFS--KLDPDYTLD 465

Query: 478 K-YTKEFFDNEDLKAKDHVDVMFIHSNLPKFDPYTL-SETNFLTTDDKPARSFTALHKVQ 535
           K + K    NED      +D+MFIH++  K DP+TL  E  F   D K  R F   ++  
Sbjct: 466 KGFLKSLMLNED---GTDLDIMFIHASFYKADPWTLYRENRFTDPDGKQLRGFRKPYRYA 522

Query: 536 NYDIELENFKVLKEYVC----DKKNPFKYLDDKLGEDKKEWRRMCDYIAKRLQFLESTHD 591
             D E+  F+ +KE  C    ++   FKY +DKL  +  EW +MC Y+   L +LE+TH+
Sbjct: 523 -MDFEMFLFRDMKESFCTPPKNQVIKFKYFNDKL--NTPEWDKMCQYLTNHLDYLEATHN 579

Query: 592 KVI 594
           + +
Sbjct: 580 EFM 582

>AEL148W Chr5 (351089..352810) [1722 bp, 573 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YJL186W (MNN5)
          Length = 573

 Score =  359 bits (921), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 203/528 (38%), Positives = 309/528 (58%), Gaps = 35/528 (6%)

Query: 84  FYNNVFNFLMLDSPTGKSARKY---NEACQLSGDIGDRPDQYEELYKL-SANELSKCLEL 139
           FY  +F  L  D+   K+   Y   +  CQ    I D  D+  E   L S + L+KC  L
Sbjct: 56  FYKMLFERLRKDAAQIKTVGSYVTQDADCQ----IRDLEDKLPESSHLGSYDGLAKCFRL 111

Query: 140 SQDEVARLTKSHKDYVDHI-------ASLALPKGTYK-GSGIATVGGGKFSLMSFLIIKT 191
            +D +  L + H +++  I       A  AL K  Y   +GI TVGGG++S+++ ++I+ 
Sbjct: 112 ERDHLEGLRQGHSEFLRTIHGELAISAKSALFKTLYPLPAGIVTVGGGRYSILAMVMIRA 171

Query: 192 LRNMGTTLPVEVLIPPGDEGESEFCNKILPNYNAKCIYVSDILPLETIEKFTFKGYQFKS 251
           LR  GTTLPVEV +   D  +  FC+ I  ++NAKC+  SD LP   +      G++ K+
Sbjct: 172 LRKRGTTLPVEVFLTDDDADDEAFCSYI-EHFNAKCVLFSDRLPKSVLASQKLSGFELKA 230

Query: 252 LALVASSFENLLLLDADNFPIKPLDNIFNEEPYLSTGLVMWPDFWRRTTHPLYYEIADIT 311
           +AL+ SS++ ++ +DADN P+KPLD++F  +P    GLV+WPD W+R T P +Y+IA I 
Sbjct: 231 VALLLSSYQQVIFIDADNVPLKPLDDVFKSKPLAEYGLVLWPDIWKRVTAPAFYDIAGIP 290

Query: 312 VNMKNRVRNSQDDLTPPAIYTK-----NSNDLGGVPLSDLDGTIPDVSTESGQLMINKTK 366
           V+ K RVR S DD++PP+ YTK      S +   VPL D  GT+P++S+ESGQL+I+K +
Sbjct: 291 VDFKRRVRFSADDVSPPSRYTKPGEVDESFNRAHVPLHDFAGTMPELSSESGQLLIDKAR 350

Query: 367 HLATALLSLFYNVNGPNWYYPIFSQKAAGEGDKETFIAAANFYGLSFYQVKTRTGVEGYH 426
           H+ T LL L+YNV+G + +Y + +Q  +GEGDKETF  AA   G  +YQVKT+   +GYH
Sbjct: 351 HMDTLLLILYYNVHGKHLFYRLSTQGTSGEGDKETFAMAAQALGKPYYQVKTKLRFQGYH 410

Query: 427 DKEGFHGVAMLQHDFVQDYSRYLTASKSITNKYKDIKSSAAIKYDKNYSLEKYTKEFFDN 486
               + G A+LQHDFVQD+ ++L A + +  +  ++ +     Y+  Y+++    E F N
Sbjct: 411 TPSQYVGAALLQHDFVQDHEQWLRAREEVARRPSELAA-----YNPAYNVD----EHFYN 461

Query: 487 EDLKAKDHVDVMFIHSNLPKFDPYTL-SETNFLTTDDKPARSFTALHKVQNYDIELENFK 545
             ++ +  +DVMF+H++  K  P  L  E  ++  D K  RSF  L  + N+DIEL   +
Sbjct: 462 TLMRPEKPLDVMFVHASYHKLVPIDLFREKVYIGEDGKQFRSFPDLAAMDNFDIELFAIQ 521

Query: 546 VLKEYVCDK--KNPFKYLDDKLGEDKKEWRRMCDYIAKRLQFLESTHD 591
           +L E +C    K  FKY  DK+ +  +E+  MC Y+  R++ L  T D
Sbjct: 522 ILNEAICSATTKIEFKYNRDKI-KSPEEFEDMCTYVRDRMRMLLDTRD 568

>Suva_6.266 Chr6 complement(467727..469487) [1761 bp, 586 aa] {ON}
           YJL186W (REAL)
          Length = 586

 Score =  350 bits (898), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 199/516 (38%), Positives = 301/516 (58%), Gaps = 43/516 (8%)

Query: 107 EACQLSGDIGDRPDQYEELYKLSANELSKCLELSQDEVARLTKSHKDYVDHIA---SLAL 163
           E C+ + ++      +++   LS   LS+C +L++  +A L + H ++ D +    + ++
Sbjct: 82  EGCEFADNVAAHDTTHDD--NLSYESLSRCYKLNRTLLANLAEMHNEFTDILLGKLNYSI 139

Query: 164 PKGTY---KGSGIATVGGGKFSLMSFLIIKTLRNMGTTLPVEVLIPPGDEGESEFCNKIL 220
           P+      +  GI T+GGGK+S+++  +IK LR  GTTLP+EV+IPP DEG+ +FC   L
Sbjct: 140 PQREALFPESEGIVTIGGGKYSVLAHTMIKKLRETGTTLPIEVIIPPQDEGDDDFCKNWL 199

Query: 221 PNYNAKCIYVSDILPLETIEKFTFKGYQFKSLALVASSFENLLLLDADNFPIKPLDNIFN 280
           P  N KC+Y SDI+P + +       +Q K   L+ S+F+ ++ +DADN+P+  LD +FN
Sbjct: 200 PRQNGKCLYFSDIVPSKPLRDLELTHFQLKVFGLIISNFKRIIFIDADNYPVTNLDLVFN 259

Query: 281 EEPYLSTGLVMWPDFWRRTTHPLYYEIADITVNMKNRVRNSQDDLTPPAIY--------- 331
              +  TGL+MWPD WRR T P +Y I   T+N   RVR   DD++P + Y         
Sbjct: 260 TTSFQDTGLIMWPDLWRRVTPPAFYNIIGSTINTSKRVRFVSDDVSPVSRYDPFVSKSKE 319

Query: 332 --TKNSND--LGGVPLSDLDGTIPDVSTESGQLMINKTKHLATALLSLFYNVNGPNWYYP 387
             ++   D  L  VPL D+DG +PD+++ESGQ++I+K +H  T LL+L+YNV GP WYY 
Sbjct: 320 YTSEEMQDHFLRHVPLHDMDGAMPDLTSESGQMVIDKVRHFHTLLLALYYNVYGPTWYYK 379

Query: 388 IFSQKAAGEGDKETFIAAANFYGLSFYQVKTRTGVEGYHDKEG-FHGVAMLQHDFVQDYS 446
           + SQ  AGEGDKETFIAAA+     +YQVKT+   +G+  KEG + G+A+LQH+F QDY 
Sbjct: 380 MLSQGTAGEGDKETFIAAAHALNAPYYQVKTKFEFDGFFYKEGDYKGLALLQHNFEQDYK 439

Query: 447 RYLTASKSITNKYKDIKSSAAIKYDKNYSLE-KYTKEFFDNEDLKAKDHVDVMFIHSNLP 505
           +Y  A K +             + D +YSL+  + K    N+D      +D+MFIH++  
Sbjct: 440 QYQKAKKKVKANIDQFS-----QLDVDYSLDGGFLKSLMLNDD---GSDLDIMFIHASYY 491

Query: 506 KFDPYTL-SETNFLTTDDKPARSFTALHKVQNY--DIELENFKVLKEYVC----DKKNPF 558
           K DP+ L  E  F+  D +  R F    K Q Y  D EL  F  +KE  C    DK   F
Sbjct: 492 KADPWNLYHENRFIGPDGEQLRGF---RKPQRYAMDFELFLFDDMKESFCTPAKDKVIKF 548

Query: 559 KYLDDKLGEDKKEWRRMCDYIAKRLQFLESTHDKVI 594
           KY +DK+  +  +W +MC Y+A  + +L+STH +++
Sbjct: 549 KYFEDKI--NTPDWDKMCKYLADHVDYLQSTHKEIM 582

>Ecym_8128 Chr8 complement(266920..268698) [1779 bp, 592 aa] {ON}
           similar to Ashbya gossypii AEL148W
          Length = 592

 Score =  349 bits (896), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 214/539 (39%), Positives = 313/539 (58%), Gaps = 36/539 (6%)

Query: 82  KSFYNNVF----NFLMLDSPTGKSARKYNEACQLSGDIGDRPDQYEELYKLSANELSKCL 137
           +SFY ++F     F     P  K++ K ++ C L        D  +  Y LS     KC 
Sbjct: 65  ESFYKDLFLALEKFKPPKGPEDKNSLK-DKTCDLHDVSFGSTDPTDGEY-LSYAARRKCF 122

Query: 138 ELSQDEVARLTKSHKDYVDHI--------ASLALPKGTYKGSGIATVGGGKFSLMSFLII 189
             S+   A L KSH  ++ HI         S    +   K +GI TVGGGK+S+++  ++
Sbjct: 123 RPSEVSTAELKKSHLGFIKHINRHLTVDTKSALFNELFPKEAGIVTVGGGKYSILALTML 182

Query: 190 KTLRNMGTTLPVEVLIPPGDEGESEFCNKILPNYNAKCIYVSDILPLETIEKFTFKGYQF 249
           + LR  GT LPVEVLIP GD G+  FC  I   +NA+CI +   LP    +   FK Y+ 
Sbjct: 183 RALREHGTKLPVEVLIPEGDIGDIHFCRAIR-KWNAECILLPKALPNTVSKLHDFKSYET 241

Query: 250 KSLALVASSFENLLLLDADNFPIKPLDNIFNEEPYLSTGLVMWPDFWRRTTHPLYYEIAD 309
           K  AL+ SSF++++L+DADN PIKPLD++F  EPY  TGL++WPD WRR T P++YEIAD
Sbjct: 242 KLAALLLSSFKDVILIDADNIPIKPLDDVFESEPYKETGLILWPDIWRRQTAPVFYEIAD 301

Query: 310 ITVNMKNRVRNSQDDLTPPAIYTKNSN-------DLGGVPLSDLDGTIPDVSTESGQLMI 362
           I ++ +NR+RNS DDL+PP+ Y KN +       ++  VPL DL G IPD+S+ESGQL++
Sbjct: 302 IDIDFRNRIRNSYDDLSPPSRY-KNPDVPNDAKYNMAHVPLHDLAGAIPDLSSESGQLLV 360

Query: 363 NKTKHLATALLSLFYNVNGPNWYYPIFSQKAAGEGDKETFIAAANFYGLSFYQVKTRTGV 422
           NK KHL+T LL+L+YN  G  W+Y + S   +G+GDKETFI AA+     +YQVK     
Sbjct: 361 NKGKHLSTLLLALYYNYYGEQWFYQMSSLGTSGQGDKETFIFAAHALKKPYYQVKNPLLF 420

Query: 423 EGYHDKEG-FHGVAMLQHDFVQDYSRYLTASKSITNKYKDIKSSAAIKYDKNYSL-EKYT 480
           +GY   +G F GV +LQHDF QDY+ +  A + +T     + +     Y+ +Y++ + + 
Sbjct: 421 DGYFGDDGSFKGVGLLQHDFTQDYANWKKAKEYMTENIAHLGT-----YNSDYNVNQDFK 475

Query: 481 KEFFDNEDLKAKDHVDVMFIHSNLPKFDPYTL-SETNFLTTDDKPARSFTALHKVQNYDI 539
            E   ++D    D VD+MFIH++  K  P+ L  E  +L    K  RSF  L  +  +D+
Sbjct: 476 DEMLHHKDF---DGVDIMFIHASFHKLIPWDLYREKIYLDKSGKQFRSFKNLKNINYFDV 532

Query: 540 ELENFKVLKEYVC-DKKNPFKYLDDKLGEDKKEWRRMCDYIAKRLQFLESTHDKVIAGN 597
           EL  F+ L++Y+C D    F+Y   ++    + +  MC YI  R++ L  TH++ I+ N
Sbjct: 533 ELFAFEGLQKYICSDDAIKFEYHTLQVTS-TESFNAMCAYIDDRVKMLRETHEEAISSN 590

>TBLA0J01190 Chr10 complement(267291..269141) [1851 bp, 616 aa] {ON}
           Anc_1.150 YJL186W
          Length = 616

 Score =  346 bits (887), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 203/504 (40%), Positives = 293/504 (58%), Gaps = 35/504 (6%)

Query: 71  KGNDKVSNEKLKSFYNNVFNFLMLDSPTGKSAR------KYNEACQLSGDIGDRPDQYEE 124
           K N   +++ + SFY  +F  +  +SP            + N+ C L  DI       E+
Sbjct: 53  KSNSNRADDSIYSFYKFLFQHIK-ESPLNDYKNNPLILDQLNDQCLLQNDITFDATSKEQ 111

Query: 125 LYKLSANELSKCLELSQDEVARLTKSHKDYVDH-IASLALPKGTY------KGSGIATVG 177
           L  +S N L  C  L + +  +++KS  +Y++  +  L+  K +Y      KG GI TVG
Sbjct: 112 LSTVSYNNLKNCYSLQEHDFKKISKSQLEYINKCVTKLSKKKKSYTDILFPKGRGIVTVG 171

Query: 178 GGKFSLMSFLIIKTLRNMGTTLPVEVLIPPGDE---GESEFCNKILPNYNAKCIYVSDIL 234
           GGK+SL+++L+IK LR  GTTLPVEV+IPP D+    ++  CN +LP  NAKCIY +D L
Sbjct: 172 GGKYSLLAYLMIKLLREKGTTLPVEVVIPPSDKEMYDDTWLCNDVLPTLNAKCIYFTDRL 231

Query: 235 PLETIEKFTFKGYQFKSLALVASSFENLLLLDADNFPIKPLDNIFNEEPYLSTGLVMWPD 294
           P E ++     G+Q+KSLA+  SSF+  L LD+DNFP+K LDN+F+   +   GL+ WPD
Sbjct: 232 PAEILQDLDIHGFQYKSLAIWISSFKKTLFLDSDNFPLKDLDNVFDTPAFEEVGLIFWPD 291

Query: 295 FWRRTTHPLYYEIADITVNMKNRVRNSQDDLTPPAIYTKNSNDLG---GVPLSDLDGTIP 351
            WRRT  P +Y+I++I  ++K RVR  QDDL+   +Y K+++       +P  DLDGTI 
Sbjct: 292 LWRRTIPPDFYDISNIKYDLKKRVRYVQDDLSSVPLYDKDNSVKDYEYNIPFHDLDGTIS 351

Query: 352 DVSTESGQLMINKTKHLATALLSLFYNVNGPNWYYPIFSQKAAGEGDKETFIAAANFYGL 411
           D STE+GQ++++K  H  T LLS+F+N  G   YY +FSQ  AG GDK+TFIAAA+  G 
Sbjct: 352 DPSTETGQMLVDKETHFETLLLSIFFNYFGFAIYYDMFSQAGAGIGDKDTFIAAAHVLGQ 411

Query: 412 SFYQVKTRTGVEGY-HDKEGFHGVAMLQHDFVQDYSRYLTASKSITNKYKDIKSSAAIKY 470
            +YQVKT    +G+ H   GF G+A+LQHDF QDY  Y  A   I  K  D K      Y
Sbjct: 412 PYYQVKTPPEFDGFWHPTMGFQGLALLQHDFNQDYKNYQVA--RIEAKGDDAKYE---NY 466

Query: 471 DKNYSLEKYTKEFFDNEDLKAKDHVDVMFIHSNLPKFDPYTLSETNFLTTDDKPARSFTA 530
             +Y+L+K+ +     ED+   +++DVMF H +L K +P +L E       D+  +    
Sbjct: 467 ITDYNLKKHFE-----EDMMDINNIDVMFAHYSLHKAEPMSLLEGQLYF--DQNGKPLKG 519

Query: 531 LHKVQNYDIELEN--FKVLKEYVC 552
           L+K   Y + LE   F  L E++C
Sbjct: 520 LYKNDKYGMNLEYYIFNTLHEFLC 543

>KNAG0C00900 Chr3 (167471..169342) [1872 bp, 623 aa] {ON} Anc_1.150
           YJL186W
          Length = 623

 Score =  345 bits (886), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 206/536 (38%), Positives = 305/536 (56%), Gaps = 35/536 (6%)

Query: 70  LKGNDKVSNEKLKSFYNNVFNFLM----LDSPTGKSARKYNEACQLSGDIGDRPDQYEEL 125
           L+      NE+ + F+ N+F  L      D P   +A K    C+L   +     + E+L
Sbjct: 102 LESRTATPNER-RVFFRNIFTTLKNAKPRDPPEDFTAFKDEARCKLRDPMFASDGEREKL 160

Query: 126 YKLSANELSKCLELSQDEVARLTKSHKDYVDHIASLA---LPKGTYKGSGIATVGGGKFS 182
             +S + L  C+ +    +  LTK H  +V  I S++   + +   + SGI  VGGG++S
Sbjct: 161 EAVSYDSLDGCMHVPDQYLESLTKMHTKFVGTIKSISSSTVRQLYPEDSGIVAVGGGRYS 220

Query: 183 LMSFLIIKTLRNMGTTLPVEVLIPPGDE-GESEFCNKILPNYNAKCIYVSDILPLETIEK 241
           ++   ++  LR   T+LPVE+ IP  D  G++ FC    P YNAKCIY   I+    I+ 
Sbjct: 221 VLLATMLPKLRKNCTSLPVEIFIPDEDAAGDASFCQVFAPRYNAKCIYAKAIVGKIDIK- 279

Query: 242 FTFKGYQFKSLALVASSFENLLLLDADNFPIKPLDNIFNEEPYLSTGLVMWPDFWRRTTH 301
              + +Q+K +A++ SSF+N+L LDADN+ +K +D IF+ E Y  TGL++WPD W+R T 
Sbjct: 280 --LERFQYKPVAILLSSFKNVLFLDADNYVMKNIDKIFSAESYHDTGLIIWPDIWKRCTS 337

Query: 302 PLYYEIADITVNMKNRVRNSQDDLTPPAIYT---KNSNDL--GGVPLSDLDGTIPDVSTE 356
           P +Y+IA I  ++  RVR   D+++P + YT   +NS +     VP  DLDG +PD S+E
Sbjct: 338 PSFYKIAGINFDLTKRVRWGGDEISPVSRYTSAEQNSPEYLKTKVPFHDLDGPMPDSSSE 397

Query: 357 SGQLMINKTKHLATALLSLFYNVNGPNWYYPIFSQKAAGEGDKETFIAAANFYGLSFYQV 416
           SGQL+INK KH+ T LL+L+YNV G  WY+P+ SQ+  GEGDKE++I+AA       YQV
Sbjct: 398 SGQLLINKVKHMDTLLLALYYNVYGKQWYFPLASQRGPGEGDKESYISAAYALKKPVYQV 457

Query: 417 KTRTGVEGYHDKEGFHGVAMLQHDFVQDYSRYLTASKSITNKYKDIKSSAAIK---YDKN 473
           KT     GY   E F+GV +LQHDF QDY  Y         K +++ ++  I+   YD  
Sbjct: 458 KTPLEFSGYFTDE-FNGVGLLQHDFEQDYQLY--------KKAEELVAANQIRYGFYDPE 508

Query: 474 YSL-EKYTKEFFDNEDLKAKDHVDVMFIHSNLPKFDPYTLSETNFLTTDDKPARSFTALH 532
           Y+    + KEFF    +    H DVMFIH++  KFDP+ LS+    T   K  R F+   
Sbjct: 509 YTYSSSFLKEFF---HVGESAHSDVMFIHASFFKFDPWELSQNERFTYRGKQVRGFSLRD 565

Query: 533 KVQNYDIELENFKVLKEYVC-DKKNPFKYLDDKLGEDKKEWRRMCDYIAKRLQFLE 587
           ++   D ELE F+++KE  C DK   + YL+ K  + K++W + C YI K + FL+
Sbjct: 566 RINGEDFELEVFELMKEAFCIDKTVKYGYLEKKF-KSKEDWEKACSYIDKHIVFLK 620

>CAGL0M02871g Chr13 (324009..325811) [1803 bp, 600 aa] {ON} similar
           to uniprot|P46982 Saccharomyces cerevisiae YJL186w MNN5
           or uniprot|P38069 Saccharomyces cerevisiae YBR015c TTP1
          Length = 600

 Score =  340 bits (872), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 191/514 (37%), Positives = 295/514 (57%), Gaps = 47/514 (9%)

Query: 108 ACQLSGDIGDRPDQYEELYKLSANELSKCLELSQDEVARLTKSHKDYVDHI----ASLAL 163
           +C   GD+       ++ +  SA  L  CL L    +  L+++H  Y+  +       A+
Sbjct: 95  SCPKKGDVSS--GGIDQFHWTSAKNLKACLNLDDYAIKTLSEAHSRYMKTLFNDKGEFAI 152

Query: 164 PKGTYKG-----SGIATVGGGKFSLMSFLIIKTLRNMGTTLPVEVLIPPGDEGESEFCNK 218
            K  +K       GI T+GGG++++++ L+I+T+R  G+TLPVEV+ PP DEGE +FCN 
Sbjct: 153 SKSDFKKLYPNEKGIVTLGGGRYTILAMLMIETVRRHGSTLPVEVMFPPEDEGEFDFCNN 212

Query: 219 ILPNYNAKCIYVSDILPLETIEK---FTFKGYQFKSLALVASSFENLLLLDADNFPIKPL 275
            LP +N +C+ +S  +P E ++K     FK YQ KSLAL+ +SF+  + +DADN  +K +
Sbjct: 213 WLPKHNGRCVMMSQEVPFEILQKDKEVRFKSYQIKSLALLLTSFKQFVFIDADNNAMKNI 272

Query: 276 DNIFNEEPYLSTGLVMWPDFWRRTTHPLYYEIADITVNMKNRVRNSQDDLTPPAIYTKN- 334
           D+IF+ E + + GL++WPD W+R T+P +Y+IA +  ++  RVRN  DD +PP  Y  N 
Sbjct: 273 DHIFDTEAFKTHGLILWPDLWKRFTNPGFYDIAGVKYDLGKRVRNVNDDASPPETYDPNH 332

Query: 335 ----SNDLGG-----------VPLSDLDGTIPDVSTESGQLMINKTKHLATALLSLFYNV 379
               ++DL             V L+DLDGTI D +TESGQ+M++  KHL+T LL+L+YN+
Sbjct: 333 SIYTTHDLKQREEIAKHLYEDVSLADLDGTIADTTTESGQMMVDNKKHLSTLLLALYYNI 392

Query: 380 NGPNWYYPIFSQKAAGEGDKETFIAAANFYGLSFYQVKTRTGVEGYHD--KEGFHGVAML 437
            GP+ YY + S   AGEGDKETFI+AA+   L +YQVKT  G +GY +     F GV ++
Sbjct: 393 YGPDLYYYMMSMGTAGEGDKETFISAAHVLHLPYYQVKTNIGFDGYVNDVDNQFKGVGLM 452

Query: 438 QHDFVQDYSRYLTASKSITNKYKDIKSSAAIKYDKNYSLEKYTKEFFDNEDLKAKDHVDV 497
           Q DF QDY R+    K +  +    K    +K    Y L  + ++   N D  +   +D+
Sbjct: 453 QTDFEQDYQRHKQVLKELATE----KPLEPVK----YQLPNHFQDKMKNPDGTS---LDI 501

