Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Smik_16.4063.501ON2122128261e-113
Skud_16.4483.501ON2082127521e-101
YPR154W (PIN3)3.501ON2152157252e-97
Suva_16.4823.501ON2352176985e-93
TPHA0A057203.501ON2202204856e-61
NDAI0B059203.501ON2351344614e-57
TDEL0D056903.501ON2012124575e-57
KNAG0A079903.501ON2212234501e-55
SAKL0F02486g3.501ON2301174511e-55
NCAS0F036003.501ON2372424414e-54
Kpol_480.83.501ON2391304414e-54
Kwal_47.189053.501ON2361444302e-52
Smik_6.2323.501ON2411154033e-48
TBLA0C045303.501ON2222233926e-47
CAGL0F04829g3.501ON2022133872e-46
Suva_7.4243.501ON2491253903e-46
Skud_7.4473.501ON2381513875e-46
KLTH0G02332g3.501ON2331153841e-45
KAFR0G037403.501ON2342443666e-43
AFR320W3.501ON2571343392e-38
ZYRO0D09702g3.501ON1581563302e-38
KNAG0B007503.501ON2171293065e-34
KLLA0E03873g3.501ON2201053003e-33
Ecym_12283.501ON2531292954e-32
ZYRO0G20372gsingletonON150652267e-23
TBLA0D029103.501ON2691142093e-19
Smik_8.472.502ON447731499e-11
TPHA0C040202.502ON485611454e-10
Smik_8.811.356ON468871429e-10
AEL017W1.356ON416721411e-09
TBLA0D049501.356ON468511401e-09
KAFR0D033602.502ON455621402e-09
NCAS0A089901.356ON434611402e-09
SAKL0D09702g1.356ON428681402e-09
KLTH0H12980g1.356ON399671392e-09
KAFR0C044001.356ON459771374e-09
Ecym_27471.356ON452631365e-09
Suva_15.1991.356ON457511356e-09
CAGL0K02761g2.502ON450591357e-09
Kwal_0.3711.356ON217631328e-09
TBLA0B054702.502ON539551358e-09
Skud_8.681.356ON475511348e-09
Smik_7.3351.356ON460591349e-09
YHR016C (YSC84)1.356ON468511349e-09
CAGL0I08965g1.356ON437691341e-08
YFR024C-A (LSB3)1.356ON459591331e-08
TPHA0O012801.356ON454511331e-08
TBLA0A025705.470ON493721331e-08
SAKL0E02200g2.502ON511591332e-08
Kpol_1056.372.502ON501651322e-08
NCAS0B072501.356ON441601322e-08
Suva_8.512.502ON456521312e-08
TDEL0D022401.356ON433601312e-08
KNAG0C020401.356ON464511303e-08
NDAI0A043505.470ON459681294e-08
KLLA0B13475g2.502ON508581295e-08
YHL002W (HSE1)2.502ON452641285e-08
KLTH0D06138g2.502ON489681295e-08
Suva_6.961.356ON455591286e-08
Skud_6.1081.356ON459591286e-08
Ecym_24402.502ON459911278e-08
NDAI0K021302.502ON459581251e-07
TDEL0A027802.502ON451631252e-07
ZYRO0B01298g2.502ON411531242e-07
KLLA0A08360g1.356ON423511242e-07
NCAS0A119205.470ON463691242e-07
NDAI0G059601.356ON423551242e-07
NCAS0A050802.502ON450551232e-07
TBLA0F034901.356ON511511233e-07
NDAI0B045801.356ON424511233e-07
Skud_8.432.502ON454571214e-07
TPHA0E015005.470ON457611215e-07
Kpol_1008.251.356ON449691205e-07
KAFR0A009701.356ON396511206e-07
KNAG0A067102.502ON419671207e-07
TDEL0A033405.470ON473711207e-07
Kwal_26.79022.502ON532531207e-07
KNAG0C046305.470ON516581198e-07
ZYRO0G00792g1.356ON469511198e-07
Ecym_23082.591ON678781199e-07
TPHA0A022101.356ON397511181e-06
KAFR0E036405.470ON441561181e-06
AFR140C5.470ON388831153e-06
ABR008C2.502ON443501143e-06
Skud_4.6615.470ON460551144e-06
SAKL0G03454g5.470ON468561135e-06
CAGL0A02145g1.356ON391591135e-06
ABR082W2.591ON683811135e-06
YDR388W (RVS167)5.470ON482561127e-06
CAGL0M01650g5.470ON466571128e-06
KLTH0F15114g5.470ON435701118e-06
Smik_4.6585.470ON472561118e-06
Kpol_440.105.470ON470681101e-05
Kwal_55.212875.470ON461561091e-05
ZYRO0D11110g5.470ON459571082e-05
KLLA0E03059g5.470ON428591073e-05
KLTH0E09790g2.159ON622671074e-05
YHR114W (BZZ1)2.159ON633591031e-04
KNAG0I015801.356ON581511021e-04
ACR266W2.159ON626541002e-04
TPHA0B028902.159ON634671002e-04
SAKL0H21912g4.108ON1253801003e-04
Ecym_23165.470ON42154976e-04
Smik_8.1922.159ON63359977e-04
Skud_8.1752.159ON63352968e-04
SAKL0G17600g4.335ON44159968e-04
KLLA0C12551g2.591ON60758950.001
Kpol_1072.562.159ON63758940.001
Ecym_25266.366ON52451940.002
Kpol_538.255.170ON70766930.002
ZYRO0G10098g4.108ON139264930.002
Kwal_47.178942.159ON62152920.003
TPHA0F031007.365ON38163910.003
YLR191W (PEX13)7.365ON38689910.003
Kpol_325.126.366ON57084910.003
TPHA0H023806.366ON52867910.003
SAKL0E10780g2.159ON62560900.005
NDAI0I002206.366ON61567900.005
ZYRO0D17358g6.366ON66863890.006
AGR306C5.170ON92358890.006
Suva_15.3102.159ON63491890.007
Skud_12.2567.365ON40389880.008
KAFR0J026506.366ON55350870.011
NDAI0B043202.159ON632112870.012
NDAI0J008508.344ON24556860.012
Suva_10.2877.365ON39263860.013
Kpol_2000.28.344ON22550840.018
Smik_3.1866.366ON59153850.018
Skud_3.1606.366ON58653850.019
TBLA0B096202.319ON94167850.020
CAGL0E01045g8.344ON21350830.020
Ecym_54262.159ON67256850.022
Suva_3.1246.366ON60053850.022
TPHA0G009302.319ON82489850.022
Ecym_33662.319ON906102850.023
TBLA0I010807.413ON155591850.025
YCR088W (ABP1)6.366ON59253830.032
TDEL0B052202.159ON61352830.032
SAKL0A00594g6.366ON63651830.039
TBLA0F002806.366ON57651820.042
Ecym_42288.344ON26152810.045
CAGL0C03597g6.366ON58053820.049
SAKL0E06820g2.319ON90552820.052
KNAG0I027006.366ON57550820.053
SAKL0B11176g2.591ON63363820.054
NCAS0B069802.159ON63970820.056
ADL288C2.319ON92561810.060
TPHA0K007207.413ON101169810.060
KLLA0F23848g2.159ON64949810.067
Kpol_1045.277.413ON88074810.069
Kpol_534.62.319ON88653810.077
AER140C4.335ON41456800.078
CAGL0H10516g2.319ON88086810.078
KAFR0L015807.365ON34463800.079
Kwal_26.83232.591ON62763800.079
Smik_13.2022.591ON66369800.081
KLLA0D16874g8.344ON22751790.084
NCAS0A145707.419ON35553800.084
KLLA0A04983g4.108ON125168800.085
Kwal_47.169434.335ON46057790.095
ZYRO0B16214g2.159ON65967800.096
KAFR0E031608.539ON55490790.098
SAKL0H15048g8.344ON20750780.10
Suva_2.1184.108ON116698800.10
NCAS0D047406.366ON59471790.11
SAKL0H10098g8.539ON55588790.12
AGL237C6.366ON57851780.15
KNAG0C029104.108ON124455780.15
TBLA0C055602.159ON67350780.16
Kwal_23.64376.366ON63151780.17
Suva_2.564singletonON4320690.17
Kwal_33.148357.365ON38462770.18
KAFR0B058608.344ON24950760.18
KLLA0E23365g8.539ON57551770.19
TDEL0E055204.45ON158983770.21
Smik_2.1134.108ON123072770.24
ACR230C7.365ON39862760.25
TBLA0D004507.413ON100554760.26
KAFR0L018807.413ON93054760.26
Kwal_53.194498.344ON19981740.27
TDEL0A078106.366ON55850760.27
YBL085W (BOI1)7.413ON98055760.27
KLLA0E06953g7.419ON35752750.30
Skud_2.1044.108ON121498760.30
YBL007C (SLA1)4.108ON124452760.31
CAGL0E02783g4.108ON1203101760.31
KLLA0D09306g4.45ON153786760.33
NCAS0B060202.319ON86455750.35
TBLA0A076107.365ON41376750.35
Ecym_11678.539ON55055750.35
KLTH0H09416g4.45ON152870750.35
Suva_2.3268.344ON24050740.38
KLLA0F14575g5.170ON85155750.40
KLTH0G11682g8.344ON18750730.44
KLTH0A07348g6.366ON62651740.44
Ecym_11474.335ON42256740.44
Skud_4.4208.344ON23369730.46
NDAI0A033304.108ON122697740.47
Suva_2.337.413ON98255740.47
YLL017WsingletonOFF10339700.49
TDEL0F046808.344ON26450730.53
YDR162C (NBP2)8.344ON23669720.54
KLTH0C06028g7.419ON34259730.55
KLLA0F10175g6.366ON57666740.55
ZYRO0B02706g7.365ON39663730.55
CAGL0A04147g7.365ON39178730.57
TDEL0G024902.319ON85053730.59
Smik_4.1512.382ON54558730.63
Smik_4.1192.319ON88753730.65
YDL117W (CYK3)2.319ON88553730.68
Suva_4.1292.319ON88753730.68
YMR032W (HOF1)2.591ON66968730.69
ZYRO0F13882g8.344ON28853720.69
Suva_5.2397.419ON36853720.69
TDEL0C018207.365ON38963720.73
Skud_2.237.413ON98255730.75
ZYRO0A02662g2.319ON88653720.82
Skud_4.1372.319ON88753720.82
CAGL0E03476g4.45ON156463720.89
NDAI0B033302.319ON91953720.96
CAGL0C01881g7.413ON99953721.0
SAKL0H24222g4.45ON152659721.1
Smik_4.4068.344ON23550701.1
NCAS0A145307.413ON102355711.1
Smik_2.357.413ON98555711.2
KNAG0C033907.419ON34253701.4
TPHA0F003804.45ON161852711.4
TDEL0F023804.108ON125560711.4
NDAI0A015007.413ON104754701.5
KAFR0K020007.419ON33247691.6
SAKL0F12958g7.413ON102755701.6
KNAG0A050208.344ON27050691.7
KNAG0H035002.159ON63466701.7
KLLA0E21891g2.382ON54769691.8
KLTH0C06182g7.413ON102554701.8
Kpol_457.12singletonON56751691.9
Kwal_27.107337.413ON101454691.9
KLTH0E07744g4.108ON124964692.0
CAGL0M05357g8.539ON55795692.0
YDL085W (NDE2)2.382ON54558692.0
NCAS0A034904.108ON123599692.1
KAFR0I023501.421ON250102682.1
TDEL0C028107.419ON33747682.3
Suva_4.161singletonON24842682.3
NDAI0A014707.419ON36753682.4
CAGL0F05885g2.591ON71263682.5
Skud_4.1702.382ON54542682.6
Suva_5.2357.413ON104355682.7
Smik_5.2637.419ON36853682.7
Skud_13.1882.591ON66968682.7
NOTE: 1 genes in the same pillar as Smik_16.406 were not hit in these BLAST results
LIST: YGR136W

BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Smik_16.406
         (212 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Smik_16.406 Chr16 (706485..707123) [639 bp, 212 aa] {ON} YPR154W...   322   e-113
Skud_16.448 Chr16 (788136..788762) [627 bp, 208 aa] {ON} YPR154W...   294   e-101
YPR154W Chr16 (834565..835212) [648 bp, 215 aa] {ON}  PIN3Protei...   283   2e-97
Suva_16.482 Chr16 (830850..831557) [708 bp, 235 aa] {ON} YPR154W...   273   5e-93
TPHA0A05720 Chr1 (1293214..1293876) [663 bp, 220 aa] {ON} Anc_3....   191   6e-61
NDAI0B05920 Chr2 (1429564..1430271) [708 bp, 235 aa] {ON} Anc_3....   182   4e-57
TDEL0D05690 Chr4 (1022136..1022741) [606 bp, 201 aa] {ON} Anc_3....   180   5e-57
KNAG0A07990 Chr1 (1272958..1273623) [666 bp, 221 aa] {ON} Anc_3....   177   1e-55
SAKL0F02486g Chr6 complement(216399..217091) [693 bp, 230 aa] {O...   178   1e-55
NCAS0F03600 Chr6 (715784..716497) [714 bp, 237 aa] {ON} Anc_3.50...   174   4e-54
Kpol_480.8 s480 complement(17610..18329) [720 bp, 239 aa] {ON} c...   174   4e-54
Kwal_47.18905 s47 (1021428..1022138) [711 bp, 236 aa] {ON} YPR15...   170   2e-52
Smik_6.232 Chr6 (380319..381044) [726 bp, 241 aa] {ON} YGR136W (...   159   3e-48
TBLA0C04530 Chr3 (1097179..1097847) [669 bp, 222 aa] {ON} Anc_3....   155   6e-47
CAGL0F04829g Chr6 (487684..488292) [609 bp, 202 aa] {ON} similar...   153   2e-46
Suva_7.424 Chr7 (732619..733368) [750 bp, 249 aa] {ON} YGR136W (...   154   3e-46
Skud_7.447 Chr7 (741615..742331) [717 bp, 238 aa] {ON} YGR136W (...   153   5e-46
KLTH0G02332g Chr7 complement(184383..185084) [702 bp, 233 aa] {O...   152   1e-45
KAFR0G03740 Chr7 (767426..768130) [705 bp, 234 aa] {ON} Anc_3.50...   145   6e-43
AFR320W Chr6 (1014675..1015448) [774 bp, 257 aa] {ON} Syntenic h...   135   2e-38
ZYRO0D09702g Chr4 complement(823900..824376) [477 bp, 158 aa] {O...   131   2e-38
KNAG0B00750 Chr2 complement(140620..141273) [654 bp, 217 aa] {ON...   122   5e-34
KLLA0E03873g Chr5 complement(354700..355362) [663 bp, 220 aa] {O...   120   3e-33
Ecym_1228 Chr1 complement(473518..474279) [762 bp, 253 aa] {ON} ...   118   4e-32
ZYRO0G20372g Chr7 (1680364..1680816) [453 bp, 150 aa] {ON} weakl...    92   7e-23
TBLA0D02910 Chr4 complement(717010..717819) [810 bp, 269 aa] {ON...    85   3e-19
Smik_8.47 Chr8 (81503..82846) [1344 bp, 447 aa] {ON} YHL002W (REAL)    62   9e-11
TPHA0C04020 Chr3 complement(861629..863086) [1458 bp, 485 aa] {O...    60   4e-10
Smik_8.81 Chr8 complement(117184..118543,118714..118760) [1407 b...    59   9e-10
AEL017W Chr5 (603303..603349,603451..604654) [1251 bp, 416 aa] {...    59   1e-09
TBLA0D04950 Chr4 complement(1216633..1218039) [1407 bp, 468 aa] ...    59   1e-09
KAFR0D03360 Chr4 complement(658469..659836) [1368 bp, 455 aa] {O...    59   2e-09
NCAS0A08990 Chr1 complement(1780800..1782036,1782134..1782201) [...    59   2e-09
SAKL0D09702g Chr4 complement(805912..807151,807326..807372) [128...    59   2e-09
KLTH0H12980g Chr8 complement(1110123..1111259,1111344..1111406) ...    58   2e-09
KAFR0C04400 Chr3 (868668..868714,868802..870134) [1380 bp, 459 a...    57   4e-09
Ecym_2747 Chr2 complement(1449887..1451198,1451401..1451447) [13...    57   5e-09
Suva_15.199 Chr15 complement(345409..346735,346904..346950) [137...    57   6e-09
CAGL0K02761g Chr11 (249893..251245) [1353 bp, 450 aa] {ON} simil...    57   7e-09
Kwal_0.371 s0 complement(179002..179655) [654 bp, 217 aa] {ON} Y...    55   8e-09
TBLA0B05470 Chr2 complement(1301018..1302637) [1620 bp, 539 aa] ...    57   8e-09
Skud_8.68 Chr8 complement(118475..119855,120025..120071) [1428 b...    56   8e-09
Smik_7.335 Chr7 complement(563424..564759,564853..564899) [1383 ...    56   9e-09
YHR016C Chr8 complement(136881..138240,138409..138455) [1407 bp,...    56   9e-09
CAGL0I08965g Chr9 complement(869942..871255) [1314 bp, 437 aa] {...    56   1e-08
YFR024C-A Chr6 complement(201960..203292,203387..203433) [1380 b...    56   1e-08
TPHA0O01280 Chr15 complement(252746..254110) [1365 bp, 454 aa] {...    56   1e-08
TBLA0A02570 Chr1 complement(622892..624373) [1482 bp, 493 aa] {O...    56   1e-08
SAKL0E02200g Chr5 complement(171315..172850) [1536 bp, 511 aa] {...    56   2e-08
Kpol_1056.37 s1056 (92852..94357) [1506 bp, 501 aa] {ON} (92852....    55   2e-08
NCAS0B07250 Chr2 complement(1371597..1372875,1373026..1373072) [...    55   2e-08
Suva_8.51 Chr8 (98991..100361) [1371 bp, 456 aa] {ON} YHL002W (R...    55   2e-08
TDEL0D02240 Chr4 (431160..431206,431314..432568) [1302 bp, 433 a...    55   2e-08
KNAG0C02040 Chr3 complement(397447..398841) [1395 bp, 464 aa] {O...    55   3e-08
NDAI0A04350 Chr1 complement(979014..980393) [1380 bp, 459 aa] {O...    54   4e-08
KLLA0B13475g Chr2 complement(1178856..1180382) [1527 bp, 508 aa]...    54   5e-08
YHL002W Chr8 (102612..103970) [1359 bp, 452 aa] {ON}  HSE1Subuni...    54   5e-08
KLTH0D06138g Chr4 (544661..546130) [1470 bp, 489 aa] {ON} simila...    54   5e-08
Suva_6.96 Chr6 complement(167266..168586,168693..168739) [1368 b...    54   6e-08
Skud_6.108 Chr6 complement(197616..198948,199044..199090) [1380 ...    54   6e-08
Ecym_2440 Chr2 (858070..859449) [1380 bp, 459 aa] {ON} similar t...    54   8e-08
NDAI0K02130 Chr11 (481352..482731) [1380 bp, 459 aa] {ON} Anc_2....    53   1e-07
TDEL0A02780 Chr1 (504696..506051) [1356 bp, 451 aa] {ON} Anc_2.5...    53   2e-07
ZYRO0B01298g Chr2 (110004..111239) [1236 bp, 411 aa] {ON} simila...    52   2e-07
KLLA0A08360g Chr1 complement(739092..740316,740718..740764) [127...    52   2e-07
NCAS0A11920 Chr1 (2363750..2365141) [1392 bp, 463 aa] {ON} Anc_5...    52   2e-07
NDAI0G05960 Chr7 (1474282..1475553) [1272 bp, 423 aa] {ON} Anc_1...    52   2e-07
NCAS0A05080 Chr1 (1011572..1012924) [1353 bp, 450 aa] {ON} Anc_2...    52   2e-07
TBLA0F03490 Chr6 (859156..859202,859415..860903) [1536 bp, 511 a...    52   3e-07
NDAI0B04580 Chr2 complement(1138779..1140053) [1275 bp, 424 aa] ...    52   3e-07
Skud_8.43 Chr8 (84125..85489) [1365 bp, 454 aa] {ON} YHL002W (REAL)    51   4e-07
TPHA0E01500 Chr5 complement(304130..305503) [1374 bp, 457 aa] {O...    51   5e-07
Kpol_1008.25 s1008 complement(50905..52207,52597..52643) [1350 b...    51   5e-07
KAFR0A00970 Chr1 (181162..182352) [1191 bp, 396 aa] {ON} Anc_1.3...    51   6e-07
KNAG0A06710 Chr1 complement(1045213..1046472) [1260 bp, 419 aa] ...    51   7e-07
TDEL0A03340 Chr1 (592752..594173) [1422 bp, 473 aa] {ON} Anc_5.4...    51   7e-07
Kwal_26.7902 s26 (560454..562052) [1599 bp, 532 aa] {ON} YHL002W...    51   7e-07
KNAG0C04630 Chr3 (908312..909862) [1551 bp, 516 aa] {ON} Anc_5.4...    50   8e-07
ZYRO0G00792g Chr7 (61277..61323,61435..62797) [1410 bp, 469 aa] ...    50   8e-07
Ecym_2308 Chr2 complement(597163..599199) [2037 bp, 678 aa] {ON}...    50   9e-07
TPHA0A02210 Chr1 (455888..457081) [1194 bp, 397 aa] {ON} Anc_1.3...    50   1e-06
KAFR0E03640 Chr5 complement(731325..732650) [1326 bp, 441 aa] {O...    50   1e-06
AFR140C Chr6 complement(692042..693208) [1167 bp, 388 aa] {ON} S...    49   3e-06
ABR008C Chr2 complement(406780..408111) [1332 bp, 443 aa] {ON} S...    49   3e-06
Skud_4.661 Chr4 (1170843..1172225) [1383 bp, 460 aa] {ON} YDR388...    49   4e-06
SAKL0G03454g Chr7 (284017..285423) [1407 bp, 468 aa] {ON} some s...    48   5e-06
CAGL0A02145g Chr1 (224026..224036,225280..226444) [1176 bp, 391 ...    48   5e-06
ABR082W Chr2 (537500..539551) [2052 bp, 683 aa] {ON} Syntenic ho...    48   5e-06
YDR388W Chr4 (1250186..1251634) [1449 bp, 482 aa] {ON}  RVS167Ac...    48   7e-06
CAGL0M01650g Chr13 complement(184085..185485) [1401 bp, 466 aa] ...    48   8e-06
KLTH0F15114g Chr6 complement(1238921..1240228) [1308 bp, 435 aa]...    47   8e-06
Smik_4.658 Chr4 (1170707..1172125) [1419 bp, 472 aa] {ON} YDR388...    47   8e-06
Kpol_440.10 s440 (25697..27109) [1413 bp, 470 aa] {ON} (25697..2...    47   1e-05
Kwal_55.21287 s55 complement(768495..769880) [1386 bp, 461 aa] {...    47   1e-05
ZYRO0D11110g Chr4 (939064..940443) [1380 bp, 459 aa] {ON} simila...    46   2e-05
KLLA0E03059g Chr5 (281543..282829) [1287 bp, 428 aa] {ON} simila...    46   3e-05
KLTH0E09790g Chr5 (881284..883152) [1869 bp, 622 aa] {ON} simila...    46   4e-05
YHR114W Chr8 (338083..339984) [1902 bp, 633 aa] {ON}  BZZ1SH3 do...    44   1e-04
KNAG0I01580 Chr9 (306534..306580,306733..308431) [1746 bp, 581 a...    44   1e-04
ACR266W Chr3 (838689..840569) [1881 bp, 626 aa] {ON} Syntenic ho...    43   2e-04
TPHA0B02890 Chr2 complement(659614..661518) [1905 bp, 634 aa] {O...    43   2e-04
SAKL0H21912g Chr8 complement(1913307..1917068) [3762 bp, 1253 aa...    43   3e-04
Ecym_2316 Chr2 complement(619368..620633) [1266 bp, 421 aa] {ON}...    42   6e-04
Smik_8.192 Chr8 (314456..316357) [1902 bp, 633 aa] {ON} YHR114W ...    42   7e-04
Skud_8.175 Chr8 (311857..313758) [1902 bp, 633 aa] {ON} YHR114W ...    42   8e-04
SAKL0G17600g Chr7 complement(1523623..1524948) [1326 bp, 441 aa]...    42   8e-04
KLLA0C12551g Chr3 complement(1065593..1067416) [1824 bp, 607 aa]...    41   0.001
Kpol_1072.56 s1072 complement(127771..129684) [1914 bp, 637 aa] ...    41   0.001
Ecym_2526 Chr2 (1025422..1026996) [1575 bp, 524 aa] {ON} similar...    41   0.002
Kpol_538.25 s538 (50807..52930) [2124 bp, 707 aa] {ON} (50807..5...    40   0.002
ZYRO0G10098g Chr7 complement(808399..812577) [4179 bp, 1392 aa] ...    40   0.002
Kwal_47.17894 s47 (597826..599691) [1866 bp, 621 aa] {ON} YHR114...    40   0.003
TPHA0F03100 Chr6 complement(680407..681552) [1146 bp, 381 aa] {O...    40   0.003
YLR191W Chr12 (537272..538432) [1161 bp, 386 aa] {ON}  PEX13Inte...    40   0.003
Kpol_325.12 s325 (19571..21283) [1713 bp, 570 aa] {ON} (19571..2...    40   0.003
TPHA0H02380 Chr8 (558973..560559) [1587 bp, 528 aa] {ON} Anc_6.3...    40   0.003
SAKL0E10780g Chr5 (897714..899591) [1878 bp, 625 aa] {ON} simila...    39   0.005
NDAI0I00220 Chr9 (32281..34128) [1848 bp, 615 aa] {ON} Anc_6.366...    39   0.005
ZYRO0D17358g Chr4 (1429127..1431133) [2007 bp, 668 aa] {ON} simi...    39   0.006
AGR306C Chr7 complement(1305647..1308418) [2772 bp, 923 aa] {ON}...    39   0.006
Suva_15.310 Chr15 (540462..542366) [1905 bp, 634 aa] {ON} YHR114...    39   0.007
Skud_12.256 Chr12 (483859..485070) [1212 bp, 403 aa] {ON} YLR191...    39   0.008
KAFR0J02650 Chr10 complement(510356..512017) [1662 bp, 553 aa] {...    38   0.011
NDAI0B04320 Chr2 (1084783..1086681) [1899 bp, 632 aa] {ON} Anc_2...    38   0.012
NDAI0J00850 Chr10 (189221..189958) [738 bp, 245 aa] {ON} Anc_8.3...    38   0.012
Suva_10.287 Chr10 (509884..511062) [1179 bp, 392 aa] {ON} YLR191...    38   0.013
Kpol_2000.2 s2000 complement(1407..2084) [678 bp, 225 aa] {ON} c...    37   0.018
Smik_3.186 Chr3 (264667..266442) [1776 bp, 591 aa] {ON} YCR088W ...    37   0.018
Skud_3.160 Chr3 (249584..251344) [1761 bp, 586 aa] {ON} YCR088W ...    37   0.019
TBLA0B09620 Chr2 complement(2277581..2280406) [2826 bp, 941 aa] ...    37   0.020
CAGL0E01045g Chr5 (94265..94906) [642 bp, 213 aa] {ON} similar t...    37   0.020
Ecym_5426 Chr5 (877285..879303) [2019 bp, 672 aa] {ON} similar t...    37   0.022
Suva_3.124 Chr3 (182459..184261) [1803 bp, 600 aa] {ON} YCR088W ...    37   0.022
TPHA0G00930 Chr7 (179525..181999) [2475 bp, 824 aa] {ON} Anc_2.3...    37   0.022
Ecym_3366 Chr3 complement(695872..698592) [2721 bp, 906 aa] {ON}...    37   0.023
TBLA0I01080 Chr9 (218200..222867) [4668 bp, 1555 aa] {ON} Anc_7....    37   0.025
YCR088W Chr3 (265068..266846) [1779 bp, 592 aa] {ON}  ABP1Actin-...    37   0.032
TDEL0B05220 Chr2 complement(918098..919939) [1842 bp, 613 aa] {O...    37   0.032
SAKL0A00594g Chr1 complement(68426..70336) [1911 bp, 636 aa] {ON...    37   0.039
TBLA0F00280 Chr6 complement(58186..59916) [1731 bp, 576 aa] {ON}...    36   0.042
Ecym_4228 Chr4 (475985..476770) [786 bp, 261 aa] {ON} similar to...    36   0.045
CAGL0C03597g Chr3 complement(358731..360473) [1743 bp, 580 aa] {...    36   0.049
SAKL0E06820g Chr5 complement(556960..559677) [2718 bp, 905 aa] {...    36   0.052
KNAG0I02700 Chr9 complement(531880..533607) [1728 bp, 575 aa] {O...    36   0.053
SAKL0B11176g Chr2 (974922..976823) [1902 bp, 633 aa] {ON} simila...    36   0.054
NCAS0B06980 Chr2 (1328203..1330122) [1920 bp, 639 aa] {ON} Anc_2...    36   0.056
ADL288C Chr4 complement(194687..197464) [2778 bp, 925 aa] {ON} S...    36   0.060
TPHA0K00720 Chr11 (147285..150320) [3036 bp, 1011 aa] {ON} Anc_7...    36   0.060
KLLA0F23848g Chr6 (2224951..2226900) [1950 bp, 649 aa] {ON} simi...    36   0.067
Kpol_1045.27 s1045 (60696..63338) [2643 bp, 880 aa] {ON} (60698....    36   0.069
Kpol_534.6 s534 (20451..23111) [2661 bp, 886 aa] {ON} (20451..23...    36   0.077
AER140C Chr5 complement(901101..902345) [1245 bp, 414 aa] {ON} N...    35   0.078
CAGL0H10516g Chr8 complement(1024427..1027069) [2643 bp, 880 aa]...    36   0.078
KAFR0L01580 Chr12 complement(286684..287718) [1035 bp, 344 aa] {...    35   0.079
Kwal_26.8323 s26 (739043..740926) [1884 bp, 627 aa] {ON} YMR032W...    35   0.079
Smik_13.202 Chr13 (329496..331487) [1992 bp, 663 aa] {ON} YMR032...    35   0.081
KLLA0D16874g Chr4 complement(1430953..1431636) [684 bp, 227 aa] ...    35   0.084
NCAS0A14570 Chr1 complement(2869713..2870780) [1068 bp, 355 aa] ...    35   0.084
KLLA0A04983g Chr1 complement(445032..448787) [3756 bp, 1251 aa] ...    35   0.085
Kwal_47.16943 s47 (182308..183690) [1383 bp, 460 aa] {ON} YDR388...    35   0.095
ZYRO0B16214g Chr2 (1312950..1314929) [1980 bp, 659 aa] {ON} simi...    35   0.096
KAFR0E03160 Chr5 complement(632974..634638) [1665 bp, 554 aa] {O...    35   0.098
SAKL0H15048g Chr8 (1304135..1304758) [624 bp, 207 aa] {ON} some ...    35   0.10 
Suva_2.118 Chr2 complement(206707..206754,206785..206832,206899....    35   0.10 
NCAS0D04740 Chr4 complement(909728..911512) [1785 bp, 594 aa] {O...    35   0.11 
SAKL0H10098g Chr8 (865874..865882,865987..867645) [1668 bp, 555 ...    35   0.12 
AGL237C Chr7 complement(254636..256372) [1737 bp, 578 aa] {ON} S...    35   0.15 
KNAG0C02910 Chr3 complement(577437..581171) [3735 bp, 1244 aa] {...    35   0.15 
TBLA0C05560 Chr3 complement(1346488..1348509) [2022 bp, 673 aa] ...    35   0.16 
Kwal_23.6437 s23 (1581839..1583734) [1896 bp, 631 aa] {ON} YCR08...    35   0.17 
Suva_2.564 Chr2 (1002523..1002651) [129 bp, 43 aa] {ON} YDR388W ...    31   0.17 
Kwal_33.14835 s33 (834951..836105) [1155 bp, 384 aa] {ON} YLR191...    34   0.18 
KAFR0B05860 Chr2 complement(1210822..1211571) [750 bp, 249 aa] {...    34   0.18 
KLLA0E23365g Chr5 complement(2077042..2078760,2078979..2078987) ...    34   0.19 
TDEL0E05520 Chr5 (1015520..1020289) [4770 bp, 1589 aa] {ON} Anc_...    34   0.21 
Smik_2.113 Chr2 complement(205503..206218,206252..209228) [3693 ...    34   0.24 
ACR230C Chr3 complement(763430..764626) [1197 bp, 398 aa] {ON} S...    34   0.25 
TBLA0D00450 Chr4 (109529..112546) [3018 bp, 1005 aa] {ON} Anc_7....    34   0.26 
KAFR0L01880 Chr12 complement(348028..350820) [2793 bp, 930 aa] {...    34   0.26 
Kwal_53.19449 s53 (58..657) [600 bp, 199 aa] {ON} YDR162C (NBP2)...    33   0.27 
TDEL0A07810 Chr1 (1355773..1357449) [1677 bp, 558 aa] {ON} Anc_6...    34   0.27 
YBL085W Chr2 (63876..66818) [2943 bp, 980 aa] {ON}  BOI1Protein ...    34   0.27 
KLLA0E06953g Chr5 (629777..630850) [1074 bp, 357 aa] {ON} unipro...    33   0.30 
Skud_2.104 Chr2 complement(196129..199773) [3645 bp, 1214 aa] {O...    34   0.30 
YBL007C Chr2 complement(212632..216366) [3735 bp, 1244 aa] {ON} ...    34   0.31 
CAGL0E02783g Chr5 (261665..265276) [3612 bp, 1203 aa] {ON} simil...    34   0.31 
KLLA0D09306g Chr4 (783852..788465) [4614 bp, 1537 aa] {ON} simil...    34   0.33 
NCAS0B06020 Chr2 (1138359..1140953) [2595 bp, 864 aa] {ON} Anc_2...    33   0.35 
TBLA0A07610 Chr1 complement(1888564..1889805) [1242 bp, 413 aa] ...    33   0.35 
Ecym_1167 Chr1 (341453..341461,341739..343382) [1653 bp, 550 aa]...    33   0.35 
KLTH0H09416g Chr8 (806836..811422) [4587 bp, 1528 aa] {ON} simil...    33   0.35 
Suva_2.326 Chr2 complement(574424..575146) [723 bp, 240 aa] {ON}...    33   0.38 
KLLA0F14575g Chr6 complement(1351796..1354351) [2556 bp, 851 aa]...    33   0.40 
KLTH0G11682g Chr7 (984811..985374) [564 bp, 187 aa] {ON} weakly ...    33   0.44 
KLTH0A07348g Chr1 (610049..611929) [1881 bp, 626 aa] {ON} simila...    33   0.44 
Ecym_1147 Chr1 (305106..306374) [1269 bp, 422 aa] {ON} similar t...    33   0.44 
Skud_4.420 Chr4 complement(749749..750450) [702 bp, 233 aa] {ON}...    33   0.46 
NDAI0A03330 Chr1 complement(756761..760441) [3681 bp, 1226 aa] {...    33   0.47 
Suva_2.33 Chr2 (60529..63477) [2949 bp, 982 aa] {ON} YBL085W (REAL)    33   0.47 
YLL017W Chr12 (112234..112545) [312 bp, 103 aa] {OFF} Non-essent...    32   0.49 
TDEL0F04680 Chr6 complement(881920..882714) [795 bp, 264 aa] {ON...    33   0.53 
YDR162C Chr4 complement(780390..781100) [711 bp, 236 aa] {ON}  N...    32   0.54 
KLTH0C06028g Chr3 (520445..521473) [1029 bp, 342 aa] {ON} simila...    33   0.55 
KLLA0F10175g Chr6 complement(944501..946231) [1731 bp, 576 aa] {...    33   0.55 
ZYRO0B02706g Chr2 complement(218864..220054) [1191 bp, 396 aa] {...    33   0.55 
CAGL0A04147g Chr1 complement(411674..412849) [1176 bp, 391 aa] {...    33   0.57 
TDEL0G02490 Chr7 (478524..481076) [2553 bp, 850 aa] {ON} Anc_2.3...    33   0.59 
Smik_4.151 Chr4 (279705..281342) [1638 bp, 545 aa] {ON} YDL085W ...    33   0.63 
Smik_4.119 Chr4 (225256..227919) [2664 bp, 887 aa] {ON} YDL117W ...    33   0.65 
YDL117W Chr4 (248581..251238) [2658 bp, 885 aa] {ON}  CYK3SH3-do...    33   0.68 
Suva_4.129 Chr4 (237039..239702) [2664 bp, 887 aa] {ON} YDL117W ...    33   0.68 
YMR032W Chr13 (335298..337307) [2010 bp, 669 aa] {ON}  HOF1Bud n...    33   0.69 
ZYRO0F13882g Chr6 complement(1143280..1144146) [867 bp, 288 aa] ...    32   0.69 
Suva_5.239 Chr5 complement(373672..374778) [1107 bp, 368 aa] {ON...    32   0.69 
TDEL0C01820 Chr3 (318850..320019) [1170 bp, 389 aa] {ON} Anc_7.3...    32   0.73 
Skud_2.23 Chr2 (47507..50455) [2949 bp, 982 aa] {ON} YBL085W (REAL)    33   0.75 
ZYRO0A02662g Chr1 (213322..215982) [2661 bp, 886 aa] {ON} simila...    32   0.82 
Skud_4.137 Chr4 (244217..246880) [2664 bp, 887 aa] {ON} YDL117W ...    32   0.82 
CAGL0E03476g Chr5 complement(319193..323887) [4695 bp, 1564 aa] ...    32   0.89 
NDAI0B03330 Chr2 (848506..851265) [2760 bp, 919 aa] {ON} Anc_2.3...    32   0.96 
CAGL0C01881g Chr3 (196299..199298) [3000 bp, 999 aa] {ON} simila...    32   1.0  
SAKL0H24222g Chr8 complement(2089734..2094314) [4581 bp, 1526 aa...    32   1.1  
Smik_4.406 Chr4 complement(738389..739096) [708 bp, 235 aa] {ON}...    32   1.1  
NCAS0A14530 Chr1 complement(2863100..2866171) [3072 bp, 1023 aa]...    32   1.1  
Smik_2.35 Chr2 (57476..60433) [2958 bp, 985 aa] {ON} YBL085W (REAL)    32   1.2  
KNAG0C03390 Chr3 (667055..668083) [1029 bp, 342 aa] {ON} Anc_7.4...    32   1.4  
TPHA0F00380 Chr6 (85560..90416) [4857 bp, 1618 aa] {ON} Anc_4.45...    32   1.4  
TDEL0F02380 Chr6 (438262..442029) [3768 bp, 1255 aa] {ON} Anc_4....    32   1.4  
NDAI0A01500 Chr1 (331951..335094) [3144 bp, 1047 aa] {ON} Anc_7....    32   1.5  
KAFR0K02000 Chr11 complement(410316..411314) [999 bp, 332 aa] {O...    31   1.6  
SAKL0F12958g Chr6 complement(1019015..1022098) [3084 bp, 1027 aa...    32   1.6  
KNAG0A05020 Chr1 (731413..732225) [813 bp, 270 aa] {ON} Anc_8.34...    31   1.7  
KNAG0H03500 Chr8 (652236..654140) [1905 bp, 634 aa] {ON} Anc_2.1...    32   1.7  
KLLA0E21891g Chr5 (1954118..1955761) [1644 bp, 547 aa] {ON} simi...    31   1.8  
KLTH0C06182g Chr3 (535274..538351) [3078 bp, 1025 aa] {ON} simil...    32   1.8  
Kpol_457.12 s457 complement(23020..24723) [1704 bp, 567 aa] {ON}...    31   1.9  
Kwal_27.10733 s27 (473078..476122) [3045 bp, 1014 aa] {ON} YER11...    31   1.9  
KLTH0E07744g Chr5 complement(710793..714542) [3750 bp, 1249 aa] ...    31   2.0  
CAGL0M05357g Chr13 (572309..573982) [1674 bp, 557 aa] {ON} simil...    31   2.0  
YDL085W Chr4 (303211..304848) [1638 bp, 545 aa] {ON}  NDE2Mitoch...    31   2.0  
NCAS0A03490 Chr1 complement(689871..693578) [3708 bp, 1235 aa] {...    31   2.1  
KAFR0I02350 Chr9 complement(473466..474218) [753 bp, 250 aa] {ON...    31   2.1  
TDEL0C02810 Chr3 complement(498625..499638) [1014 bp, 337 aa] {O...    31   2.3  
Suva_4.161 Chr4 (293198..293944) [747 bp, 248 aa] {ON} YDL085W (...    31   2.3  
NDAI0A01470 Chr1 (326531..327634) [1104 bp, 367 aa] {ON} Anc_7.4...    31   2.4  
CAGL0F05885g Chr6 (588828..590966) [2139 bp, 712 aa] {ON} simila...    31   2.5  
Skud_4.170 Chr4 (298687..300324) [1638 bp, 545 aa] {ON} YDL085W ...    31   2.6  
Suva_5.235 Chr5 complement(366285..369416) [3132 bp, 1043 aa] {O...    31   2.7  
Smik_5.263 Chr5 complement(407025..408131) [1107 bp, 368 aa] {ON...    31   2.7  
Skud_13.188 Chr13 (322010..324019) [2010 bp, 669 aa] {ON} YMR032...    31   2.7  
TBLA0E01560 Chr5 (365693..369877) [4185 bp, 1394 aa] {ON} Anc_4....    31   2.8  
NCAS0D01950 Chr4 (358938..361757) [2820 bp, 939 aa] {ON} Anc_5.170     31   2.8  
ZYRO0B04004g Chr2 complement(337594..338709) [1116 bp, 371 aa] {...    30   3.0  
ZYRO0B03850g Chr2 complement(320570..323839) [3270 bp, 1089 aa] ...    31   3.1  
Kwal_27.10707 s27 (457482..458513) [1032 bp, 343 aa] {ON} YER118...    30   3.2  
Suva_13.201 Chr13 (325718..327724) [2007 bp, 668 aa] {ON} YMR032...    30   3.2  
KNAG0B02230 Chr2 (431524..434238) [2715 bp, 904 aa] {ON} Anc_7.4...    31   3.3  
SAKL0E05302g Chr5 complement(431939..433546) [1608 bp, 535 aa] {...    30   3.5  
AGL293C Chr7 complement(156902..159856) [2955 bp, 984 aa] {ON} S...    30   3.7  
TDEL0C02730 Chr3 complement(479746..482796) [3051 bp, 1016 aa] {...    30   3.7  
TBLA0C04100 Chr3 (990555..994463) [3909 bp, 1302 aa] {ON} Anc_4....    30   4.0  
AGL286C Chr7 complement(174535..175527) [993 bp, 330 aa] {ON} Sy...    30   4.3  
ZYRO0F01166g Chr6 complement(90553..92799) [2247 bp, 748 aa] {ON...    30   4.4  
KLTH0H15708g Chr8 complement(1356162..1357778) [1617 bp, 538 aa]...    30   4.6  
KAFR0F00750 Chr6 complement(145999..147807) [1809 bp, 602 aa] {O...    30   4.6  
Ecym_7141 Chr7 (283803..286892) [3090 bp, 1029 aa] {ON} similar ...    30   4.8  
Scer_YGOB_SDC25 Chr12 (112234..112506,112508..115993) [3759 bp, ...    30   4.9  
NDAI0C02830 Chr3 complement(651724..654657) [2934 bp, 977 aa] {O...    30   5.0  
Kwal_47.17481 s47 complement(421795..425544) [3750 bp, 1249 aa] ...    30   5.0  
Kwal_34.15827 s34 (76814..78424) [1611 bp, 536 aa] {ON} YMR145C ...    30   5.0  
Smik_5.259 Chr5 complement(399447..402572) [3126 bp, 1041 aa] {O...    30   5.7  
TPHA0C02610 Chr3 complement(577049..579061) [2013 bp, 670 aa] {O...    30   5.7  
Skud_5.265 Chr5 (427799..430930) [3132 bp, 1043 aa] {ON} YER114C...    30   6.0  
Ecym_7134 Chr7 (266402..267400) [999 bp, 332 aa] {ON} similar to...    30   6.2  
KNAG0E02050 Chr5 (419283..420980) [1698 bp, 565 aa] {ON} Anc_2.3...    30   6.2  
TBLA0H01160 Chr8 (259004..259678) [675 bp, 224 aa] {ON} Anc_8.34...    29   6.4  
KAFR0K01960 Chr11 complement(403631..406459) [2829 bp, 942 aa] {...    30   6.4  
YER114C Chr5 complement(390590..393712) [3123 bp, 1040 aa] {ON} ...    30   6.4  
KNAG0C03420 Chr3 (670941..673997) [3057 bp, 1018 aa] {ON} Anc_7....    30   6.6  
NDAI0I03110 Chr9 complement(729539..732637) [3099 bp, 1032 aa] {...    29   8.3  
Suva_10.406 Chr10 complement(713226..717989) [4764 bp, 1587 aa] ...    29   8.8  
AEL241W Chr5 (184639..184647,184836..186476) [1650 bp, 549 aa] {...    29   9.9  