Query: 498 MFIHSNLPKFDPYTLSET-NFLTTDDKPARSFTALHKVQNYDIELENFKVLKEYVCDKKN 556
           MF+H++  KFDP  L+++  +   + +  R +  +   +N+D EL +FK L + +C   +
Sbjct: 502 MFLHASFHKFDPADLAKSKQYFKQNGEQVRGYNRIDAYKNFDFELFSFKKLYDNLCTSDH 561

Query: 557 -PFKYLDDKLGEDKKEWRRMCDYIAKRLQFLEST 589
             FK L  K  E  + W  MC Y  +R+ FL  T
Sbjct: 562 ISFKSL--KKHEGTEFWTSMCSYFKQRVDFLTKT 593

>KLLA0C16467g Chr3 (1442002..1443825) [1824 bp, 607 aa] {ON} similar
           to uniprot|P46982 Saccharomyces cerevisiae YJL186W MNN5
           Alpha-1 2-mannosyltransferase responsible for addition
           of the second alpha-1 2-linked mannose of the branches
           on the mannan backbone of oligosaccharides localizes to
           an early Golgi compartment
          Length = 607

 Score =  332 bits (852), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 188/505 (37%), Positives = 300/505 (59%), Gaps = 32/505 (6%)

Query: 109 CQLSGDIGDRPDQYEELYKLSANELSKCLELSQDEVARLTKSHKDYVDHIASL-----AL 163
           C + GD+G   +  +E  +LS + L+KCL+L +     L   H+ +V +++++      L
Sbjct: 99  CDM-GDVGFDSNGRDE--RLSYDNLAKCLQLPESNYNSLKNGHEKFVKYLSTVDTSASQL 155

Query: 164 PKGTYKGSGIATVGGGKFSLMSFLIIKTLRNMGTTLPVEVLIPPGDEGESEFCNKILPNY 223
            +      GI TVGG ++SL+S+L+I  +R  G+ LP+EV+IPP DE E+EFC  IL  +
Sbjct: 156 EQIYATKRGIVTVGGRRYSLLSYLMINMVRRSGSKLPIEVVIPPDDEPETEFCESIL-QF 214

Query: 224 NAKCIYVSDILPLETIEKFTFKGYQFKSLALVASSFENLLLLDADNFPIKPLDNIFNEEP 283
           NA+CIY  D LP   +   + K YQ K +AL+ SSF+  +L+D+DN P+K +D +F+   
Sbjct: 215 NARCIYFKDRLPTSLLANLSVKSYQVKGIALLLSSFQEFVLIDSDNMPLKNIDEVFDYNV 274

Query: 284 YLSTGLVMWPDFWRRTTHPLYYEIADITVNMKNRVRNSQDDLTPPAIYTKNSNDL----G 339
           +   G+V+WPD WRR T P +Y++A++ ++   RVRN+ D+L+P + Y K  N +     
Sbjct: 275 FRDHGMVIWPDIWRRMTSPQFYQLAEVPIDFTKRVRNAGDELSPVSRYDKLENTVSENKA 334

Query: 340 GVPLSDLDGTIPDVSTESGQLMINKTKHLATALLSLFYNVNGPNWYYPIFSQKAAGEGDK 399
            VP+ D  GT+PD +TESGQ+++NK  HL   LL+L+YN  GP +YY +FSQ  +G+GDK
Sbjct: 335 KVPMHDFLGTLPDPTTESGQMIVNKKTHLKMLLLALYYNQYGPEYYYQLFSQGTSGQGDK 394

Query: 400 ETFIAAANFYGLSFYQVKTRTGVEGYHD-KEG---FHGVAMLQHDFVQDYSRYLTASKSI 455
           ETF  AA+     FYQVK   G   Y D +EG   F G  +LQHD  QDY RY    K+ 
Sbjct: 395 ETFAMAAHILKEPFYQVKKTFGFAAYMDPREGKSEFQGAGLLQHDPEQDY-RYWNILKTE 453

Query: 456 TNKYKDIKSSAAIKYDKNYSLEKYTKEFFDNEDLKAKDH-VDVMFIHSNLPKFDPYTL-S 513
               ++   +    +D++Y ++   K F+D    K  D   + +F+H++  K+DP+ L +
Sbjct: 454 IEGQQEKYGT----FDEDYHIK---KTFYDKMLGKVGDQPREHLFLHASYHKYDPWNLYN 506

Query: 514 ETNFLTTDDKPARSFTALHKV-QNYDIELENFKVLKEYVCDKKNPFK--YLDDKLGEDKK 570
           E N + +D K  R++       + +D+EL  ++++ + VC  +NP K  Y+ DKL ED  
Sbjct: 507 EKNLMHSDGKQFRAYPCSSTAFKGFDVELFLWEIVNKIVC-SENPVKMAYI-DKLKEDTD 564

Query: 571 EWRRMCDYIAKRLQFLESTHDKVIA 595
           +++ +C +   R+  L  THD+ ++
Sbjct: 565 KFKAVCQFTKDRVNHLNETHDEYVS 589

>SAKL0H22616g Chr8 complement(1966196..1968421) [2226 bp, 741 aa]
           {ON} similar to uniprot|P38069 Saccharomyces cerevisiae
           YBR015C MNN2 Alpha-1 2-mannosyltransferase responsible
           for addition of the first alpha-1 2-linked mannose to
           form the branches on the mannan backbone of
           oligosaccharides localizes to an early Golgi compartment
          Length = 741

 Score =  332 bits (851), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 217/593 (36%), Positives = 320/593 (53%), Gaps = 99/593 (16%)

Query: 79  EKLKSFYNNVFNFLMLDSPTGKSARKYNEACQLSGDIGDRPDQYEELYKLSANELSKCLE 138
           + LK+FY ++   +   SP G   R     C++ GDIG      ++  KLS +ELSKC++
Sbjct: 159 QNLKAFYTSILKEIKDYSPEGTLDRTKGSDCKI-GDIG--ATNIKDFGKLSESELSKCIQ 215

Query: 139 LSQDEVARLTKSHKDYVDHIASLALP-----KGTYKGSGIATVGGGKFSLMSFLIIKTLR 193
           + +D    L   H  + + + +  LP     +  YKG GI  VGGGKFSL+    IK +R
Sbjct: 216 IPKDTSDMLKDLHTRFYETVKTKILPSFNSIEAPYKGEGIVIVGGGKFSLIGLPAIKAIR 275

Query: 194 -----NMGTTLPVEVLIPPGDEGESEFCNKILPNYN----AKCIYVSDILPLETIEKFTF 244
                 + +++PVE++IPP D+ + EFC  +LP  +     +C++ SDI   E ++    
Sbjct: 276 VNSGHRLQSSIPVEIMIPPSDDEDVEFCKNVLPKVDPTGLTRCVFFSDIFEEEILKDI-- 333

Query: 245 KGYQFKSLALVASSFENLLLLDADNFPIKPLDNIFNEEPYLSTGLVMWPDFWRRTTHPLY 304
           KGYQ K+LAL+ SSF  +L+LDADN+ +  ++N F+   +   GLV+WPDFWRR  HP +
Sbjct: 334 KGYQLKALALLVSSFRKVLMLDADNYVVNSIENFFDSPVFNEKGLVLWPDFWRRLHHPKF 393

Query: 305 YEIADITVNMKNRVRNSQDDLTPPAIYTKNSNDLGGVPLSDLDGTIPDVSTESGQLMINK 364
           YEI  I VN    +R S D++TPP +Y  N +D   +P  DL  +IPD+STESGQL+++K
Sbjct: 394 YEIIGIDVNRNESIRYSIDNVTPPEVYRDNDDD--SIPFHDLANSIPDISTESGQLLVDK 451

Query: 365 TKHLATALLSLFYNVNGPNWYYPIFSQKAAGEGDKETFIAAANFY----GLSFYQVKTRT 420
            KHL T LLS +YN NGP++YYP+  Q  AGEGDK+TFIAAA+        S++Q++T  
Sbjct: 452 QKHLDTLLLSCYYNYNGPSFYYPLLGQGYAGEGDKDTFIAAAHVTHPSESGSYHQIQTPV 511

Query: 421 GVEGYHDKE-------------------GFHGVAMLQHDFVQDYSRYLTASKSITNKYKD 461
            V+G+   E                    + GVAMLQ ++++D+ R   A  +I    KD
Sbjct: 512 RVQGHWCDEFEISIDDNPDDIIAEVKNKKYRGVAMLQSNYIEDHERLKEAQSAIP---KD 568

Query: 462 IKSSAAIKYDKNYSLEKYTKEFFDNED-------------------LKAKDHVDVMFIHS 502
           IK     + DK     +  K+ F+NED                   L+  D  +V FIHS
Sbjct: 569 IKK----RLDK---FRQEHKDEFNNEDDLYKKFYESLRGHYSLNDYLEYFDSTEVSFIHS 621

Query: 503 NLPKFDPYTLSETNFLTTDDKPARSF-------------------TALHKVQNYDIELEN 543
           +LPK+DP+ +S+      D K A+                     +A  KV NYD+EL N
Sbjct: 622 HLPKYDPWVISQDEDFKYDGKRAKKLRGDKDSPSSKLSGHYRIYNSAFPKVTNYDLELAN 681

Query: 544 FKVLKEYVC--DKKN--PFKYLDDKLGEDKK---EWRRMCDYIAKRLQFLEST 589
           + V +E++C  DK+N   FKYL  ++ +          MC YI +R++FL  T
Sbjct: 682 WAVFQEFLCSGDKENYKNFKYLKTQVSKADNPTVAVENMCKYIDERVEFLRKT 734

>TDEL0C03020 Chr3 (537820..539802) [1983 bp, 660 aa] {ON} 
          Length = 660

 Score =  322 bits (826), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 204/575 (35%), Positives = 303/575 (52%), Gaps = 73/575 (12%)

Query: 81  LKSFYNNVFNFLMLDSPTGKSARKYNEACQLSGDIGDRPDQYEELYKLSANELSKCLELS 140
           L+    +V N +   SP G+  R   + C L GD+     Q +E  K+S +EL KC++++
Sbjct: 85  LREALGSVMNQIRELSPQGELDRSKGDDCSL-GDLNVGVPQNDE--KVSKSELLKCIQIT 141

Query: 141 QDEVARLTKSHKDYVDHIASLALPK---GTYKGSGIATVGGGKFSLMSFLIIKTLR-NMG 196
            D    L   HK ++  +    +PK     Y+G GI  VGGG+F++     I+ +R N G
Sbjct: 142 PDAEDELKNLHKSFLSVLEKKIMPKYPISMYRGDGIVFVGGGRFTMFVMPAIQAIRANAG 201

Query: 197 TTLPVEVLIPPGDEGESEFCNKILPNYN----AKCIYVSDILPLETIEKFTFKGYQFKSL 252
             +P+E++IPPG+  ES FC  ILP  +     +C+++  +   +T++    KGYQ K+L
Sbjct: 202 RDIPIEIMIPPGNNHESGFCENILPLVDPSGLTRCVFMETLFDSKTMK--NVKGYQLKAL 259

Query: 253 ALVASSFENLLLLDADNFPIKPLDNIFNEEPYLSTGLVMWPDFWRRTTHPLYYEIADITV 312
           AL+ASSF   LLLDADN+ +  +D+ F+ E     G+ +WPD+W+R  HP  Y+I    V
Sbjct: 260 ALLASSFRKTLLLDADNYVVNSIDSFFDSEIIEDYGMALWPDYWKRLHHPAVYDIVGSHV 319

Query: 313 NMKNRVRNSQDDLTPPAIYTKNSNDLGGVPLSDLDGTIPDVSTESGQLMINKTKHLATAL 372
           +   R R   D ++P  +Y   S+D+  VP  DLDGTIPD  TESGQL+++K KHL T +
Sbjct: 320 DSSRRARFIMDTVSPSQLY--QSDDISKVPFHDLDGTIPDGGTESGQLLVDKYKHLDTII 377

Query: 373 LSLFYNVNGPNWYYPIFSQKAAGEGDKETFIAAA---NFYGLS--FYQVKTRTGVEGY-- 425
           LSL+YN NGP++YYP+  Q  AGEGDK+TF  AA   + +GL   FYQ++   G  GY  
Sbjct: 378 LSLYYNYNGPSYYYPLLGQGLAGEGDKDTFALAARALSAHGLQRYFYQLRAPVGALGYWA 437

Query: 426 ---------------HDKEGFHGVAMLQHDFVQDYSRYLTASKSITNK-YKDIK------ 463
                           D+  F GVAMLQHD   D+  Y  A   I +K  +D+K      
Sbjct: 438 HPKDNVPILDDEHVPEDQRSFRGVAMLQHDLDLDFKAYKKAYTEIKSKLVQDLKTFRKKA 497

Query: 464 -----SSAAIKYDKNYSLEKYTKEFFDNEDLKAKDHVDVMFIHSNLPKFDPYTLSETNFL 518
                S+     D+ +  E+    +  NE L     V V FIHS+ PK++P+  ++    
Sbjct: 498 TLSDASADLANVDELFWKERRKDGYDVNEFLSYFSDVPVTFIHSHFPKYNPWEFAQDQEF 557

Query: 519 TTDDKPARS-------FTALH------------KVQNYDIELENFKVLKEYVC--DKKNP 557
             D K   S       F   H            K+ NYD+EL N+   KE++C  D    
Sbjct: 558 IFDGKKVMSDHKDDPNFKPTHHGHFRMYDHTFQKLSNYDLELANWLSFKEHICREDGHTN 617

Query: 558 FKYLDDKLGEDKKEWRR---MCDYIAKRLQFLEST 589
           F YL +++ + +   +R   MC YI +R++ L+ST
Sbjct: 618 FSYLAEEIEKTEHGLQRYEEMCKYIDERVKMLKST 652

>ZYRO0F13244g Chr6 (1084412..1086406) [1995 bp, 664 aa] {ON} similar
           to uniprot|P38069 Saccharomyces cerevisiae YBR015C MNN2
           Alpha-1 2-mannosyltransferase responsible for addition
           of the first alpha-1 2-linked mannose to form the
           branches on the mannan backbone of oligosaccharides
           localizes to an early Golgi compartment
          Length = 664

 Score =  314 bits (805), Expect = 5e-98,   Method: Compositional matrix adjust.
 Identities = 207/571 (36%), Positives = 315/571 (55%), Gaps = 85/571 (14%)

Query: 96  SPTGKSARKYNEACQLSGDIGDRPDQYEELYKLSANELSKCLELSQDEVARLTKSHKDYV 155
           S T    R  N+ CQL GD+G   +  ++  K++  +L KC++  Q+   +L  SH  ++
Sbjct: 95  SSTAVVDRTKNKGCQL-GDVG--ANAVDKFSKVTKEQLLKCIDFPQETFEQLKDSHTTFL 151

Query: 156 DHIASLAL---PKGTYKGSGIATVGGGKFSLMSFLIIKTLRNMG-TTLPVEVLIPPGDEG 211
           D + +  L   P   Y G GI  VGGGK++L +   IK +R  G  T+P+E++IPP ++G
Sbjct: 152 DTLTNDILDEYPTDLYGGKGIVIVGGGKYTLYAMPAIKAVRTNGDPTIPIELMIPPENDG 211

Query: 212 ESEFCNKILPNYN----AKCIYVSDILPLETIEKFTFKGYQFKSLALVASSFENLLLLDA 267
           E  FC  +LP  +     +CIY++ +   +T++    KGYQ K+LAL+ASSFE +LLLDA
Sbjct: 212 EDAFCENVLPELDPSGLTRCIYMNQVFDEQTLKDV--KGYQLKALALLASSFEKVLLLDA 269

Query: 268 DNFPIKPLDNIFNEEPYLSTGLVMWPDFWRRTTHPLYYEIADITVNMKNRVRNSQDDLTP 327
           DN+ +  + +IF  + +   GL++WPD+WRR  HP  Y+I  I+VN   RVR S DD++P
Sbjct: 270 DNYVVNSIRDIFELDVFKEFGLILWPDYWRRLHHPRLYDIVGISVNENKRVRYSMDDVSP 329

Query: 328 PAIYTKNSNDLGGVPLSDLDGTIPDVSTESGQLMINKTKHLATALLSLFYNVNGPNWYYP 387
             +Y +   D   +P  D +G IPD  TESGQL+++K+KHL T +LSL+YN NGP+ YYP
Sbjct: 330 TELYEEK--DQSKIPFHDFEGAIPDGGTESGQLLVDKSKHLGTIILSLYYNYNGPSQYYP 387

Query: 388 IFSQKAAGEGDKETFIAAANFY---GL--SFYQVKTRTGVEGY---------------HD 427
           +  Q  AGEGDK+TF  AA      G+  +++QVKT  G  GY                 
Sbjct: 388 LLGQGFAGEGDKDTFALAATALTQRGIVSAYHQVKTPVGTSGYWANSKDETPFEKGLPDA 447

Query: 428 KEGFHGVAMLQHDFVQDYSRYLTASKSITNKY-KDIK-------SSAAIKYDKNYSLEKY 479
           +  + GVAMLQHD + D+  Y+ A   +++ Y +D K           ++ D + S EK 
Sbjct: 448 QRSYRGVAMLQHDLLGDFEAYMNAIHDLSDSYDEDFKIYYHRRLGQRPLEEDNSESREKV 507

Query: 480 T-------KEFFDNE----DLKA-----KDHVDVMFIHSNLPKFDPYTLSETNFLTTDDK 523
                   ++F+ +     DLK+     KD V V+F+HS+LPK++P+ LS+   L  D K
Sbjct: 508 ANWEKKIREDFWKSHKVDYDLKSFLQHFKD-VPVLFVHSHLPKYNPWLLSQFGDLKYDGK 566

Query: 524 -------------PARSF------TALHKVQNYDIELENFKVLKEYVC---DKKNPFKYL 561
                        P+R            +  NYD+EL NF  +++++C   D    F YL
Sbjct: 567 RVLEKHADDPNFKPSRHGHYRMYGDEFKEKINYDLELANFITMRDHICAVEDGYKNFSYL 626

Query: 562 DDKLGEDKK---EWRRMCDYIAKRLQFLEST 589
             ++ ++ K   ++R MCDYIA+R+  L  T
Sbjct: 627 SKEVNQEDKGFEKYRAMCDYIAERVDMLSDT 657

>TBLA0A00270 Chr1 complement(39183..42056) [2874 bp, 957 aa] {ON}
           Anc_3.188 YBR015C
          Length = 957

 Score =  308 bits (788), Expect = 6e-93,   Method: Compositional matrix adjust.
 Identities = 186/532 (34%), Positives = 289/532 (54%), Gaps = 25/532 (4%)

Query: 82  KSFYNNVFNFLMLDSPT-GKSARKYNEACQLSGDIGDRPDQYEELYKLSANELSKCLELS 140
           K    ++F  L++ S + G++  + +  C +   +  +  + +E   L+ N L++CL + 
Sbjct: 104 KPILKSIFQKLIISSSSSGQNNIQLSPNCPIKRPVASKSIREDEWEYLTFNNLNQCLIID 163

Query: 141 QDEVARLTKSHKDYVDHIASLA-LPKGTYKGSGIATVGGGKFSLMSFLIIKTLRNMGTTL 199
              +  L   H+++++ +  L  LP   Y G GI  +GGGK +L + ++ K +R+ G  +
Sbjct: 164 DTTLQNLKTDHQNFLESLNILQDLPINMYYGKGIVLIGGGKNTLFASIVAKFIRDQGNEI 223

Query: 200 PVEVLIPPG-----------DEGESEFCNKILPNYNAKCIYVSDILPLETIEKFTFKGYQ 248
           PVE+ IPP             + ES+FCNKI    N  CI++SDI+  E           
Sbjct: 224 PVEIFIPPTPQKDSLSNFDFKQSESDFCNKISKELNTNCIFISDIIDEEDFHLPELTEST 283

Query: 249 FKSLALVASSFENLLLLDADNFPIKPLDNIFNEEPYLSTGLVMWPDFWRRTTHPLYYEIA 308
              LAL+ SSF++ L+L   NFP+KPLD IF  +PY  TG + WP FWRR  HP  Y+I 
Sbjct: 284 TLLLALLTSSFDDTLVLSPKNFPLKPLDTIFQLKPYPETGFISWPGFWRRAIHPSTYDIM 343

Query: 309 DITVNMKNRVRNSQDDLTPPAIYT----KNSNDLGGVPLSDLDGTIPDVSTESGQLMINK 364
              +N   R+R   DD+TPP +YT    KN+     +PL DL+GT+PD  T   Q +I K
Sbjct: 344 GKQINFDKRIRMFLDDITPPKVYTSEEQKNATFKNSIPLHDLEGTLPDPVTSGSQFLIKK 403

Query: 365 TKHLATALLSLFYNVNGPNWYYPIFSQKAAGEGDKETFIAAANFYGLSFYQVKTRTGVEG 424
           +K++ T LL+L+Y+VNGP+WYY ++ QK +    K+    AA+     FYQVK    ++G
Sbjct: 404 SKNIDTILLALYYSVNGPSWYYILWYQKISPHSSKDELTIAAHILDKPFYQVKATPFLDG 463

Query: 425 -YHDKEGFHGVAMLQHDFVQDYSRYLTASKSITNKYKDIKSSAAIKYDKNYSLEKYTKEF 483
               KE     + L HDF QD++ Y  A  +I + Y D+K S  I++D +Y+ EK++  +
Sbjct: 464 IVKTKERPMFSSTLYHDFQQDFAFYTFAKMNIKSTY-DLKDSNDIQFDPSYTYEKFSNNY 522

Query: 484 FDN--EDLKAKDHVDVMFIHSNLPKFDPYTLSETNFLTTD--DKPARSFTALHKVQNYDI 539
            D   E ++  +H  +MF HSNL   DP  L     L  D   +P      +   +  +I
Sbjct: 523 MDVGWEAIRNGNH--LMFAHSNLFDGDPKLLKNRKLLIDDISKEPLLMTWNIAIFEKQNI 580

Query: 540 ELENFKVLKEYVCDKKNPFKYLDDKLGEDKKEWRRMCDYIAKRLQFLESTHD 591
           ELE+FK + EY+C+K   F YL+D+  ++      MC +I +RL FL+S+ D
Sbjct: 581 ELESFKTMHEYLCEKAYYFDYLEDEYVDETNALPGMCLFIKQRLDFLQSSAD 632

>KLLA0F24574g Chr6 complement(2285387..2287522) [2136 bp, 711 aa]
           {ON} similar to uniprot|P38069 Saccharomyces cerevisiae
           YBR015C MNN2 Alpha-1 2-mannosyltransferase responsible
           for addition of the first alpha-1 2-linked mannose to
           form the branches on the mannan backbone of
           oligosaccharides localizes to an early Golgi compartment
          Length = 711

 Score =  301 bits (770), Expect = 2e-92,   Method: Compositional matrix adjust.
 Identities = 208/596 (34%), Positives = 314/596 (52%), Gaps = 97/596 (16%)

Query: 81  LKSFYNNVFNFLMLDSPTGKSARKYNEACQLSGDIGDRPDQYEELYKLSANELSKCLELS 140
           LK FY  +   L   +  GK   K  E C+LS D G      E+L  L+ + L KCL +S
Sbjct: 115 LKDFYQEIMTTLKETALKGKLEVKKPEGCKLS-DTGVENTDSEKLSTLTKDNLLKCLPIS 173

Query: 141 QDEVARLTKSHKDYVDHIASLALPK---------GTYKGSGIATVGGGKFSLMSFLIIKT 191
            ++V  + ++H ++   +    +P            YKG GI+ VGGGK++LM+  +IK+
Sbjct: 174 DEDVKEVKEAHNNFKKLLQDKLMPNFKKLNTEKDPVYKGEGISIVGGGKYTLMALPVIKS 233

Query: 192 LR-NMGTTL----PVEVLIPPGDEGESEFCNKILPNYN----AKCIYVSDILPLETIEKF 242
           +R N G TL    P+E++IPP D  + + C  I+P  +     KC+Y+S+    E ++  
Sbjct: 234 IRMNSGLTLKSSVPIEIVIPPSDNADRKVCENIIPTIDPSGLTKCVYLSEFFDSEILKDI 293

Query: 243 TFKGYQFKSLALVASSFENLLLLDADNFPIKPLDNIFNEEPYLSTGLVMWPDFWRRTTHP 302
           T  GYQ KSL+L+ SSFE +LLLDADN+ I  L N F+ + +  TGL++WPD+WRR   P
Sbjct: 294 T--GYQLKSLSLLISSFEKVLLLDADNYVINSLGNFFDGDIFRETGLILWPDYWRRVHSP 351