>Smik_16.406 Chr16 (706485..707123) [639 bp, 212 aa] {ON} YPR154W
           (REAL)
          Length = 212

 Score =  322 bits (826), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 166/212 (78%), Positives = 166/212 (78%)

Query: 1   MSASLINRSLTNIRTELDFLKESNVISNDVFDQINKSLPMRWDPPSASRNTSSTSLEYVE 60
           MSASLINRSLTNIRTELDFLKESNVISNDVFDQINKSLPMRWDPPSASRNTSSTSLEYVE
Sbjct: 1   MSASLINRSLTNIRTELDFLKESNVISNDVFDQINKSLPMRWDPPSASRNTSSTSLEYVE 60

Query: 61  ALYQFDPQQDGDLGLKPGDKIQLLEKLSPEWYKGSCNGRTGIFPANYVKPAFSGSNGQSN 120
           ALYQFDPQQDGDLGLKPGDKIQLLEKLSPEWYKGSCNGRTGIFPANYVKPAFSGSNGQSN
Sbjct: 61  ALYQFDPQQDGDLGLKPGDKIQLLEKLSPEWYKGSCNGRTGIFPANYVKPAFSGSNGQSN 120

Query: 121 LPPPPQYKAQELQPVPTQNSAVXXXXXXXXXXXXTNYYXXXXXXXXXXXXXXXXXXXXNS 180
           LPPPPQYKAQELQPVPTQNSAV            TNYY                    NS
Sbjct: 121 LPPPPQYKAQELQPVPTQNSAVSSYQQQPFPPPSTNYYQQPQQAPAPAPQQQQQQQQPNS 180

Query: 181 HNHLKSFGSKLXXXXXXXXXXXXXXDIVNSIF 212
           HNHLKSFGSKL              DIVNSIF
Sbjct: 181 HNHLKSFGSKLGNAAIFGAGASIGSDIVNSIF 212

>Skud_16.448 Chr16 (788136..788762) [627 bp, 208 aa] {ON} YPR154W
           (REAL)
          Length = 208

 Score =  294 bits (752), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 152/212 (71%), Positives = 159/212 (75%), Gaps = 4/212 (1%)

Query: 1   MSASLINRSLTNIRTELDFLKESNVISNDVFDQINKSLPMRWDPPSASRNTSSTSLEYVE 60
           MSASLINRSLT IRTELDFLKESNVIS+DVFDQINKSLP+RW+P SA+R+TSS SLEYVE
Sbjct: 1   MSASLINRSLTTIRTELDFLKESNVISSDVFDQINKSLPVRWNPSSAARDTSSASLEYVE 60

Query: 61  ALYQFDPQQDGDLGLKPGDKIQLLEKLSPEWYKGSCNGRTGIFPANYVKPAFSGSNGQSN 120
           ALYQFDPQQDGDLGLKPGDK+QLLEKLSPEWYKGSCNGR GIFPANYVKPAFSGSNG SN
Sbjct: 61  ALYQFDPQQDGDLGLKPGDKVQLLEKLSPEWYKGSCNGRVGIFPANYVKPAFSGSNGSSN 120

Query: 121 LPPPPQYKAQELQPVPTQNSAVXXXXXXXXXXXXTNYYXXXXXXXXXXXXXXXXXXXXNS 180
           LPPPPQYKAQELQ  PTQNSAV            TNYY                    +S
Sbjct: 121 LPPPPQYKAQELQQAPTQNSAVSSYQQQPFPPPSTNYY----QQPQQQPQQAPPQQQPSS 176

Query: 181 HNHLKSFGSKLXXXXXXXXXXXXXXDIVNSIF 212
           HNHLKSFGSKL              DIVNSIF
Sbjct: 177 HNHLKSFGSKLGNAAIFGAGASIGSDIVNSIF 208

>YPR154W Chr16 (834565..835212) [648 bp, 215 aa] {ON}  PIN3Protein
           that induces appearance of [PIN+] prion when
           overproduced
          Length = 215

 Score =  283 bits (725), Expect = 2e-97,   Method: Compositional matrix adjust.
 Identities = 148/215 (68%), Positives = 156/215 (72%), Gaps = 3/215 (1%)

Query: 1   MSASLINRSLTNIRTELDFLKESNVISNDVFDQINKSLPMRWDPPSASRNTSSTSLEYVE 60
           MSASLINRSLTNIRTELDFLK SNVISNDV+DQINKSLP +WDP +A RN S  SLEYVE
Sbjct: 1   MSASLINRSLTNIRTELDFLKGSNVISNDVYDQINKSLPAKWDPANAPRNASPASLEYVE 60

Query: 61  ALYQFDPQQDGDLGLKPGDKIQLLEKLSPEWYKGSCNGRTGIFPANYVKPAFSGSNGQSN 120
           ALYQFDPQQDGDLGLKPGDK+QLLEKLSPEWYKGSCNGRTGIFPANYVKPAFSGSNG SN
Sbjct: 61  ALYQFDPQQDGDLGLKPGDKVQLLEKLSPEWYKGSCNGRTGIFPANYVKPAFSGSNGPSN 120

Query: 121 LPPPPQYKAQELQPVPTQNSAVXXXXXXXXXXXXTNYY---XXXXXXXXXXXXXXXXXXX 177
           LPPPPQYKAQELQ +PTQNSA             TNYY                      
Sbjct: 121 LPPPPQYKAQELQQIPTQNSAASSYQQQPFPPPSTNYYQQPQQQPQQAPPPQQQQQQQQH 180

Query: 178 XNSHNHLKSFGSKLXXXXXXXXXXXXXXDIVNSIF 212
            +SH+HLKSFGSKL              DIVN+IF
Sbjct: 181 QSSHSHLKSFGSKLGNAAIFGAGASIGSDIVNNIF 215

>Suva_16.482 Chr16 (830850..831557) [708 bp, 235 aa] {ON} YPR154W
           (REAL)
          Length = 235

 Score =  273 bits (698), Expect = 5e-93,   Method: Compositional matrix adjust.
 Identities = 143/217 (65%), Positives = 155/217 (71%), Gaps = 5/217 (2%)

Query: 1   MSASLINRSLTNIRTELDFLKESNVISNDVFDQINKSLPMRWDPPSASRNTSSTSLEYVE 60
           MSASL+NRSLTNIRTELDFLKESNVIS+DVFDQINKSLP++WDP SA R ++S SLEYVE
Sbjct: 19  MSASLVNRSLTNIRTELDFLKESNVISDDVFDQINKSLPVKWDPSSAPRGSNSASLEYVE 78

Query: 61  ALYQFDPQQDGDLGLKPGDKIQLLEKLSPEWYKGSCNGRTGIFPANYVKPAFSGSNGQSN 120
           A+YQFDPQQDGDLGLK GDK+QLLEKLSPEWYKGSCNGRTGIFPANYVKP FS S+GQ  
Sbjct: 79  AVYQFDPQQDGDLGLKQGDKVQLLEKLSPEWYKGSCNGRTGIFPANYVKPVFSDSDGQHR 138

Query: 121 LPPPPQYKAQELQPVPTQNSAVXXXXXXXXXXXXTNYY-----XXXXXXXXXXXXXXXXX 175
           LPPPPQYKAQELQ +PTQNS V            TNYY                      
Sbjct: 139 LPPPPQYKAQELQQIPTQNSNVSSYQPQPFPPPSTNYYQQPLQQPQLQPQQPPPPQQQQQ 198

Query: 176 XXXNSHNHLKSFGSKLXXXXXXXXXXXXXXDIVNSIF 212
              +S+NHLKSFGSKL              DIVNSIF
Sbjct: 199 QQSSSNNHLKSFGSKLGNAAIFGAGASIGSDIVNSIF 235

>TPHA0A05720 Chr1 (1293214..1293876) [663 bp, 220 aa] {ON} Anc_3.501
           YPR154W
          Length = 220

 Score =  191 bits (485), Expect = 6e-61,   Method: Compositional matrix adjust.
 Identities = 111/220 (50%), Positives = 128/220 (58%), Gaps = 8/220 (3%)

Query: 1   MSASLINRSLTNIRTELDFLKESNVISNDVFDQINKSLPMRWDPP------SASRNTSST 54
           MS SLINRSLT IRTEL+FLKES VIS+ VF +IN SLP R+DP       SA+    ST
Sbjct: 1   MSTSLINRSLTTIRTELEFLKESKVISDSVFKEINSSLPERYDPSNAPSMLSATTTRDST 60

Query: 55  SLEYVEALYQFDPQQDGDLGLKPGDKIQLLEKLSPEWYKGSCNGRTGIFPANYVKPAFSG 114
           +LEYVEA+Y+FDPQQDGDL ++PGDKIQ+LEK+SPEWYKGSCNG+ G+FP+NY KPAFSG
Sbjct: 61  ALEYVEAIYRFDPQQDGDLAIQPGDKIQVLEKISPEWYKGSCNGKVGVFPSNYTKPAFSG 120

Query: 115 SNGQSNLPPPPQYKAQELQPVPTQNSAVXXXXXXXXXXXXTNYY--XXXXXXXXXXXXXX 172
           S   S     P     + Q  P Q                TNYY                
Sbjct: 121 STNASKSELTPVPPQYQQQQQPIQQVQSYHSYQQPFPPQSTNYYQQAPQQQQQQQQPEQQ 180

Query: 173 XXXXXXNSHNHLKSFGSKLXXXXXXXXXXXXXXDIVNSIF 212
                 N+  HLKSFGSKL              DIVNSIF
Sbjct: 181 QQQHHSNTGKHLKSFGSKLGNAAIFGAGATIGSDIVNSIF 220

>NDAI0B05920 Chr2 (1429564..1430271) [708 bp, 235 aa] {ON} Anc_3.501
          Length = 235

 Score =  182 bits (461), Expect = 4e-57,   Method: Compositional matrix adjust.
 Identities = 89/134 (66%), Positives = 107/134 (79%), Gaps = 5/134 (3%)

Query: 1   MSASLINRSLTNIRTELDFLKESNVISNDVFDQINKSLPMRWDPPSASRNTSST--SLEY 58
           MSASLINRSLTNIRTELDFLKESNVIS + F+QIN  LP R+DP  +  + SS   +LEY
Sbjct: 1   MSASLINRSLTNIRTELDFLKESNVISEETFNQINNQLPQRYDPNGSRESVSSQAPTLEY 60

Query: 59  VEALYQFDPQQDGDLGLKPGDKIQLLEKLSPEWYKGSCNGRTGIFPANYVKPAFSGSNGQ 118
           VEA+Y F+PQQ+GDL LK GDKIQ++EK SPEW+KG CNG+ GIFP+NYV+PAFSG++  
Sbjct: 61  VEAIYPFEPQQEGDLALKAGDKIQVIEKPSPEWFKGKCNGQVGIFPSNYVRPAFSGTSQP 120

Query: 119 SN---LPPPPQYKA 129
           S     P PPQY+A
Sbjct: 121 SKTRLTPGPPQYQA 134

>TDEL0D05690 Chr4 (1022136..1022741) [606 bp, 201 aa] {ON} Anc_3.501
           YPR154W
          Length = 201

 Score =  180 bits (457), Expect = 5e-57,   Method: Compositional matrix adjust.
 Identities = 101/212 (47%), Positives = 125/212 (58%), Gaps = 11/212 (5%)

Query: 1   MSASLINRSLTNIRTELDFLKESNVISNDVFDQINKSLPMRWDPPSASRNTSSTSLEYVE 60
           MSAS INRSL  +RTELDFL+ESNVIS +++D +N+SLP         +N S+   EY+E
Sbjct: 1   MSASQINRSLATVRTELDFLRESNVISQEIYDMVNQSLP---------QNASNKGGEYME 51

Query: 61  ALYQFDPQQDGDLGLKPGDKIQLLEKLSPEWYKGSCNGRTGIFPANYVKPAFSGSNGQSN 120
           ALYQFDPQQDGDL L PGDKI++LEK S EW+KG CNGR G+FPANYVK A+SGS+ + +
Sbjct: 52  ALYQFDPQQDGDLALSPGDKIEVLEKPSNEWFKGRCNGRVGMFPANYVKAAYSGSD-RPS 110

Query: 121 LPPPPQYKAQELQPVPTQNSAVXXXXXXXXXXXXTNYYXXXXXXXXXXXXXXXXXXXXNS 180
           +PPPPQY+ Q  +    Q+S                                      +S
Sbjct: 111 VPPPPQYE-QAQRTNTGQSSGSYQQPFPPPSTNYYQQPPQQYQQPQQQQPQQEQQQQHHS 169

Query: 181 HNHLKSFGSKLXXXXXXXXXXXXXXDIVNSIF 212
           HNHLK FGSKL              D+VNSIF
Sbjct: 170 HNHLKKFGSKLGNAAIFGAGATMGSDLVNSIF 201

>KNAG0A07990 Chr1 (1272958..1273623) [666 bp, 221 aa] {ON} Anc_3.501
           YPR154W
          Length = 221

 Score =  177 bits (450), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 104/223 (46%), Positives = 123/223 (55%), Gaps = 13/223 (5%)

Query: 1   MSASLINRSLTNIRTELDFLKESNVISNDVFDQINKSLPMRWDPPSASRNTSSTS----- 55
           MSASLINRSLTN+RTELDFL+ES VIS + F++I  SLP ++DP   + N S  S     
Sbjct: 1   MSASLINRSLTNVRTELDFLRESEVISEETFNKIMHSLPQKYDPNQHNDNRSRDSSESHA 60

Query: 56  -LEYVEALYQFDPQQDGDLGLKPGDKIQLLEKLSPEWYKGSCNGRTGIFPANYVKPAFSG 114
            LEYVEALY F PQQDGDL L+PGDKIQ+LEK S EWYKG C G+ G+FP+NYVKPAFSG
Sbjct: 61  KLEYVEALYAFQPQQDGDLELRPGDKIQVLEKPSAEWYKGKCGGQVGMFPSNYVKPAFSG 120

Query: 115 SNGQSNLPPPPQYKAQELQ-PVPT----QNSAVXXXXXXXXXXXXTNYYXXXXXXXXXXX 169
            +     P  P Y+ Q+     P     QN+               NYY           
Sbjct: 121 ESSAPKRPAGPPYQPQQQHLAAPMYQQPQNTGYSQSSNPPFPPQSANYY--PPQQQQQPQ 178

Query: 170 XXXXXXXXXNSHNHLKSFGSKLXXXXXXXXXXXXXXDIVNSIF 212
                    + HN  K FGS+L              DIVNSIF
Sbjct: 179 QVVVEQQQPHKHNAFKKFGSQLGNAAIFGAGATIGSDIVNSIF 221

>SAKL0F02486g Chr6 complement(216399..217091) [693 bp, 230 aa] {ON}
           similar to uniprot|Q06449 Saccharomyces cerevisiae
           YPR154W PIN3 Protein that induces appearance of [PIN ]
           prion when overproduced
          Length = 230

 Score =  178 bits (451), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 85/117 (72%), Positives = 95/117 (81%)

Query: 1   MSASLINRSLTNIRTELDFLKESNVISNDVFDQINKSLPMRWDPPSASRNTSSTSLEYVE 60
           MSASLINRSLT IRTELDFL+ES VIS + F QI+ SLP R+DP +    +SS SLEYVE
Sbjct: 1   MSASLINRSLTTIRTELDFLRESEVISEETFQQISNSLPQRYDPNANGNRSSSPSLEYVE 60

Query: 61  ALYQFDPQQDGDLGLKPGDKIQLLEKLSPEWYKGSCNGRTGIFPANYVKPAFSGSNG 117
           A+Y F  QQDGDL LKPGDKIQ+LEK S EWYKG CNG  G+FP+NYVKPAFSGSNG
Sbjct: 61  AIYAFQAQQDGDLNLKPGDKIQVLEKPSSEWYKGKCNGSVGMFPSNYVKPAFSGSNG 117

>NCAS0F03600 Chr6 (715784..716497) [714 bp, 237 aa] {ON} Anc_3.501
           YGR136W
          Length = 237

 Score =  174 bits (441), Expect = 4e-54,   Method: Compositional matrix adjust.
 Identities = 113/242 (46%), Positives = 132/242 (54%), Gaps = 35/242 (14%)

Query: 1   MSASLINRSLTNIRTELDFLKESNVISNDVFDQINKSLPMRWDPPSASRNTSSTSL---- 56
           MSAS INRSL  IRTELDFLKESNVIS + FDQI  +LP+++DP  ASR  S  S     
Sbjct: 1   MSASSINRSLATIRTELDFLKESNVISQETFDQITSTLPVKYDP-DASRAPSIHSSNNNQ 59

Query: 57  ------EYVEALYQFDPQQDGDLGLKPGDKIQLLEKLSPEWYKGSCNGRTGIFPANYVKP 110
                 E+VEA+Y F+PQQ GDL LKPGDKI+++EK SPEW+KG CNG+TG+FP+NYVKP
Sbjct: 60  PQDQGNEFVEAIYPFEPQQQGDLALKPGDKIEVIEKPSPEWFKGRCNGQTGMFPSNYVKP 119

Query: 111 AFSGSNGQSNLPP----PPQYKAQELQPVPTQNSAV-XXXXXXXXXXXXTNYY------- 158
           AFSGS+G  N       PPQY+   LQ   TQNS               TNYY       
Sbjct: 120 AFSGSSGSVNKVARPNGPPQYQ-NSLQ---TQNSHTPSFQQPAPFPPALTNYYQQQQPQF 175

Query: 159 --------XXXXXXXXXXXXXXXXXXXXNSHNHLKSFGSKLXXXXXXXXXXXXXXDIVNS 210
                                       +SH+ LK FGSKL              DIVNS
Sbjct: 176 IQTPQQQQPQQVQQQPVQQQQPQQQEQHHSHHGLKKFGSKLGNAAIFGAGATIGSDIVNS 235

Query: 211 IF 212
           IF
Sbjct: 236 IF 237

>Kpol_480.8 s480 complement(17610..18329) [720 bp, 239 aa] {ON}
           complement(17610..18329) [720 nt, 240 aa]
          Length = 239

 Score =  174 bits (441), Expect = 4e-54,   Method: Compositional matrix adjust.
 Identities = 83/130 (63%), Positives = 106/130 (81%), Gaps = 5/130 (3%)

Query: 1   MSASLINRSLTNIRTELDFLKESNVISNDVFDQINKSLPMRWDP--PSASRNTSSTSLEY 58
           MS++ INRSLT+++TEL+FL++SNVIS + FDQIN  LP R DP   S + N SS +LEY
Sbjct: 1   MSSASINRSLTSVKTELEFLRDSNVISGEAFDQINNLLPDRHDPSRESLATNNSSPNLEY 60

Query: 59  VEALYQFDPQQDGDLGLKPGDKIQLLEKLSPEWYKGSCNGRTGIFPANYVKPAFSGSNGQ 118
           VEA+Y+FDPQQDGDL ++PGDKIQ+LEK+SPEWYKG CNG+ G+FP+NYVKPAFSG + +
Sbjct: 61  VEAIYRFDPQQDGDLAIQPGDKIQVLEKISPEWYKGKCNGKVGVFPSNYVKPAFSGGSNE 120