Query: 303 LYYEIADITVNMKNRVRNSQDDLTPPAIYTKNSNDLGGVPLSDLDGTIPDVSTESGQLMI 362
             Y+I DI V  K   R S D +T   ++ ++  D   +P  DL+G IPD STESGQL++
Sbjct: 352 KLYDIVDIKVQDK-LARYSTDYITNSRLFPES--DPAKIPFHDLEGAIPDGSTESGQLLV 408

Query: 363 NKTKHLATALLSLFYNVNGPNWYYPIFSQKAAGEGDKETFIAAANFYGLSFYQVKTRTGV 422
           NK  HL   +LSL+YN NGP++YY +  Q  +GEGDK+TFI AA      +YQV+T    
Sbjct: 409 NKASHLDALILSLYYNYNGPSYYYRLLGQGISGEGDKDTFILAATVLKHRYYQVRTPVRP 468

Query: 423 EGYHDK-------------------EGFHGVAMLQHDFVQDYSRYLTASKSITNKYKDIK 463
           +GY  K                   + + G+AM+QHD+ +D +    A  +I     +  
Sbjct: 469 QGYWGKIENEVRIQDDLVDDTPSNEKKYRGIAMIQHDYNEDRTFDSIARDAIRGSVNNKL 528

Query: 464 SSAAIKYDKNY-----------SLEKYTK------EFFDNEDLK--AKDHVDV------M 498
            +  ++Y KN+           +LEK +K      +F+D+   K   KD   +      +
Sbjct: 529 KAHRLEYIKNHKSEFKDMNEKDALEKVSKMSEVSDKFWDSMKGKYTIKDFFTIFQFTTPV 588

Query: 499 FIHSNLPKFDPYTLSETNFLTTDDKPA------------------RSFTALHK-VQNYDI 539
           F+HSNLPK++P+ LS +  L  D K A                  R ++   K + NYD+
Sbjct: 589 FLHSNLPKYNPWELSISGDLLYDGKKATKKMDDPSKYVPNGKGHHRMYSPTFKDLTNYDL 648

Query: 540 ELENFKVLKEYVCDKKNP-----FKYLDDKLGEDKK---EWRRMCDYIAKRLQFLE 587
           EL N+K+  + +C  KNP     F YL + +G  +K   E + MC YI  R+++L+
Sbjct: 649 ELANWKLFDDVLC--KNPDDYLNFSYLSEVIGATEKPEQEVKNMCKYIKDRVEYLK 702

>SAKL0C08888g Chr3 (814687..816726) [2040 bp, 679 aa] {ON} weakly
           similar to uniprot|P38069 Saccharomyces cerevisiae
           YBR015C MNN2 Alpha-1 2-mannosyltransferase responsible
           for addition of the first alpha-1 2-linked mannose to
           form the branches on the mannan backbone of
           oligosaccharides localizes to an early Golgi compartment
          Length = 679

 Score =  278 bits (712), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 195/596 (32%), Positives = 302/596 (50%), Gaps = 90/596 (15%)

Query: 76  VSNEKLKSFYNNVFNFLMLDSPTGKSARKYNEACQLSGDIG-DRPDQYEELYKLSANELS 134
           V +++LK FY N+   +  +SPTG+   K  + C L G+IG     ++++L KL   ELS
Sbjct: 85  VISDELKKFYRNITQLVKQNSPTGELDAKKQKWCDL-GNIGLTETTKFDKLTKL---ELS 140

Query: 135 KCLELSQDEVARLTKSHKDYVDHIASLALP------KGTYKGSGIATVGGGKFSLMSFLI 188
           KC+ +  D V+ L   H  +   I    LP      K  Y+G GI  +GGG+ +L++   
Sbjct: 141 KCINVPADTVSHLKDLHLKFQKLIKDEILPAASRLSKPAYEGEGIVILGGGQKTLLALPA 200

Query: 189 IKTLRNMG-----TTLPVEVLIPPGDEGESEFCNKILPNYN----AKCIYVSDILPLETI 239
           I  +R  G      T PVE++IPP  + E+ FC  +LP  +     +C+ +SD+   E +
Sbjct: 201 INAIRTSGGVTIRNTTPVELVIPPRYKNETAFCQHLLPQLDPTGLTRCVLLSDLYDGEAL 260

Query: 240 EKFTFKGYQFKSLALVASSFENLLLLDADNFPIKPLDNIFNEEPYLSTGLVMWPDFWRRT 299
           E    +  Q K LAL+ SSF+  LLLD D++ +  LD  F+ E +   GLV+WPD WRR 
Sbjct: 261 EHL--EDQQLKPLALLVSSFQKALLLDCDSYVVNSLDGYFDGEIFRDKGLVLWPDAWRRL 318

Query: 300 THPLYYEIADITVNMKNRVRNSQDDLTPPAIYTKNSNDLGGVPLSDLDGTIPDVSTESGQ 359
            HP  YE+ +I V+  N+ RNS D +TP  ++ +  N L  VP  DL+ TIPD ST++GQ
Sbjct: 319 HHPALYEVLNIKVDENNQPRNSIDIVTPREVF-QVENKL-SVPYHDLEHTIPDGSTDTGQ 376

Query: 360 LMINKTKHLATALLSLFYNVNGPNWYYPIFSQKAAGEGDKETFIAAANFYGL---SFYQV 416
           L+I+K KHL T ++S++YN NGP++YY +  Q     GDK T+ AAA+       S+Y V
Sbjct: 377 LLIDKDKHLDTLIMSVYYNFNGPSYYYLLLEQGCNVNGDKNTYTAAAHAMHPNDGSYYHV 436

Query: 417 KTRTGVEGYH-DKEGF------------HGVAMLQHDFVQDYSRYLTASKSITNKYKD-- 461
           +T  G++G+  D++G               VA LQHD+ +DY  Y  + + I N +++  
Sbjct: 437 RTPIGMQGHWVDEDGARLADPNQKSQTRRVVAGLQHDYNEDYKYYKWSREVIGNNFREKL 496

Query: 462 ----IKSSAAIKYDKNYSLEKYTKEFFDNEDLKAK------------------DHVDVMF 499
                K   A K D +   +K  KE  +N++L AK                  D   V F
Sbjct: 497 AQFRKKWYQAHKSDFSEDEKKRQKELENNKELNAKFWSQFTGSYKLEDYLSFFDFTPVTF 556

Query: 500 IHSNLPKFDPYTLSETNFLT----------TDDKPARSFTALH---------KVQNYDIE 540
           +HS  P +DP+ LS+   L            DD+  +  ++ H            N+D+E
Sbjct: 557 VHSRQPSYDPWQLSQIGDLKFDGARITDQHADDEEYKPSSSGHYRMYGPEFTDQTNFDLE 616

Query: 541 LENFKVLKEYVC----DKKNPFKYLDDKLG---EDKKEWRRMCDYIAKRLQFLEST 589
           L ++ + +   C    +      YL +++    +  K  + MC Y+  R Q+L  T
Sbjct: 617 LSSWLLFQRLFCSSDREAYTQLAYLQEQISNTPDPDKSVQEMCKYVGARAQYLRDT 672

>KLTH0C08976g Chr3 (751731..753839) [2109 bp, 702 aa] {ON} weakly
           similar to uniprot|P38069 Saccharomyces cerevisiae
           YBR015C MNN2 Alpha-1 2-mannosyltransferase responsible
           for addition of the first alpha-1 2-linked mannose to
           form the branches on the mannan backbone of
           oligosaccharides localizes to an early Golgi compartment
          Length = 702

 Score =  269 bits (687), Expect = 2e-80,   Method: Compositional matrix adjust.
 Identities = 192/602 (31%), Positives = 303/602 (50%), Gaps = 92/602 (15%)

Query: 71  KGNDKVSNEKLKSFYNNVFNFLMLDSPTGKSARKYNEACQLSGDIGDRPDQYEELYKLSA 130
           K +D   +E  K  +  V + +  +SP G+        C L  DIG       +  +L+ 
Sbjct: 103 KPDDPQVSEATKKAFKEVLDAIQANSPEGQLQVSKGSECNLM-DIG--VTDTSKFDRLTK 159

Query: 131 NELSKCLELSQDEVARLTKSHKDYVDHIASLALP------KGTYKGSGIATVGGGKFSLM 184
             L KCL++ ++    L ++HK +   I    +P         + G GI  VGGGK+S+ 
Sbjct: 160 ESLEKCLQIPEEMTKTLHEAHKKFRAAIGEKLMPMFRKLDTPAFSGDGILIVGGGKYSVF 219

Query: 185 SFLIIKTLR-NMGTTLPVEVLIPPG----DEGESEFCNKILPNYN----AKCIYVSDILP 235
           +   IK +R N G  L   + I       D+ +  FC+ +LP  +     KC+++ ++  
Sbjct: 220 ALPAIKAIRENSGFKLKSSIPIEIIIPPSDKADRGFCDNVLPKVDPLGLTKCVFLDEMFD 279

Query: 236 LETIEKFTFKGYQFKSLALVASSFENLLLLDADNFPIKPLDNIFNEEPYLSTGLVMWPDF 295
            +T+     +GYQ K+LAL+ S FE +L+LDADN+ +  +++ F        GL++WPD+
Sbjct: 280 ADTLSHI--EGYQIKALALLVSRFERVLMLDADNYVVNSINDYFTSSALNDKGLILWPDY 337

Query: 296 WRRTTHPLYYEIADITVNMKNRVRNSQDDLTPPAIYTKNSNDLGGVPLSDLDGTIPDVST 355
           WRR  HP  Y I D+ V+  +  R S DD++P  +Y K+  D    P  D    +PD  T
Sbjct: 338 WRRLHHPKLYGIVDLGVSPDHISRYSVDDVSPDYMYKKSVTD---TPFHDFRDALPDGGT 394

Query: 356 ESGQLMINKTKHLATALLSLFYNVNGPNWYYPIFSQKAAGEGDKETF-IAAANFYGL-SF 413
           ESGQL+++K KHL + ++SL+YN NG ++YYPI  Q  AGEGDK+TF +A+   +G  SF
Sbjct: 395 ESGQLLVDKKKHLDSIIMSLYYNYNGKSYYYPILGQGFAGEGDKDTFALASRVMHGPGSF 454

Query: 414 YQVKT---------------RTGVEGYHDKE-GFHGVAMLQHDFVQDYSRYLTASK---- 453
           YQVKT               R   E Y + E  F G AMLQHD+++D S++ + ++    
Sbjct: 455 YQVKTPVDTLGHWADAKDEIRLLEEEYENVEKKFRGCAMLQHDYIED-SKFSSLAREVLG 513

Query: 454 -SITNKYKDIKSSAAIKYDKNYSLE--------KYTKEFFD--NEDLKAKDHVD------ 496
            +I N  +      A K    +S E        K +KE  D  +E ++A   +D      
Sbjct: 514 NTIRNNEEKFCDEWAAKNKGKFSAEEKARREECKKSKEVQDALHEKMRASYKLDDYLAFF 573

Query: 497 ----VMFIHSNLPKFDPYTLSETNFLTTDDK-------------PARSF------TALHK 533
               V F+HS+LPK+DP+   E   +  D K             PA S       +  ++
Sbjct: 574 SFTGVSFVHSHLPKYDPWEWYENGDMMFDGKKAKKNHKNDPDYVPAHSGNYRMYDSKFNQ 633

Query: 534 VQNYDIELENFKVLKEYVCDKKNPFK---YLDDKLGED---KKEWRRMCDYIAKRLQFLE 587
           + +YD+EL N+   K Y+CD +  +K   YL +K+      K+  + MC YI +R+++L+
Sbjct: 634 ISSYDLELANWSAFKSYLCDLEGGYKNFGYLSNKIDSTKSPKQSNKDMCKYIEERVEYLK 693

Query: 588 ST 589
           ST
Sbjct: 694 ST 695

>Kwal_56.22779 s56 complement(277096..279183) [2088 bp, 695 aa] {ON}
           YBR015C (MNN2) - putative Golgi
           alpha-1,2-mannosyltransferase [contig 184] FULL
          Length = 695

 Score =  255 bits (651), Expect = 2e-75,   Method: Compositional matrix adjust.
 Identities = 200/599 (33%), Positives = 309/599 (51%), Gaps = 96/599 (16%)

Query: 76  VSNEKLKSFYNNVFNFLMLDSPTGKSARKYNEACQLSGDIGDRPDQYEELYKLSANELSK 135
           +SNE  K+F N+    +   SP GK      + C++ GDI  R     + +KL+   L K
Sbjct: 99  ISNETRKAF-NDALELVKKYSPDGKLDTTKGDDCEI-GDI--RITDTSQFHKLTKESLEK 154

Query: 136 CLELSQDEVARLTKSHKDYVDHIASLALPK---------GTYKGSGIATVGGGKFSLMSF 186
           CL +  + V +L K H+D+   I    LP            +KG GI  VGGG+FS+ + 
Sbjct: 155 CLNVPDETVKKLNKLHEDFKGAIRKSILPSFDVLEAQGNPAFKGDGIVIVGGGRFSVFAL 214

Query: 187 LIIKTLR-NMGT----TLPVEVLIPPGDEGESEFCNKILPNYN----AKCIYVSDILPLE 237
             IK +R N G     T+P+E++IPP D+G+  FC  +LP  +     KC+++ +IL  E
Sbjct: 215 PAIKAIRENSGVKTKNTIPIEIIIPPHDKGDRGFCENVLPKVDPSGLTKCVFLDEILSPE 274

Query: 238 TIEKFTFKGYQFKSLALVASSFENLLLLDADNFPIKPLDNIFNEEPYLSTGLVMWPDFWR 297
           T+     +GYQ K++AL  S FE +L+LDADN+ +  LD  F  +     GL++WPD+WR
Sbjct: 275 TLSHI--EGYQIKAVALFVSQFERVLMLDADNYVVNSLDEYFTHQKLKEKGLILWPDYWR 332

Query: 298 RTTHPLYYEIADITVNMKNRVRNSQDDLTPPAIYTKNSNDLGGVPLSDLDGTIPDVSTES 357
           R  HP  Y+I ++ V+ K++ R S D+ TP  +Y K++ +    P  D    +PD STES
Sbjct: 333 RLHHPKTYDIVNLGVSTKSQ-RYSIDNATPDFVYKKDAKE---TPFHDFFDALPDGSTES 388

Query: 358 GQLMINKTKHLATALLSLFYNVNGPNWYYPIFSQKAAGEGDKETF-IAAANFYG-LSFYQ 415
           GQ++I+K KHL + L++L+YN NG +++YP+  Q  AGEGDK+TF +     +G  ++YQ
Sbjct: 389 GQVLIDKKKHLDSLLMTLYYNFNGKSYFYPLLGQGFAGEGDKDTFALGCRVMHGPEAYYQ 448

Query: 416 VKTRTGVEGYH-----------------DKEGFHGVAMLQHDFVQDYSRYLTASKSITNK 458
           VKT     G+                  D + F G AM+QHDF  D      A + I N 
Sbjct: 449 VKTPVDTLGHWADKDEIRIPDEDLEKSIDGKQFRGTAMIQHDFTDDVRFSSLAREVIGNA 508

Query: 459 YKDIKSSAAIKYDKNYS--LEKYTKE--------------FFDNE--DLKAKDHVD---- 496
            +D   S   ++ +++   L K  KE              F D E      KD++     
Sbjct: 509 IRDRFHSFCDEWARSHEGKLSKDQKERREQCDKSDEVKKAFNDKESPSYGLKDYLSFFHF 568

Query: 497 --VMFIHSNLPKFDPYTLSETNFLT-------TDDKPARSFTALH------------KVQ 535
             V FIHS+LPK+DP+  S T  +         + K    ++ +H            ++ 
Sbjct: 569 TKVSFIHSHLPKYDPWEWSHTGDMMFNGAKALKNHKDEPEYSPMHAGHYRMYDSKISQLT 628

Query: 536 NYDIELENFKVLKEYVCDKKNPFK---YLDDKLGEDK---KEWRRMCDYIAKRLQFLES 588
           +YD+EL N+   K+Y+CD K+ +K   YL   L E +   +    MC+YI +R+++L+S
Sbjct: 629 SYDLELANWSAFKDYLCDIKDGYKNFGYLVQVLEETEFPHQSNENMCNYIRERVEYLQS 687

>Ecym_3545 Chr3 complement(1030762..1032774) [2013 bp, 670 aa] {ON}
           similar to Ashbya gossypii AEL082W
          Length = 670

 Score =  244 bits (623), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 184/601 (30%), Positives = 291/601 (48%), Gaps = 97/601 (16%)

Query: 79  EKLKSFYNNVFNFLMLDSPTGKSARKYNEACQ---LSGDIGDRPDQYEELYKLSANELSK 135
           E  K F N V   +   +P  +     ++ CQ   +S D G    ++E L +L+  ELSK
Sbjct: 70  EHYKEFINQVVTAVQESAPVDELKLLQDDNCQHRRVSIDEG----KHEVLLQLTEAELSK 125

Query: 136 CLELSQDEVARLTKSH---KDYVDH--IASLA-LPKGTYKGSGIATVGGGKFSLMSFLII 189
           CL +S D  +++  SH   K+YV    + SLA L    YKG G+  + GG+ +L +   I
Sbjct: 126 CLHVSDDIKSKMMASHLQFKEYVQGTLMKSLANLESYPYKGDGVIIMAGGEHTLSAMASI 185

Query: 190 KTLRN-----MGTTLPVEVLIPPGDEGESEFCNKILPNYN----AKCIYVSDILPLETIE 240
           K +R      M  ++P++++IP   + +  FC K+LP  +    + C++  DI   + + 
Sbjct: 186 KAIRQNGGIIMRRSVPIQIVIPSKKQDDEVFCTKVLPMLDPTGLSTCLFFEDIFDSDVLN 245

Query: 241 KFTFKGYQFKSLALVASSFENLLLLDADNFPIKPLDNIFNEEPYLSTGLVMWPDFWRRTT 300
           K   +  Q+KSLAL+ SSF  +LLLD+D F +  +D  F+       G+++WPD+WRR  
Sbjct: 246 KI--ESSQYKSLALIVSSFRRVLLLDSDTFVVNSIDGYFHHSQLKENGMILWPDYWRRLH 303

Query: 301 HPLYYEIADITVNMKNRVRNSQDDLTPPAIYTKNSNDLGGVPLSDLDGTIPDVSTESGQL 360
           HP  Y+I  I V+   R+R S DD +P  +Y     D    P  D +  IPD ST SG L
Sbjct: 304 HPDLYKIVGINVHADTRLRFSVDDSSPKVLYESPKGD-SPFPFHDSENAIPDGSTASGPL 362

Query: 361 MINKTKHLATALLSLFYNVNGPNWYYPIFSQKAAGEGDKETF-IAAANFYGLS--FYQVK 417
           +I+K  HL T ++SL+Y+ NGP+ YYP+       E +K+TF +AA   Y  +  +YQVK
Sbjct: 363 LIDKQIHLDTIIMSLYYSFNGPSLYYPLLGCDQGSECEKDTFALAAHALYPDTPKYYQVK 422

Query: 418 TRTGVEGYHDK------------------EG--FHGVAMLQHDFVQDYSRYLTASKSITN 457
           T +  EG+ +                   EG  F  VAML +D+++D      A + I  
Sbjct: 423 TPSAHEGHWENITTGVRILDEELASTNSDEGKTFRKVAMLLYDYIEDTEFARLAREIIKE 482

Query: 458 KYKDIKSSAAIKYDKNYSLEKYTK-----EFFDNEDLKA---KDHVDVM----------- 498
               +  S     + +++  K  K     +   N++L+A   K H DV            
Sbjct: 483 NADTLLESFKNDGNAHHANRKTFKPRDINDLETNDELRADFWKKHNDVYHIQDFLLFFDF 542

Query: 499 ----FIHSNLPKFDPYTLSETNFLTTDD-------------KPARS------FTALHKVQ 535
               FI S  P ++P+ L  T  +  D              KPA S       + +  V 
Sbjct: 543 IPMKFIRSLSPSYNPWKLLTTGDMQFDAARALKGHENDPKYKPAHSGHYRMYSSGISTVT 602

Query: 536 NYDIELENFKVLKEYVCDKK----NPFKYLDDKLGEDKK---EWRRMCDYIAKRLQFLES 588
           NYD+EL N+ + + +VC+ K      + YL  ++   K    E+++MC YI  R+++L +
Sbjct: 603 NYDLELANWSLFENFVCNSKAFTYRDYGYLKQQIENTKDPALEYKKMCKYIRNRVKYLRN 662

Query: 589 T 589
           T
Sbjct: 663 T 663

>CAGL0L08096g Chr12 complement(886827..888521) [1695 bp, 564 aa]
           {ON} some similarities with uniprot|P46982 Saccharomyces
           cerevisiae YJL186w or uniprot|P38069 Saccharomyces
           cerevisiae YBR015c
          Length = 564

 Score =  228 bits (581), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 151/531 (28%), Positives = 247/531 (46%), Gaps = 38/531 (7%)

Query: 70  LKGNDKVSNEKLKSFYNNVFNFLMLDSPTGKSARKYNEACQLSGDIGDRPDQYEELYKLS 129
           ++G D    +     + ++  +  ++ P  K    + + C L   I       + L +LS
Sbjct: 46  VEGLDAAVEQFYLDLFRSINQYRPMNPPAKKQKLVFKDKCTLVAPISVEETSDDTLKQLS 105

Query: 130 ANELSKCLELSQDEVARLTKSHKDYVDHIASLALPKGTY-------KGSGIATVGGGKFS 182
              L  C  LS  +   L  +H  Y   + +L      Y       +  GI T+GG + +
Sbjct: 106 YMTLDYCFHLSPTQTNNLKTAHNGYCRRVETLFGSLDEYLRDSLMPRYKGIVTLGGNERT 165

Query: 183 LMSFLIIKTLRNMGTTLPVEVLIPPGDEGESEFCNKILPNYNAKCIYVSDILPLETIEKF 242
           L     I  LR MG+TLP+EV+ PP    E +FC+  LP YN KCIY+S  LP   ++  
Sbjct: 166 LSLLASIPRLRKMGSTLPIEVIFPPYVSNEDKFCDDFLPRYNGKCIYMSKALPEYVLKAH 225

Query: 243 TFKGYQFKSLALVASSFENLLLLDADNFPIKPLDNIFNEEPYLSTGLVMWPDFWRRTTHP 302
            F     +    + S+F+++L +++++F    +D  F+ + +  TGLV+WP   RR+T P
Sbjct: 226 KFDEKMIRMFTPLVSTFKSILYMESNDFANTNVDKAFDSKSFTDTGLVLWPGRSRRSTSP 285

Query: 303 LYYEIADITVNMKNRVRNSQDDLTPPAIYTKNS------NDLGGVPLSDLDGTIPDVSTE 356
            +Y+I +  +++ NR RN  DD++ P  YT  +      N L   P+ DLDG IPD  T 
Sbjct: 286 AFYQIVNRKIDLNNRTRNLADDVSRPTRYTSQALENIQFNLLAHTPMHDLDGAIPDAVTH 345

Query: 357 SGQLMINKTKHLATALLSLFYNVNGPNWYYPIFSQKAAGEGDKETFIAAANFYGLSFYQV 416
            G  MI+K KH  T +L+++Y V+G  W+  +F+ +    G +E  +AAA+   LS+YQV
Sbjct: 346 VGHYMIDKQKHFKTLMLAMYYAVHGEMWFDMMFAPEKGSSGYRENIVAAAHALELSYYQV 405

Query: 417 K--TRTGVEGYHDKEGFHGVAMLQHDFVQDYSRYLTASKSITNKYKDIKSSAAIKYDKNY 474
               R+   G  D     G   +  D   DY ++   +  + +K  D+ S     +D+ Y
Sbjct: 406 HLIPRSMRGGSKDTLQ-SGETFMHFDPDFDYRKHQALADKVKSKLIDVHS-----FDRKY 459

Query: 475 SLEKYTKEFFDNEDLKAKDHVDVMFIHSNLPKFDPYTLSETNFLTTDDKPARSFTALHKV 534
           +  +     F+ + L     V  +FI    P+FDP  L    F       A+S   L + 
Sbjct: 460 TAIRT----FEKDLLAGNQDVKSIFIEMPSPQFDPLAL----FFK-----AKSLQKLDRK 506