Query: 119 ---SNLPPPP 125
              S+L  PP
Sbjct: 121 KSRSHLTSPP 130

 Score = 30.4 bits (67), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 15/34 (44%), Positives = 17/34 (50%)

Query: 179 NSHNHLKSFGSKLXXXXXXXXXXXXXXDIVNSIF 212
           N+  H KSFGSKL              D+VNSIF
Sbjct: 206 NASKHFKSFGSKLGNAAIFGAGATLGSDLVNSIF 239

>Kwal_47.18905 s47 (1021428..1022138) [711 bp, 236 aa] {ON} YPR154W
           (PIN3) -  [contig 189] FULL
          Length = 236

 Score =  170 bits (430), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 82/144 (56%), Positives = 107/144 (74%), Gaps = 3/144 (2%)

Query: 1   MSASLINRSLTNIRTELDFLKESNVISNDVFDQINKSLPMRWDPPSASRNTSSTSLEYVE 60
           MSAS INRSL+ +RTEL+FL+ESNVI+   +  I   LP R++PP ++    S+  E+VE
Sbjct: 1   MSASSINRSLSTVRTELEFLRESNVINETSYRDILGMLPERYEPPRSTPTVPSSQSEFVE 60

Query: 61  ALYQFDPQQDGDLGLKPGDKIQLLEKLSPEWYKGSCNGRTGIFPANYVKPAFSGSNG--- 117
           A+Y F  QQDGDL L+ GDKI++LEK SPEWYKG CNGR G+FP+NYVKPAFSGSN    
Sbjct: 61  AIYAFQAQQDGDLNLQVGDKIEVLEKPSPEWYKGRCNGRVGMFPSNYVKPAFSGSNASLE 120

Query: 118 QSNLPPPPQYKAQELQPVPTQNSA 141
           + N+P PP+Y++Q++ P  T  SA
Sbjct: 121 RPNVPAPPEYQSQQIVPQATNTSA 144

>Smik_6.232 Chr6 (380319..381044) [726 bp, 241 aa] {ON} YGR136W
           (REAL)
          Length = 241

 Score =  159 bits (403), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 77/115 (66%), Positives = 91/115 (79%), Gaps = 1/115 (0%)

Query: 1   MSASLINRSLTNIRTELDFLKESNVISNDVFDQINKSLPMRWDPPSASRNTSSTSLEYVE 60
           MSA+L+NRSL NIR EL+FL+ESNVIS D+FD IN  LP +W+  + S N + T  EYVE
Sbjct: 1   MSATLVNRSLKNIRNELEFLRESNVISGDIFDLINSKLPEKWNDNTRSPNNADTE-EYVE 59

Query: 61  ALYQFDPQQDGDLGLKPGDKIQLLEKLSPEWYKGSCNGRTGIFPANYVKPAFSGS 115
           ALY F+ QQDGDL LK GDKIQ+LEK+SP+WYKG  N R GIFPANYVKPAF+ S
Sbjct: 60  ALYDFEAQQDGDLSLKTGDKIQVLEKISPDWYKGKANNRVGIFPANYVKPAFTRS 114

>TBLA0C04530 Chr3 (1097179..1097847) [669 bp, 222 aa] {ON} Anc_3.501
           YPR154W
          Length = 222

 Score =  155 bits (392), Expect = 6e-47,   Method: Compositional matrix adjust.
 Identities = 92/223 (41%), Positives = 120/223 (53%), Gaps = 12/223 (5%)

Query: 1   MSASLINRSLTNIRTELDFLKESNVISNDVFDQINKSLPMRW-DPPSASRNTSSTSLEYV 59
           MS+SLIN+SL+ I TELDFL +SN I    + +I+  LP R  + PS  ++ SS + E+V
Sbjct: 1   MSSSLINKSLSTIDTELDFLLKSNAIDKKTYSKIHDLLPRRAPEVPSRQQSNSSKNEEWV 60

Query: 60  EALYQFDPQQDGDLGLKPGDKIQLLEKLSPEWYKGSCNGRTGIFPANYVKPAFSGSNGQS 119
           EA+YQFDPQQDGDL L PGDKI + EK SPEW+KG CNG+ G+FP+NYV+PAFSGSN + 
Sbjct: 61  EAIYQFDPQQDGDLQLMPGDKILVTEKPSPEWFKGKCNGKVGVFPSNYVRPAFSGSNNEK 120

Query: 120 NL--PPPPQYKAQELQPVPTQNS--------AVXXXXXXXXXXXXTNYYXXXXXXXXXXX 169
           +     PPQY+ Q+   +   +S                                     
Sbjct: 121 SRSDAAPPQYQ-QDDHHISKHSSHQSSMMPPQPYPQQQQVYQAPPPQQQQAYQAPPQQVV 179

Query: 170 XXXXXXXXXNSHNHLKSFGSKLXXXXXXXXXXXXXXDIVNSIF 212
                    + H HLK+FGSKL              D+VNSIF
Sbjct: 180 VEQAPAKQHHEHKHLKNFGSKLGNAAIFGAGATLGSDLVNSIF 222

>CAGL0F04829g Chr6 (487684..488292) [609 bp, 202 aa] {ON} similar to
           uniprot|Q06449 Saccharomyces cerevisiae YPR154w
          Length = 202

 Score =  153 bits (387), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 98/213 (46%), Positives = 115/213 (53%), Gaps = 12/213 (5%)

Query: 1   MSASLINRSLTNIRTELDFLKESNVISNDVFDQINKSLPMRWDPPSASRNTSSTSLEYVE 60
           MS S INRSL NIR ELDFL+ESNVIS   F +I   LP       AS      SLEYVE
Sbjct: 1   MSQSAINRSLNNIRNELDFLRESNVISEGCFKEIMMKLPSN----GASPVPPPMSLEYVE 56

Query: 61  ALYQFDPQQDGDLGLKPGDKIQLLEKLSPEWYKGSCNGRTGIFPANYVKPAFSGSNGQSN 120
           ALY F PQQDGDL ++ GDKIQ+LEK S EWY+G+ NGR G+FP+NYV+PA + S   +N
Sbjct: 57  ALYDFQPQQDGDLAIRAGDKIQVLEKPSAEWYRGTVNGREGMFPSNYVRPAAAPS---AN 113

Query: 121 LPPPPQYKAQELQPVPT-QNSAVXXXXXXXXXXXXTNYYXXXXXXXXXXXXXXXXXXXXN 179
           L  PP Y   +L P PT Q+                 YY                    +
Sbjct: 114 L-APPAYDNPKLSPQPTVQSFQPPAQPIVAQPSPQPAYY---QAPPQQVVVEQQPVQQSS 169

Query: 180 SHNHLKSFGSKLXXXXXXXXXXXXXXDIVNSIF 212
           +HN LKSFGSKL              D+VNSIF
Sbjct: 170 AHNGLKSFGSKLGNAAIFGAGATLGSDLVNSIF 202

>Suva_7.424 Chr7 (732619..733368) [750 bp, 249 aa] {ON} YGR136W
           (REAL)
          Length = 249

 Score =  154 bits (390), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 79/125 (63%), Positives = 92/125 (73%), Gaps = 11/125 (8%)

Query: 1   MSASLINRSLTNIRTELDFLKESNVISNDVFDQINKSLPMRWDP-----PSASRNTSSTS 55
           MSASLINRSL NIR ELDFLKES VIS+D+F+ IN  LP +WD      P+AS       
Sbjct: 1   MSASLINRSLKNIRNELDFLKESEVISDDIFNLINSKLPEKWDVNLRPVPNASVE----- 55

Query: 56  LEYVEALYQFDPQQDGDLGLKPGDKIQLLEKLSPEWYKGSCNGRTGIFPANYVKPAFSGS 115
            E+VEALY F+PQQ+GDL LK GDKIQ+LEK+SP+WY+G  N R GIFPANYVKPAF+ S
Sbjct: 56  -EFVEALYDFEPQQEGDLPLKTGDKIQILEKISPDWYRGKANNRVGIFPANYVKPAFARS 114

Query: 116 NGQSN 120
               N
Sbjct: 115 ASPEN 119

>Skud_7.447 Chr7 (741615..742331) [717 bp, 238 aa] {ON} YGR136W
           (REAL)
          Length = 238

 Score =  153 bits (387), Expect = 5e-46,   Method: Compositional matrix adjust.
 Identities = 84/151 (55%), Positives = 103/151 (68%), Gaps = 20/151 (13%)

Query: 1   MSASLINRSLTNIRTELDFLKESNVISNDVFDQINKSLPMRWDPPSASRNTSSTSLEYVE 60
           MSASLINRSL NIR EL+FLKESNVIS ++F  I+ +LP +WD  S S N +ST  EYVE
Sbjct: 1   MSASLINRSLNNIRNELEFLKESNVISGELFHFIDSNLPGKWDENSKSANNASTE-EYVE 59

Query: 61  ALYQFDPQQDGDLGLKPGDKIQLLEKLSPEWYKGSCNGRTGIFPANYVKPAFSGSN---- 116
           ALY F+ QQDGDL LK GDKIQ+LEK+S +WYKG  N   GIFPANYVKPAF+ S     
Sbjct: 60  ALYDFEAQQDGDLSLKTGDKIQILEKISLDWYKGKANDMIGIFPANYVKPAFTRSTSPDF 119

Query: 117 ---------GQSNLPPP------PQYKAQEL 132
                     + ++PPP      P+Y +Q++
Sbjct: 120 EKTPLSSRVSRPSVPPPSYEPAVPEYSSQQV 150

>KLTH0G02332g Chr7 complement(184383..185084) [702 bp, 233 aa] {ON}
           similar to uniprot|Q06449 Saccharomyces cerevisiae
           YPR154W PIN3 Protein that induces appearance of [PIN ]
           prion when overproduced
          Length = 233

 Score =  152 bits (384), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 69/115 (60%), Positives = 90/115 (78%)

Query: 1   MSASLINRSLTNIRTELDFLKESNVISNDVFDQINKSLPMRWDPPSASRNTSSTSLEYVE 60
           MSAS INRSL+ +RTEL+FL+ES+VI+ + +  I  +LP R+DP    +  S+T  E+VE
Sbjct: 1   MSASSINRSLSTVRTELEFLRESDVITENSYRDILSALPERYDPSRGPQQPSATQGEFVE 60

Query: 61  ALYQFDPQQDGDLGLKPGDKIQLLEKLSPEWYKGSCNGRTGIFPANYVKPAFSGS 115
           A+Y F  QQDGDL L+ GDK+++LEK SPEW+KG CNGR G+FP+NYVKPAFSGS
Sbjct: 61  AIYAFQAQQDGDLNLQVGDKVEVLEKPSPEWFKGKCNGRVGMFPSNYVKPAFSGS 115

>KAFR0G03740 Chr7 (767426..768130) [705 bp, 234 aa] {ON} Anc_3.501
           YPR154W
          Length = 234

 Score =  145 bits (366), Expect = 6e-43,   Method: Compositional matrix adjust.
 Identities = 91/244 (37%), Positives = 117/244 (47%), Gaps = 42/244 (17%)

Query: 1   MSASLINRSLTNIRTELDFLKESNVISNDVFDQINKSLPMRWDPPSASRNTS-------- 52
           MS++LINR++TNI+TELDFL+ES +I+    D+I K LP ++DP S    ++        
Sbjct: 1   MSSALINRAITNIKTELDFLRESEIITQQQLDEILKQLPEKYDPSSKQAQSNEKLPLQTV 60

Query: 53  --------------------STSLEYVEALYQFDPQQDGDLGLKPGDKIQLLEKLSPEWY 92
                               +  LEYVEALY F+PQQ+GDL L  GDK+Q+LEK S EWY
Sbjct: 61  NAAANSSSASVDHASATPPPANQLEYVEALYAFEPQQEGDLRLVAGDKVQILEKPSAEWY 120

Query: 93  KGSCNGRTGIFPANYVKPAFSGSNGQSNLPPPPQYKAQELQPVPTQNSAVXXXXXXXXXX 152
           KG+CNG+ G+FPANYVKP    S      PPPPQY+        + N             
Sbjct: 121 KGTCNGQIGMFPANYVKPVTKDSFA----PPPPQYQQY------SNNYQQPSYSQPAYPP 170

Query: 153 XXTNYY----XXXXXXXXXXXXXXXXXXXXNSHNHLKSFGSKLXXXXXXXXXXXXXXDIV 208
             T YY                         ++  LK FGSKL              D+V
Sbjct: 171 ASTGYYQQPQQVQVQQPQQVQVQQQPQQQSQTNEQLKRFGSKLGNAAIFGAGATLGSDLV 230

Query: 209 NSIF 212
           NSIF
Sbjct: 231 NSIF 234

>AFR320W Chr6 (1014675..1015448) [774 bp, 257 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGR136W (LSB1) and
           YPR154W (PIN3)
          Length = 257

 Score =  135 bits (339), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 70/134 (52%), Positives = 89/134 (66%), Gaps = 1/134 (0%)

Query: 1   MSASLINRSLTNIRTELDFLKESNVISNDVFDQINKSLPMRWDPPSASRNTSSTSLEYVE 60
           MS++LINRSL  IRTEL FL +S VI+    +QI  +LP   +    +   ++  +EYVE
Sbjct: 1   MSSTLINRSLATIRTELAFLVDSGVITRQQSEQIESNLPNPNEALRGAPANNAGPVEYVE 60

Query: 61  ALYQFDPQQDGDLGLKPGDKIQLLEKLSPEWYKGSCNGRTGIFPANYVKPAFSGSNGQSN 120
           ALY F  QQ GDL  K G+KI++LEK SPEWYKG CNG+ G+FP+NYVKPAFSG +    
Sbjct: 61  ALYAFQAQQPGDLDFKVGEKIEVLEKPSPEWYKGRCNGKVGMFPSNYVKPAFSGGSLMKE 120

Query: 121 LPPPPQYKAQELQP 134
              PP+Y AQ   P
Sbjct: 121 A-SPPRYPAQASAP 133

>ZYRO0D09702g Chr4 complement(823900..824376) [477 bp, 158 aa] {ON}
           weakly similar to uniprot|Q06449 Saccharomyces
           cerevisiae YPR154W PIN3 Protein that induces appearance
           of [PIN ] prion when overproduced
          Length = 158

 Score =  131 bits (330), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 67/156 (42%), Positives = 86/156 (55%), Gaps = 1/156 (0%)

Query: 57  EYVEALYQFDPQQDGDLGLKPGDKIQLLEKLSPEWYKGSCNGRTGIFPANYVKPAFSGSN 116
           E+VEA+Y+FDPQQ+GDL L PGDKI++LEK SPEW++G CNGR G+FP+NYVKPAFSG  
Sbjct: 4   EFVEAIYRFDPQQEGDLALHPGDKIEVLEKPSPEWFRGRCNGRVGMFPSNYVKPAFSGGF 63

Query: 117 GQSNLPPPPQYKAQELQPVPTQNSAVXXXXXXXXXXXXTNYYXXXXXXXXXXXXXXXXXX 176
            +   PPPPQY  + +   P+  +A+            TNYY                  
Sbjct: 64  DRPAAPPPPQYDQKAMASQPSGGNAM-WQQPSPYPPPSTNYYQPPPPQQQQPQPMVVQQE 122

Query: 177 XXNSHNHLKSFGSKLXXXXXXXXXXXXXXDIVNSIF 212
               H+ L  FGSKL              D++NSIF
Sbjct: 123 QGKRHHGLGKFGSKLGNAAIFGAGATLGSDLINSIF 158

>KNAG0B00750 Chr2 complement(140620..141273) [654 bp, 217 aa] {ON}
           Anc_3.501 YPR154W
          Length = 217

 Score =  122 bits (306), Expect = 5e-34,   Method: Compositional matrix adjust.
 Identities = 61/129 (47%), Positives = 84/129 (65%), Gaps = 6/129 (4%)

Query: 1   MSASLINRSLTNIRTELDFLKESNVISNDVFDQINKSLPMRWDPP---SASRNTSSTSLE 57
           MS   +NRS+TNIRTEL++L ES VIS D FD+ N+ LP  WD      A         E
Sbjct: 1   MSVGSVNRSITNIRTELEYLLESKVISRDTFDEFNRKLPDNWDGKPIGGAGEKHPPHEPE 60

Query: 58  YVEALYQFDPQQDGDLGLKPGDKIQLLEKLSPEWYKGSCNGRTGIFPANYVKPA-FSGSN 116
           YVEA++++ PQ+  DL L+ GDK+++LEKLS +WY+G   G+ G+FP+NYVK   FSG +
Sbjct: 61  YVEAIFRYKPQEKEDLELQVGDKVEILEKLSADWYRGKNKGKVGVFPSNYVKAVKFSGVD 120

Query: 117 GQ--SNLPP 123
                ++PP
Sbjct: 121 DAMFQDIPP 129

>KLLA0E03873g Chr5 complement(354700..355362) [663 bp, 220 aa] {ON}
           similar to uniprot|Q06449 Saccharomyces cerevisiae
           YPR154W PIN3 Protein that induces appearance of [PIN ]
           prion when overproduced
          Length = 220

 Score =  120 bits (300), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 57/105 (54%), Positives = 73/105 (69%), Gaps = 3/105 (2%)

Query: 6   INRSLTNIRTELDFLKESNVISNDVFDQINKSLP-MRWDPPSASRNTSSTSLEYVEALYQ 64
           +  S+  I++EL +LKE   ++   +  I   LP +R  PP A  +T   + E VEALY 
Sbjct: 4   VEESVATIKSELKYLKEQGALAELAYKDIESLLPRVRPQPPVA--DTMGQNNEIVEALYA 61

Query: 65  FDPQQDGDLGLKPGDKIQLLEKLSPEWYKGSCNGRTGIFPANYVK 109
           F PQQDGDL LKPGDKI++LEKLSPEWYKG CNG+ G+FP+NYVK
Sbjct: 62  FQPQQDGDLALKPGDKIEILEKLSPEWYKGKCNGQVGVFPSNYVK 106

>Ecym_1228 Chr1 complement(473518..474279) [762 bp, 253 aa] {ON}
           similar to Ashbya gossypii AFR320W
          Length = 253

 Score =  118 bits (295), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 71/129 (55%), Positives = 84/129 (65%), Gaps = 5/129 (3%)

Query: 1   MSASLINRSLTNIRTELDFLKESNVISNDVFDQINKSLPMRWDPPSASRNTSSTSL--EY 58
           MS+SLINRSL NI+TEL+FL ESNVIS     QI     M  +P   +   +S  +  EY
Sbjct: 1   MSSSLINRSLANIKTELEFLVESNVISQSQSQQILS---MLSNPREGTMKAASQQVLKEY 57

Query: 59  VEALYQFDPQQDGDLGLKPGDKIQLLEKLSPEWYKGSCNGRTGIFPANYVKPAFSGSNGQ 118
           VEALY F PQQ GDL  K GDKI++LEK S +WYKG  NGR G+FP+NYVK   +  NG 
Sbjct: 58  VEALYAFVPQQPGDLEFKVGDKIEVLEKPSADWYKGQHNGRVGMFPSNYVKSLRTLPNGG 117

Query: 119 SNLPPPPQY 127
               PPPQY
Sbjct: 118 RFDEPPPQY 126

>ZYRO0G20372g Chr7 (1680364..1680816) [453 bp, 150 aa] {ON} weakly
           similar to uniprot|Q06449 Saccharomyces cerevisiae
           YPR154W PIN3 Protein that induces appearance of [PIN ]
           prion when overproduced
          Length = 150

 Score = 91.7 bits (226), Expect = 7e-23,   Method: Compositional matrix adjust.
 Identities = 38/65 (58%), Positives = 48/65 (73%)

Query: 50  NTSSTSLEYVEALYQFDPQQDGDLGLKPGDKIQLLEKLSPEWYKGSCNGRTGIFPANYVK 109
           N   +  EYVE LY+F PQ   DL +KPGDK++++EKLS +WYKG CNG+ G+FPANYVK
Sbjct: 8   NKEKSQGEYVEVLYEFKPQNKEDLHIKPGDKVEVVEKLSADWYKGKCNGKEGMFPANYVK 67

Query: 110 PAFSG 114
           P   G
Sbjct: 68  PVGGG 72

>TBLA0D02910 Chr4 complement(717010..717819) [810 bp, 269 aa] {ON}
           Anc_3.501 YPR154W
          Length = 269

 Score = 85.1 bits (209), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 45/114 (39%), Positives = 67/114 (58%), Gaps = 8/114 (7%)

Query: 4   SLINRSLTNIRTELDFLKESNVISNDVFDQINKSLPMRWDPPSASRNTSST--------S 55
           + I  + T IR  L+ L ++  IS + +D+I   L  +   PSAS  ++ T         
Sbjct: 8   AAIKDAYTEIRRCLELLIDTKEISENDYDEIQDILRHKRRSPSASSYSNPTKGALSPRNG 67

Query: 56  LEYVEALYQFDPQQDGDLGLKPGDKIQLLEKLSPEWYKGSCNGRTGIFPANYVK 109
            +YVEA+Y +  +Q GDL L PGD I+++ K SP+WY+G  NG+ G+FP NYVK
Sbjct: 68  PQYVEAIYAWSGEQKGDLELCPGDIIEVITKKSPQWYEGRLNGKVGVFPTNYVK 121

>Smik_8.47 Chr8 (81503..82846) [1344 bp, 447 aa] {ON} YHL002W (REAL)
          Length = 447

 Score = 62.0 bits (149), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 28/73 (38%), Positives = 43/73 (58%)

Query: 38  LPMRWDPPSASRNTSSTSLEYVEALYQFDPQQDGDLGLKPGDKIQLLEKLSPEWYKGSCN 97
           LP + + PSA   +  T ++ V ALY     +  +L  + GD I +LE++  +W+KG+  
Sbjct: 196 LPQQRNQPSAHTTSRQTVVKKVRALYDLATNESEELSFRKGDVIIVLEQVYRDWWKGALR 255

Query: 98  GRTGIFPANYVKP 110
           G+ GIFP NYV P
Sbjct: 256 GKMGIFPLNYVTP 268

>TPHA0C04020 Chr3 complement(861629..863086) [1458 bp, 485 aa] {ON}
           Anc_2.502 YHL002W
          Length = 485

 Score = 60.5 bits (145), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 23/61 (37%), Positives = 39/61 (63%)

Query: 56  LEYVEALYQFDPQQDGDLGLKPGDKIQLLEKLSPEWYKGSCNGRTGIFPANYVKPAFSGS 115
           +  V A+Y+   Q++ +L  + GD I +LE++  +W++G+ +G+ GIFP NYV P    S
Sbjct: 231 IRKVRAMYELISQEENELSFRKGDVITVLEQVYRDWWRGTLHGKIGIFPLNYVTPIIELS 290

Query: 116 N 116
           N
Sbjct: 291 N 291

>Smik_8.81 Chr8 complement(117184..118543,118714..118760) [1407 bp,
           468 aa] {ON} YHR016C (REAL)
          Length = 468

 Score = 59.3 bits (142), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 33/87 (37%), Positives = 50/87 (57%), Gaps = 8/87 (9%)

Query: 27  SNDVFDQINKSLPMRW--DPPSASRNTSSTSLEYVEALYQFDPQQDGDLGLKPGDKIQLL 84
           SN   D ++  + M    D  S +++++ T++    ALY F  +Q GDL  K GD I +L
Sbjct: 384 SNSNVDDLSHKMTMTGIDDESSGAKSSTPTAV----ALYNFAGEQSGDLAFKKGDVISIL 439

Query: 85  EKLSP--EWYKGSCNGRTGIFPANYVK 109
           +K     +W+ G  NG+ GIFPANYV+
Sbjct: 440 KKSDSQNDWWTGRANGKEGIFPANYVR 466

>AEL017W Chr5 (603303..603349,603451..604654) [1251 bp, 416 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YFR024C-A
           (LSB3) and YHR016C (YSC84); 1-intron
          Length = 416

 Score = 58.9 bits (141), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 30/72 (41%), Positives = 41/72 (56%), Gaps = 2/72 (2%)

Query: 39  PMRWDPPSASRNTSSTSLEYVEALYQFDPQQDGDLGLKPGDKIQLLEKLSP--EWYKGSC 96
           P    P   S +TSS ++    ALY F  +Q GDL  + GD I +L++     +W+ G  
Sbjct: 342 PTSAKPDFGSHSTSSGAIPKAVALYTFKGEQKGDLPFRKGDVIMILKRTESQDDWWTGRI 401

Query: 97  NGRTGIFPANYV 108
           NG+ GIFPANYV
Sbjct: 402 NGQEGIFPANYV 413

>TBLA0D04950 Chr4 complement(1216633..1218039) [1407 bp, 468 aa]
           {ON} Anc_1.356 YFR024C-A
          Length = 468

 Score = 58.5 bits (140), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 25/51 (49%), Positives = 34/51 (66%), Gaps = 2/51 (3%)

Query: 61  ALYQFDPQQDGDLGLKPGDKIQLLEKLSP--EWYKGSCNGRTGIFPANYVK 109
           ALY FD ++ GDL  + GD I +++K     +W+ G CNG  GIFPANYV+
Sbjct: 416 ALYTFDGEERGDLSFRKGDIIVIIKKSESQDDWWSGRCNGEEGIFPANYVE 466

>KAFR0D03360 Chr4 complement(658469..659836) [1368 bp, 455 aa] {ON}
           Anc_2.502 YHL002W
          Length = 455

 Score = 58.5 bits (140), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 25/62 (40%), Positives = 38/62 (61%)

Query: 51  TSSTSLEYVEALYQFDPQQDGDLGLKPGDKIQLLEKLSPEWYKGSCNGRTGIFPANYVKP 110
           ++S  ++ V A+Y F   +  +L  K GD I +LE++  +W++GS  GR GIFP NYV P
Sbjct: 208 STSAGVKKVRAMYDFPSTEADELSFKKGDIIIVLEQVYRDWWRGSLRGRIGIFPLNYVTP 267

Query: 111 AF 112
             
Sbjct: 268 IM 269

>NCAS0A08990 Chr1 complement(1780800..1782036,1782134..1782201)
           [1305 bp, 434 aa] {ON} Anc_1.356 YFR024C-A
          Length = 434

 Score = 58.5 bits (140), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 27/61 (44%), Positives = 38/61 (62%), Gaps = 2/61 (3%)

Query: 51  TSSTSLEYVEALYQFDPQQDGDLGLKPGDKIQLLEKLSP--EWYKGSCNGRTGIFPANYV 108
           TS  +     ALY+F  +Q GDL  + GDKI +L++     +W+ G  NG+ GIFPANYV
Sbjct: 372 TSGHASNEAVALYRFTGEQKGDLSFQKGDKITILKRTESQNDWWSGRVNGKEGIFPANYV 431

Query: 109 K 109
           +
Sbjct: 432 E 432

>SAKL0D09702g Chr4 complement(805912..807151,807326..807372) [1287
           bp, 428 aa] {ON} similar to Saccharomyces cerevisiae
           YFR024C-A LSB3 or to YHR016C uniprot|P32793
           Saccharomyces cerevisiae YHR016C YSC84
          Length = 428

 Score = 58.5 bits (140), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 28/68 (41%), Positives = 41/68 (60%), Gaps = 2/68 (2%)

Query: 44  PPSASRNTSSTSLEYVEALYQFDPQQDGDLGLKPGDKIQLLEKLSP--EWYKGSCNGRTG 101
           PP + R+ +S+      ALY F  +Q GDL  + GD + +L+K     +W+ G  NG+ G
Sbjct: 359 PPVSRRSPASSGAPKAVALYTFKGEQSGDLPFRKGDVVTILKKSDSQDDWWTGRVNGQEG 418

Query: 102 IFPANYVK 109
           IFPANYV+
Sbjct: 419 IFPANYVE 426

>KLTH0H12980g Chr8 complement(1110123..1111259,1111344..1111406)
           [1200 bp, 399 aa] {ON} similar to Saccharomyces
           cerevisiae YFR024C-A LSB3 or to YHR016C uniprot|P32793
           Saccharomyces cerevisiae YHR016C YSC84
          Length = 399

 Score = 58.2 bits (139), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 30/67 (44%), Positives = 40/67 (59%), Gaps = 2/67 (2%)

Query: 45  PSASRNTSSTSLEYVEALYQFDPQQDGDLGLKPGDKIQLLEKLSPE--WYKGSCNGRTGI 102
           PSA   T+S+      ALY F  +Q GDL  + GD I +L+K   +  W+ G  NG+ GI
Sbjct: 331 PSAHSRTASSGAPKAVALYTFKGEQSGDLPFRKGDVITILKKSESQDDWWTGRNNGQEGI 390

Query: 103 FPANYVK 109
           FPANYV+
Sbjct: 391 FPANYVE 397

>KAFR0C04400 Chr3 (868668..868714,868802..870134) [1380 bp, 459 aa]
           {ON} Anc_1.356 YFR024C-A
          Length = 459

 Score = 57.4 bits (137), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 31/77 (40%), Positives = 43/77 (55%), Gaps = 7/77 (9%)

Query: 35  NKSLPMRWDPPSASRNTSSTSLEYVEALYQFDPQQDGDLGLKPGDKIQLLEKLSPE--WY 92
           +++   R D PS+S N          ALY F  ++ GDL  + GD I +L+K   +  W+
Sbjct: 386 DRAASSRVDAPSSSSNAPKAV-----ALYSFAGEESGDLPFRKGDVITILKKSESQNDWW 440

Query: 93  KGSCNGRTGIFPANYVK 109
            G  NGR GIFPANYV+
Sbjct: 441 TGRVNGREGIFPANYVE 457

>Ecym_2747 Chr2 complement(1449887..1451198,1451401..1451447) [1359
           bp, 452 aa] {ON} similar to Ashbya gossypii AEL017W
           1-intron
          Length = 452

 Score = 57.0 bits (136), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 28/63 (44%), Positives = 39/63 (61%), Gaps = 2/63 (3%)

Query: 49  RNTSSTSLEYVEALYQFDPQQDGDLGLKPGDKIQLLEKLSPE--WYKGSCNGRTGIFPAN 106
           R+  S+      ALY F  +QDGDL  + GD I +L+K + +  W+ G  NG+ GIFPAN
Sbjct: 388 RDRPSSGTPKAVALYTFKGEQDGDLPFRTGDVIAILKKSNSQDDWWTGRVNGQEGIFPAN 447

Query: 107 YVK 109
           YV+
Sbjct: 448 YVE 450

>Suva_15.199 Chr15 complement(345409..346735,346904..346950) [1374
           bp, 457 aa] {ON} YHR016C (REAL)
          Length = 457

 Score = 56.6 bits (135), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 26/51 (50%), Positives = 33/51 (64%), Gaps = 2/51 (3%)

Query: 61  ALYQFDPQQDGDLGLKPGDKIQLLEKLSP--EWYKGSCNGRTGIFPANYVK 109
           ALY F  +Q GDL  K GD I +L+K     +W+ G  NG+ GIFPANYV+
Sbjct: 405 ALYNFAGEQSGDLAFKKGDVITILKKSDSQNDWWTGRVNGKEGIFPANYVR 455

>CAGL0K02761g Chr11 (249893..251245) [1353 bp, 450 aa] {ON} similar
           to uniprot|P38753 Saccharomyces cerevisiae YHL002w
          Length = 450

 Score = 56.6 bits (135), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 38/59 (64%)

Query: 52  SSTSLEYVEALYQFDPQQDGDLGLKPGDKIQLLEKLSPEWYKGSCNGRTGIFPANYVKP 110
           +++ +  V ALY  +  +  +L  + GD I +LE++  +W++GS +G+ GIFP NYV P
Sbjct: 210 TTSGIRRVRALYDLNANEQDELSFRKGDVIVVLEQVYRDWWRGSLHGKIGIFPLNYVTP 268

>Kwal_0.371 s0 complement(179002..179655) [654 bp, 217 aa] {ON}
           YFR024C - Hypothetical ORF [contig 89] FULL
          Length = 217

 Score = 55.5 bits (132), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 30/63 (47%), Positives = 42/63 (66%), Gaps = 3/63 (4%)

Query: 49  RNTSSTSLEYVEALYQFDPQQDGDLGLKPGDKIQLLEKLSP--EWYKGSCNGRTGIFPAN 106
           R+TSS + + V ALY F+ +Q GDL  + GD I +L+K     +W+ G  NG+ GIFPAN
Sbjct: 154 RSTSSGAPKAV-ALYTFNGEQSGDLPFRKGDVITILKKSESQDDWWTGRNNGQEGIFPAN 212

Query: 107 YVK 109
           YV+
Sbjct: 213 YVE 215

>TBLA0B05470 Chr2 complement(1301018..1302637) [1620 bp, 539 aa]
           {ON} Anc_2.502 YHL002W
          Length = 539

 Score = 56.6 bits (135), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 22/55 (40%), Positives = 35/55 (63%)

Query: 56  LEYVEALYQFDPQQDGDLGLKPGDKIQLLEKLSPEWYKGSCNGRTGIFPANYVKP 110
           ++ V A+Y     + G+L  K GD I+++E++  +W++GS  G  GIFP NYV P
Sbjct: 242 VKRVRAMYDLTASEPGELSFKKGDIIKVIEQVYRDWWRGSLRGTVGIFPLNYVNP 296

>Skud_8.68 Chr8 complement(118475..119855,120025..120071) [1428 bp,
           475 aa] {ON} YHR016C (REAL)
          Length = 475

 Score = 56.2 bits (134), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 26/51 (50%), Positives = 33/51 (64%), Gaps = 2/51 (3%)

Query: 61  ALYQFDPQQDGDLGLKPGDKIQLLEKLSP--EWYKGSCNGRTGIFPANYVK 109
           ALY F  +Q GDL  K GD I +L+K     +W+ G  NG+ GIFPANYV+
Sbjct: 423 ALYNFAGEQPGDLAFKKGDAISILKKSDSQNDWWTGRINGKEGIFPANYVR 473

>Smik_7.335 Chr7 complement(563424..564759,564853..564899) [1383 bp,
           460 aa] {ON} YFR024C-A (REAL)
          Length = 460

 Score = 56.2 bits (134), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 28/59 (47%), Positives = 36/59 (61%), Gaps = 2/59 (3%)

Query: 53  STSLEYVEALYQFDPQQDGDLGLKPGDKIQLLEKLSPE--WYKGSCNGRTGIFPANYVK 109
           STS     ALY F  ++ GDL  + GD I +L+K   +  W+ G  NGR GIFPANYV+
Sbjct: 400 STSSPKAVALYSFAGEESGDLPFRKGDVITILKKSDSQNDWWTGRVNGREGIFPANYVE 458

>YHR016C Chr8 complement(136881..138240,138409..138455) [1407 bp,
           468 aa] {ON}  YSC84Actin-binding protein involved in
           bundling of actin filaments and endocytosis of actin
           cortical patches; activity stimulated by Las17p;
           contains SH3 domain similar to Rvs167p
          Length = 468

 Score = 56.2 bits (134), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 26/51 (50%), Positives = 33/51 (64%), Gaps = 2/51 (3%)

Query: 61  ALYQFDPQQDGDLGLKPGDKIQLLEKLSP--EWYKGSCNGRTGIFPANYVK 109
           ALY F  +Q GDL  K GD I +L+K     +W+ G  NG+ GIFPANYV+
Sbjct: 416 ALYNFAGEQPGDLAFKKGDVITILKKSDSQNDWWTGRTNGKEGIFPANYVR 466

>CAGL0I08965g Chr9 complement(869942..871255) [1314 bp, 437 aa] {ON}
           highly similar to uniprot|P43603 Saccharomyces
           cerevisiae YFR024ca or uniprot|P32793 Saccharomyces
           cerevisiae YHR016c YSC84
          Length = 437

 Score = 56.2 bits (134), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 28/69 (40%), Positives = 40/69 (57%), Gaps = 5/69 (7%)

Query: 43  DPPSASRNTSSTSLEYVEALYQFDPQQDGDLGLKPGDKIQLLEKLSPE--WYKGSCNGRT 100
           +PP   R  +S+      ALY F  ++ GDL  + GD I +++K   +  W+ G  NGR 
Sbjct: 370 EPP---RRDASSGAPKAVALYSFAGEEAGDLSFRKGDVITIIKKSDSQNDWWTGKVNGRE 426

Query: 101 GIFPANYVK 109
           GIFPANYV+
Sbjct: 427 GIFPANYVE 435

>YFR024C-A Chr6 complement(201960..203292,203387..203433) [1380 bp,
           459 aa] {ON}  LSB3Protein containing a C-terminal SH3
           domain; binds Las17p, which is a homolog of human
           Wiskott-Aldrich Syndrome protein involved in actin patch
           assembly and actin polymerization
          Length = 459

 Score = 55.8 bits (133), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 28/59 (47%), Positives = 36/59 (61%), Gaps = 2/59 (3%)

Query: 53  STSLEYVEALYQFDPQQDGDLGLKPGDKIQLLEKLSPE--WYKGSCNGRTGIFPANYVK 109
           STS     ALY F  ++ GDL  + GD I +L+K   +  W+ G  NGR GIFPANYV+
Sbjct: 399 STSSPKAVALYSFAGEESGDLPFRKGDVITILKKSDSQNDWWTGRVNGREGIFPANYVE 457

>TPHA0O01280 Chr15 complement(252746..254110) [1365 bp, 454 aa] {ON}
           Anc_1.356 YFR024C-A
          Length = 454

 Score = 55.8 bits (133), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 25/51 (49%), Positives = 33/51 (64%), Gaps = 2/51 (3%)

Query: 61  ALYQFDPQQDGDLGLKPGDKIQLLEKLSP--EWYKGSCNGRTGIFPANYVK 109
           ALY F  ++ GDL  K GD I +L+K     +W+ G  NG+ GIFPANYV+
Sbjct: 402 ALYTFSGEESGDLSFKKGDVIAILKKSDSQDDWWTGRVNGKEGIFPANYVE 452

>TBLA0A02570 Chr1 complement(622892..624373) [1482 bp, 493 aa] {ON}
           Anc_5.470 YDR388W
          Length = 493

 Score = 55.8 bits (133), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 28/72 (38%), Positives = 43/72 (59%), Gaps = 6/72 (8%)

Query: 44  PPSASRNT----SSTSLEYVEALYQFDPQQDGDLGLKPGDKIQLLEKLSP--EWYKGSCN 97
           PPS +  T    S+ + E V ALY++  Q +GDL    G  I+++++ +   EW+ G  N
Sbjct: 418 PPSYTSATGVPQSAPAFETVTALYEYQAQAEGDLSFPAGAVIEIVQRTADINEWWTGKYN 477

Query: 98  GRTGIFPANYVK 109
           G+ G+FP NYVK
Sbjct: 478 GQQGVFPGNYVK 489

>SAKL0E02200g Chr5 complement(171315..172850) [1536 bp, 511 aa] {ON}
           similar to uniprot|P38753 Saccharomyces cerevisiae
           YHL002W HSE1 Subunit of the endosomal Vps27p-Hse1p
           complex required for sorting of ubiquitinated membrane
           proteins into intralumenal vesicles prior to vacuolar
           degradation as well as for recycling of Golgi proteins
           and formation of lumenal membranes
          Length = 511

 Score = 55.8 bits (133), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 36/59 (61%)

Query: 52  SSTSLEYVEALYQFDPQQDGDLGLKPGDKIQLLEKLSPEWYKGSCNGRTGIFPANYVKP 110
           + T ++ V A+Y     +  +L  K GD I ++E++  +W++G+  GR GIFP NYV P
Sbjct: 226 AQTVIKRVRAMYDLTATESDELSFKKGDVITVVEQVYRDWWRGNIRGRVGIFPLNYVTP 284

>Kpol_1056.37 s1056 (92852..94357) [1506 bp, 501 aa] {ON}
           (92852..94357) [1506 nt, 502 aa]
          Length = 501

 Score = 55.5 bits (132), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 25/65 (38%), Positives = 36/65 (55%)

Query: 54  TSLEYVEALYQFDPQQDGDLGLKPGDKIQLLEKLSPEWYKGSCNGRTGIFPANYVKPAFS 113
           T +  V A+Y     +  +L  K GD I +LE++  +W+KG+  G  GIFP NYV P   
Sbjct: 235 TVVRKVRAMYDLSSNEPDELSFKKGDIITVLEQVYRDWWKGTLRGNIGIFPLNYVTPISD 294

Query: 114 GSNGQ 118
            SN +
Sbjct: 295 LSNAE 299

>NCAS0B07250 Chr2 complement(1371597..1372875,1373026..1373072)
           [1326 bp, 441 aa] {ON} Anc_1.356 YFR024C-A
          Length = 441

 Score = 55.5 bits (132), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 29/60 (48%), Positives = 39/60 (65%), Gaps = 3/60 (5%)

Query: 52  SSTSLEYVEALYQFDPQQDGDLGLKPGDKIQLLEKLSP--EWYKGSCNGRTGIFPANYVK 109
           SST+ + V ALY F  ++ GDL  + GD I +L+K     +W+ G  NGR GIFPANYV+
Sbjct: 381 SSTAPKAV-ALYSFSGEESGDLPFRKGDVITILKKSESQNDWWTGRVNGREGIFPANYVE 439

>Suva_8.51 Chr8 (98991..100361) [1371 bp, 456 aa] {ON} YHL002W
           (REAL)
          Length = 456

 Score = 55.1 bits (131), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 22/52 (42%), Positives = 32/52 (61%)

Query: 59  VEALYQFDPQQDGDLGLKPGDKIQLLEKLSPEWYKGSCNGRTGIFPANYVKP 110
           V A+Y     +  +L  + GD I +LE++  +W+KG+  GR GIFP NYV P
Sbjct: 226 VRAMYDLSTNEPDELSFRKGDVITVLEQVYRDWWKGALRGRMGIFPLNYVTP 277

>TDEL0D02240 Chr4 (431160..431206,431314..432568) [1302 bp, 433 aa]
           {ON} Anc_1.356 YFR024C-A
          Length = 433

 Score = 55.1 bits (131), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 27/60 (45%), Positives = 37/60 (61%), Gaps = 2/60 (3%)

Query: 52  SSTSLEYVEALYQFDPQQDGDLGLKPGDKIQLLEKLSPE--WYKGSCNGRTGIFPANYVK 109
           SS++     ALY F  ++ GDL  + GD I +L+K   +  W+ G  NGR GIFPANYV+
Sbjct: 372 SSSNAPKAVALYSFAGEESGDLPFRKGDVITILKKSESQDDWWTGRVNGREGIFPANYVE 431

>KNAG0C02040 Chr3 complement(397447..398841) [1395 bp, 464 aa] {ON}
           Anc_1.356 YFR024C-A
          Length = 464

 Score = 54.7 bits (130), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 25/51 (49%), Positives = 33/51 (64%), Gaps = 2/51 (3%)