Query: 535 QNYD----IELENFKVLKEYVCDKKNPFKYLDDKLGEDKKEWRRMCDYIAK 581
              D    +E +N+  L E +C   +P           K + + MC Y+ K
Sbjct: 507 DKVDDLMALERQNYSNLMEVLCRDTDPLVLQMMVNHPSKYKMKDMCVYLKK 557

>AEL082W Chr5 (474072..476117) [2046 bp, 681 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YBR015C (MNN2)
          Length = 681

 Score =  201 bits (511), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 161/562 (28%), Positives = 257/562 (45%), Gaps = 118/562 (20%)

Query: 128 LSANELSKCLELSQDEVARLTKSH--------KDYVDHIASLALPKGTYKGSGIATVGGG 179
           L+A++L  C++LS D  A   + H        K   +H++ L      Y   GI  +GGG
Sbjct: 130 LTASKLQGCVDLSGDAFAHAKEQHALMMKVIQKSLPEHLSDL--DHYPYISDGIVILGGG 187

Query: 180 KFSLMSFLIIKTLR-NMGTT----LPVEVLIP-PGDEGESEFCNKILPNYN----AKCIY 229
             ++ +   I+++R N G T    +P+EV+IP P DE E  FC+KILP  +     +C++
Sbjct: 188 HKTIAAIPAIRSIRENSGITVRNSMPIEVVIPGPADE-EKVFCSKILPVLDPSGLTRCVH 246

Query: 230 VSDILPLETIEKFTFKGYQFKSLALVASSFENLLLLDADNFPIKPLDNIFNEEPYLSTGL 289
           + D +    + K   K    ++LAL+ASSF  +L LD+    I  +D  F+ E +   GL
Sbjct: 247 LGDTISSSLLSKV--KPSDHRTLALLASSFSRVLYLDSSVQVINAIDGYFHHELFNERGL 304

Query: 290 VMWPDFWRRTTHPLYYEIADITVNMKNRVRNSQDDLTPPAIYTKNSNDLGGVPLSDLDGT 349
           V+WPD+WRR  HP  YE+A   V+   R R S D  +P  +Y       G  P+ D   +
Sbjct: 305 VLWPDYWRRLHHPKLYELAGSKVDTGRRERYSIDKGSPIELYGGKD---GEWPMHDCKDS 361

Query: 350 IPDVSTESGQLMINKTKHLATALLSLFYNVNGPNWYYPIFSQKAAGEGDKETFIAAANFY 409
           IPD S+ SG L+I+K KH  T  L+L+YNV+G  ++YP+   KA  E +K+T + AA+  
Sbjct: 362 IPDASSSSGVLLIDKKKHFKTLALALYYNVHGEPFFYPLLDPKAPREAEKDTIVFAAHVL 421

Query: 410 ----GLSFYQVKTRTGVEGYHDKEGF--------------------HGVAMLQHDFVQDY 445
               G  ++QV T    EG+   +                      HG A   HDF  D+
Sbjct: 422 SRGGGPLYHQVTTPKRSEGHRKDKASSKPILEDTVDTSTIITSTYRHGAASY-HDFFADH 480

Query: 446 SRYLTASKSITNKY--------------------------KDIKSSAAIKYD------KN 473
           +  L A + I + +                          +D+ + A++K D       N
Sbjct: 481 NFELLAGEIINSNFDSRRLAYVKWWRQNHSDDTTYKDKSDEDLSNDASVKADFYTSFHGN 540

Query: 474 YSLEKYTKEFFDNEDLKAKDHVDVMFIHSNLPKFDPYTLSETNFLTTDD------KPARS 527
           Y+L +Y   F         +   V F+ +++   +P+ ++++  LT D       +PA  
Sbjct: 541 YTLAEYLNFF---------EFTPVSFVETDVLTCNPWIVAQSRDLTFDGASAVGAQPANQ 591

Query: 528 FTA---------------LHKVQNYDIELENFKVLKEYVCDK--KNPFKYLDDKLG---E 567
            T                  K+  YD+EL  +    E++C K     + YL + LG    
Sbjct: 592 QTQYKAGPPTHHRLFSDHFQKLTTYDLELATWSAYAEFLCSKFSYKDYPYLKEHLGLTDS 651

Query: 568 DKKEWRRMCDYIAKRLQFLEST 589
               ++ MC YI+ R+  L+ST
Sbjct: 652 PTTAYKMMCKYISARVSHLQST 673

>KNAG0G01070 Chr7 complement(232251..234149) [1899 bp, 632 aa] {ON} 
          Length = 632

 Score = 64.3 bits (155), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 79/321 (24%), Positives = 137/321 (42%), Gaps = 31/321 (9%)

Query: 170 GSGIATVGGGKFSLMSFLIIKTLRNMGTTLPVEVLIPPGDEGESEFCNKILPNYNAKC-- 227
           G G+    G     M   +++ L N+   +P++V +  G E + +F  + L  Y  +   
Sbjct: 234 GRGVVITMGDNDVDMFGRLVRVLENLENDIPIQV-VTTGKEMKPQFIQQ-LREYTVQTGQ 291

Query: 228 -IYVSDILPLETIEKFTFKGYQF--KSLALVASSFENLLLLDADNFPIKPLDNIFNEEPY 284
            I + D  P+       FK  +F  K +A + ++FE  +L+D D+ P  PL   F  E Y
Sbjct: 292 RIQLVDSSPMLDRLYVAFKITRFLNKWVATIFNTFEEAILIDVDSIPFVPLSTFFEIESY 351

Query: 285 LSTGLVMWPDFWRRTTHPLYYEIADITVNMKNRVRNSQDDLTPPAIYTKNSNDLGGVPLS 344
            +TG+ M+ D   +  H     IAD   N++  V+ +    T        SNDL     +
Sbjct: 352 KTTGIYMYRDRDIKHEHAPEKCIADFR-NLEPSVQETDLIGTSLRFDLSQSNDLQRQQQN 410

Query: 345 DLDGTIPDV------------STESGQLMINKTKHLATALLSLFYNVNGPNWYYPIFSQK 392
               TI +V              +SG ++INK K L + LL+   +++G      +F + 
Sbjct: 411 GESITIEEVIYKNFFHNYNLHQVDSGLVVINKHKQLHSLLLAFQLHLSG------VFEKC 464

Query: 393 AAGEGDKETFIAAANFYGLSFYQVKTRTGVEG-YHDKEGFHGVAMLQHDFVQDYSRYLTA 451
               GDKE F       G+ +      + V G +++  G  G+   Q   + D+ + +  
Sbjct: 465 V--HGDKEFFWLGPLLSGVDYTIDPLGSSVIGQFYEDNGKTGICAPQMSHLNDFDQLMWT 522

Query: 452 SKSITNKYKDIKSSAAIKYDK 472
           +  +  K    K +AA  +DK
Sbjct: 523 NGGL--KICKFKGAAANDFDK 541

>NCAS0F00780 Chr6 (156307..158226) [1920 bp, 639 aa] {ON} Anc_7.123
          Length = 639

 Score = 60.8 bits (146), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 71/285 (24%), Positives = 116/285 (40%), Gaps = 43/285 (15%)

Query: 165 KGTYKGSGIATVGGGKFSLMSFLIIKTLRNMGTTLPVEVLIPPGDEGESEFCNKIL---- 220
           K +  G GI    G +   M    ++ L ++G  LP++ L+  G E   EF   +     
Sbjct: 236 KQSSHGKGIVLTMGERDVDMFKKQLRVLDHLGNKLPIQ-LVTAGSEYSPEFLKDLTDFLK 294

Query: 221 -PNYNAKCIYVSDILPLETIEKFTFKGYQFKSLALVASSFENLLLLDADNFPIKPLDNIF 279
             N     +  S IL  E + K+    +  K +A++ ++FE L+L+DAD  P  PL + F
Sbjct: 295 TTNQEVYLVEASPILDPEFVSKYIVFFFH-KWIAILLNTFEELVLIDADVVPFVPLKSFF 353

Query: 280 NEEPYLSTGLVMWPDFWRRTTHPLYYEIADITVNMKNR----------VRNSQDDLTPP- 328
             E Y +TGL+++ D   +  H   Y +  +     +R          + +S  +L  P 
Sbjct: 354 KSEGYKTTGLLLFKDRNMKGEHTFTYCMESLKYMEPSRQETEYIQTNLLIDSTKELPSPT 413

Query: 329 -----AIYTKNSNDLGGVPLSDLDGTIPDVSTESGQLMINKTKHLATALLSLFYNVNGPN 383
                A+Y     DL    L  +D         SG + +NK + +   L+S   ++NG  
Sbjct: 414 SSEEAAVYNHFFKDLR---LHHVD---------SGLVTVNKNEKMNGLLMSFMLHLNG-- 459

Query: 384 WYYPIFSQKAAGEGDKETFIAAANFYGLSFYQVKTRTGVEGYHDK 428
                   +    GDKE F     F G  +       GV G  D+
Sbjct: 460 ------KIQRCVYGDKEFFWLGQLFAGQDYSIHPMDAGVAGGIDR 498

>NDAI0H01270 Chr8 (306136..308106) [1971 bp, 656 aa] {ON} Anc_7.123
          Length = 656

 Score = 59.7 bits (143), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 68/278 (24%), Positives = 118/278 (42%), Gaps = 46/278 (16%)

Query: 170 GSGIATVGGGKFSLMSFLIIKTLRNMGTTLPVEVLIPPGDEGESEFCNKILPNYNAK--- 226
           G GI        S M    +K L ++   LP+++ I  G+E  +EF N  L N+  K   
Sbjct: 270 GKGIVVTMSEGDSYMFKKQLKVLDHLNNELPIQI-ITKGNEFSTEFIND-LSNFVQKETK 327

Query: 227 ----CIYVSDILPLETIEKFTFKGYQFKSLALVASSFENLLLLDADNFPIKPLDNIFNEE 282
                + +S +L     +K+    Y  K LA++ ++F+ +++LDAD  P  P+++ F E+
Sbjct: 328 QKVAILNISSMLDPAFADKYIVNFYN-KWLAVIFNTFQEIIILDADVVPFVPINDFFEEK 386

Query: 283 PYLSTGLVMWPDFWRRTTHPLYYEIADIT-----------VNMKNRVRNSQDDLTPP--- 328
            + ++G++++ D      H   Y I  +            +N K  V ++ +   PP   
Sbjct: 387 KFKNSGMLLYKDRLMVNEHTFSYCIDSMKFLEPSSLELKYLNTKLLVDSNTEIAIPPSSE 446

Query: 329 --AIYTKNSNDLGGVPLSDLDGTIPDVSTESGQLMINKTKHLATALLSLFYNVNGPNWYY 386
             ++Y    N    + L  +D         SG ++INK + L   LLS   +++G     
Sbjct: 447 ELSVYY---NFFKNLRLHHID---------SGLVVINKQEKLNGLLLSFALHLDG----- 489

Query: 387 PIFSQKAAGEGDKETFIAAANFYGLSFYQVKTRTGVEG 424
                +    GDKE F     F G  +       GV G
Sbjct: 490 ---KLRRCVYGDKEFFWLGQLFIGQDYSIYSMDGGVSG 524

>Kwal_55.20984 s55 complement(634833..636692) [1860 bp, 619 aa] {ON}
           YIL014W (MNT3) - Product of gene unknown [contig 135]
           FULL
          Length = 619

 Score = 59.3 bits (142), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 83/351 (23%), Positives = 151/351 (43%), Gaps = 53/351 (15%)

Query: 169 KGSGIATVGGGKFSLMSFL-IIKTLRNMGTTLPVEVLIPPGDEGESEFCN--KILPNYNA 225
           KG G+     G+  L  FL ++K L     +LP++++  P +  ++   N  + L + + 
Sbjct: 221 KGKGLV-FSLGERHLDPFLRLLKILDQQNNSLPIQIVQQPHELSDAFLGNLTEFLQSSHQ 279

Query: 226 KCIYVSDILPLETIEKFTFKGYQFKSLALVASSFENLLLLDADNFPIKPLDNIFNEEPYL 285
           +  Y+     L+T  K     +  K LA + ++F  ++L+DAD  P  P+++ F EE Y 
Sbjct: 280 EVYYIDCEALLDTTYKAYMTYFVNKWLASIFNTFSEVVLMDADVVPFVPVESFFQEEQYK 339

Query: 286 STGLVMWPDF---------WRRTTHPLYYEIADITVNMKNRVRNSQDDLTPPAIYTKNSN 336
           +TG++++ D          +  TT  L    +   V M +R++ +   + P A    N  
Sbjct: 340 ATGVLLYKDRDMPQETTFDYCITTFKLLEPSSQEVVLMNHRMKTNSSVVDPGAHIFANEK 399

Query: 337 DLGGVPLSDLDGTIPDVSTESGQLMINKTKHLATALLSLFYNVNGPNWYYPIFSQKAAG- 395
           D         + T+ +V  +SG ++++KT+ L+  L+S   N++          QKA+  
Sbjct: 400 DKVYHRFF-YNETLHNV--DSGLVVLHKTERLSGLLISFIMNLD----------QKASNC 446

Query: 396 -EGDKETFIAAANFYGLSFYQVKTRTGVEGYHDKEGFHGVAMLQHDFVQDYSRYLTASKS 454
             GDKE F     F G + Y +    G           G   L HD V  + +Y   +  
Sbjct: 447 IYGDKELFWLGQLFSG-NDYAIDPLDGAAV--------GRVNLTHDKVSGHQKYEICATQ 497

Query: 455 ITNKYKD--------------IKSSAAIKYDKNYSLEKYTKEFFDNEDLKA 491
           + +   D              IK +A I +++    E + + F   E L+A
Sbjct: 498 MGHGSSDGRLLWTNGGLKACKIKGAAHIDFERK--PEHFEQHFGTEEKLQA 546

>CAGL0C04004g Chr3 complement(394614..396512) [1899 bp, 632 aa] {ON}
           similar to uniprot|P40549 Saccharomyces cerevisiae
           YIL014w MNT3 or uniprot|P53059 Saccharomyces cerevisiae
           YGL257c MNT2 or uniprot|P39106 Saccharomyces cerevisiae
           YER001w MNN1
          Length = 632

 Score = 55.1 bits (131), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 91/379 (24%), Positives = 159/379 (41%), Gaps = 60/379 (15%)

Query: 148 TKSHKDYVDHIASLALPKGTYKGSGIA-TVGGGKFSLMSFLIIKTLRNMGTTLPVEVLIP 206
           TKS +D+  +   +A  +    G GIA TV       M   + + L+ +G T P++V I 
Sbjct: 226 TKSPQDFNANF--MANWRQLANGKGIAITVNPDDVEFM-IRLFRVLKELGNTYPIQV-IQ 281

Query: 207 PGDEGESEFCNKILPNY--NAKCIYVSDILPL--ETIEKFTFKGYQFKSLALVASSFENL 262
            G E  S    +I        + + + D+ P+  E   +     +  K  A + ++FE +
Sbjct: 282 KGGELTSPLIEQIKKTAIETNQAVSIVDLSPILDEKFAREQITSFHNKFFAAMFNTFEEV 341

Query: 263 LLLDADNFPIKPLDNIFNEEPYLSTGLVMWPDFWRRT-THP------LYYEIA------- 308
           LLLDAD  P   LD  FN + Y  TGL  W D  R + TH       +Y E +       
Sbjct: 342 LLLDADVVPYVSLDEFFNLKGYKDTGLQFWRDRNRGSDTHKFCSNLGVYLEPSLEEHNLL 401

Query: 309 ------DITVNMKNRVRNSQDDLTPPAIYTKNSNDLGGVPLSDLDGTIPDVSTESGQLMI 362
                  I    K +VR+S++       + +  N+L    + ++D         SG +++
Sbjct: 402 GTELKFRINSLAKKKVRSSEE-----RAFHRFFNEL---KVHNID---------SGIIVL 444

Query: 363 NKTKHLATALLSLFYNVNGPNWYYPIFSQKAAGEGDKETFIAAANFYGLSFYQVKTRTGV 422
           NK + L + ++   +  NG       F + A   GDKE F+  A   G  F       G+
Sbjct: 445 NKKQKLHSLIMGEIFYTNGR------FGRCAY--GDKEMFMMGAFATGADFIIDPRDAGI 496

Query: 423 ---EGYHDKEGFHGVAMLQHDFVQDYSRYLTASKSIT-NKYKDIKSSAAIKYDKNYSLEK 478
               GY+  +  + +   Q   + + +R L ++  +   K+ D         +++Y ++K
Sbjct: 497 IGPIGYNIDQRVNFICSAQMGHLDENNRVLWSNGGLRFCKFPDFAKKDYTPKNQDYFIQK 556

Query: 479 YTKEFFDNEDLKAKDHVDV 497
           Y  + +DN     K  V++
Sbjct: 557 Y--QSYDNMARIYKTKVEI 573

>KLTH0G07986g Chr7 complement(646652..648361) [1710 bp, 569 aa] {ON}
           weakly similar to uniprot|P39106 Saccharomyces
           cerevisiae YER001W MNN1 Alpha-1 3-mannosyltransferase
           integral membrane glycoprotein of the Golgi complex
           required for addition of alpha1 3-mannose linkages to N-
           linked and O-linked oligosaccharides one of five S.
           cerevisiae proteins of the MNN1 family
          Length = 569

 Score = 54.7 bits (130), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 53/225 (23%), Positives = 96/225 (42%), Gaps = 19/225 (8%)

Query: 188 IIKTLRNMGTTLPVEVLIPP--GDEGESEFCNKILPNYNAKCIYVSDILPLETIEKFTFK 245
           ++K L + G  LP++++      D   S     + PN     + V  +L    I+ F+  
Sbjct: 201 LLKVLEHQGNRLPIQIIHKGDLSDYSRSLISRSLPPNQRLWFVNVKPMLDPHFIDDFSL- 259

Query: 246 GYQFKSLALVASSFENLLLLDADNFPIKPLDNIFNEEPYLSTGLVMWPDFWRRTTHPLYY 305
            Y+ K LA++ ++F   + +DAD   ++P+++    E Y+ +G + + D  R   H   Y
Sbjct: 260 -YRNKWLAMIFNTFSTPIFIDADAVSVQPVEDYLQSEAYVESGTIFFRD--RAFAHKFDY 316

Query: 306 E--IADITVNMKNRVRN---SQDDLTPPAIYTKNSNDLGGVPLSDLDGTIPDVSTESGQL 360
           E  +  +     +R+      Q  L    +   +S  L    +            +SG L
Sbjct: 317 EYCVPLLKALQPSRLETLYFGQRRLIDEQLMMSDSTSLEQRIVQSFFVGGQRHQMDSGLL 376

Query: 361 MINKTKHLATALLSLFYNVNGPNWYYPIFSQKAAGEGDKETFIAA 405
            ++K+KHL   +  +F N+       P  S+     GDKETF  A
Sbjct: 377 AVDKSKHLMPLMAGVFLNLA------PKLSK--CTHGDKETFWLA 413

>KNAG0D05360 Chr4 (981032..982633) [1602 bp, 533 aa] {ON} 
          Length = 533

 Score = 54.3 bits (129), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 68/278 (24%), Positives = 109/278 (39%), Gaps = 46/278 (16%)

Query: 169 KGSGIATV-GGGKFSLMSFLIIKTLRNMGTTLPVEVLIPPGDEGESEFCNKILPNYNAKC 227
           +G GI T     KFS   F  +K L+     LP+++++      ++EF +  +    A  
Sbjct: 158 QGRGIVTTFSAKKFSDFFFRQLKVLQYHNNELPIQIIV-----QDNEFSDDFIAEIAAAG 212

Query: 228 IYVSDILPLETIEKFT-------FKGYQFKSLALVASSFENLLLLDADNFPIKPLDNIFN 280
                 L L  I K           G+  K LA + ++FE  +LLDAD  P       F+
Sbjct: 213 ERTKQSLYLVKISKLLDPANQKYLSGWINKLLANLFNTFEEFILLDADVVPYAAPHTYFS 272

Query: 281 EEPYLSTGLVMWPDFWRRTTHPLYYEIADITVNMKNRVRNSQDDLTPPAIYTKNSNDLGG 340
            + Y STGL M+ D        L  E   I  +  N +  S+ ++     Y + ++ +  
Sbjct: 273 TKEYTSTGLYMFQD------RALLSETETICTDTLNSLEPSKQEVELLGSYLQFTHTM-- 324

Query: 341 VPLSDLDGTIPDVST-------------ESGQLMINKTKHLATALLSLFYNVNGPNWYYP 387
               DL G   + ST             E+G +  NK   +   + SL  N+N       
Sbjct: 325 ----DLQGKTQEESTYTALFKKKLPHNVETGLVTANKKSKMFGLVTSLMLNLNT------ 374

Query: 388 IFSQKAAGEGDKETFIAAANFYGLSFYQVKTRTGVEGY 425
               +A   GDKE +     F G+S+    T   + G+
Sbjct: 375 --KLRACFWGDKEFYWLGPLFAGVSYTIEPTPAALTGF 410

>KNAG0D03070 Chr4 (552018..553970) [1953 bp, 650 aa] {ON} 
          Length = 650

 Score = 54.3 bits (129), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 74/285 (25%), Positives = 120/285 (42%), Gaps = 28/285 (9%)

Query: 170 GSGIATVGGGKFSLMSFL-IIKTLRNMGTTLPVEVLIPPGDEGESEFCNKIL---PNYNA 225
           G GI T    K     FL  +K L+    TLP+++L+  GD  +S F  K+       N 
Sbjct: 273 GKGIITTFNPKAHGDYFLRQLKILQYQKNTLPIQILVRDGDFSDS-FVRKLADAARRTNQ 331

Query: 226 KCIYVSDILPLETIEKFTFKGYQFKSLALVASSFENLLLLDADNFPIKPLDNIFNEEPYL 285
           K   V+    L+      FK Y  K  A + ++FE  +LLDAD  P  PL++      Y 
Sbjct: 332 KIYLVNYTAILDKSNMGEFKSYINKLAANLFNTFEEFILLDADAVPYFPLESYLELPDYQ 391

Query: 286 STGLVMWPDFWRRTTHPLYYEIADITVNMKNRVRNSQDD---LTPPAIYTKNSNDLGGVP 342
            TG+ M+ D        L + I D        +  S ++   L    +YT +SN +   P
Sbjct: 392 KTGMYMFRD------RILDHRIDDACTTTLEHLEPSMEEAVLLGTSIMYTVSSNVVPTTP 445

Query: 343 LSDL-DGTIPD---VSTESGQLMINKTKHLATALLSLFYNVNGPNWYYPIFSQKAAGEGD 398
              +  G + +    + E+G ++++K   L   L++L  N++            A   G+
Sbjct: 446 EEKVYVGMVREHIRENVETGLVVVDKKNKLPGLLMALALNLSK--------KLNACMYGE 497

Query: 399 KETFIAAANFYGLSFYQVKTRTGVEGYHDK--EGFHGVAMLQHDF 441
           KE +     F G+S+        + G+ +K  +GF  V     DF
Sbjct: 498 KEFYWLGPYFSGMSYSIEAKGAALTGFPEKMYDGFQYVNTKLCDF 542

>CAGL0C04048g Chr3 complement(399734..401596) [1863 bp, 620 aa] {ON}
           similar to uniprot|P40549 Saccharomyces cerevisiae
           YIL014w MNT3 or uniprot|P53059 Saccharomyces cerevisiae
           YGL257c MNT2 or uniprot|P39106 Saccharomyces cerevisiae
           YER001w MNN1
          Length = 620

 Score = 53.9 bits (128), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 86/348 (24%), Positives = 144/348 (41%), Gaps = 53/348 (15%)

Query: 169 KGSGIA-TVGGGKFSLMSFLIIKTLRNMGTTLPVEVLIPPGDEGESEFCNKILPNYNAKC 227
           +G GI  TV      L+     +  + +G  LP++V +  G E  +E   KI   Y  + 
Sbjct: 231 RGKGIVLTVSQSDVPLLR-QQFRVWKELGNKLPIQV-VHKGTEINAELEQKI-KEYAIEM 287

Query: 228 ---IYVSDILPL-------ETIEKFTFKGYQFKSLALVASSFENLLLLDADNFPIKPLDN 277
              +YV D+ P+        +I+ F  K Y     A + ++FE L+L+DAD  P  P ++
Sbjct: 288 EQDVYVVDLSPVIDPDFAENSIQNFHNKWY-----AAIFNTFEELILIDADAIPYVPAED 342