Query: 61  ALYQFDPQQDGDLGLKPGDKIQLLEKLSPE--WYKGSCNGRTGIFPANYVK 109
           ALY F  ++ GDL  + GD I +L+K   +  W+ G  NGR GIFPANYV+
Sbjct: 412 ALYSFTGEESGDLPFRKGDVITVLKKSDSQNDWWTGRVNGREGIFPANYVE 462

>NDAI0A04350 Chr1 complement(979014..980393) [1380 bp, 459 aa] {ON}
           Anc_5.470
          Length = 459

 Score = 54.3 bits (129), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 27/68 (39%), Positives = 41/68 (60%), Gaps = 3/68 (4%)

Query: 44  PPSASRNTSSTSLEYVEALYQFDPQQDGDLGLKPGDKIQLLEKLSP--EWYKGSCNGRTG 101
           PP+A  + ++  +E V ALY +  Q  GDL    G  I+++E+ S   EW+ G  NG+ G
Sbjct: 389 PPTAG-SMAAPGVETVTALYDYQAQAAGDLSFPAGAVIEIVERTSDANEWWTGKYNGQQG 447

Query: 102 IFPANYVK 109
           +FP NYV+
Sbjct: 448 VFPGNYVQ 455

>KLLA0B13475g Chr2 complement(1178856..1180382) [1527 bp, 508 aa]
           {ON} similar to uniprot|P38753 Saccharomyces cerevisiae
           YHL002W HSE1 Subunit of the endosomal Vps27p-Hse1p
           complex required for sorting of ubiquitinated membrane
           proteins into intralumenal vesicles prior to vacuolar
           degradation, as well as for recycling of Golgi proteins
           and formation of lumenal membranes
          Length = 508

 Score = 54.3 bits (129), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 22/58 (37%), Positives = 35/58 (60%)

Query: 54  TSLEYVEALYQFDPQQDGDLGLKPGDKIQLLEKLSPEWYKGSCNGRTGIFPANYVKPA 111
           T +  V A+Y F+  +  +L  K GD I ++E++  +W++G+  G  GIFP NYV P 
Sbjct: 222 TVIRKVRAMYDFNSTEQDELSFKKGDLICVVEQVYRDWWRGTLAGSVGIFPLNYVTPV 279

>YHL002W Chr8 (102612..103970) [1359 bp, 452 aa] {ON}  HSE1Subunit
           of the endosomal Vps27p-Hse1p complex required for
           sorting of ubiquitinated membrane proteins into
           intralumenal vesicles prior to vacuolar degradation, as
           well as for recycling of Golgi proteins and formation of
           lumenal membranes
          Length = 452

 Score = 53.9 bits (128), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 24/64 (37%), Positives = 36/64 (56%)

Query: 47  ASRNTSSTSLEYVEALYQFDPQQDGDLGLKPGDKIQLLEKLSPEWYKGSCNGRTGIFPAN 106
           A +  + T +  V ALY     +  +L  + GD I +LE++  +W+KG+  G  GIFP N
Sbjct: 210 AHKIPAQTVVRRVRALYDLTTNEPDELSFRKGDVITVLEQVYRDWWKGALRGNMGIFPLN 269

Query: 107 YVKP 110
           YV P
Sbjct: 270 YVTP 273

>KLTH0D06138g Chr4 (544661..546130) [1470 bp, 489 aa] {ON} similar
           to uniprot|P38753 Saccharomyces cerevisiae YHL002W HSE1
           Subunit of the endosomal Vps27p- Hse1p complex required
           for sorting of ubiquitinated membrane proteins into
           intralumenal vesicles prior to vacuolar degradation as
           well as for recycling of Golgi proteins and formation of
           lumenal membranes
          Length = 489

 Score = 54.3 bits (129), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 39/68 (57%), Gaps = 2/68 (2%)

Query: 46  SASRNTSST--SLEYVEALYQFDPQQDGDLGLKPGDKIQLLEKLSPEWYKGSCNGRTGIF 103
           S+  N S T  ++  V AL+    ++  +L  + GD I ++E++  +W++G   GR GIF
Sbjct: 202 SSHHNESQTQNTVRKVRALHDLTGRESDELSFRKGDIIVVIEQVYKDWWRGRLRGRVGIF 261

Query: 104 PANYVKPA 111
           P NYV P 
Sbjct: 262 PLNYVTPV 269

>Suva_6.96 Chr6 complement(167266..168586,168693..168739) [1368 bp,
           455 aa] {ON} YFR024C-A (REAL)
          Length = 455

 Score = 53.9 bits (128), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 26/59 (44%), Positives = 36/59 (61%), Gaps = 2/59 (3%)

Query: 53  STSLEYVEALYQFDPQQDGDLGLKPGDKIQLLEKLSPE--WYKGSCNGRTGIFPANYVK 109
           STS     AL+ F  ++ GDL  + GD + +L+K   +  W+ G  NGR GIFPANYV+
Sbjct: 395 STSSPKAVALFSFAGEESGDLPFRKGDVVTILKKSDSQNDWWTGRVNGREGIFPANYVE 453

>Skud_6.108 Chr6 complement(197616..198948,199044..199090) [1380 bp,
           459 aa] {ON} YFR024C-A (REAL)
          Length = 459

 Score = 53.9 bits (128), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 27/59 (45%), Positives = 36/59 (61%), Gaps = 2/59 (3%)

Query: 53  STSLEYVEALYQFDPQQDGDLGLKPGDKIQLLEKLSPE--WYKGSCNGRTGIFPANYVK 109
           STS     ALY F  ++ GDL  + GD I +L+K   +  W+ G  +GR GIFPANYV+
Sbjct: 399 STSSPKAVALYTFAGEESGDLPFRKGDVITILKKSDSQNDWWTGRVSGREGIFPANYVE 457

>Ecym_2440 Chr2 (858070..859449) [1380 bp, 459 aa] {ON} similar to
           Ashbya gossypii ABR008C
          Length = 459

 Score = 53.5 bits (127), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 28/91 (30%), Positives = 47/91 (51%), Gaps = 10/91 (10%)

Query: 44  PPSASRNTSST-SLEYVEALYQFDPQQDGDLGLKPGDKIQLLEKLSPEWYKGSCNGRTGI 102
           P    R+TS    ++ V A+Y  +  +  +L    GD I ++E++  +W++G+  G+ GI
Sbjct: 215 PGQEQRHTSQLFQVKKVRAMYSLNASESDELSFVKGDVITVIEQVYKDWWRGTLRGKVGI 274

Query: 103 FPANYVKPAFSGSNGQSNLPPPPQYKAQELQ 133
           FP NYV P            P P+  A+EL+
Sbjct: 275 FPLNYVTPCPE---------PTPEELARELE 296

>NDAI0K02130 Chr11 (481352..482731) [1380 bp, 459 aa] {ON} Anc_2.502
          Length = 459

 Score = 52.8 bits (125), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 32/58 (55%)

Query: 54  TSLEYVEALYQFDPQQDGDLGLKPGDKIQLLEKLSPEWYKGSCNGRTGIFPANYVKPA 111
           T +  V ALY        +L  K GD I +LE++  +W+KG    +TGIFP NYV P 
Sbjct: 228 TIVRKVRALYDLAGSGSDELSFKKGDVIMVLEQVYKDWWKGKLRDQTGIFPLNYVTPV 285

>TDEL0A02780 Chr1 (504696..506051) [1356 bp, 451 aa] {ON} Anc_2.502
           YHL002W
          Length = 451

 Score = 52.8 bits (125), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 20/63 (31%), Positives = 39/63 (61%)

Query: 48  SRNTSSTSLEYVEALYQFDPQQDGDLGLKPGDKIQLLEKLSPEWYKGSCNGRTGIFPANY 107
           +++++   +  V A+Y    ++  +L  + GD I +LE++  +W++G+  G+ GIFP NY
Sbjct: 217 AKSSAPAVIRKVRAMYDLSSEEPDELSFRKGDVIVVLEQVYRDWWRGTLCGKVGIFPLNY 276

Query: 108 VKP 110
           V P
Sbjct: 277 VTP 279

>ZYRO0B01298g Chr2 (110004..111239) [1236 bp, 411 aa] {ON} similar
           to uniprot|P38753 Saccharomyces cerevisiae YHL002W HSE1
           Subunit of the endosomal Vps27p-Hse1p complex required
           for sorting of ubiquitinated membrane proteins into
           intralumenal vesicles prior to vacuolar degradation as
           well as for recycling of Golgi proteins and formation of
           lumenal membranes
          Length = 411

 Score = 52.4 bits (124), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 23/53 (43%), Positives = 32/53 (60%)

Query: 59  VEALYQFDPQQDGDLGLKPGDKIQLLEKLSPEWYKGSCNGRTGIFPANYVKPA 111
           V+ALY     +  +L  K GD I +LE++  +W++GS  G  GIFP NYV P 
Sbjct: 232 VKALYDLASNEPDELAFKKGDIIVVLEQVYRDWWRGSLRGSIGIFPLNYVTPV 284

>KLLA0A08360g Chr1 complement(739092..740316,740718..740764) [1272
           bp, 423 aa] {ON} similar to Saccharomyces cerevisiae
           YFR024C-A LSB3 or to YHR016C uniprot|P32793
           Saccharomyces cerevisiae YHR016C YSC84
          Length = 423

 Score = 52.4 bits (124), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 23/51 (45%), Positives = 33/51 (64%), Gaps = 2/51 (3%)

Query: 61  ALYQFDPQQDGDLGLKPGDKIQLLEKLSPE--WYKGSCNGRTGIFPANYVK 109
           ALY F  ++ GDL  + GD I +++K   +  W+ G  NG+ GIFPANYV+
Sbjct: 371 ALYTFKGEESGDLPFRKGDVISIIKKSESQDDWWTGRVNGKEGIFPANYVE 421

>NCAS0A11920 Chr1 (2363750..2365141) [1392 bp, 463 aa] {ON}
           Anc_5.470
          Length = 463

 Score = 52.4 bits (124), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 28/69 (40%), Positives = 41/69 (59%), Gaps = 6/69 (8%)

Query: 44  PPSASRNTSSTSLEYVEALYQFDPQQDGDLGLKPGDKIQLLEKLSP---EWYKGSCNGRT 100
           PP+A   T+    E V ALY++  Q  GDL    G  I+++E+ +P   EW+ G  NG+ 
Sbjct: 394 PPTAGSMTAGG--ETVTALYEYQAQAAGDLSFPAGAVIEIVER-TPDVNEWWTGRYNGQQ 450

Query: 101 GIFPANYVK 109
           G+FP NYV+
Sbjct: 451 GVFPGNYVQ 459

>NDAI0G05960 Chr7 (1474282..1475553) [1272 bp, 423 aa] {ON}
           Anc_1.356
          Length = 423

 Score = 52.4 bits (124), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 25/55 (45%), Positives = 33/55 (60%), Gaps = 2/55 (3%)

Query: 57  EYVEALYQFDPQQDGDLGLKPGDKIQLLEKLSPE--WYKGSCNGRTGIFPANYVK 109
           E V ALY F  +Q GDL  K GD I +++K   +  W+ G    + GIFPANYV+
Sbjct: 367 EKVVALYTFVGEQKGDLAFKKGDIITVIKKTKSQDDWWTGKLGNKEGIFPANYVE 421

>NCAS0A05080 Chr1 (1011572..1012924) [1353 bp, 450 aa] {ON}
           Anc_2.502
          Length = 450

 Score = 52.0 bits (123), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 22/55 (40%), Positives = 32/55 (58%)

Query: 56  LEYVEALYQFDPQQDGDLGLKPGDKIQLLEKLSPEWYKGSCNGRTGIFPANYVKP 110
           +  V ALY     +  +L    GD I +LE++  +W++G+  G TGIFP NYV P
Sbjct: 217 IRKVRALYDLSSPEADELSFVKGDVITVLEQVYKDWWRGTLRGNTGIFPLNYVTP 271

>TBLA0F03490 Chr6 (859156..859202,859415..860903) [1536 bp, 511 aa]
           {ON} Anc_1.356 YFR024C-A
          Length = 511

 Score = 52.0 bits (123), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 23/51 (45%), Positives = 33/51 (64%), Gaps = 2/51 (3%)

Query: 61  ALYQFDPQQDGDLGLKPGDKIQLLEKLSP--EWYKGSCNGRTGIFPANYVK 109
           ALY F  ++ GDL  + GD I +++K     +W+ G  +GR GIFPANYV+
Sbjct: 459 ALYSFTGEERGDLSFRKGDVITIIKKSESQNDWWTGRVSGREGIFPANYVE 509

>NDAI0B04580 Chr2 complement(1138779..1140053) [1275 bp, 424 aa]
           {ON} Anc_1.356
          Length = 424

 Score = 52.0 bits (123), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 32/51 (62%), Gaps = 2/51 (3%)

Query: 61  ALYQFDPQQDGDLGLKPGDKIQLLEKLSPE--WYKGSCNGRTGIFPANYVK 109
           ALY F  ++  DL  + GD I +L+K   +  W+ G  NGR GIFPANYV+
Sbjct: 372 ALYSFAGEETDDLPFRKGDVITILKKSESQNDWWTGRVNGREGIFPANYVE 422

>Skud_8.43 Chr8 (84125..85489) [1365 bp, 454 aa] {ON} YHL002W (REAL)
          Length = 454

 Score = 51.2 bits (121), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 22/57 (38%), Positives = 33/57 (57%)

Query: 54  TSLEYVEALYQFDPQQDGDLGLKPGDKIQLLEKLSPEWYKGSCNGRTGIFPANYVKP 110
           T +  V ALY     +  +L  +  D I +LE++  +W+KG+  G+ GIFP NYV P
Sbjct: 220 TIVRRVRALYDLSTNEPDELSFRKDDVIIVLEQVYRDWWKGALRGKMGIFPLNYVTP 276

>TPHA0E01500 Chr5 complement(304130..305503) [1374 bp, 457 aa] {ON}
           Anc_5.470 YDR388W
          Length = 457

 Score = 51.2 bits (121), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 22/61 (36%), Positives = 38/61 (62%), Gaps = 2/61 (3%)

Query: 51  TSSTSLEYVEALYQFDPQQDGDLGLKPGDKIQLLEKLSP--EWYKGSCNGRTGIFPANYV 108
           T++ + EY  +LY++  Q  GDL    G  IQ++++ +   +W+ G  NG+ G+FP NYV
Sbjct: 394 TTAQAGEYCTSLYEYQAQAQGDLSFPAGAVIQIVQRSADVNDWWTGVYNGQQGVFPGNYV 453

Query: 109 K 109
           +
Sbjct: 454 Q 454

>Kpol_1008.25 s1008 complement(50905..52207,52597..52643) [1350 bp,
           449 aa] {ON} complement(50905..52207,52597..52643) [1350
           nt, 450 aa]
          Length = 449

 Score = 50.8 bits (120), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 28/69 (40%), Positives = 37/69 (53%), Gaps = 2/69 (2%)

Query: 43  DPPSASRNTSSTSLEYVEALYQFDPQQDGDLGLKPGDKIQLLEKLSP--EWYKGSCNGRT 100
           + PS      S+S     ALY F  ++ GDL  K GD I +L+K     +W+ G  N   
Sbjct: 379 EKPSFGGTRQSSSTPKAIALYSFAGEESGDLRFKKGDVITILKKSDSQDDWWTGRVNTSE 438

Query: 101 GIFPANYVK 109
           GIFPANYV+
Sbjct: 439 GIFPANYVE 447

>KAFR0A00970 Chr1 (181162..182352) [1191 bp, 396 aa] {ON} Anc_1.356
           YFR024C-A
          Length = 396

 Score = 50.8 bits (120), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 22/51 (43%), Positives = 35/51 (68%), Gaps = 2/51 (3%)

Query: 61  ALYQFDPQQDGDLGLKPGDKIQLLEKLSPE--WYKGSCNGRTGIFPANYVK 109
           ALY F  +++GDL  K GD I ++++   +  W+ G+ NG+ G+FPANYV+
Sbjct: 344 ALYNFGGKEEGDLIFKRGDIIAIVKRSDSQYDWWTGNLNGKEGLFPANYVE 394

>KNAG0A06710 Chr1 complement(1045213..1046472) [1260 bp, 419 aa]
           {ON} Anc_2.502 YHL002W
          Length = 419

 Score = 50.8 bits (120), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 22/67 (32%), Positives = 35/67 (52%)

Query: 44  PPSASRNTSSTSLEYVEALYQFDPQQDGDLGLKPGDKIQLLEKLSPEWYKGSCNGRTGIF 103
           P    R T + +++ V A+Y  +     +L  +  D I ++E+   +W+ GS   R GIF
Sbjct: 204 PEVTKRETGTNTIKKVRAMYDLETSDPKELAFRKDDIIVVIEQSYKDWWLGSLGRRVGIF 263

Query: 104 PANYVKP 110
           P NYV P
Sbjct: 264 PLNYVTP 270

>TDEL0A03340 Chr1 (592752..594173) [1422 bp, 473 aa] {ON} Anc_5.470
           YDR388W
          Length = 473

 Score = 50.8 bits (120), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 26/71 (36%), Positives = 41/71 (57%), Gaps = 5/71 (7%)

Query: 44  PPSASRNTSSTS---LEYVEALYQFDPQQDGDLGLKPGDKIQLLEKLSP--EWYKGSCNG 98
           PP+ S +T++T+      V ALY +  Q  GDL    G  I+++++     EW+ G  NG
Sbjct: 399 PPAYSMSTATTAPPAANTVTALYDYQAQAPGDLSFTAGAVIEVVQRTDDPNEWWTGRYNG 458

Query: 99  RTGIFPANYVK 109
           + G+FP NYV+
Sbjct: 459 QQGVFPGNYVQ 469

>Kwal_26.7902 s26 (560454..562052) [1599 bp, 532 aa] {ON} YHL002W
           (HSE1) - Hypothetical ORF [contig 55] FULL
          Length = 532

 Score = 50.8 bits (120), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 20/53 (37%), Positives = 33/53 (62%)

Query: 59  VEALYQFDPQQDGDLGLKPGDKIQLLEKLSPEWYKGSCNGRTGIFPANYVKPA 111
           V AL+    +   +L  + GD I+++E++  +W++GS  G+ GIFP NYV P 
Sbjct: 229 VRALHDLVGRGSDELSFRKGDVIRVMEQVYRDWWRGSLRGKIGIFPLNYVTPV 281

>KNAG0C04630 Chr3 (908312..909862) [1551 bp, 516 aa] {ON} Anc_5.470
           YDR388W
          Length = 516

 Score = 50.4 bits (119), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 23/58 (39%), Positives = 35/58 (60%), Gaps = 2/58 (3%)

Query: 54  TSLEYVEALYQFDPQQDGDLGLKPGDKIQLLEKLSP--EWYKGSCNGRTGIFPANYVK 109
           T +E V ALY +  Q  GDL    G  I+++++ +   EW+ G  NG+ G+FP NYV+
Sbjct: 456 TGVETVTALYDYQAQAAGDLSFPAGATIEIVQRTADVNEWWTGRYNGQQGVFPGNYVQ 513

>ZYRO0G00792g Chr7 (61277..61323,61435..62797) [1410 bp, 469 aa]
           {ON} similar to Saccharomyces cerevisiae YFR024C-A LSB3
           or to YHR016C uniprot|P32793 Saccharomyces cerevisiae
           YHR016C YSC84
          Length = 469

 Score = 50.4 bits (119), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 32/51 (62%), Gaps = 2/51 (3%)

Query: 61  ALYQFDPQQDGDLGLKPGDKIQLLEKLSP--EWYKGSCNGRTGIFPANYVK 109
           ALY F  ++ GDL  + GD I +L+K     +W+ G   GR GIFPANYV+
Sbjct: 417 ALYTFSGEEYGDLPFRKGDVITILKKSDSQDDWWTGRVGGREGIFPANYVE 467

>Ecym_2308 Chr2 complement(597163..599199) [2037 bp, 678 aa] {ON}
           similar to Ashbya gossypii ABR082W
          Length = 678

 Score = 50.4 bits (119), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 30/78 (38%), Positives = 42/78 (53%), Gaps = 7/78 (8%)

Query: 36  KSLPMRWDPPSASRNTSSTSLEYVEALYQF-DPQQDGDLGLKPGDKIQLLEKLSPEWYKG 94
           K+    W P + SR      + Y +ALY F +P ++  L  + GD + L EKL+ +WY G
Sbjct: 601 KTTTFEW-PKATSR--GQRVIGYAKALYSFTEPNENDILNFQMGDHLLLTEKLNTDWYIG 657

Query: 95  SC---NGRTGIFPANYVK 109
                NGR G+ P NYVK
Sbjct: 658 EVHNSNGRQGLIPMNYVK 675

>TPHA0A02210 Chr1 (455888..457081) [1194 bp, 397 aa] {ON} Anc_1.356
           YFR024C-A
          Length = 397

 Score = 50.1 bits (118), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 22/51 (43%), Positives = 32/51 (62%), Gaps = 2/51 (3%)

Query: 61  ALYQFDPQQDGDLGLKPGDKIQLLEKLSPE--WYKGSCNGRTGIFPANYVK 109
           AL++F  +Q GDL    GD + +L+K   +  W+ G  N + GIFPANYV+
Sbjct: 345 ALFRFKGEQAGDLSFNKGDVVTILKKTDTQNDWWTGRVNNQEGIFPANYVE 395