Query: 278 IFNEEPYLSTGLVMWPDFWRRTTH--PLYY--EIA---DITVNMKNRVRNSQD-DLTPPA 329
               + Y  TGL +W D  R  TH   L++  E+A   + T+   N +  +    LT   
Sbjct: 343 FLKSKSYKKTGLRLWRD--RDITHERTLHFCVEMAPYFEPTLEEHNLIGTTLSYRLTDSG 400

Query: 330 IYTKNSNDLGGVPLSDLDGTIPDVSTESGQLMINKTKHLATALLSLFYNVNGPNWYYPIF 389
           +  K++ D  G  L +    +     +SG ++I+K   + + ++S             + 
Sbjct: 401 L--KDAKDSEGRALYEFFQKMYLHHVDSGLVVIDKKDKIHSLIMSEI-----------LH 447

Query: 390 SQKAAGE---GDKETFIAAANFYGLSF---YQVKTRTGVEGYHDKEGFHGVAMLQHDFVQ 443
           S    G    GDKE F+  A   G S+    Q     G  GY  +   H +   Q     
Sbjct: 448 SHTRFGRCTYGDKELFMLGAYMVGESYTLEAQSAAIIGTVGYEKEFSRHYICATQMGHSD 507

Query: 444 DYSRYLTASKSITNKYKDIKSSAAIKYDKNYSLEKYTKEFFDNEDLKA 491
           + +R L ++  +     D         D N   E Y K + + ++LKA
Sbjct: 508 EDNRLLWSNGGLRTCKFDCAEE-----DFNKDEEYYKKRYQNVDNLKA 550

>CAGL0C03938g Chr3 complement(386673..388586) [1914 bp, 637 aa] {ON}
           weakly similar to uniprot|P40549 Saccharomyces
           cerevisiae YIL014w MNT3 or uniprot|P53059 Saccharomyces
           cerevisiae YGL257c MNT2 or uniprot|P39106 Saccharomyces
           cerevisiae YER001w MNN1
          Length = 637

 Score = 53.1 bits (126), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 72/280 (25%), Positives = 115/280 (41%), Gaps = 34/280 (12%)

Query: 165 KGTYKGSGIA-TVGGGKFSLMSFLIIKTLRNMGTTLPVEVLIPPGD-EGESEFCNKILPN 222
           K   +G GI  TV      L+  L  K L  +G   PVEV+   G+   + E   +    
Sbjct: 242 KAEARGRGITLTVAPDDIKLLRSLF-KVLEKLGNEYPVEVVHKGGEMTPKMEDLIRQYAE 300

Query: 223 YNAKCIYVSDILPL--ETIEKFTFKGYQFKSLALVASSFENLLLLDADNFPIKPLDNIFN 280
              + +YV ++ P+          K ++ K  A + ++FE  +LLD D       +  F 
Sbjct: 301 ETNQEVYVINLSPILDPDFASQNIKSFKNKWFAAMFNTFEEAILLDVDVVLYASPEYFFE 360

Query: 281 EEPYLSTGLVMWPDFWRRTTHPLYYEIADITVNMKNRVRNSQDD-----------LTPPA 329
            + Y  TGL++W D  R  T     E +D   +M      S+++           LT P 
Sbjct: 361 LDGYKKTGLMLWKD--REYTE---VETSDRCASMAPYFEPSEEEHELLGTIQKYRLTGPD 415

Query: 330 IYTKNSNDLGGVPLSDLDGTIPDVSTESGQLMINKTKHLATALLSLFYNVNGPNWYYPIF 389
           + T N ++     L+D          +SG ++INK + L   LL+ +Y+++    Y+   
Sbjct: 416 LETHNESE--ATTLNDFFNNKLATIIDSGVVLINKKQKLNALLLAAYYHMSK---YF--- 467

Query: 390 SQKAAGEGDKETFIAAANFYGLSFYQVKTRTGV---EGYH 426
                  GDKE F  AA   G  +Y    + G     GYH
Sbjct: 468 --GGCTYGDKELFEIAALAAGEDYYVDPNKAGAIGPIGYH 505

>TDEL0B00160 Chr2 (29809..31497) [1689 bp, 562 aa] {ON} 
          Length = 562

 Score = 52.0 bits (123), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 71/261 (27%), Positives = 118/261 (45%), Gaps = 39/261 (14%)

Query: 163 LPKGTYKGSGIATVGGGKFSLMSFLIIKTLRNMGTTLPVEVLIPPGDEGESEFCNKIL-- 220
           L K + KG  + +VG G+ S  + LI K LR     LP+E+ I  GD  E +   ++L  
Sbjct: 171 LSKSSSKGI-VISVGAGQISDATKLI-KVLRYQMNALPIEI-IHRGDLSEDQ--QQLLIQ 225

Query: 221 -------PNYNAKCIY---VSDILPLETIEKFTFKGYQFKSLALVASSFENLLLLDADNF 270
                   +Y A+ ++   VS++L     E+F    Y  K LA++ SSFE+ +L+DAD  
Sbjct: 226 AARSAHSASYPAQELWFVNVSNVLNPRHAEQFA--TYSNKWLAIIFSSFESPILVDADTI 283

Query: 271 PIKPLDNIFNEEPYLSTGLVMWPDFWRRTTHPLYYEIADITVNMKNRVRNSQDDLTPPAI 330
           P   L+  ++ + Y   GL+ + D  R  T  L   +    +N   ++  S   L   A 
Sbjct: 284 PFISLEKYYDFQQYKEMGLLFFKD--RAITSDL---LNKEQLNTLKQIALSTIKLGSAAA 338

Query: 331 YTKNSNDLG---GVPLSDLDGTIPDVS---TESGQLMINKTKHLATALLSLFYNVNGPNW 384
              N+ +LG    +    +   + +      ESG ++++K+ HL   L S+    +  + 
Sbjct: 339 DLNNAIELGIKDNIAAETVMSMLVEGQKHHMESGLVLLDKSLHLVNLLTSVSLQFSSISS 398

Query: 385 YYPIFSQKAAGEGDKETFIAA 405
           Y+          GDKE F  A
Sbjct: 399 YF---------HGDKEWFWIA 410

>CAGL0C03916g Chr3 complement(383989..385875) [1887 bp, 628 aa] {ON}
           weakly similar to uniprot|P40549 Saccharomyces
           cerevisiae YIL014w MNT3 or uniprot|P53059 Saccharomyces
           cerevisiae YGL257c MNT2 or uniprot|P39106 Saccharomyces
           cerevisiae YER001w MNN1
          Length = 628

 Score = 51.2 bits (121), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 67/284 (23%), Positives = 122/284 (42%), Gaps = 34/284 (11%)

Query: 161 LALPKGTYKGSGIATVGGGKFSLMSFLIIKTLRNMGTTLPVEVLIPPGDEGESEFCNKIL 220
           +A  K   KG GIA     K   +   + K    +G T P++++   G+   S     ++
Sbjct: 229 MAYWKQESKGRGIALTAAPKDVKLLRSLFKVFEKLGNTYPIQIVQKGGEM--SPTMESLI 286

Query: 221 PNYNAKC---IYVSDILPLETIEKFT--FKGYQFKSLALVASSFENLLLLDADNFPIKPL 275
            +Y  +    +++ D+ P+   +  T   + +Q K  A + ++FE ++L+DAD       
Sbjct: 287 KDYAIETNQNVFIVDLSPVLDPDFATDHIRKFQNKWFASIFNTFEEVMLIDADVVIYTEP 346

Query: 276 DNIFNEEPYLSTGLVMWPD--------FWRRTTHPLYYEIADITVNMKNRVRNSQDDLTP 327
           ++ FN + Y +TGL++W D          R T    Y+E A     +   V+  +  LT 
Sbjct: 347 ESFFNLDGYKNTGLLLWRDREIVDAKTHERCTDMAPYFEPALEEHRLLGTVQKYR--LTG 404

Query: 328 PAIYTKNSNDLGGVPLSDLDGTIPDVSTESGQLMINKTKHLATALLSLFYNVNGPNWYYP 387
           P++ T +  +     L D          +SG ++ NK + L   +L+ +++         
Sbjct: 405 PSLETHDEPE--AETLFDFFHRRIVTIIDSGVVIYNKKQKLHGLILAEYFHN-------- 454

Query: 388 IFSQKAAG--EGDKETFIAAANFYGLSFY---QVKTRTGVEGYH 426
             S++ AG   GDKE F   A   G  ++   +     G  GYH
Sbjct: 455 --SKQFAGCVYGDKEYFEFGALVAGEDYHVEAEKAVAIGAVGYH 496

>AEL345W Chr5 (1961..3898) [1938 bp, 645 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YIL014W (MNT3)
          Length = 645

 Score = 50.8 bits (120), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 61/266 (22%), Positives = 111/266 (41%), Gaps = 44/266 (16%)

Query: 169 KGSGIATVGGGKFSLMSFLIIKTLRNMGTTLPVEVL----IPPGDEGESEFCNKILPNYN 224
           KG GI    G +   M   ++  L ++G TLP+E++    +PP    +     ++  N  
Sbjct: 243 KGRGITITAGAEHVEMLPRLLNVLDHIGNTLPIELINAADLPPTTIDKIAKYVQMKSNQT 302

Query: 225 AKCIYVSDILPLETIEKFTFKGYQFKSLALVASSFENLLLLDADNFPIKPLDNIFNEEPY 284
            + +     L  E   +    G++ K LA + ++FE  + +D D  P   L+ +F  E Y
Sbjct: 303 VRLVDCGKTL--EHSYRSLITGFRHKWLAYIFNTFEEAVFIDLDAVPFVDLEKLFEVEGY 360

Query: 285 LSTGLVMW---------PDFWRRTTH-----PLYYEIADITVNMKNRVRNSQDDLTPPAI 330
            S G++M+         PD   +        P  + +     N   +V  ++D+L     
Sbjct: 361 KSEGILMFRDRSYDGEKPDDCPKAMRIMMPSPKEHTMWQHGSNYDKQV--AEDEL----- 413

Query: 331 YTKNSNDLGGVP--LSDLDGTIPDVSTESGQLMINKTKHLATALLSLFYNVNGPNWYYPI 388
            TK   D G     +  ++G    ++ ESG ++++K K L + L+SL  ++         
Sbjct: 414 -TKKPRDAGAATFYIKYMEGKSFHMA-ESGLIVMHKNKKLPSLLISLMLHMT-------- 463

Query: 389 FSQKAAGEGDKE-----TFIAAANFY 409
           F       GDKE       ++  N+Y
Sbjct: 464 FETHLCSHGDKEYLWLGQLVSGENYY 489

>KNAG0G01060 Chr7 complement(228987..231071) [2085 bp, 694 aa] {ON}
           Anc_7.123 YIL014W
          Length = 694

 Score = 50.8 bits (120), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 66/281 (23%), Positives = 113/281 (40%), Gaps = 35/281 (12%)

Query: 169 KGSGIATVGGGKFSLMSFLIIKTLRNMGTTLPVEVLIPPGDEGESEFCNKI--LPNYNAK 226
           +G GI        S M +  + T + +G  LP++V +  G E  ++F   +  L     +
Sbjct: 285 EGKGIVLTMRESDSGMFYKQLNTFKELGNKLPIQV-VTTGKEATNKFVETLGKLAKKTEQ 343

Query: 227 CIYVSDILPLETIEKFTFKGYQF--KSLALVASSFENLLLLDADNFPIKPLDNIFNEEPY 284
            IY+ D+  L   +    K   F  K +A + ++FE  + +D D     P+ + F  E Y
Sbjct: 344 KIYLVDVSKLLKPDFVQDKIINFLNKWIATIFNTFEEEVFIDVDAISYVPMQDYFQTENY 403

Query: 285 LSTGLVMWPDFWRRT--THPLYYEIADITVNM---KNRVRNSQDDLTPPAIYTKNSNDLG 339
             TG++M+ D   RT      +    D+ +     K  VR         +++ K ++D  
Sbjct: 404 KDTGILMFRD---RTLLQENTFKRCTDLLIEAEPTKEEVRLIGSRQMFDSLWLKKNDD-- 458

Query: 340 GVPLSDLDGTIPDV-----------STESGQLMINKTKHLATALLSLFYNVNGPNWYYPI 388
            VP  +L  T  +V             +SG + I+K   L   L+S F+N++        
Sbjct: 459 -VPDKELMSTEAEVYRNFYERLKLHHVDSGLIAIHKKYKLTGVLMSFFFNLDA------- 510

Query: 389 FSQKAAGEGDKETFIAAANFYGLSFYQVKTRTGVEGYHDKE 429
               +   GDKE F       G  F   +   G+ G   +E
Sbjct: 511 -RLSSCVYGDKELFWLGQLVAGERFAINQMEGGILGAVSEE 550

>Suva_5.322 Chr5 (525925..527586) [1662 bp, 553 aa] {ON} YGL257C
           (REAL)
          Length = 553

 Score = 50.1 bits (118), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 62/242 (25%), Positives = 106/242 (43%), Gaps = 29/242 (11%)

Query: 188 IIKTLRNMGTTLPVEVLIPPGDEGESEFC-------NKILPNYNAKCIY---VSDILPLE 237
           ++K LR++    P+E+ +  GD  +           N+    Y A+ I+   V  +L   
Sbjct: 187 LLKVLRSIKNNFPIEI-VHKGDLSKDSIGSLVKYARNQDALEYPAQEIWFLNVHSVLSPG 245

Query: 238 TIEKFTFKGYQFKSLALVASSFENLLLLDADNFPIKPLDNIFNEEPYLSTGLVMWPDFWR 297
             EKF  + Y  K LAL+ SSFE  +LLD+D  P   +D ++  E +  TG++ + D   
Sbjct: 246 YSEKF--EAYSNKWLALIFSSFEIPILLDSDTVPFVSIDKLYKLEEFQRTGVLFFKD--- 300

Query: 298 RTTHPLYYEIADITVNMKNRVRNSQD-DLTPPAIYTKNSNDLGGVPLSDLDGTIPDVSTE 356
           R      +E++ + V +K  +      +LT  +      + +    L ++         E
Sbjct: 301 RIISDDLFELSQVDV-LKEVIYGCVGLNLTDESNINHIKDPMVAQALENMLVKKYKHHLE 359

Query: 357 SGQLMINKTKHLATALLSLFYNVNGPNWYYPIFSQKAAGEGDKETFIAAANFYG--LSFY 414
           SG ++++K +HL + L SL    +    Y+          GDKE F   A   G   +FY
Sbjct: 360 SGLVILDKKRHLFSVLTSLALQFSPIAEYF---------HGDKEWFWLGALLSGNPFTFY 410

Query: 415 QV 416
            V
Sbjct: 411 PV 412

>Kwal_23.2926 s23 complement(78806..80512) [1707 bp, 568 aa] {ON}
           YGL257C (MNT2) - Mannosyltransferase [contig 247] FULL
          Length = 568

 Score = 50.1 bits (118), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 60/230 (26%), Positives = 96/230 (41%), Gaps = 28/230 (12%)

Query: 188 IIKTLRNMGTTLPVEVLIPPGDEGESE---FCNKILPNYNAKCIYVSDILPLETIEKFTF 244
           ++K L +    LP++V I  GD  E+        + P+ N   + VS +L    +  F+ 
Sbjct: 198 LLKVLHHQKNELPIQV-IHKGDLSEASKNLISEALSPSQNLWFVDVSSMLNKRFVRDFS- 255

Query: 245 KGYQFKSLALVASSFENLLLLDADNFPIKPLDNIFNEEPYLSTGLVMWPDFWRRTTHPLY 304
            GY+ K LA++ ++F   + +DAD   +   ++ F    Y  TG + + D  R   H   
Sbjct: 256 -GYKNKWLAMILNTFSEAVFIDADAVSMMSFEDYFEMGLYNQTGALFFKD--RAFDHKFD 312

Query: 305 YEIADITVNM-------KNRVRNSQDDLTPPAIYTKNSNDLG--GVPLSDLDGTIPDVST 355
           Y   D  V M       K+  R  Q       +  +N+ D       + D          
Sbjct: 313 Y---DFCVPMIKSLQPGKHETRYFQHRKRLIDLQLRNTQDPSTEQTIIKDFFEGYQRHQM 369

Query: 356 ESGQLMINKTKHLATALLSLFYNVNGPNWYYPIFSQKAAGEGDKETFIAA 405
           +SG ++I K KHL   L ++F N+       P  S+     GDKETF  A
Sbjct: 370 DSGLVLIEKGKHLTPLLAAVFLNLA------PKLSK--CTHGDKETFWLA 411

>Kpol_298.4 s298 (12426..14321) [1896 bp, 631 aa] {ON}
           (12426..14321) [1896 nt, 632 aa]
          Length = 631

 Score = 49.3 bits (116), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 59/267 (22%), Positives = 110/267 (41%), Gaps = 26/267 (9%)

Query: 170 GSGIATVGGGKFSLMSFLIIKTLRNMGTTLPVEVLIPPGDEGESEFCNKILPNYN--AKC 227
           G GI    G +   M F +++ L       P+++ +  G+E   EF N+I        + 
Sbjct: 239 GKGIVITMGERDKPMLFKLLRVLEFQDNKYPIQI-VTSGNELSREFINEIHDELQRIKQD 297

Query: 228 IYVSDILPL--ETIEKFTFKGYQFKSLALVASSFENLLLLDADNFPIKPLDNIFNEEPYL 285
           +Y+ D   L      K     +  K LA++ ++FE ++ LD D  P   +D  F+ E Y 
Sbjct: 298 VYLVDCGSLLDPHYSKDLIINFLNKWLAVIFNTFEEVIFLDVDVIPFVDMDYFFDNEEYK 357

Query: 286 STGLVMWPDFWRRTTHPLYYEIADITVNMKNRVRNSQDD---LTPPAIYTKNS-----ND 337
           S+ L+++ D  R   H   Y      ++M + V  S+++   L    ++   +     N 
Sbjct: 358 SSNLLLYKD--RVMLHESTYPHC---IDMFHEVEPSREESAVLGTKILFDSRTKEFDHNS 412

Query: 338 LGGVPLSDLDGTIPDVSTESGQLMINKTKHLATALLSLFYNVNGPNWYYPIFSQKAAGEG 397
              +   +    +     +SG +++NK + L   L S   +++           +    G
Sbjct: 413 QVAMTFRNFFRKLQLHHVDSGLIVVNKMEKLNGLLFSFMLHLDA--------KVRRCVYG 464

Query: 398 DKETFIAAANFYGLSFYQVKTRTGVEG 424
           DKE F     F G ++   K  +G+ G
Sbjct: 465 DKELFWIGQLFAGQTYSIDKIDSGLIG 491

>CAGL0C03960g Chr3 complement(389250..391121) [1872 bp, 623 aa] {ON}
           similar to uniprot|P40549 Saccharomyces cerevisiae
           YIL014w MNT3 or uniprot|P53059 Saccharomyces cerevisiae
           YGL257c MNT2 or uniprot|P39106 Saccharomyces cerevisiae
           YER001w MNN1
          Length = 623

 Score = 48.1 bits (113), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 86/341 (25%), Positives = 138/341 (40%), Gaps = 51/341 (14%)

Query: 165 KGTYKGSGIA-TVGGGKFSLMSFLIIKTLRNMGTTLPVEVLIPPGD-EGESEFCNKILPN 222
           K   +G GI  TV      L+  L  K L  +G   PVEV+   G+   + E   +    
Sbjct: 229 KAEARGRGITLTVAPDDIKLLRSLF-KVLEKLGNEYPVEVVHKGGEMTPKMEDLIRQYAE 287

Query: 223 YNAKCIYVSDILPL-------ETIEKFTFKGYQFKSLALVASSFENLLLLDADNFPIKPL 275
              + +YV ++ P+       E I++F+ K      LA + ++FE ++LLDAD       
Sbjct: 288 ETNQEVYVINLSPILDPDFAEENIKRFSNKW-----LAAMFNTFEEVMLLDADVVLYNHP 342

Query: 276 DNIFNEEPYLSTGLVMWPDFWRRTTHPLYYEIADITVNMKNRVRNSQDD----------- 324
           D+ F  + Y  TGL++W D  R  T     ++ D    M      S ++           
Sbjct: 343 DHFFELKGYQDTGLMLWKD--REITDT---DVYDKCTAMAPFFEPSLEEHKLLGTTQKYR 397

Query: 325 LTPPAIYTKNSNDLGGVPLSDLDGTIPDVSTESGQLMINKTKHLATALLSLFYNVNGPNW 384
           LT P++   N ++     L D          +SG ++ NK + L   +LS +Y++N    
Sbjct: 398 LTGPSLEAHNESE--ATTLIDYFRKKRLNVIDSGVVIFNKKQKLHALVLSNYYHIN---- 451

Query: 385 YYPIFSQKAAG--EGDKETF----IAAANFYGLSFYQVKTRTGVEGYHDKEGFHGVAMLQ 438
                 +K  G   GDKE F    +AA   Y ++  Q     G  G+H     + V   Q
Sbjct: 452 ------RKFLGCVHGDKEFFEFGVLAAGEDYHIA-PQRAAALGPIGFHPGRQKYYVCSTQ 504

Query: 439 HDFVQDYSRYLTASKSITNKYKDIKSSAAIKYDKNYSLEKY 479
                + +  L ++  + N   D K+ A  K    Y   KY
Sbjct: 505 MGHPDENNNILWSNGGLKNCKLD-KAEADFKRHPEYFKAKY 544

>KNAG0J02990 Chr10 (576491..578425) [1935 bp, 644 aa] {ON} 
          Length = 644

 Score = 47.4 bits (111), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 61/269 (22%), Positives = 109/269 (40%), Gaps = 23/269 (8%)

Query: 170 GSGIATVGGGKFSLMSFLIIKTLRNMGTTLPVEVLIPPGDEGESEFCNKILPNYNAK--- 226
           G GI T     FS   F  +K L+     LP+++++  G E   EF +K+          
Sbjct: 271 GKGIVTTFSEPFSDFFFRQLKVLQYQENKLPIQIVVKNG-EFTKEFLSKLSERGRQTGQR 329

Query: 227 --CIYVSDILPLETIEKFTFKGYQFKSLALVASSFENLLLLDADNFPIKPLDNIFNEEPY 284
              +  S+IL  + +     + Y  K +A + ++FE  +LLDAD  P  P+++      Y
Sbjct: 330 LFLVEYSEILEEKNVN--LIRKYFNKLIANIFNTFEEFVLLDADAVPYSPIESFMELPEY 387

Query: 285 LSTGLVMWPDFWRRTTHPLYYEIADITVNMKNRVRNSQDDLTPPAIYTKN-SNDLGGVPL 343
            +TG+ M+ D   R       +   +T+          + L    ++T       G V  
Sbjct: 388 KNTGIYMFRD---RVVDNELDDTCLVTLEHLEPTIEEVELLGSTLLFTSEMQKTTGSVEE 444

Query: 344 SDLDGTIPDV---STESGQLMINKTKHLATALLSLFYNVNGPNWYYPIFSQKAAGEGDKE 400
           S     + D    + E+G +++NK +  A  +++L  + N           +A   GDKE
Sbjct: 445 SIYRKMMEDRMKENVETGLVVVNKKEKFAGLVMTLMLSFN--------HKLQACFHGDKE 496

Query: 401 TFIAAANFYGLSFYQVKTRTGVEGYHDKE 429
            +     F G S+        + G+  K+
Sbjct: 497 FYWLGPLFAGQSYSIEPKGAALTGFPQKK 525

>ABR245C Chr2 complement(854587..856512) [1926 bp, 641 aa] {ON}
           Non-syntenic homolog of Saccharomyces cerevisiae YIL014W
           (MNT3)
          Length = 641

 Score = 47.0 bits (110), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 59/228 (25%), Positives = 98/228 (42%), Gaps = 24/228 (10%)

Query: 170 GSGIA-TVGGGKFSLMSFLIIKTLRNMGTTLPVEVLIPPGDEGESEFCNKILPNYNAKCI 228
           G GI  +VG G   ++   ++  L  +G  LP+E+ +  G E   +F +K+      K  
Sbjct: 244 GKGITMSVGDGHLEML-LRMLTVLDYLGNELPIEI-VEKGGELSQQFRDKLTEFVRNKSK 301

Query: 229 YVSDILPL-----ETIEKFTFKGYQFKSLALVASSFENLLLLDADNFPIKPLDNIFNEEP 283
               I+       ET  +  F G+  K +AL+ ++FE  + LD D  P    +  F+ E 
Sbjct: 302 QKVRIISCARTLDETHARLIF-GFSCKWVALMFNTFEEAIFLDVDAVPYILPEQFFDMEG 360

Query: 284 YLSTGLVMWPDFWRRTTHPLYYEIADITVNM-----KNRVRNSQDDLTPPAIYTK---NS 335
           Y STG++++ D  R     +  E  D    M     +  + N +   + PA   +   N+
Sbjct: 361 YKSTGIMLFRD--RLIDQHVSKECPDAVRQMIPTQEETSIWNHKAKFSGPAANKEAYDNT 418

Query: 336 NDLGGVPLSD---LDGTIPDVSTESGQLMINKTKHLATALLSLFYNVN 380
            D G   + D    D     V  ESG ++ NK   L + + S   N+N
Sbjct: 419 KDEGAAAVYDRFFRDHYYHVV--ESGVVVFNKKNKLQSIVNSFMLNLN 464

>AFL235W Chr6 (2..1147) [1146 bp, 381 aa] {ON} Non-syntenic homolog
           of Saccharomyces cerevisiae YIL014W (MNT3) and YER001W
           (MNN1)
          Length = 381

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 49/216 (22%), Positives = 97/216 (44%), Gaps = 37/216 (17%)

Query: 188 IIKTLRNMGTTLPVEVLIPPGDEGESEFCNKILPNYNAKCIYVSDILPLETIEKFTFK-- 245
           ++  L + G TLP+E+++   +    E   KI      K      I+  + I + +++  
Sbjct: 1   LLAVLDHHGNTLPIELVL--TESPSHERIQKIAHYLRDKTKQSLRIVDCKKILEPSYRPL 58

Query: 246 --GYQFKSLALVASSFENLLLLDADNFPIKPLDNIFNEEPYLSTGLVMWPDF-------- 295
              +++K LA + +S E ++ +D D  P   +D  F  E Y STG++M+ D         
Sbjct: 59  IFDFRYKWLAYLLNSSEEVVFIDLDVVPFVSIDKFFEMEGYKSTGILMFQDRVFNSIKNS 118

Query: 296 -WRRTTHPLYYEIADITV----------NMKNRVRNSQDDLTPPAIYTKNSNDLGGVPLS 344
             R   H +    A+ T+            K+R++N  DD    ++Y +           
Sbjct: 119 KCRTAIHHILPSHAEQTLWKHQAKYTKEKAKHRLKNFPDDAGAASVYDRY---------- 168

Query: 345 DLDGTIPDVSTESGQLMINKTKHLATALLSLFYNVN 380
            L+G    +  ESG ++++K K +++ ++SL  ++N
Sbjct: 169 -LEGDRMHM-VESGLVVVDKRKKISSLIISLMLHMN 202

>TDEL0H03260 Chr8 complement(542810..544735) [1926 bp, 641 aa] {ON}
           Anc_7.123 YIL014W
          Length = 641

 Score = 47.0 bits (110), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 39/143 (27%), Positives = 70/143 (48%), Gaps = 7/143 (4%)

Query: 170 GSGIA-TVGGGKFSLMSFLIIKTLRNMGTTLPVEVLIPPGDEGESEFCNKILPNYNA--K 226
           GSGI  T+  G  +L+ +  +K   +   TLP+++ I  G++    F  ++     A  +
Sbjct: 251 GSGIVITLNEGSKNLL-YKQLKVFDHSDNTLPIQI-ITTGNDFSDGFIEELKAKVAASKQ 308

Query: 227 CIYVSDILPLETIE--KFTFKGYQFKSLALVASSFENLLLLDADNFPIKPLDNIFNEEPY 284
            +Y+ D  P+   E  K        K +A++ ++FE  +LLD D  P  P+D+   E+ Y
Sbjct: 309 NVYLVDCSPILDSEFAKEHIGDIINKWIAVIFTTFEESILLDVDAVPFVPMDDFLTEKSY 368

Query: 285 LSTGLVMWPDFWRRTTHPLYYEI 307
            ++G++M+ D      H   Y I
Sbjct: 369 KASGILMYKDRSMPNEHTFQYCI 391

>CAGL0H09262g Chr8 complement(908258..910135) [1878 bp, 625 aa] {ON}
           similar to uniprot|P40549 Saccharomyces cerevisiae
           YIL014w MNT3
          Length = 625

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 71/276 (25%), Positives = 109/276 (39%), Gaps = 47/276 (17%)

Query: 161 LALPKGTYKGSGI---ATVGGGKFSLMSFLIIKTLRNMGTTLPVEVLIPPGDEGESEFCN 217
           +A  K   KG GI   A+V   +F    F + K L   G T P++V +  G E   E   
Sbjct: 226 IAHWKNEAKGRGIVVTASVNDCRFLRSQFFVWKEL---GNTYPIQV-VTKGKEMPPELIA 281

Query: 218 KILPNYNAKC---IYVSD---ILPLETIEKFTFKGYQFKSLALVASSFENLLLLDADNFP 271
           KI   Y  +    +Y+ D   +L     EK+  + +  K  A + ++FE  +L+DAD   
Sbjct: 282 KI-KEYATEADQEVYIVDLQNVLDPNYAEKY-IENFHNKWYAAMFNTFEEAILVDADVVS 339

Query: 272 IKPLDNIFNEEPYLSTGLVMWPDFWRRTTHPLYYEIADITV-----NMKNRVRNSQDD-- 324
               D  F    +  TGL +W D           +I DI V     NM      S+++  
Sbjct: 340 YVHPDEYFESADFKKTGLKLWRD----------RDIPDIHVHIYCLNMAPYFLPSKEEHR 389

Query: 325 -LTPPAIYTKNSNDLGGVPLSDLDG------TIPDVSTESGQLMINKTKHLATALLSLFY 377
            L     Y      L     S+ DG             +SG ++ NK K L + ++S F+
Sbjct: 390 TLGTTLKYRLEEESLKDAGTSEADGLHKFFFEKSGSIVDSGLVVFNKKKKLHSLIISEFF 449

Query: 378 NVNGPNWYYPIFSQKAAGEGDKETFIAAANFYGLSF 413
           + +           K    GDKE F+  A   G+ +
Sbjct: 450 HTDA--------KFKPCTYGDKEIFMLGAYSAGVDY 477

>CAGL0C04026g Chr3 complement(397303..399213) [1911 bp, 636 aa] {ON}
           similar to uniprot|P40549 Saccharomyces cerevisiae
           YIL014w MNT3
          Length = 636

 Score = 46.6 bits (109), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 42/149 (28%), Positives = 66/149 (44%), Gaps = 11/149 (7%)

Query: 169 KGSGIATVGGGKFSLMSFLIIKTLRNMGTTLPVEVLIPPGDEGES-EFCNK-ILPNYNAK 226
           KG GIA     K   M   +   L   G  LP++++    D+GE+    +K ++ +Y  K
Sbjct: 248 KGKGIAVSVSPKEIRMLHSLFAVLNQQGNKLPIQII----DKGETLTLADKELIKSYAVK 303

Query: 227 C---IYVSDILPLETIEKF--TFKGYQFKSLALVASSFENLLLLDADNFPIKPLDNIFNE 281
               + V D+ P+   E       G   K  A + ++FE +LLLD D  P    +  F  
Sbjct: 304 TNQDVSVVDLSPIIDAEYADENIIGMHNKWFAAMFNTFEEVLLLDVDVIPFVGTEKFFQL 363

Query: 282 EPYLSTGLVMWPDFWRRTTHPLYYEIADI 310
           EPY S  ++ W +   +  +P Y   A I
Sbjct: 364 EPYTSRHILFWRNRDIKKKNPKYCPEAAI 392

>CAGL0C03982g Chr3 complement(391909..393798) [1890 bp, 629 aa] {ON}
           similar to uniprot|P40549 Saccharomyces cerevisiae
           YIL014w MNT3 or uniprot|P53059 Saccharomyces cerevisiae
           YGL257c MNT2 or uniprot|P53745 Saccharomyces cerevisiae
           YNR059w MNT4
          Length = 629

 Score = 46.2 bits (108), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 39/132 (29%), Positives = 63/132 (47%), Gaps = 9/132 (6%)

Query: 169 KGSGIA-TVGGGKFSLMSFLIIKTLRNMGTTLPVEVLIPPGD-EGESEFCNKILPNYNAK 226
           KG GI  T+  G   L+  L  K L+  G   PV+++   G+   + E   K       +
Sbjct: 237 KGKGITLTIAPGDIKLLRSLF-KVLQRQGNEYPVQIIQKGGEMTPKMESLIKKYALETEQ 295

Query: 227 CIYVSDILPLE----TIEKFTFKGYQFKSLALVASSFENLLLLDADNFPIKPLDNIFNEE 282
            +Y+ D+ P+      I++ T   +Q K  A + ++FE  LLLDAD       ++ F  +
Sbjct: 296 DVYIIDLAPILDPAFAIQRIT--KFQNKWFASMFNTFEEALLLDADVVLYTEPEHFFKMK 353

Query: 283 PYLSTGLVMWPD 294
            Y  TGL++W D
Sbjct: 354 GYQDTGLLLWRD 365

>KLTH0F13486g Chr6 complement(1108786..1110657) [1872 bp, 623 aa]
           {ON} weakly similar to uniprot|P40549 Saccharomyces
           cerevisiae YIL014W MNT3 Alpha-1 3-mannosyltransferase
           adds the fourth and fifth alpha-1 3-linked mannose
           residues to O-linked glycans during protein
           O-glycosylation
          Length = 623

 Score = 44.7 bits (104), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 53/234 (22%), Positives = 105/234 (44%), Gaps = 24/234 (10%)

Query: 189 IKTLRNMGTTLPVEVLIPPGDEGESEFCNKI---LPNYNAKCIYVSDILPLETIEKFTFK 245
           +K L ++G  LP+++ +   +E   +F N +   L   + +  Y++    LE +      
Sbjct: 241 LKILDHLGNKLPIQI-VQRENELSEQFLNALSSFLQRSHQRVYYINCGAILEPLYGLEMT 299

Query: 246 GYQFKSLALVASSFENLLLLDADNFPIKPLDNIFNEEPYLSTGLVMWPDFWRRTTHPLYY 305
            +  K +A + ++F  ++L+DAD  P  PL+  F+++ Y  +G++++ D          Y
Sbjct: 300 YFVNKWIASIFNTFSEVILMDADVIPFIPLEEFFDDDQYNRSGVLLYKDRDMPGETTFDY 359

Query: 306 EI---------ADITVNMKNRVRNSQDDLTPPAIYTKNSNDLGGVPLSDLDGTIPDVSTE 356
            I         A+ T+ M + ++ +   + P +    N  +         + T+ +V  +
Sbjct: 360 CIESFNYLMPSAEATILMNHTMKVNGSAVRPDSTIFSNEEEHIYYRFF-YNKTLHNV--D 416

Query: 357 SGQLMINKTKHLATALLSLFYNVNGPNWYYPIFSQKAAGEGDKETFIAAANFYG 410
           SG ++  K + L   L+SLF N++      P  S+     GDKE F     F G
Sbjct: 417 SGLVVFRKPEKLIGLLISLFMNLD------PRLSRCVY--GDKELFWLGQLFGG 462

>TPHA0L00820 Chr12 complement(162210..164402) [2193 bp, 730 aa] {ON}
           
          Length = 730

 Score = 44.7 bits (104), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 72/298 (24%), Positives = 121/298 (40%), Gaps = 49/298 (16%)

Query: 157 HIASLALPKGTYKGSGIATVGGGKFSLMSFLIIKTLRNMGTTLPVEVLIPPGDEGESE-F 215
           +I   A  K   K  GI+     +  +M   +I  L     TLP++++    +E   E F
Sbjct: 294 NINFFANYKSILKDKGISMTMRSEDLMMFKKMINVLDFQNNTLPIQIITKGNNELTKENF 353

Query: 216 CNKI---LPNYNA-KCIYVSDILPL------ETIEKFTFKGYQFKSLALVASSFENLLLL 265
            N++   L N N+ + +++ ++  L      E +  F +     K ++++ S+F+  + L
Sbjct: 354 INELQSFLQNNNSTQTVFIVNVETLLNKHYVENMLNFFYN----KWVSIIFSTFKETIFL 409

Query: 266 DADNFPIKPLDNIFNEEP--------YLSTGLVMWPDFWR-------------RTTHPLY 304
           D D+ P   LD  + +E         Y  TG++M+ D                +   P  
Sbjct: 410 DVDSIPFVNLDEFYFQENNINNDYKNYKDTGMLMYKDRMLINEFTFGYCMDALKFVEPSL 469

Query: 305 YEIADITVNMK-NRVRNSQDDLTPPAIYTKNSNDLGGVPLSDLDGTIPDVSTESGQLMIN 363
            E   I  N+  N      DD+T  +I   N  ++  +  + L      +S  SG ++IN
Sbjct: 470 QESQLINSNILFNSTSPKIDDIT--SIENTNDREIYNIYNNFLTKIFAIISI-SGLVVIN 526

Query: 364 KTKHLATALLSLFYNVNGPNWYYPIFSQKAAGEGDKETFIAAANFYGLSFYQVKTRTG 421
           K K L + + SL  N+NG          +    GDKE F     F G  F  V T  G
Sbjct: 527 KDKKLFSLIFSLMMNLNG--------KLQRCVYGDKEFFWLGQLFAGERF-TVNTHDG 575

>CAGL0H09240g Chr8 complement(905670..907598) [1929 bp, 642 aa] {ON}
           some similarities with uniprot|P40549 Saccharomyces
           cerevisiae YIL014w MNT3
          Length = 642

 Score = 44.3 bits (103), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 51/234 (21%), Positives = 96/234 (41%), Gaps = 33/234 (14%)

Query: 189 IKTLRNMGTTLPVEVLIPPGD-EGESEFCNKILPNYNAKCIYVSDILPL-------ETIE 240
           +   + +G   P++V+   G+   ++E   K       + IY+ D  P+       E I 
Sbjct: 262 LSVWKELGNKYPIQVVHKGGELTRDNEISLKQFAEETDQNIYIVDAGPVLDKNFADEHIT 321

Query: 241 KFTFKGYQFKSLALVASSFENLLLLDADNFPIKPLDNIFNEEPYLSTGLVMWPDFWRRTT 300
           KF       K + ++ ++FE  +++DAD  P    ++ F  E +  +G+ MW D      
Sbjct: 322 KF-----HNKWVGVLFNTFEEYIMVDADTVPFISAEDFFESENFKKSGMRMWRDRTLTNR 376

Query: 301 HPLYYEIADITVNMKNRVRNSQ--------DDLTPPAIYTKNSNDLGGVPLSDLDGTIPD 352
           H +     D+ + ++  +   +          L P     K S +      + +   +  
Sbjct: 377 H-IREHCPDLALKLEPSLEEHRILGTTLRFKLLDPDLKQEKTSEERA---FNQMRTNLAL 432

Query: 353 VSTESGQLMINKTKHLATALLSLFYNVNGPNWYYPIFSQKAAGEGDKETFIAAA 406
              +SG ++INK + L + LLS F+        + +F  +    GDKE F  AA
Sbjct: 433 HHVDSGLVVINKKEKLHSLLLSEFFQ------NHALF--RRCSYGDKELFWYAA 478

>Skud_7.10 Chr7 complement(16816..18516) [1701 bp, 566 aa] {ON}
           YGL257C (REAL)
          Length = 566

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 47/171 (27%), Positives = 77/171 (45%), Gaps = 33/171 (19%)

Query: 221 PNYNAKCIYVSDILPLETIEKFT--FKGYQFKSLALVASSFENLLLLDADNFPIKPLDNI 278
           P Y A+ I+ S++  L +  K++  F  Y  K LAL+ S FE  +LLD+D  P  P+D  
Sbjct: 238 PEYPAQEIWFSNVRNLLS-PKYSNKFATYSNKWLALIFSFFEVPILLDSDTVPFVPIDEF 296

Query: 279 FNEEPYLSTGLVMWPDFWRRTTHPLYYEIADITVNMKNRVRNSQDDLTPPAIYTK---NS 335
           +  E +  TG + + D  R  ++ L+               +SQ D+    I+     N 
Sbjct: 297 YKLEEFQRTGALFFKD--RIISNDLF--------------ESSQLDVLKEIIHGCIGLNL 340

Query: 336 NDLGGVPLSDLDGTIPDV-----------STESGQLMINKTKHLATALLSL 375
            D   +     D T+  V             ESG ++++K KHL + L+S+
Sbjct: 341 TDESDIHEKIEDPTVVQVLENMLIKKHKHHLESGLVVLHKDKHLFSVLISV 391

>TBLA0C06250 Chr3 (1512916..1515126) [2211 bp, 736 aa] {ON} 
          Length = 736

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 69/284 (24%), Positives = 99/284 (34%), Gaps = 71/284 (25%)

Query: 188 IIKTLRNMGTTLPVEVLI----------------------PPGDEGESEFCNKILPNYNA 225
           +I TLR MG  LP++++                       P  D+   E  N +  N   
Sbjct: 322 LISTLRFMGNRLPIQIIFKNDISDKSIEQVFYVATNKNYKPFNDQVNWEHKNDVKQN--- 378

Query: 226 KCIYVSDILPL-ETIEKFTFKGYQFKSLALVASSFENLLLLDADNFPIKPLDNIFNEEPY 284
             +Y  DI  L +   K  F  ++ K LA   + FE  L +D D       ++ F  + Y
Sbjct: 379 --VYFVDIENLLDPKYKDKFSRFKNKWLASNFNMFEEFLFIDTDAITYIDPNDYFELQEY 436

Query: 285 LSTGLVMWPDFWRRTTHPLYYEIADITVNMKNRVRNSQDDLTPPAIYTKNSNDLGGVPLS 344
             +G V + D   RT    + + A  +  M          L PP I    S      PL 
Sbjct: 437 KESGTVFFRD---RTWPKQWGDEAKCSSLMS---------LLPPRILE--SKYFNNYPLF 482

Query: 345 DLDGTIPDVST---------------------ESGQLMINKTKHLATALLSLFYNVNGPN 383
           D+D      ST                     ESG   INK KH+ + L     N++   
Sbjct: 483 DVDYIKETPSTRLSIEEKIYKRYFENGRIHQMESGVFAINKNKHIISILTGTILNIDH-- 540

Query: 384 WYYPIFSQKAAGEGDKETFIAAANFYGLSFYQVKTRTGVEGYHD 427
                   ++ G GDKE F       G  +    T  GV G +D
Sbjct: 541 ------VTESCGYGDKEFFWFGFMISGHKYRFYNTTVGVIGNYD 578

>CAGL0C03894g Chr3 complement(381514..383397) [1884 bp, 627 aa] {ON}
           weakly similar to uniprot|P40549 Saccharomyces
           cerevisiae YIL014w MNT3 or uniprot|P53059 Saccharomyces
           cerevisiae YGL257c MNT2
          Length = 627

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 34/134 (25%), Positives = 63/134 (47%), Gaps = 13/134 (9%)

Query: 169 KGSGIATVGGGKFSLMSFLIIKTLRNMGTTLPVEVLIPPGDEGESEFCNKILPNYNAKCI 228
           +G GI      + + M   +I  L ++   LP++++I    +G ++F ++ +     K I
Sbjct: 221 RGRGIVVTFKEEEANMMMKLIAVLGHLKNRLPIQIVI----QG-NKFGSRTIEMLKEKAI 275

Query: 229 ------YVSDI--LPLETIEKFTFKGYQFKSLALVASSFENLLLLDADNFPIKPLDNIFN 280
                 Y+ D   L +E   +   +GY  K +A + ++FE  +LLD D  P       F 
Sbjct: 276 EKKQQIYIVDATKLLMEKYAEVHIQGYTNKWIASIFNTFEEFILLDVDTVPFINPKKFFE 335

Query: 281 EEPYLSTGLVMWPD 294
           ++ Y +TG  M+ D
Sbjct: 336 KKGYRTTGFYMYQD 349

>TBLA0H00130 Chr8 complement(8943..11006) [2064 bp, 687 aa] {ON} 
          Length = 687

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 37/128 (28%), Positives = 56/128 (43%), Gaps = 24/128 (18%)

Query: 188 IIKTLRNMGTTLPVEVLIPPGDEGESEFCNKILP--NYNAKCIY-----------VSDIL 234
           ++ +LR  G TLP++++   GD  +      I    N N +  Y           V +I+
Sbjct: 274 LLVSLRYQGNTLPIQIIYTDGDLTDENIQRLIFAAQNGNVRVPYKNGAPRPGQLTVQEIM 333

Query: 235 PLET--------IEKFTFKGYQFKSLALVASSFENLLLLDADNFPIKPLDNIFNEEPYLS 286
            L+         +E F FKG   K LA   + FE  + LDAD  P   L+  FN + Y  
Sbjct: 334 FLDVTKMLDSNFVEDFKFKG---KWLASFFNLFEEHIFLDADTVPYVDLNYFFNTQEYNQ 390

Query: 287 TGLVMWPD 294
           TG + + D
Sbjct: 391 TGTLFFRD 398

>TBLA0A00640 Chr1 (128803..131046) [2244 bp, 747 aa] {ON} 
          Length = 747

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 39/144 (27%), Positives = 64/144 (44%), Gaps = 22/144 (15%)

Query: 172 GIA-TVGGGKFSLMSFLIIKTLRNMGTTLPVEVLIPPGDEGESEFCNKILP--------- 221
           GI+  +G G+  L +  +I TLR  G TLP+++++  G+  +      I           
Sbjct: 321 GISMCIGDGQLKL-ALKLITTLRYSGNTLPIQIIMKKGELSKGSIEKLIFAAQGNNFKFR 379

Query: 222 ----------NYNAKCIYVSDILPLETIEKFT-FKGYQFKSLALVASSFENLLLLDADNF 270
                     +Y  + I  +DI  L   E    F+ ++ K LA + + FE  + LDAD  
Sbjct: 380 IDKDEYKPASSYMPQEILFTDITDLLDPEFLNDFQWFKNKWLASIFNVFEENIFLDADVV 439

Query: 271 PIKPLDNIFNEEPYLSTGLVMWPD 294
           P   L+  FN + Y  TG + + D
Sbjct: 440 PYVDLNFFFNTKEYNETGTIFFKD 463

>YER001W Chr5 (153520..155808) [2289 bp, 762 aa] {ON}
           MNN1Alpha-1,3-mannosyltransferase, integral membrane
           glycoprotein of the Golgi complex, required for addition
           of alpha1,3-mannose linkages to N-linked and O-linked
           oligosaccharides, one of five S. cerevisiae proteins of
           the MNN1 family
          Length = 762

 Score = 43.5 bits (101), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 67/284 (23%), Positives = 110/284 (38%), Gaps = 64/284 (22%)

Query: 170 GSGIA-TVGGGKFSLMSFLIIKTLRNMGTTLPVEVLIPPGDEGESEFCNKIL-------- 220
           G GI  ++G  +F L +   I +LR  G TLP++V+   GDE   E  +K++        
Sbjct: 317 GRGIVLSLGSNQFPL-AVKFIASLRFEGNTLPIQVVYR-GDELSQELVDKLIYAARSPDF 374

Query: 221 ----PNYNAKCIYVSDILPLE---TIE---KFTFKGYQFKSLALVASSFENLLLLDADNF 270
                NY+       +I  L+   TI    +  F  Y+ K L ++ +  +  + LD D  
Sbjct: 375 KPVENNYDNSTNVPQEIWFLDVSNTIHPKWRGDFGSYKSKWLVVLLNLLQEFVFLDIDAI 434

Query: 271 PIKPLDNIFNEEPYLSTGLVMWPDFWRRTTHPLYYEIADITVNMKNRVRNSQDDLTPPAI 330
             + +DN F    Y  TG V             +Y    +  N+  R     + L P  +
Sbjct: 435 SYEKIDNYFKTTEYQKTGTV-------------FYRERALRENVNERCIARYETLLPRNL 481

Query: 331 YTKN-SNDLGGVP---LSDLDGTIP--------------DVSTESGQLMINKTKHLATAL 372
            +KN  N L   P   L++ D T+                   E+G   ++K+KH    +
Sbjct: 482 ESKNFQNSLLIDPDHALNECDNTLTTEEYIFKAFFHHRRQHQLEAGLFAVDKSKHTIPLV 541