>KAFR0E03640 Chr5 complement(731325..732650) [1326 bp, 441 aa] {ON}
           Anc_5.470 YDR388W
          Length = 441

 Score = 50.1 bits (118), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 35/56 (62%), Gaps = 2/56 (3%)

Query: 56  LEYVEALYQFDPQQDGDLGLKPGDKIQLLEKLSPE--WYKGSCNGRTGIFPANYVK 109
           +E V ALY++  Q  GDL    G  I+++++ + E  W+ G  NG+ G+FP NYV+
Sbjct: 383 METVTALYEYQAQAAGDLSFPAGAVIEIVQRTANENEWWTGRYNGQQGVFPGNYVQ 438

>AFR140C Chr6 complement(692042..693208) [1167 bp, 388 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR388W
           (RVS167)
          Length = 388

 Score = 48.9 bits (115), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 32/83 (38%), Positives = 46/83 (55%), Gaps = 12/83 (14%)

Query: 36  KSLPMRWDPP--------SASRNTSSTSL-EYVEALYQFDPQQDGDLGLKPGDKIQLLEK 86
           +S P+  DPP        S+S + ++T+  E   ALY F  Q DGDL       I++L++
Sbjct: 304 RSTPL--DPPAYSEPSYGSSSASPATTAAPETCIALYDFAAQADGDLSFPVNAIIEILDR 361

Query: 87  L-SPEWYKGSCNGRTGIFPANYV 108
             +  W+ G  NGR G+FPANYV
Sbjct: 362 SDAAGWWTGRYNGREGLFPANYV 384

>ABR008C Chr2 complement(406780..408111) [1332 bp, 443 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YHL002W
          Length = 443

 Score = 48.5 bits (114), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 32/50 (64%)

Query: 59  VEALYQFDPQQDGDLGLKPGDKIQLLEKLSPEWYKGSCNGRTGIFPANYV 108
           V+A++  +  +  +L  K GD I ++E++  +W++G   G+ GIFP NYV
Sbjct: 215 VKAIFDLNASEPDELSFKKGDVITVIEQVYKDWWRGLLRGKVGIFPVNYV 264

>Skud_4.661 Chr4 (1170843..1172225) [1383 bp, 460 aa] {ON} YDR388W
           (REAL)
          Length = 460

 Score = 48.5 bits (114), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 22/55 (40%), Positives = 33/55 (60%), Gaps = 2/55 (3%)

Query: 57  EYVEALYQFDPQQDGDLGLKPGDKIQLLEKL--SPEWYKGSCNGRTGIFPANYVK 109
           E V ALY +  Q  GDL    G  I+++++   + EW+ G  NG+ G+FP NYV+
Sbjct: 402 ETVSALYDYQAQAAGDLSFPAGAVIEIVQRTPDANEWWTGRYNGQQGVFPGNYVQ 456

>SAKL0G03454g Chr7 (284017..285423) [1407 bp, 468 aa] {ON} some
           similarities with uniprot|P39743 Saccharomyces
           cerevisiae YDR388W RVS167 BAR adaptor protein subunit of
           a complex (Rvs161p-Rvs167p) that regulates actin
           endocytosis and viability following starvation or
           osmotic stress
          Length = 468

 Score = 48.1 bits (113), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 34/56 (60%), Gaps = 2/56 (3%)

Query: 56  LEYVEALYQFDPQQDGDLGLKPGDKIQLLEKLSPE--WYKGSCNGRTGIFPANYVK 109
           +E V ALY +  Q +GDL    G  I+++E+ +    W+ G  NG+ G+FP NYV+
Sbjct: 409 VETVTALYDYQAQAEGDLTFPVGAIIEVVERTTDTNGWWTGRYNGQQGVFPGNYVQ 464

>CAGL0A02145g Chr1 (224026..224036,225280..226444) [1176 bp, 391 aa]
           {ON} similar to uniprot|P32793 Saccharomyces cerevisiae
           YHR016c YSC84 and similar to uniprot|P43603
           Saccharomyces cerevisiae YFR024C-A LSB3
          Length = 391

 Score = 48.1 bits (113), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 25/59 (42%), Positives = 33/59 (55%), Gaps = 2/59 (3%)

Query: 52  SSTSLEYVEALYQFDPQQDGDLGLKPGDKIQLLEKLSP--EWYKGSCNGRTGIFPANYV 108
           +  S   V ALY F+ QQ GDL  K  D I + +K     +W+ G  +G  G+FPANYV
Sbjct: 330 AERSFPKVRALYDFNGQQQGDLSFKKDDIIVVQKKTDSHNDWWYGVAHGVEGVFPANYV 388

>ABR082W Chr2 (537500..539551) [2052 bp, 683 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR032W (HOF1)
          Length = 683

 Score = 48.1 bits (113), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 30/81 (37%), Positives = 41/81 (50%), Gaps = 7/81 (8%)

Query: 33  QINKSLPMRWDPPSASRNTSSTSLEYVEALYQFDPQQDGD-LGLKPGDKIQLLEKLSPEW 91
           Q  KS+ M W P   S+      + Y  A+Y F    D D L  + GD + L EKL+ +W
Sbjct: 603 QRTKSVAMEW-PKVTSKGRRV--IGYARAIYSFTEPNDNDILYFEMGDHLLLTEKLNTDW 659

Query: 92  YKGSC---NGRTGIFPANYVK 109
           Y G     NG+ G+ P NYV+
Sbjct: 660 YIGEVHNGNGKQGLIPMNYVE 680

>YDR388W Chr4 (1250186..1251634) [1449 bp, 482 aa] {ON}
           RVS167Actin-associated protein with roles in endocytosis
           and exocytosis; interacts with Rvs161p to regulate actin
           cytoskeleton, endocytosis, and viability following
           starvation or osmotic stress; recruited to bud tips by
           Gyl1p and Gyp5p during polarized growth; homolog of
           mammalian amphiphysin
          Length = 482

 Score = 47.8 bits (112), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 23/56 (41%), Positives = 34/56 (60%), Gaps = 4/56 (7%)

Query: 57  EYVEALYQFDPQQDGDLGLKPGDKIQLLEKLSP---EWYKGSCNGRTGIFPANYVK 109
           E V ALY +  Q  GDL    G  I+++++ +P   EW+ G  NG+ G+FP NYV+
Sbjct: 424 ETVTALYDYQAQAAGDLSFPAGAVIEIVQR-TPDVNEWWTGRYNGQQGVFPGNYVQ 478

>CAGL0M01650g Chr13 complement(184085..185485) [1401 bp, 466 aa]
           {ON} highly similar to uniprot|P39743 Saccharomyces
           cerevisiae YDR388w RVS167
          Length = 466

 Score = 47.8 bits (112), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 23/57 (40%), Positives = 35/57 (61%), Gaps = 4/57 (7%)

Query: 56  LEYVEALYQFDPQQDGDLGLKPGDKIQLLEKLSP---EWYKGSCNGRTGIFPANYVK 109
           +E V ALY +  Q  GDL    G  I+++++ +P   EW+ G  NG+ G+FP NYV+
Sbjct: 409 VETVTALYDYQAQAAGDLSFPAGAVIEVVQR-TPDVNEWWTGRYNGQQGVFPGNYVQ 464

>KLTH0F15114g Chr6 complement(1238921..1240228) [1308 bp, 435 aa]
           {ON} some similarities with uniprot|P39743 Saccharomyces
           cerevisiae YDR388W RVS167 BAR adaptor protein subunit of
           a complex (Rvs161p-Rvs167p) that regulates actin
           endocytosis and viability following starvation or
           osmotic stress
          Length = 435

 Score = 47.4 bits (111), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 24/70 (34%), Positives = 40/70 (57%), Gaps = 5/70 (7%)

Query: 42  WDPPSASRNTSSTSLEYVEALYQFDPQQDGDLGLKPGDKIQLLEKLSPE--WYKGSCNGR 99
           + PP+ +    +++ E V ALY +  Q +GDL    G  I+++E+ +    W+ G  NG 
Sbjct: 366 YTPPTTA---PASAPETVTALYDYQAQAEGDLTFPAGAIIEVVERTNDTNGWWTGRYNGY 422

Query: 100 TGIFPANYVK 109
            G+FP NYV+
Sbjct: 423 QGVFPGNYVQ 432

>Smik_4.658 Chr4 (1170707..1172125) [1419 bp, 472 aa] {ON} YDR388W
           (REAL)
          Length = 472

 Score = 47.4 bits (111), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 23/56 (41%), Positives = 34/56 (60%), Gaps = 4/56 (7%)

Query: 57  EYVEALYQFDPQQDGDLGLKPGDKIQLLEKLSP---EWYKGSCNGRTGIFPANYVK 109
           E V ALY +  Q  GDL    G  I+++++ +P   EW+ G  NG+ G+FP NYV+
Sbjct: 414 ETVTALYDYQAQAAGDLSFPAGAVIEIVQR-TPDVNEWWTGRYNGQQGVFPGNYVQ 468

>Kpol_440.10 s440 (25697..27109) [1413 bp, 470 aa] {ON}
           (25697..27109) [1413 nt, 471 aa]
          Length = 470

 Score = 47.0 bits (110), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 39/68 (57%), Gaps = 5/68 (7%)

Query: 44  PPSASRNTSSTSLEYVEALYQFDPQQDGDLGLKPGDKIQLLEKLSP--EWYKGSCNGRTG 101
           PP+ S   ++   E   +LY++  Q  GDL    G  I+++E+ +   EW+ G  NG+ G
Sbjct: 403 PPAYS---AAPQAETCTSLYEYQAQAAGDLSFPAGVLIEIVERTANVNEWWTGRYNGQQG 459

Query: 102 IFPANYVK 109
           +FP NYV+
Sbjct: 460 VFPGNYVQ 467

>Kwal_55.21287 s55 complement(768495..769880) [1386 bp, 461 aa] {ON}
           YDR388W (RVS167) - 1:1 [contig 130] FULL
          Length = 461

 Score = 46.6 bits (109), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 23/56 (41%), Positives = 34/56 (60%), Gaps = 4/56 (7%)

Query: 57  EYVEALYQFDPQQDGDLGLKPGDKIQLLEKLSPE---WYKGSCNGRTGIFPANYVK 109
           E V ALY +  Q +GDL    G  I+++E+ +P+   W+ G  NG  G+FP NYV+
Sbjct: 404 ETVTALYDYQAQAEGDLTFPAGAIIEVVER-TPDVNGWWTGRYNGYQGVFPGNYVQ 458

>ZYRO0D11110g Chr4 (939064..940443) [1380 bp, 459 aa] {ON} similar
           to DEHA0G12903g and some similarites with YDR388W
           uniprot|P39743 Saccharomyces cerevisiae YDR388W RVS167
           BAR adaptor protein subunit of a complex (Rvs161p-
           Rvs167p) that regulates actin endocytosis and viability
           following starvation or osmotic stress
          Length = 459

 Score = 46.2 bits (108), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 21/57 (36%), Positives = 34/57 (59%), Gaps = 2/57 (3%)

Query: 55  SLEYVEALYQFDPQQDGDLGLKPGDKIQLLEKL--SPEWYKGSCNGRTGIFPANYVK 109
           S+E V ALY +  Q  GDL       I+++++   + EW+ G  +G+ G+FP NYV+
Sbjct: 399 SVETVTALYDYQAQAPGDLSFPANAVIEIVQRTQDTNEWWTGRYHGQVGVFPGNYVQ 455

>KLLA0E03059g Chr5 (281543..282829) [1287 bp, 428 aa] {ON} similar
           to uniprot|P39743 Saccharomyces cerevisiae YDR388W
           RVS167 BAR adaptor protein subunit of a complex
           (Rvs161p-Rvs167p) that regulates actin endocytosis and
           viability following starvation or osmotic stress
          Length = 428

 Score = 45.8 bits (107), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 34/59 (57%), Gaps = 1/59 (1%)

Query: 52  SSTSLEYVEALYQFDPQQDGDLGLKPGDKIQLLEKL-SPEWYKGSCNGRTGIFPANYVK 109
           +S  +E   ALY +  Q +GDL    G  IQ++++  +  W+ G  NG  G+FP NYV+
Sbjct: 366 TSAGVETCTALYDYTAQAEGDLTFPAGAIIQVVDRSDAAGWWVGVYNGVQGVFPGNYVE 424

>KLTH0E09790g Chr5 (881284..883152) [1869 bp, 622 aa] {ON} similar
           to uniprot|P38822 Saccharomyces cerevisiae YHR114W BZZ1
           SH3 domain protein implicated in the regulation of actin
           polymerization able to recruit actin polymerization
           machinery through its SH3 domains colocalizes with
           cortical actin patches and Las17p interacts with type I
           myosins
          Length = 622

 Score = 45.8 bits (107), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 23/67 (34%), Positives = 37/67 (55%), Gaps = 5/67 (7%)

Query: 44  PPSASRNTSSTSLEYVEALYQFDPQQDGDLGLKPGDKIQLLEKLSPE-WYKGSCNGRTGI 102
           PP  S N + T    V+AL+ ++ Q D ++ ++ GD I +L+      W  G  NG+ G+
Sbjct: 560 PPRKSGNAART----VKALFDYEAQGDDEISIRQGDLISVLKADDGSGWTYGELNGQKGL 615

Query: 103 FPANYVK 109
           FP NY +
Sbjct: 616 FPTNYCQ 622

 Score = 30.4 bits (67), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 17/69 (24%), Positives = 31/69 (44%), Gaps = 3/69 (4%)

Query: 61  ALYQFDPQQDGDLGLKPGDKIQLLEKLSPEWY---KGSCNGRTGIFPANYVKPAFSGSNG 117
            L+Q+  Q + ++ + PG+ I LL   S   +   K    G  G+ P +Y++      + 
Sbjct: 495 VLFQYQKQDNDEVSVSPGNAISLLTADSGSGWTRIKNDSTGEAGLVPTSYIEINEKPRSS 554

Query: 118 QSNLPPPPQ 126
               PPP +
Sbjct: 555 APRAPPPRK 563

>YHR114W Chr8 (338083..339984) [1902 bp, 633 aa] {ON}  BZZ1SH3
           domain protein implicated in the regulation of actin
           polymerization, able to recruit actin polymerization
           machinery through its SH3 domains, colocalizes with
           cortical actin patches and Las17p, interacts with type I
           myosins
          Length = 633

 Score = 44.3 bits (103), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 19/59 (32%), Positives = 33/59 (55%), Gaps = 1/59 (1%)

Query: 52  SSTSLEYVEALYQFDPQQDGDLGLKPGDKIQLLE-KLSPEWYKGSCNGRTGIFPANYVK 109
           S+  +  +EA+Y ++ Q D ++ + PGD I ++       W  G C+G  G+FP +Y K
Sbjct: 575 STLPVRTMEAIYAYEAQGDDEISIDPGDIITVIRGDDGSGWTYGECDGLKGLFPTSYCK 633

 Score = 37.0 bits (84), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 18/70 (25%), Positives = 35/70 (50%), Gaps = 3/70 (4%)

Query: 60  EALYQFDPQQDGDLGLKPGDKIQLLEK-LSPEWYK--GSCNGRTGIFPANYVKPAFSGSN 116
           + LY +  + D ++ + PGDKI L+ +     W K      G TG+ P  Y++ + + + 
Sbjct: 499 KVLYAYVQKDDDEITITPGDKISLVARDTGSGWTKINNDTTGETGLVPTTYIRISSAATV 558

Query: 117 GQSNLPPPPQ 126
             ++  P P+
Sbjct: 559 KANDRGPAPE 568

>KNAG0I01580 Chr9 (306534..306580,306733..308431) [1746 bp, 581 aa]
           {ON} Anc_1.356 YFR024C-A
          Length = 581

 Score = 43.9 bits (102), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 31/51 (60%), Gaps = 2/51 (3%)

Query: 61  ALYQFDPQQDGDLGLKPGDKIQLLEKLSP--EWYKGSCNGRTGIFPANYVK 109
           AL+ F   + GDL  K GD I ++++     +W+ G  N R G+FPANYV+
Sbjct: 529 ALFDFGGAEPGDLTFKKGDVITIIKRSQSQNDWWLGRINEREGLFPANYVE 579

>ACR266W Chr3 (838689..840569) [1881 bp, 626 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YHR114W (BZZ1)
          Length = 626

 Score = 43.1 bits (100), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 31/54 (57%), Gaps = 1/54 (1%)

Query: 56  LEYVEALYQFDPQQDGDLGLKPGDKIQLLEKLSPE-WYKGSCNGRTGIFPANYV 108
           L+ V A+Y +  Q D ++ ++ GD I++L   +   W  G  NG  G+FP+NY 
Sbjct: 572 LKTVTAIYDYSAQDDDEISIRAGDVIKVLRGDTGNGWTYGEVNGSKGLFPSNYC 625

>TPHA0B02890 Chr2 complement(659614..661518) [1905 bp, 634 aa] {ON}
           Anc_2.159 YHR114W
          Length = 634

 Score = 43.1 bits (100), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 22/67 (32%), Positives = 37/67 (55%), Gaps = 4/67 (5%)

Query: 44  PPSASRNTSSTSLEYVEALYQFDPQQDGDLGLKPGDKIQLLE-KLSPEWYKGSCNGRTGI 102
           PPS  + T++     V+ALY ++ Q D ++ +  GD I +++      W  G  NG  G+
Sbjct: 571 PPSRRKTTTTRK---VQALYDYEAQGDDEISISVGDTITVIKGDDGSGWTFGELNGIKGL 627

Query: 103 FPANYVK 109
           FP++Y K
Sbjct: 628 FPSSYCK 634

 Score = 36.2 bits (82), Expect = 0.049,   Method: Compositional matrix adjust.
 Identities = 21/79 (26%), Positives = 37/79 (46%), Gaps = 3/79 (3%)

Query: 60  EALYQFDPQQDGDLGLKPGDKIQLLEK-LSPEW--YKGSCNGRTGIFPANYVKPAFSGSN 116
           + LYQ++ Q   ++ +  GD I L++      W   K +  G  G+ P +YV+     S 
Sbjct: 505 KVLYQYNKQDADEISIDVGDSISLVQADTGSGWTRIKNNTTGEEGLVPTSYVEIKTQESR 564

Query: 117 GQSNLPPPPQYKAQELQPV 135
           G + + PP + K    + V
Sbjct: 565 GPAPVAPPSRRKTTTTRKV 583

>SAKL0H21912g Chr8 complement(1913307..1917068) [3762 bp, 1253 aa]
           {ON} similar to uniprot|P32790 Saccharomyces cerevisiae
           YBL007C SLA1 Cytoskeletal protein binding protein
           required for assembly of the cortical actin cytoskeleton
           contains 3 SH3 domains interacts with proteins
           regulating actin dynamics and with proteins required for
           endocytosis
          Length = 1253

 Score = 43.1 bits (100), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 24/80 (30%), Positives = 43/80 (53%), Gaps = 4/80 (5%)

Query: 56  LEYVEALYQFDPQQ--DGDLGLKPGDKIQLLEKLSPEWYKGS--CNGRTGIFPANYVKPA 111
           + + +ALY +D  Q  D +L    GD+  + +   P+W   S   +G  G  P NYV+ +
Sbjct: 71  ISHAKALYDYDQVQNPDEELLFHEGDEFDVYDNRDPDWILCSSKTSGEIGFVPGNYVEIS 130

Query: 112 FSGSNGQSNLPPPPQYKAQE 131
            +   G ++ PPPPQ+ +++
Sbjct: 131 EATPVGSNSFPPPPQHVSKQ 150

 Score = 31.6 bits (70), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 19/65 (29%), Positives = 35/65 (53%), Gaps = 3/65 (4%)

Query: 49  RNTSSTSLEYVEALYQFDPQQDGDLGLKPGDKIQLL-EKLSPEWYKGSC--NGRTGIFPA 105
           R +SS S +  + +Y F  +   +L +K G  + +L +K S +W+       G+ G+ PA
Sbjct: 341 RPSSSGSRKQGKIIYDFIGESADELSVKEGQLVYILNDKKSKDWWMCESVDTGKQGVVPA 400

Query: 106 NYVKP 110
            +V+P
Sbjct: 401 QFVEP 405

>Ecym_2316 Chr2 complement(619368..620633) [1266 bp, 421 aa] {ON}
           similar to Ashbya gossypii AFR140C
          Length = 421

 Score = 42.0 bits (97), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 20/54 (37%), Positives = 29/54 (53%), Gaps = 1/54 (1%)

Query: 57  EYVEALYQFDPQQDGDLGLKPGDKIQLLEKL-SPEWYKGSCNGRTGIFPANYVK 109
           E   +LY F  Q   DL       I++L++  S  W+ G  NG+ G+FP NYV+
Sbjct: 364 ETCTSLYAFAAQDKADLTFPANAVIEILDRADSSGWWTGRYNGQEGLFPGNYVR 417

>Smik_8.192 Chr8 (314456..316357) [1902 bp, 633 aa] {ON} YHR114W
           (REAL)
          Length = 633

 Score = 42.0 bits (97), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 18/59 (30%), Positives = 32/59 (54%), Gaps = 1/59 (1%)

Query: 52  SSTSLEYVEALYQFDPQQDGDLGLKPGDKIQLLE-KLSPEWYKGSCNGRTGIFPANYVK 109
           S+  +  +EA+Y ++ Q D ++ +  GD I ++       W  G C+G  G+FP +Y K
Sbjct: 575 STLPIRTLEAMYAYEAQGDDEISIDVGDVITVIRGDDGSGWTYGECDGLKGLFPTSYCK 633