Query: 373 LSLFYNVNGPNWYYPIFSQKAAGEGDKET----FIAAANFYGLS 412
           L+   ++          +      GDKE     F+AA + Y L 
Sbjct: 542 LAAMIHLAK--------NTAHCTHGDKENFWLGFLAAGHTYALQ 577

>TDEL0F05640 Chr6 complement(1055778..1057442) [1665 bp, 554 aa]
           {ON} 
          Length = 554

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 62/263 (23%), Positives = 107/263 (40%), Gaps = 48/263 (18%)

Query: 173 IATVGGGKFSLMSFLIIKTLRNMGTTLPVEVLIPPGD----------EGESEFCNKILPN 222
           + ++G G+ +  +  +I  LR +  TLP++ L+  GD          +   E  +   P 
Sbjct: 180 VISIGDGQVA-DTIRLIHVLRYLDNTLPIQ-LVHKGDLSSAKVEELFKAARERRSDGSPP 237

Query: 223 YNAKCIYVSDILPLETIEKFTFKGYQFKSLALVASSFENLLLLDADNFPIKPLDNIFNEE 282
                + V ++L    I  + FK +  K LAL+  SFE  +LLDAD  P   L+  ++ +
Sbjct: 238 QELWIVDVKNLLNPAMI--YEFKRFSNKWLALLFCSFEKPILLDADTVPFTKLEEYYDTD 295

Query: 283 PYLSTGLVMWPDFWRRTTHPLYYEIADITVNMKNR-----VRNSQDDLTPPAIYTKNSND 337
            +   G V + D   RT          +T +M NR     ++   D L   +    +++ 
Sbjct: 296 QFKKYGTVFFKD---RT----------LTAHMLNRGQRRTLKRIFDGLLTSSDRQSSADS 342

Query: 338 LGGVPLSDLDGTIPDV-------STESGQLMINKTKHLATALLSLFYNVNGPNWYYPIFS 390
             G+    +   +  +         ESG +  +K KHL   L SL    +  N Y+    
Sbjct: 343 YYGIQDPIVQKALERILKKRQKHIMESGLVAYDKKKHLFGLLTSLALQFSPLNEYF---- 398

Query: 391 QKAAGEGDKETFIAAANFYGLSF 413
                 G+KE F  +    G+ F
Sbjct: 399 -----HGEKEWFWISQLIRGVPF 416

>NDAI0A08550 Chr1 complement(1967085..1969079) [1995 bp, 664 aa]
           {ON} 
          Length = 664

 Score = 42.4 bits (98), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 57/250 (22%), Positives = 99/250 (39%), Gaps = 28/250 (11%)

Query: 188 IIKTLRNMGTTLPVEVLIPPGDEGESEFCNKILPNY--NAKC-IYVSDILPL---ETIEK 241
           ++     MG  LP++ L+  G +   E  +  L N+  NAK  +Y  D  P+   + +EK
Sbjct: 280 LVTVFEEMGNKLPIQ-LVSTGKDFTKETMDH-LQNFAKNAKQDVYYVDCSPMLDQDFVEK 337

Query: 242 FTFKGYQFKSLALVASSFENLLLLDADNFPIKPLDNIFNEEPYLSTGLVMWPDFWRRTTH 301
              K Y  K + ++ ++FE L+  DAD+ P    +       Y  TG   + D       
Sbjct: 338 -NIKSYVNKWIGVLFNTFEELVFFDADSVPFIAPEKFLENSEYKKTGAYFFRDRSLGNDR 396

Query: 302 PLYYEIADITVNMKN-------RVRNSQDDLTPPAIYTKNSNDLGGVPLSDLDGTIPDVS 354
              Y I  I V   +       + +   + L PP   TK+S++      +         +
Sbjct: 397 TFQYCIDMIQVMEPSKEEKKLIKSKTKFETLNPPE--TKSSSE--AAIFNSFFQNFQHNN 452

Query: 355 TESGQLMINKTKHLATALLSLFYNVNGPNWYYPIFSQKAAGEGDKETFIAAANFYGLSFY 414
            +SG +M+NK + +   L+  F +++           K    GDKE F       G  + 
Sbjct: 453 VDSGVVMLNKKQKMGGLLMGFFLHLDA--------KMKKCVSGDKEMFWLGNLLAGQDYS 504

Query: 415 QVKTRTGVEG 424
             K+   + G
Sbjct: 505 IAKSYGSIAG 514

>Smik_14.393 Chr14 (693641..695383) [1743 bp, 580 aa] {ON} YNR059W
           (REAL)
          Length = 580

 Score = 42.0 bits (97), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 30/121 (24%), Positives = 57/121 (47%), Gaps = 21/121 (17%)

Query: 188 IIKTLRNMGTTLPVEV-------------LIPPGDEGESEFCNKILPNYNAKCIYVSDIL 234
           +I+TLR +  +LP+E+             LI    E  S        +Y  + ++  D+ 
Sbjct: 215 LIRTLRLLNNSLPIEIVHKSDLDERYQQLLIISARESAS-------LDYPPQELWFLDVQ 267

Query: 235 PLETIEKF-TFKGYQFKSLALVASSFENLLLLDADNFPIKPLDNIFNEEPYLSTGLVMWP 293
            + + +    FK +  K LA+  SSF+  + LD+D  P  P+D ++  + ++ TG + + 
Sbjct: 268 SMLSDDYLGKFKRFSNKWLAITFSSFQVPIFLDSDTVPFAPVDTLYQTDEFIRTGTLFFR 327

Query: 294 D 294
           D
Sbjct: 328 D 328

>Skud_14.395 Chr14 (704847..706589) [1743 bp, 580 aa] {ON} YNR059W
           (REAL)
          Length = 580

 Score = 41.2 bits (95), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 56/240 (23%), Positives = 93/240 (38%), Gaps = 51/240 (21%)

Query: 188 IIKTLRNMGTTLPVEV-------------LIPPGDEGESEFCNKILPNYNAKCIYVSDIL 234
           +++ LR +  +LP+E+             LI    E  S        NY  + ++  D+ 
Sbjct: 215 LMRILRLLNNSLPIEIVHKSDLSKSSQQLLIASARESASS-------NYPPQELWFLDVK 267

Query: 235 PLETIEKFT-FKGYQFKSLALVASSFENLLLLDADNFPIKPLDNIFNEEPYLSTGLVMWP 293
            L   E    FK +  K LA+  SSF+  + LD+D  P  PLD  +    +  TG +   
Sbjct: 268 SLIKDEYLNRFKRFSNKWLAITFSSFQMPIFLDSDTVPFVPLDGFYRTGEFERTGTL--- 324

Query: 294 DFWRRTTHPLYYEIADITVNMKNRVRNSQDDLTPPAIYTKNSNDLGGVPLSDLD----GT 349
            F++  + PL    +  T  ++  + NS        I + +      +  S  D    G 
Sbjct: 325 -FFKDRSFPLSKLSSQQTKALRQIINNSL------GISSNSEQGFESLKNSSKDDTAIGA 377

Query: 350 IPDV-------STESGQLMINKTKHLATALLSLFYNVNGPNWYYPIFSQKAAGEGDKETF 402
           I  V         +SG L+I+K KH     +++    +    Y+          GDKE F
Sbjct: 378 IDSVIFKQQKHYMDSGLLVIDKQKHFFCLPIAIMLQFSPIQEYF---------HGDKEWF 428

>AAR183C Chr1 complement(672091..674037) [1947 bp, 648 aa] {ON}
           Non-syntenic homolog of Saccharomyces cerevisiae YIL014W
           (MNT3)
          Length = 648

 Score = 40.8 bits (94), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 40/133 (30%), Positives = 59/133 (44%), Gaps = 13/133 (9%)

Query: 170 GSGI-ATVGGGKFSLMSFLIIKTLRNMGTTLPVEVLIPPGDEGESEFCNKILPNY----- 223
           G GI ATV       +  L+   L  +G  LP+E++    D   S    K L  Y     
Sbjct: 257 GRGIVATVADIHLDQLKRLL-HVLDELGNKLPIELVYKGNDF--SRLPIKRLKRYVRQHT 313

Query: 224 --NAKCIYVSDILPLETIEKFTFKGYQFKSLALVASSFENLLLLDADNFPIKPLDNIFNE 281
               + +  S +L    I K   K +  K LA + +SFE ++LLD D  P+ P+D+ F  
Sbjct: 314 KQRVRLVDCSRVLRSTHIPKI--KRFMNKWLATIFNSFEEIILLDVDVVPLVPIDSYFKL 371

Query: 282 EPYLSTGLVMWPD 294
             Y  TG + + D
Sbjct: 372 PGYTKTGALFFKD 384

>YNR059W Chr14 (736803..738545) [1743 bp, 580 aa] {ON}  MNT4Putative
           alpha-1,3-mannosyltransferase, not required for protein
           O-glycosylation
          Length = 580

 Score = 40.8 bits (94), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 57/228 (25%), Positives = 96/228 (42%), Gaps = 27/228 (11%)

Query: 188 IIKTLRNMGTTLPVEVLIPPGDEGESEFCNKILP-------NYNAKCIY---VSDILPLE 237
           +I+ LR +  +LP+E+ +   D  ES     I         NY  + ++   V D+L  E
Sbjct: 215 LIRVLRLLNNSLPIEI-VHKSDLHESSQQLLIAAARESGSLNYPPQELWFLDVKDMLNDE 273

Query: 238 TIEKFTFKGYQFKSLALVASSFENLLLLDADNFPIKPLDNIFNEEPYLSTGLVMWPD--F 295
            + +F  K +  K LA+   SF+  + LD+D  P  PLD ++  + +  TG + + D  F
Sbjct: 274 YLARF--KRFSNKWLAITFCSFQIPIFLDSDTVPFVPLDTLYEIDGFKRTGTLFFKDRSF 331

Query: 296 WRRTTHPLYYEIADITVNMKNRVRNSQDDLTPPAIYTKNSNDLGGV-PLSDLDGTIPDVS 354
                 PL  ++    +N  N +  S D      I   N ND   +  +  L        
Sbjct: 332 PTSKLSPLQVKVLKQIIN--NSLDVSSDSEQGFEILKHNLNDEMAIDAIEALIFKKQKHY 389

Query: 355 TESGQLMINKTKHLATALLSLFYNVNGPNWYYPIFSQKAAGEGDKETF 402
            +SG ++ +K KH     +++         + PI   +    GDKE F
Sbjct: 390 MDSGLVIFDKQKHFFCLPIAIMLQ------FSPI---QEFFHGDKEWF 428

>SAKL0D15180g Chr4 complement(1259592..1261325) [1734 bp, 577 aa]
           {ON} similar to uniprot|P53059 Saccharomyces cerevisiae
           YGL257C MNT2 Mannosyltransferase involved in adding the
           4th and 5th mannose residues of O-linked glycans
          Length = 577

 Score = 40.8 bits (94), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 38/142 (26%), Positives = 62/142 (43%), Gaps = 12/142 (8%)

Query: 163 LPKGTYKGSGIATVGGGKFSLM-SFLIIKTLRNMGTTLPVEVL----IPPGDE-----GE 212
           L K    GS    +  G+F    +  +I+ LR +   LP+EV+    + P  +       
Sbjct: 176 LQKVMQSGSRGIVLSIGQFQTADTIRLIRILRFLKNNLPIEVVHKGDLSPHHQSVLIGAA 235

Query: 213 SEFCNKILPNYNAKCIYVSDILPLETIEKFTFKGYQFKSLALVASSFENLLLLDADNFPI 272
            E  +   P      + V+++L  +   KFT   Y  K LAL+  SFE  +LLDAD  P 
Sbjct: 236 REDLSDEYPGQELWFLDVTNMLNPQYSAKFT--RYSNKWLALLFCSFEQPILLDADTVPF 293

Query: 273 KPLDNIFNEEPYLSTGLVMWPD 294
              +  +  E + ++G   + D
Sbjct: 294 TTFERYYQSEQFKNSGTFFFKD 315

>Suva_14.418 Chr14 (721586..723328) [1743 bp, 580 aa] {ON} YNR059W
           (REAL)
          Length = 580

 Score = 40.8 bits (94), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 57/242 (23%), Positives = 98/242 (40%), Gaps = 49/242 (20%)

Query: 185 SFLIIKTLRNMGTTLPVEV-------------LIPPGDEGES-EFCNKILPNYNAKCIYV 230
           S  +I+ LR +  +LP+E+             LI    E  S ++  + L   N K +  
Sbjct: 212 SIRLIRVLRLLNNSLPIEIVHKSDLSEYYQQLLIASARESASLDYPPQELWFLNVKSLLK 271

Query: 231 SDILPLETIEKFTFKGYQFKSLALVASSFENLLLLDADNFPIKPLDNIFNEEPYLSTGLV 290
            D           FK +  K LA+   SF+  +LLD+D  P  PLD  +  + +  TG +
Sbjct: 272 DDYAA-------KFKRFSNKWLAITFCSFQKPILLDSDAVPFVPLDTFYEADEFKKTGTL 324

Query: 291 MWPDFWRRTTHPLYYEIADITVNMKNRVRNSQDDLTPPAIYTKNSNDLGGVPLSDLDGTI 350
            + D   R+     +  + +++   N ++    D     + +K   +L    L+D D  +
Sbjct: 325 FFKD---RS-----FPTSKLSLRKINVLKKVIGDCLGIPLDSKKGLELLKNRLND-DMAM 375

Query: 351 PDVST----------ESGQLMINKTKHLATALLSLFYNVNGPNWYYPIFSQKAAGEGDKE 400
             V +          ESG L+++K KH    L+S+    +    Y+          GDKE
Sbjct: 376 DAVESLFIKHQKHYMESGLLVLDKQKHFFGLLVSIMLQFSPIREYF---------YGDKE 426

Query: 401 TF 402
            F
Sbjct: 427 WF 428

>ZYRO0G04048g Chr7 complement(328792..330717) [1926 bp, 641 aa] {ON}
           similar to uniprot|P40549 Saccharomyces cerevisiae
           YIL014W MNT3 Alpha-1 3-mannosyltransferase adds the
           fourth and fifth alpha-1 3-linked mannose residues to
           O-linked glycans during protein O-glycosylation
          Length = 641

 Score = 40.0 bits (92), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 61/271 (22%), Positives = 103/271 (38%), Gaps = 33/271 (12%)

Query: 169 KGSGIATVGGGKFSLMSFLIIKTLRNMGTTLPVEVLIPPGDEGESEFCNKILP-----NY 223
           KG GIA         +    ++ L  +  TLP++V +  G E      +++       + 
Sbjct: 238 KGKGIAATFNPTELTLFHRQLRVLSKLNNTLPIQV-VTSGFEFTRAQVDQLSQYARDTDQ 296

Query: 224 NAKCIYVSDILPLE----TIEKFTFKGYQFKSLALVASSFENLLLLDADNFPIKPLDNIF 279
               I  S IL  E     +EKF  K      LA + ++FE +LLLD D  P   ++  F
Sbjct: 297 EVTLIDCSTILIKEFTQNNVEKFVNKW-----LAALFNTFEEVLLLDVDTVPFVDVEEFF 351

Query: 280 NEEPYLSTGLVMWPDFWRRTTHPLYYEIADITVNMKNRVRNSQDDLTPPAIYTKNSNDLG 339
            E  Y +TG+ ++ D      H   Y +  +     +   N    +    ++     +L 
Sbjct: 352 KEPQYRATGMALFKDRAMMDEHTYGYCLETLAGLEPSHEENKL--MGTKLLFESTQKELP 409

Query: 340 GVPLSDL------DGTIPDVSTESGQLMINKTKHLATALLSLFYNVNGPNWYYPIFSQKA 393
               + +      DG +  V  +SG + +NK K+    L S   N++           + 
Sbjct: 410 QTEAASVYRRFFHDGVLHHV--DSGLVPVNKVKNFGGLLFSFMINLDT--------KIQG 459

Query: 394 AGEGDKETFIAAANFYGLSFYQVKTRTGVEG 424
              GDKE F     + G ++       GV G
Sbjct: 460 CVHGDKEFFWLGQLYAGKNYAIYPQDAGVIG 490

>TBLA0G03680 Chr7 complement(975688..977943) [2256 bp, 751 aa] {ON} 
          Length = 751

 Score = 39.7 bits (91), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 37/151 (24%), Positives = 61/151 (40%), Gaps = 25/151 (16%)

Query: 166 GTYKGSGIATVGGGKFSLMSFLIIKTLRNMGTTLPVEVLIPPGDEGESEFCNKILPNYNA 225
           G     G+    G K    +  +I  LR    TLP++++I   D  ++    KIL    +
Sbjct: 317 GNVAHRGVILSFGDKHLKWALKLIMALRYRQNTLPIQIIITKNDLSKNSM-EKILFAAQS 375

Query: 226 KCIYVSD----------------------ILPLETIEKFTFKGYQFKSLALVASSFENLL 263
             + + D                      I+  E  + FT  G++ K LA + + FE  +
Sbjct: 376 DEVQIKDKKGNVMKDVFTKQEIIFVDVTNIIDPEFFDNFT--GWKSKWLASIFNLFEEYI 433

Query: 264 LLDADNFPIKPLDNIFNEEPYLSTGLVMWPD 294
            LDAD      L++ FN + Y  TG + + D
Sbjct: 434 FLDADAISYVDLNHYFNTKEYNETGTIFFRD 464

>Smik_7.4 Chr7 complement(8045..9733) [1689 bp, 562 aa] {ON} YGL257C
           (REAL)
          Length = 562

 Score = 38.9 bits (89), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 29/51 (56%)

Query: 244 FKGYQFKSLALVASSFENLLLLDADNFPIKPLDNIFNEEPYLSTGLVMWPD 294
           F  Y  K LAL+ SSFE  +LLD+D  P   +D  +  E +  TG++ + D
Sbjct: 254 FATYSNKWLALIFSSFEIPILLDSDTVPFVSIDKFYKLEEFQKTGVLFFKD 304

>KLLA0E09813g Chr5 (867899..870139) [2241 bp, 746 aa] {ON} similar
           to uniprot|P39106 Saccharomyces cerevisiae YER001W MNN1
           Alpha-1 3-mannosyltransferase integral membrane
           glycoprotein of the Golgi complex required for addition
           of alpha1 3-mannose linkages to N-linked and O- linked
           oligosaccharides one of five S. cerevisiae proteins of
           the MNN1 family
          Length = 746

 Score = 38.9 bits (89), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 32/133 (24%), Positives = 61/133 (45%), Gaps = 13/133 (9%)

Query: 172 GIATVGGGKFSLMSFLIIKTLRNMGTTLPVEVLIPPGDEGESEFCNKILPNY-------- 223
           GI    G         +I TLR  G  LP++++    +   +E   K+L           
Sbjct: 336 GIILAAGDGQVDQCIRLIATLRAQGNALPIQII---HNNQLNEKSVKLLSEAAKSTEFSS 392

Query: 224 -NAKCIYVSDILP-LETIEKFTFKGYQFKSLALVASSFENLLLLDADNFPIKPLDNIFNE 281
             A+ +++ ++ P LE+  K  F  ++ K L+++ ++FE  + +D D      + + FN 
Sbjct: 393 GRAQSLWLVNVGPTLESSMKSNFGRFKNKWLSVIFNTFEEFIFIDTDAISYINMADYFNF 452

Query: 282 EPYLSTGLVMWPD 294
           + Y STG + + D
Sbjct: 453 KEYKSTGTLFFKD 465

>Smik_9.180 Chr9 (300789..302681) [1893 bp, 630 aa] {ON} YIL014W
           (REAL)
          Length = 630

 Score = 38.5 bits (88), Expect = 0.047,   Method: Compositional matrix adjust.
 Identities = 41/175 (23%), Positives = 73/175 (41%), Gaps = 27/175 (15%)

Query: 247 YQFKSLALVASSFENLLLLDADNFPIKPLDNIFNEEPYLSTGLVMWPDFWRRTTHPLYYE 306
           +Q K +A + ++F+  +LLDAD  P    D  F+   Y  +G++++ D   ++     Y 
Sbjct: 314 FQNKWVATLFNTFKEYILLDADVVPFVESDYFFDSPSYRQSGILLFKDRVMKSEQTFSY- 372

Query: 307 IADITVNMKNRVRNSQDDLTPPAIYTKNSNDLGGVPLSDLDGTIPDV-----------ST 355
                + M   V  S  +    +I +K   D   +P S ++     V             
Sbjct: 373 ----CIEMLREVEPSGQERK--SIGSKLIFD-SSLPFSSINSEEASVYYNFFKKLQLHHV 425

Query: 356 ESGQLMINKTKHLATALLSLFYNVNGPNWYYPIFSQKAAGEGDKETFIAAANFYG 410
           +SG +++NK + L   L+S  +N+NG          +    GDKE F     + G
Sbjct: 426 DSGLVVVNKLEKLNGLLMSFMFNLNG--------KLQRCVYGDKEIFWLGQLYAG 472

>TBLA0A01160 Chr1 complement(267341..269332) [1992 bp, 663 aa] {ON} 
          Length = 663

 Score = 38.5 bits (88), Expect = 0.053,   Method: Compositional matrix adjust.
 Identities = 19/58 (32%), Positives = 31/58 (53%)

Query: 250 KSLALVASSFENLLLLDADNFPIKPLDNIFNEEPYLSTGLVMWPDFWRRTTHPLYYEI 307
           K +A++ ++F+  + LD D  P   +D  F  E +  TG++M+ D   RT H   Y I
Sbjct: 353 KWVAMLFNTFKEAIFLDVDAIPFIGMDYFFENEGFEETGILMYKDRVMRTEHTFQYCI 410

>CAGL0G04279g Chr7 complement(404144..406126) [1983 bp, 660 aa] {ON}
           weakly similar to uniprot|P40549 Saccharomyces
           cerevisiae YIL014w MNT3
          Length = 660

 Score = 38.1 bits (87), Expect = 0.059,   Method: Compositional matrix adjust.
 Identities = 36/132 (27%), Positives = 66/132 (50%), Gaps = 9/132 (6%)

Query: 169 KGSG-IATVGGGKFSLMSFLIIKTLRNMGTTLPVEVLIPPGDEGESEFCNKILPNYNAKC 227
           KG G + T+      ++  L  K L+  G TLP++ L+   +   + F + I+       
Sbjct: 254 KGKGLVITIESNNLHILRKLF-KFLKENGNTLPIQ-LVFKRNVTLARFKDAIISYAEESD 311

Query: 228 IYVSDILPLETI-----EKFTFKGYQFKSLALVASSFENLLLLDADNFPIKPLDNIFNEE 282
            +V+ I+ +E +      K TF GY  K LA + ++FE+++++D +  P    + +   E
Sbjct: 312 QHVT-IIEIEALIDDSFNKGTFVGYDDKFLASIFNTFEDVVMMDIEVIPYVNPEELLENE 370

Query: 283 PYLSTGLVMWPD 294
            Y ++GL MW D
Sbjct: 371 EYKNSGLYMWRD 382

>Kwal_14.2057 s14 complement(590944..593145) [2202 bp, 733 aa] {ON}
           YER001W (MNN1) - Alpha-1,3-mannosyltransferase [contig
           230] FULL
          Length = 733

 Score = 38.1 bits (87), Expect = 0.063,   Method: Compositional matrix adjust.
 Identities = 42/156 (26%), Positives = 69/156 (44%), Gaps = 24/156 (15%)

Query: 156 DHIASLALPKGTYKGSGIATVGGGKFSLMSFLIIKTLRNMGTTLPVEVLIPPGD--EGES 213
           +H++SL   KG      + + G G+    S LI   LR +G  LP++V +  GD  EG  
Sbjct: 305 NHMSSLVAQKGI-----VLSFGDGQLKHASRLIAH-LRYIGNKLPLQV-VHKGDLSEGSI 357

Query: 214 EFCNKILPN-------------YNAKC-IYVSDILP-LETIEKFTFKGYQFKSLALVASS 258
           +   KI  +              N K  ++  D+ P L+ +   +F  ++ K LA   + 
Sbjct: 358 KALQKIAQSDDITFPETDYEGGQNVKQELWFVDVSPTLDPVMAGSFTRFKNKWLATSFNL 417

Query: 259 FENLLLLDADNFPIKPLDNIFNEEPYLSTGLVMWPD 294
           FE  +L+D D      L+  F+   Y  TG + + D
Sbjct: 418 FEEFILIDVDTVHYVDLEQYFHSVEYQHTGTLFFRD 453

>KAFR0K01260 Chr11 complement(261190..263076) [1887 bp, 628 aa] {ON}
           
          Length = 628

 Score = 38.1 bits (87), Expect = 0.074,   Method: Compositional matrix adjust.
 Identities = 49/193 (25%), Positives = 86/193 (44%), Gaps = 25/193 (12%)

Query: 122 YEELYKLSANELSKC--LELSQDEVARLTKSHKDYVDHIASLALPKGTYKGSGIATVGGG 179
           Y E++ +S NE+     L+L+  E  R      D+     +LA      KG GI T    
Sbjct: 201 YPEIFDISNNEMVSKPKLKLTPLEFNR------DFWRQYKTLA------KGKGIVTTLHS 248

Query: 180 KFSLMSFLIIKTLRNMGTTLPVEVLIPPGD---EGESEFCNKILPNYNAKCIYV---SDI 233
           K     +  +K L+ +   LP+ ++   GD     ++E   ++      + +YV   S I
Sbjct: 249 KELDFFYRQLKVLQKLDNKLPIYIVSSDGDITDNHKNELFTQV--KETTQQVYVVGCSQI 306

Query: 234 LPLETIEKFTFKGYQFKSLALVASSFENLLLLDADNFPIKPLDNIFNEEPYLSTGLVMWP 293
           L     +K   K +  K +A++ +  E ++ +DAD  P+  +++ F  E Y  +GL ++ 
Sbjct: 307 LNPSFSQK-HLKSFLNKWVAILFNPLEEVIFMDADAVPLISVEDYFKYEDYKESGLYVFK 365

Query: 294 DFWRRTTHPLYYE 306
           D  R   H L  E
Sbjct: 366 D--RVMPHKLATE 376

>KNAG0E03170 Chr5 complement(632635..634875) [2241 bp, 746 aa] {ON} 
          Length = 746

 Score = 37.4 bits (85), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 53/255 (20%), Positives = 104/255 (40%), Gaps = 33/255 (12%)

Query: 189 IKTLRNMGTTLPVEVLIPPGDEGESEFCNK--ILPNYNAKCIYV---SDILPLETIEKFT 243
           ++ L+     LP++V I  G E   EF  +  I+   + + IY+   SDI+    +    
Sbjct: 227 MRILKEFDNKLPLQV-ITTGSEMRDEFVKQLQIIAEIHNQEIYLVDLSDIIDRRFVND-K 284

Query: 244 FKGYQFKSLALVASSFENLLLLDADNFPIKPLDNIFNEEPYLSTGLVMWPDF-----WRR 298
              ++ K L+++ ++FE  + +D D  P       F  + Y  TG+ ++ D         
Sbjct: 285 IDRFKHKFLSVLFNTFEEAIFMDVDAVPFVETTEFFEIQAYKDTGMYLYRDRSLDEGGEG 344

Query: 299 TTHPLYYEIADITVNMKNRVRNSQDDLTPPAIYTKNSNDLGGVPLSDLDGTIPDV----- 353
              PL  ++       ++R+ N++  L    ++    N +    ++  +    ++     
Sbjct: 345 NCRPLMRQLEPSFA--ESRLLNNR--LKFDLLWAIEHNGMSTKYMTSEEAVFKNMYVYGR 400

Query: 354 --STESGQLMINKTKHLATALLSLFYNVNGPNWYYPIFSQKAAGEGDKETFIAAANFYGL 411
               ESG ++IN+ K +A  + ++ + ++         S      GDKE F    N Y  
Sbjct: 401 RHHIESGLMVINRRKQMAGLIGAMLFGLSN--------SGSKCSWGDKE-FFWLGNLYAG 451

Query: 412 SFYQVK-TRTGVEGY 425
             Y V     G+ GY
Sbjct: 452 KDYAVNPMEGGIVGY 466

>Smik_5.115 Chr5 (157563..159851) [2289 bp, 762 aa] {ON} YER001W
           (REAL)
          Length = 762

 Score = 37.4 bits (85), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 60/280 (21%), Positives = 110/280 (39%), Gaps = 63/280 (22%)

Query: 173 IATVGGGKFSLMSFLIIKTLRNMGTTLPVEVLIPPGDEGESEFCNKIL------------ 220
           I ++G  +F+L +  +I  LR  G  LP++++   G+E   E  +K++            
Sbjct: 323 ILSLGPNQFAL-AVKLIAALRFQGNKLPIQIVYR-GNELSQELVDKLIYAARSPDFKPVK 380

Query: 221 PNYNAKCIYVSDILPLE---TIE---KFTFKGYQFKSLALVASSFENLLLLDADNFPIKP 274
            NY+       +I  L+   TI    +  F  Y+ K L ++ + F+  + LD D    + 
Sbjct: 381 NNYDNSTNVPQNIWFLDVSNTIHPKWRDDFGSYKSKWLVVLFNLFQEFVFLDIDAISYQE 440

Query: 275 LDNIFNEEPYLSTGLVMWPDFWRRTTHPLYYEIADITVNMKNRVRNSQDDLTPPAIYTKN 334
           +D  F+   Y  TG V             +Y    +T  +  R     + L P  + +KN
Sbjct: 441 IDKYFDTPEYQKTGTV-------------FYRERALTETLDGRCVARYETLLPRKLESKN 487

Query: 335 SNDLGGV-PLSDLDGTIPDVST-----------------ESGQLMINKTKHLATALLSLF 376
             +L  + P + L+     ++T                 E+G   I+K+KH+   +L+  
Sbjct: 488 FQNLLTIDPDTVLNKCDELLTTEEYIFKSMFRHKGQHQLEAGLFAIDKSKHVLPLVLASM 547

Query: 377 YNVNGPNWYYPIFSQKAAGEGDKET----FIAAANFYGLS 412
            ++                 GDKE     F+A+ + Y L 
Sbjct: 548 IHLAR--------DTGGCTHGDKENFWLGFLASGHPYALQ 579

>Suva_9.191 Chr9 (314586..316463) [1878 bp, 625 aa] {ON} YIL014W
           (REAL)
          Length = 625

 Score = 37.0 bits (84), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 32/122 (26%), Positives = 57/122 (46%), Gaps = 7/122 (5%)

Query: 189 IKTLRNMGTTLPVEVLIPPGDEGESEFCNKI--LPNYNAKCIYVSD---ILPLETIEKFT 243
           +K +  +   LP ++ I  G+E   E   KI  +     + +Y+ D   +L  E  + F 
Sbjct: 252 LKVMELLENVLPFQI-ITTGNELSPESIAKISKVAKEGGQKVYLMDCSTVLDAEFSKTF- 309

Query: 244 FKGYQFKSLALVASSFENLLLLDADNFPIKPLDNIFNEEPYLSTGLVMWPDFWRRTTHPL 303
              +Q K +A + ++FE  +LLDAD  P    D  F+   Y  +G++++ D   +  H  
Sbjct: 310 ISFFQNKWVATLFNTFEEFILLDADVVPFVKSDYFFDSPSYKRSGILLFKDRVMQNEHTF 369

Query: 304 YY 305
            Y
Sbjct: 370 EY 371

>Kpol_1015.13 s1015 complement(31451..33682) [2232 bp, 743 aa] {ON}
           complement(31451..33682) [2232 nt, 744 aa]
          Length = 743

 Score = 37.0 bits (84), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 69/305 (22%), Positives = 109/305 (35%), Gaps = 71/305 (23%)

Query: 168 YKGSGIATVGGGKFSLMSFLIIKTLRNMGTTLPVEVLIPPGDEGESEFCNKILP------ 221
           +   GIA         M+  +I TLR  G  LP+++ I   +E   +  +KIL       
Sbjct: 312 FAKRGIALSFADSHLEMALKLIATLRFQGNKLPIQI-IYKDNELSKDTMSKILQVAHSSE 370

Query: 222 ---------------NYNAKCIYVSDILPLETIEKFTFKGYQFKSLALVASSFENLLLLD 266
                            +   + V++ +    IE++T   ++ K LA + + FE  + +D
Sbjct: 371 LKFPGTPIDESIKPVKQDVWFLDVTNTVDPSLIERYT--DFKNKWLACIFNLFEEFIFMD 428

Query: 267 ADNFPIKPLDNIFNEEPYLSTGLVMWPDFWRR------------TTHPLYYE---IADIT 311
            D     P++  F  + Y  TG V + D   R            T  P Y E     +  
Sbjct: 429 IDAVNYVPMEYFFEMDEYKRTGTVFFRDRMLRASVKRECVPIFETLTPNYMESKYFGNFP 488

Query: 312 VNMKNRVRNSQDD-LTPPAIYTKNSNDLGGVPLSDLDGTIPDVSTESGQLMINKTKHLAT 370
              K+ V    D  LTP  +  K         L  +         ESG   INKTKH+  
Sbjct: 489 FINKDYVEEQCDKYLTPEELIYKRY--FINHKLHQM---------ESGLFAINKTKHVIP 537

Query: 371 ALLSLFYNVNGPNWYYPIFSQKAAGEGDKETFIAAANFYGLSF------------YQVKT 418
            + S+  ++            +    GDKE +       G SF            Y+V +
Sbjct: 538 LIFSMMLHMTP--------QVRDCNYGDKEFYWIGFVVSGHSFAFNEMNAGSVGKYEVLS 589

Query: 419 RTGVE 423
           + GVE
Sbjct: 590 KKGVE 594

>Kwal_23.5454 s23 (1171360..1173111) [1752 bp, 583 aa] {ON} YGL257C
           (MNT2) - Mannosyltransferase [contig 9] FULL
          Length = 583

 Score = 36.6 bits (83), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 49/173 (28%), Positives = 78/173 (45%), Gaps = 27/173 (15%)

Query: 145 ARLTKSHKDYVDHIAS----LALPKGTYKGSGIA-TVGGGKFSLMSFLIIKTLRNMGTTL 199
           A+L+K   +  + IAS        K  Y G GI  ++G G    +   +++ LR +  TL
Sbjct: 159 AKLSKKDYEVKEEIASKDAYWKQVKERYSGKGIVISIGEGGVDEV-IRLLRVLRALKNTL 217

Query: 200 PVEVLIPPGDEGESEFCNKILPNYNAKC-----IYVSDIL--PLE--------TIEKFT- 243
           P++ L+  GD   S   N I+     K      IY SDI   P E        +I+K   
Sbjct: 218 PIQ-LVHKGDVSASSM-NMIIQAGRGKIEDKQGIY-SDISEHPQEIWFVNAARSIKKGNL 274

Query: 244 --FKGYQFKSLALVASSFENLLLLDADNFPIKPLDNIFNEEPYLSTGLVMWPD 294
             F+ +  K +A + +SFE ++L+D+D  P      +F+   Y  TG   + D
Sbjct: 275 DLFQRFSNKWIASLFNSFEEMILMDSDVVPFLNPKELFDATEYRETGAYFFKD 327

>KAFR0K01240 Chr11 complement(258683..260683) [2001 bp, 666 aa] {ON}
           Anc_7.123 YIL014W
          Length = 666

 Score = 35.4 bits (80), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 62/283 (21%), Positives = 112/283 (39%), Gaps = 49/283 (17%)

Query: 169 KGSGIAT---VGGGKFSLMSFLIIKTLRNMGTTLPVEVLIPPGDEGESEFCNKILPNYNA 225
           KG GI T   +G  K   + +  +K L  +  TLP++++   G     E   + L +Y+ 
Sbjct: 263 KGRGIVTTLPIGDIK---LFYKQLKVLDYLNNTLPIQIVTTGG--ASVELFIEELKSYSK 317

Query: 226 KC---IYVSDILPL--ETIEKFTFKGYQFKSLALVASSFENLLLLDADNFPIKPLDNIFN 280
                I + D  P+   +      + +  K ++++ ++FE ++ +D D  P    +  F 
Sbjct: 318 STHQKILLIDTSPMLNTSFASLYIRFFSNKWISILFNTFEEMIFMDVDVVPFVNPNEFFE 377

Query: 281 EEPYLSTGLVMWPDFWRRTTHPLYYEI----------ADITVNMKNRV-----RNSQDDL 325
            + Y  TG+ M+ D      H   Y I           +  +  KN V     R S D  
Sbjct: 378 IDGYKETGIFMYKDRALLNEHTFQYCIDTFRGLEPSMQENELLSKNHVLDRLLRGSSDK- 436

Query: 326 TPPAIYTKNSNDLGGVPLS----DLDGTIPDVSTESGQLMINKTKHLATALLSLFYNVNG 381
                 +K++ D  G   +     +D  +  V  +SG ++I+K +     L+S   N++ 
Sbjct: 437 ------SKSAKDQTGQQQTFNSFFIDQKLHHV--DSGLVVIDKKRKFDGILMSFLLNID- 487

Query: 382 PNWYYPIFSQKAAGEGDKETFIAAANFYGLSFYQVKTRTGVEG 424
                  +  +    GDKE F     F G  +    T  G+ G
Sbjct: 488 -------WKTQRCVYGDKEVFWLGHLFAGSDYAIDATYAGLLG 523

>NCAS0I00480 Chr9 (77950..79923) [1974 bp, 657 aa] {ON} 
          Length = 657

 Score = 35.0 bits (79), Expect = 0.54,   Method: Compositional matrix adjust.
 Identities = 53/232 (22%), Positives = 93/232 (40%), Gaps = 36/232 (15%)

Query: 188 IIKTLRNMGTTLPVEVLIPPGD-EGES-EFCNKILPNYNAKC--IYVSDILPLETIEKFT 243
           +I TL+ +  TLP++++    D E E+ E  N+ L   + +   I  S IL  + +++  
Sbjct: 267 LIATLQEVKNTLPIQIITTGQDFEKETFESMNRFLQTTDQQVSLIDCSSILDADFVKEH- 325

Query: 244 FKGYQFKSLALVASSFENLLLLDADNFPIKPLDNIFNEEPYLSTGLVMWPDFW---RRT- 299
              +  K    + ++FE +++LDAD+ P    +  F  + Y   G   + D      RT 
Sbjct: 326 IASHLHKWFGTLFNTFEEVVILDADSVPFVAPETFFKNKEYKDAGSFFFRDKTLGNERTY 385

Query: 300 ---------THPLYYEIADITVNMKNRVRNSQDDLTPPAIYTKNSNDLGGVPLSDLDGTI 350
                      P   E   I   +K    N  +D + PA    N+   G     +LD   
Sbjct: 386 QYCIEMIEAMEPSKAESGLINTKLKFTSNNPPEDNSSPAASVYNTF-FGKYKHKNLD--- 441

Query: 351 PDVSTESGQLMINKTKHLATALLSLFYNVNGPNWYYPIFSQKAAGEGDKETF 402
                 SG +++ K + L + L+    N++           K    G+KE F
Sbjct: 442 ------SGVVVLKKKEKLTSLLMGFMMNLDA--------KMKQCVSGEKELF 479

>Kwal_55.22238 s55 complement(1166321..1168075) [1755 bp, 584 aa]
           {ON} YNR059W (MNT4) - Product of gene unknown [contig
           697] FULL
          Length = 584

 Score = 35.0 bits (79), Expect = 0.55,   Method: Compositional matrix adjust.
 Identities = 34/147 (23%), Positives = 62/147 (42%), Gaps = 19/147 (12%)

Query: 165 KGTYKGSGIA-TVGGGKFSLMSFLIIKTLRNMGTTLPVEVLIPPGDEGESEFCNKILPNY 223
           K +  G GI  ++G G  S +  L+ + LR +G  LP++ L+  GD   +     I    
Sbjct: 183 KESMNGRGIVISLGEGGVSDVKRLL-RVLRTVGNRLPIQ-LVHKGDLSRAAMQEIINIGR 240

Query: 224 NAKCIYVSDIL----------------PLETIEKFTFKGYQFKSLALVASSFENLLLLDA 267
               + + D+                  + +     FK +  K +A + +SFE ++L+D 
Sbjct: 241 GDVIVEIGDVSQSIGNPQDIWFVDAGKSVNSSSAHLFKRFSNKWIASLFNSFEEIILMDC 300

Query: 268 DNFPIKPLDNIFNEEPYLSTGLVMWPD 294
           D  P    + +FN   Y  +G + + D
Sbjct: 301 DAVPFVDPELLFNTTEYKESGALFFVD 327

>YGL257C Chr7 complement(12481..14157) [1677 bp, 558 aa] {ON}
           MNT2Mannosyltransferase involved in adding the 4th and
           5th mannose residues of O-linked glycans
          Length = 558

 Score = 35.0 bits (79), Expect = 0.56,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 28/51 (54%)

Query: 244 FKGYQFKSLALVASSFENLLLLDADNFPIKPLDNIFNEEPYLSTGLVMWPD 294
           F  Y  K LAL  SSFE  +L+D+D  P   ++  +  E +  TG++ + D
Sbjct: 255 FTTYSNKWLALTFSSFEIPILMDSDTVPFVSIEKFYELEEFQKTGVLFFKD 305

>Skud_9.158 Chr9 (296090..297979) [1890 bp, 629 aa] {ON} YIL014W
           (REAL)
          Length = 629

 Score = 33.9 bits (76), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 34/131 (25%), Positives = 58/131 (44%), Gaps = 7/131 (5%)

Query: 169 KGSGIATVGGGKFSLMSFLIIKTLRNMGTTLPVEVLIPPGDEGESEFCNKI--LPNYNAK 226
           KG G       K   +    +K +      LP ++ I  G+E   E   KI  +     +
Sbjct: 232 KGRGFVLTIAEKDVPLFIRQLKVMEFSKNELPFQI-ITTGNELSPESIAKISKVAAEGKQ 290

Query: 227 CIYVSD---ILPLETIEKFTFKGYQFKSLALVASSFENLLLLDADNFPIKPLDNIFNEEP 283
            +Y+ D   +L  E    + F  +Q K +A + ++FE  +LLDAD  P    D  F+   
Sbjct: 291 KVYLVDCSTVLESEFSSTYIF-SFQNKWVASLFNTFEEYILLDADVVPFVKSDYFFDSPS 349

Query: 284 YLSTGLVMWPD 294
           Y  +G++++ D
Sbjct: 350 YKGSGILLFKD 360

>ADR020C Chr4 complement(740413..742227) [1815 bp, 604 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YIL014W
           (MNT3)
          Length = 604

 Score = 32.7 bits (73), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 26/108 (24%), Positives = 48/108 (44%), Gaps = 3/108 (2%)

Query: 170 GSGIATVGGGKFSLMSFLIIKTLRNMGTTLPVEVLIPPGDEGESEFCNKI--LPNYNAKC 227
           G GIA     + +     ++  L ++G TLPV+ +   G+  +  F   +  +  ++ + 
Sbjct: 206 GRGIAVAVNDELADSFQALLAVLDHLGNTLPVQAVHNGGELSQRRFDELVAHIQAHSRQQ 265

Query: 228 IYVSDILP-LETIEKFTFKGYQFKSLALVASSFENLLLLDADNFPIKP 274
           ++  D  P L  +    F       LA + +SF+  +LLDA   P  P
Sbjct: 266 VFFVDCTPTLRNMWLRKFARVPPSRLAALFNSFDEFVLLDASAVPFVP 313

>YIL014W Chr9 (326103..327995) [1893 bp, 630 aa] {ON}
           MNT3Alpha-1,3-mannosyltransferase, adds the fourth and
           fifth alpha-1,3-linked mannose residues to O-linked
           glycans during protein O-glycosylation
          Length = 630

 Score = 32.7 bits (73), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 41/175 (23%), Positives = 68/175 (38%), Gaps = 27/175 (15%)

Query: 247 YQFKSLALVASSFENLLLLDADNFPIKPLDNIFNEEPYLSTGLVMWPDFWRRTTHPLYYE 306
           +Q K +A + ++FE  +LLDAD  P    D  F+   Y  +G++++ D          Y 
Sbjct: 314 FQNKWVATLFNTFEEYILLDADVVPFVGSDYFFDSPSYRESGILLFKDRVMENEQTFQY- 372

Query: 307 IADITVNMKNRVRNSQDDLTPPAIYTKNSNDLGGVPLSDLDGTIPDV-----------ST 355
                + M N V  S  +     I ++   D   +P S        V             
Sbjct: 373 ----CIEMLNEVEPSAQERR--FIGSRLVFD-SSLPFSSETSEEASVYYNFFKKLRLHHV 425

Query: 356 ESGQLMINKTKHLATALLSLFYNVNGPNWYYPIFSQKAAGEGDKETFIAAANFYG 410
           +SG +++NK + L   L+S   N++G          +    GDKE F     + G
Sbjct: 426 DSGLVVVNKLEKLNGLLMSFMLNLDG--------KLQRCVYGDKEIFWLGQLYAG 472

>Suva_2.404 Chr2 complement(717797..720718) [2922 bp, 973 aa] {ON}
           YDR238C (REAL)
          Length = 973

 Score = 32.0 bits (71), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 24/98 (24%), Positives = 43/98 (43%), Gaps = 9/98 (9%)

Query: 79  EKLKSFYNNVFNFLMLDSPTGKSARKYNEACQLSGDIGDRPDQYEELYKLSANELSKCLE 138
           EK      N+F  ++      KSA+ Y  A  + G+  ++  + +  +K   N + + + 
Sbjct: 430 EKYPQLRANIFENMVQSLDNVKSAKAYRGALWIMGEYAEKEHEVQHCWKHIRNSVGE-VP 488

Query: 139 LSQDEVARLTKSHKDYVDH--------IASLALPKGTY 168
           + Q E  RLTK+  D  ++           + LP GTY
Sbjct: 489 ILQSEARRLTKNQDDTEENEDDASAKPTGPVILPDGTY 526

>KLLA0D13376g Chr4 (1150858..1152849) [1992 bp, 663 aa] {ON} similar
           to uniprot|P40549 Saccharomyces cerevisiae YIL014W MNT3
           Alpha-1 3-mannosyltransferase adds the fourth and fifth
           alpha-1 3-linked mannose residues to O-linked glycans
           during protein O-glycosylation
          Length = 663

 Score = 32.0 bits (71), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 15/45 (33%), Positives = 29/45 (64%)

Query: 250 KSLALVASSFENLLLLDADNFPIKPLDNIFNEEPYLSTGLVMWPD 294
           K +AL+ ++F   +LLDAD+     L++ F+ + Y  TG++++ D
Sbjct: 351 KWMALLFNTFSECILLDADSVSFASLESYFDFKGYQDTGMLLFRD 395

>SAKL0H19316g Chr8 complement(1705548..1707941) [2394 bp, 797 aa]
           {ON} similar to uniprot|P39106 Saccharomyces cerevisiae
           YER001W MNN1 Alpha-1 3-mannosyltransferase integral
           membrane glycoprotein of the Golgi complex required for
           addition of alpha1 3-mannose linkages to N-linked and O-
           linked oligosaccharides one of five S. cerevisiae
           proteins of the MNN1 family
          Length = 797

 Score = 32.0 bits (71), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 38/154 (24%), Positives = 63/154 (40%), Gaps = 27/154 (17%)

Query: 162 ALPKGTYKGSGIATVGGGKFSLMSFLIIKTLRNMGTTLPVEVLIPPGDEGE--------- 212
           A+ + T K   + ++G G+       ++ TLR  G  LP++V I  GD  E         
Sbjct: 368 AISRKTAKRGIVISLGNGQVDY-GIKLLATLRFQGNKLPIQV-IHKGDLSEDSVRKLTDV 425

Query: 213 ---SEFCNKILPN---------YNAKCIYVSDILPLETIEKFTFKGYQFKSLALVASSFE 260
              +EF   I PN              + VS  L    I +F    ++ K LA+V + F+
Sbjct: 426 AQAAEF--DIPPNSFDNTTDVKQELWFVDVSTTLNPSVINEFD--RFKNKWLAVVFNLFD 481

Query: 261 NLLLLDADNFPIKPLDNIFNEEPYLSTGLVMWPD 294
             + +D D      +++ F    Y  +G V + D
Sbjct: 482 EFVFIDVDAISYVSIEDYFETSEYKDSGTVFFKD 515

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.136    0.399 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 67,259,361
Number of extensions: 3167881
Number of successful extensions: 10375
Number of sequences better than 10.0: 160
Number of HSP's gapped: 10305
Number of HSP's successfully gapped: 167
Length of query: 597
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 482
Effective length of database: 40,294,809
Effective search space: 19422097938
Effective search space used: 19422097938
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 69 (31.2 bits)