 Score = 38.9 bits (89), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 18/70 (25%), Positives = 35/70 (50%), Gaps = 3/70 (4%)

Query: 60  EALYQFDPQQDGDLGLKPGDKIQLLEK-LSPEWYK--GSCNGRTGIFPANYVKPAFSGSN 116
           + LY +  Q D ++ + PGD+I L+ +     W K      G +G+ P  Y++ + + + 
Sbjct: 499 KVLYAYVKQDDDEISISPGDRISLVARDTGSGWTKINNDSTGESGLVPTTYIRISTTDTA 558

Query: 117 GQSNLPPPPQ 126
             +N  P P+
Sbjct: 559 TANNRGPAPE 568

>Skud_8.175 Chr8 (311857..313758) [1902 bp, 633 aa] {ON} YHR114W
           (REAL)
          Length = 633

 Score = 41.6 bits (96), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 16/52 (30%), Positives = 30/52 (57%), Gaps = 1/52 (1%)

Query: 59  VEALYQFDPQQDGDLGLKPGDKIQLLE-KLSPEWYKGSCNGRTGIFPANYVK 109
           +EA+Y ++ Q D ++ +  GD+I ++       W  G C+G  G+FP +Y +
Sbjct: 582 MEAVYAYEAQGDDEMSIDVGDEITVIRGDDGSGWTYGECDGLKGLFPTSYCR 633

 Score = 36.2 bits (82), Expect = 0.052,   Method: Compositional matrix adjust.
 Identities = 18/59 (30%), Positives = 30/59 (50%), Gaps = 3/59 (5%)

Query: 60  EALYQFDPQQDGDLGLKPGDKIQLLEK-LSPEWYK--GSCNGRTGIFPANYVKPAFSGS 115
           + LY +  Q D ++ + PGDKI L+ +     W K      G TG+ P  Y++ + + S
Sbjct: 499 KVLYAYVKQDDDEIDITPGDKISLVARDTGSGWTKINNGNTGETGLVPTTYIRVSSAAS 557

>SAKL0G17600g Chr7 complement(1523623..1524948) [1326 bp, 441 aa]
           {ON} conserved hypothetical protein
          Length = 441

 Score = 41.6 bits (96), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 23/59 (38%), Positives = 31/59 (52%), Gaps = 7/59 (11%)

Query: 58  YVEALYQF--DPQQDG---DLGLKPGDKIQLLEKLSPEWYKGSC--NGRTGIFPANYVK 109
           Y  ALY +  DP Q G   DL  K GD I++++K    W+ G      R G FP N+V+
Sbjct: 378 YATALYDYSPDPNQQGTGEDLTFKNGDMIRVIKKTENNWWYGEVLRTKRRGYFPVNFVE 436

>KLLA0C12551g Chr3 complement(1065593..1067416) [1824 bp, 607 aa]
           {ON} weakly similar to uniprot|Q05080 Saccharomyces
           cerevisiae YMR032W HOF1 Bud neck-localized SH3 domain-
           containing protein required for cytokinesis
          Length = 607

 Score = 41.2 bits (95), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 20/58 (34%), Positives = 35/58 (60%), Gaps = 4/58 (6%)

Query: 56  LEYVEALYQF-DPQQDGDLGLKPGDKIQLLEKLSPEWYKGSC---NGRTGIFPANYVK 109
           ++YV+A+Y + +P ++  L    GD + L+E ++ +WY G     N + G+ P NYVK
Sbjct: 547 VKYVKAMYSYTEPNENNILLFNSGDILLLVECINDDWYVGEVYQGNKQHGLVPMNYVK 604

>Kpol_1072.56 s1072 complement(127771..129684) [1914 bp, 637 aa]
           {ON} complement(127771..129684) [1914 nt, 638 aa]
          Length = 637

 Score = 40.8 bits (94), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 18/58 (31%), Positives = 32/58 (55%), Gaps = 1/58 (1%)

Query: 53  STSLEYVEALYQFDPQQDGDLGLKPGDKIQLLE-KLSPEWYKGSCNGRTGIFPANYVK 109
           + S+  VEA+Y ++   D +L +  G+ I+++       W  G  NG  G+FP++Y K
Sbjct: 580 TASIRTVEAIYDYEAAGDDELSISQGETIKVIRGDDGSGWTYGESNGAKGLFPSSYCK 637

>Ecym_2526 Chr2 (1025422..1026996) [1575 bp, 524 aa] {ON} similar to
           Ashbya gossypii AGL237C
          Length = 524

 Score = 40.8 bits (94), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 30/51 (58%), Gaps = 2/51 (3%)

Query: 61  ALYQFDPQQDGDLGLKPGDKIQLLEKLSPEWYKGSC--NGRTGIFPANYVK 109
           A Y ++  +D +L  K GD+I  +E +  +W+ G     G  G+FP+NYVK
Sbjct: 471 AEYDYEAGEDNELTFKEGDRIIDIEFVDDDWWLGVLKNTGEKGLFPSNYVK 521

>Kpol_538.25 s538 (50807..52930) [2124 bp, 707 aa] {ON}
           (50807..52930) [2124 nt, 708 aa]
          Length = 707

 Score = 40.4 bits (93), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 23/66 (34%), Positives = 35/66 (53%), Gaps = 6/66 (9%)

Query: 59  VEALYQFDPQQDGDLGLKPGDKIQLLEKLSPEWYKGSCNGR-----TGIFPANYVKPAFS 113
           V A+  ++PQ   DL +  GDKI +L      WY G    +     +GIFP+++VK    
Sbjct: 11  VVAVQAYEPQFTADLKISKGDKITVLYVEDDRWYYGRYVDKDGFTNSGIFPSSHVK-VIE 69

Query: 114 GSNGQS 119
           G +G+S
Sbjct: 70  GKDGKS 75

>ZYRO0G10098g Chr7 complement(808399..812577) [4179 bp, 1392 aa]
           {ON} similar to uniprot|P32790 Saccharomyces cerevisiae
           YBL007C SLA1 Cytoskeletal protein binding protein
           required for assembly of the cortical actin cytoskeleton
           contains 3 SH3 domains interacts with proteins
           regulating actin dynamics and with proteins required for
           endocytosis
          Length = 1392

 Score = 40.4 bits (93), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 26/64 (40%), Positives = 37/64 (57%), Gaps = 8/64 (12%)

Query: 56  LEYVEALYQFDPQQDGDLGLKPGDKIQLLEKLS-PEWY--KGSCNGR-----TGIFPANY 107
           +  V+ALY ++PQ D +L +K  D + LLEK    EW+  K    G      TG+ P+NY
Sbjct: 5   IGVVKALYDYEPQTDEELAIKEDDILYLLEKSDVDEWWTVKKRVIGLDAEEPTGLVPSNY 64

Query: 108 VKPA 111
           V+PA
Sbjct: 65  VEPA 68

>Kwal_47.17894 s47 (597826..599691) [1866 bp, 621 aa] {ON} YHR114W
           (BZZ1) - Myo3/5p-Bee1p-Vrp1p actin assembly complex
           component [contig 204] FULL
          Length = 621

 Score = 40.0 bits (92), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 27/52 (51%), Gaps = 1/52 (1%)

Query: 59  VEALYQFDPQQDGDLGLKPGDKIQLLEKLSPE-WYKGSCNGRTGIFPANYVK 109
           VEA+Y +  Q + +  L  GD I +L+      W  G  NG  G+FP +Y K
Sbjct: 570 VEAVYSYQAQGEDETSLTEGDVITVLKADDGSGWTYGEVNGEKGLFPTSYCK 621

 Score = 35.4 bits (80), Expect = 0.086,   Method: Compositional matrix adjust.
 Identities = 21/66 (31%), Positives = 28/66 (42%), Gaps = 3/66 (4%)

Query: 62  LYQFDPQQDGDLGLKPGDKIQLL-EKLSPEW--YKGSCNGRTGIFPANYVKPAFSGSNGQ 118
           LY +  Q D ++ + PGD I LL       W   K    G+TG+ P  YV       +  
Sbjct: 496 LYLYQKQDDDEVSISPGDPITLLVADTGSGWTKIKNDRTGQTGLVPTTYVDIKEKARSSA 555

Query: 119 SNLPPP 124
              PPP
Sbjct: 556 PRAPPP 561

>TPHA0F03100 Chr6 complement(680407..681552) [1146 bp, 381 aa] {ON}
           Anc_7.365 YLR191W
          Length = 381

 Score = 39.7 bits (91), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 22/63 (34%), Positives = 38/63 (60%), Gaps = 7/63 (11%)

Query: 54  TSLEYVEALYQFDPQ-QDGDLGLKPGDKIQLLEKLSP-----EWYK-GSCNGRTGIFPAN 106
           ++LE+  AL+ F+P+ +  +L L  GD + +L K  P     +W+K  + NG TG  P+N
Sbjct: 304 SNLEFARALFDFNPENRKIELTLTKGDLMAILTKKDPYGNTSKWWKVRTKNGDTGYVPSN 363

Query: 107 YVK 109
           Y++
Sbjct: 364 YIE 366

>YLR191W Chr12 (537272..538432) [1161 bp, 386 aa] {ON}
           PEX13Integral peroxisomal membrane protein required for
           translocation of peroxisomal matrix proteins, interacts
           with the PTS1 signal recognition factor Pex5p and the
           PTS2 signal recognition factor Pex7p, forms a complex
           with Pex14p and Pex17p
          Length = 386

 Score = 39.7 bits (91), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 26/89 (29%), Positives = 43/89 (48%), Gaps = 7/89 (7%)

Query: 28  NDVFDQINKSLPMRWDPPSASRNTSSTSLEYVEALYQFDPQQ-DGDLGLKPGDKIQLLEK 86
           N    ++  S  +R    + S     + LE+  ALY F P+  + ++ LK GD + +L K
Sbjct: 280 NKFITKLQTSGTIRASQGNGSEPIDPSKLEFARALYDFVPENPEMEVALKKGDLMAILSK 339

Query: 87  LSP-----EWYK-GSCNGRTGIFPANYVK 109
             P     +W+K  + NG  G  P NY++
Sbjct: 340 KDPLGRDSDWWKVRTKNGNIGYIPYNYIE 368

>Kpol_325.12 s325 (19571..21283) [1713 bp, 570 aa] {ON}
           (19571..21283) [1713 nt, 571 aa]
          Length = 570

 Score = 39.7 bits (91), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 26/84 (30%), Positives = 37/84 (44%), Gaps = 13/84 (15%)

Query: 38  LPMRWDPPSASRNTSSTSLEYVE-----------ALYQFDPQQDGDLGLKPGDKIQLLEK 86
           LP R +P  AS +  S                  A Y +D  +D +L    GDKI  +E 
Sbjct: 483 LPSRGEPAPASASAGSVPPPPPRKPAQSGGPSAVAEYDYDAAEDNELTFVEGDKIVNIEF 542

Query: 87  LSPEWYKGSC--NGRTGIFPANYV 108
           +  +W+ G     G  G+FP+NYV
Sbjct: 543 VDDDWWLGELEKTGEKGLFPSNYV 566

>TPHA0H02380 Chr8 (558973..560559) [1587 bp, 528 aa] {ON} Anc_6.366
           YCR088W
          Length = 528

 Score = 39.7 bits (91), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 22/67 (32%), Positives = 31/67 (46%), Gaps = 2/67 (2%)

Query: 44  PPSASRNTSSTSLEYVEALYQFDPQQDGDLGLKPGDKIQLLEKLSPEWYKGS--CNGRTG 101
           PP         +L    A Y +D  +D +L    G KI  +E +  +W+ G     G  G
Sbjct: 458 PPRKVATQEKPALATAVAEYDYDAAEDNELTFVEGTKIINIEFVDDDWWLGENGTTGEKG 517

Query: 102 IFPANYV 108
           +FPANYV
Sbjct: 518 LFPANYV 524

>SAKL0E10780g Chr5 (897714..899591) [1878 bp, 625 aa] {ON} similar
           to uniprot|Q75BK5 Ashbya gossypii ACR266W ACR266Wp and
           some similarites with YHR114W uniprot|P38822
           Saccharomyces cerevisiae YHR114W BZZ1 SH3 domain protein
           implicated in the regulation of actin polymerization
           able to recruit actin polymerization machinery through
           its SH3 domains colocalizes with cortical actin patches
           and Las17p interacts with type I myosins
          Length = 625

 Score = 39.3 bits (90), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 19/60 (31%), Positives = 33/60 (55%), Gaps = 7/60 (11%)

Query: 54  TSLEYVEALYQFDPQQDGDLGLKPGDKIQLLEKLSPE----WYKGSCNGRTGIFPANYVK 109
           +S+  +EALY +  Q D +L +  G  +++L+   P+    W  G  +G  G+FP +Y K
Sbjct: 569 SSVRTIEALYDYQAQGDDELSIYAGSVVKVLK---PDDGSGWTYGELDGAKGLFPTSYCK 625

 Score = 30.0 bits (66), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 21/67 (31%), Positives = 32/67 (47%), Gaps = 4/67 (5%)

Query: 61  ALYQFDPQQDGDLGLKPGDKIQLLEK-LSPEW--YKGSCNGRTGIFPANYVKPAFSGSNG 117
            LY +  Q   ++ + PGD I L+ K     W   K S  G  G+ P++YV    S ++ 
Sbjct: 499 VLYPYAKQDADEVTINPGDLISLVTKDTGSGWTKIKNSTTGEMGLVPSSYVDIKES-THS 557

Query: 118 QSNLPPP 124
             + PPP
Sbjct: 558 VPHAPPP 564

>NDAI0I00220 Chr9 (32281..34128) [1848 bp, 615 aa] {ON} Anc_6.366
           YCR088W
          Length = 615

 Score = 39.3 bits (90), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 20/67 (29%), Positives = 33/67 (49%), Gaps = 2/67 (2%)

Query: 44  PPSASRNTSSTSLEYVEALYQFDPQQDGDLGLKPGDKIQLLEKLSPEWYKGSC--NGRTG 101
           PP  +      +  +  A Y +D  ++ +L     DKI  +E +  +W+ G    NG  G
Sbjct: 545 PPRRTMEPKEETKPWATAEYDYDAGEENELTFVENDKIINIEFVDDDWWLGELEKNGEKG 604

Query: 102 IFPANYV 108
           +FP+NYV
Sbjct: 605 LFPSNYV 611

>ZYRO0D17358g Chr4 (1429127..1431133) [2007 bp, 668 aa] {ON} similar
           to uniprot|P15891 Saccharomyces cerevisiae YCR088W ABP1
           Actin-binding protein of the cortical actin cytoskeleton
           important for activation of the Arp2/3 complex that
           plays a key role actin in cytoskeleton organization
          Length = 668

 Score = 38.9 bits (89), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 23/63 (36%), Positives = 33/63 (52%), Gaps = 4/63 (6%)

Query: 48  SRNTSSTSLEYVEALYQFDPQQDGDLGLKPGDKIQLLEKLSPEWYKG--SCNGRTGIFPA 105
           S NTSS      E  Y +D  +D +L  +  DKI  +E +  +W+ G     G  G+FP+
Sbjct: 604 SGNTSSNPSAIAE--YDYDAAEDNELTFRENDKIVNIEFVDEDWWLGELGSTGEKGLFPS 661

Query: 106 NYV 108
           NYV
Sbjct: 662 NYV 664

>AGR306C Chr7 complement(1305647..1308418) [2772 bp, 923 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YJL020C
           (BBC1)
          Length = 923

 Score = 38.9 bits (89), Expect = 0.006,   Method: Composition-based stats.
 Identities = 21/58 (36%), Positives = 32/58 (55%), Gaps = 5/58 (8%)

Query: 59  VEALYQFDPQQDGDLGLKPGDKIQLLEKLSPEWY-----KGSCNGRTGIFPANYVKPA 111
           V A Y ++   DGDL  + G +I+++     +WY      G+ N + GIFP NYV+ A
Sbjct: 13  VIAKYTYESIHDGDLNFEDGQRIEVISIEDNQWYYGHFVDGAGNEQEGIFPKNYVEVA 70

>Suva_15.310 Chr15 (540462..542366) [1905 bp, 634 aa] {ON} YHR114W
           (REAL)
          Length = 634

 Score = 38.9 bits (89), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 29/91 (31%), Positives = 42/91 (46%), Gaps = 12/91 (13%)

Query: 60  EALYQFDPQQDGDLGLKPGDKIQLLEKLSPE-WYK--GSCNGRTGIFPANYVK----PAF 112
           + LY +  Q   ++ + PGDKI L+ + S   W K      G TG+ P  YV+       
Sbjct: 499 KVLYAYSKQDTDEISISPGDKISLVARDSGSGWTKINNDSTGETGLVPTTYVRISNADGG 558

Query: 113 SGSNGQSNLP--PPPQYKAQELQPVPTQNSA 141
             +NG+   P  PPP+  A    PV T  +A
Sbjct: 559 DAANGRGPAPEVPPPRRTA---LPVRTLEAA 586

 Score = 38.5 bits (88), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 16/52 (30%), Positives = 28/52 (53%), Gaps = 1/52 (1%)

Query: 59  VEALYQFDPQQDGDLGLKPGDKIQLLE-KLSPEWYKGSCNGRTGIFPANYVK 109
           +EA Y ++ + D ++ +  GD I ++       W  G C+G  G+FP +Y K
Sbjct: 583 LEAAYAYEAKGDDEMSIDVGDVITVIRGDDGSGWTYGECDGLKGLFPTSYCK 634

>Skud_12.256 Chr12 (483859..485070) [1212 bp, 403 aa] {ON} YLR191W
           (REAL)
          Length = 403

 Score = 38.5 bits (88), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 25/89 (28%), Positives = 42/89 (47%), Gaps = 7/89 (7%)

Query: 28  NDVFDQINKSLPMRWDPPSASRNTSSTSLEYVEALYQFDPQQ-DGDLGLKPGDKIQLLEK 86
           N    ++  S  ++    S S     + LE+  ALY F P+    ++ L  GD + +L K
Sbjct: 297 NKFITKVQNSGAIQISKGSGSEPIDPSKLEFARALYDFVPENPQIEVALTKGDLMAILSK 356

Query: 87  LSP-----EWYK-GSCNGRTGIFPANYVK 109
             P     +W+K  + NG+ G  P NY++
Sbjct: 357 KDPIGKNSDWWKVRTKNGKIGYIPYNYIE 385

>KAFR0J02650 Chr10 complement(510356..512017) [1662 bp, 553 aa] {ON}
           Anc_6.366 YCR088W
          Length = 553

 Score = 38.1 bits (87), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 29/50 (58%), Gaps = 2/50 (4%)

Query: 61  ALYQFDPQQDGDLGLKPGDKIQLLEKLSPEWYKGSC--NGRTGIFPANYV 108
           A Y ++  +D +L  +  DKI  +E +  +W+ G    NG  G+FP+NYV
Sbjct: 499 AEYDYEAGEDNELTFEENDKIINIEFVDDDWWLGELEKNGEKGLFPSNYV 548

>NDAI0B04320 Chr2 (1084783..1086681) [1899 bp, 632 aa] {ON}
           Anc_2.159 YHR114W
          Length = 632

 Score = 38.1 bits (87), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 33/112 (29%), Positives = 50/112 (44%), Gaps = 14/112 (12%)

Query: 24  NVISNDVFDQINKSLPMRWDPPSASRNTSSTSLEYVEALYQFDPQQDGDLGLKPGDKIQL 83
           +V SNDV D     L   +   ++   +S T ++  + LY +  Q   ++ + PGD I L
Sbjct: 466 DVASNDVDD-----LSSNYTTTTSGATSSRTGIKKNKVLYAYAKQDTDEISISPGDSISL 520

Query: 84  LEK-LSPEWYK--GSCNGRTGIFPANYVK----PAFSGSNGQSNLP--PPPQ 126
           L       W K      G +G+ P  YVK     A  G +G  + P  PPP+
Sbjct: 521 LAADTGSGWTKIRNDTTGESGLVPTTYVKITENVAVDGGHGNGHAPAVPPPR 572

 Score = 29.3 bits (64), Expect = 9.6,   Method: Compositional matrix adjust.
 Identities = 14/50 (28%), Positives = 22/50 (44%), Gaps = 1/50 (2%)

Query: 61  ALYQFDPQQDGDLGLKPGDKIQLLE-KLSPEWYKGSCNGRTGIFPANYVK 109
           A Y +    D ++ +  GD I ++       W  G  NG  G+ P +Y K
Sbjct: 583 AAYSYSAAGDDEISINVGDVITVIRGDDGSGWTYGELNGSKGLVPTSYCK 632

>NDAI0J00850 Chr10 (189221..189958) [738 bp, 245 aa] {ON} Anc_8.344
           YDR162C
          Length = 245

 Score = 37.7 bits (86), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 27/56 (48%), Gaps = 2/56 (3%)

Query: 61  ALYQFDPQQDGDLGLKPGDKIQLLEKLSPEWYKGSCNGR--TGIFPANYVKPAFSG 114
           ALY F+P+ D +LGLK  D + +  K    W       R  TG+ P  YV    SG
Sbjct: 111 ALYDFEPENDNELGLKENDIVFISYKHGQGWLVAENEKRTQTGLVPEEYVSYLESG 166

>Suva_10.287 Chr10 (509884..511062) [1179 bp, 392 aa] {ON} YLR191W
           (REAL)
          Length = 392

 Score = 37.7 bits (86), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 22/63 (34%), Positives = 34/63 (53%), Gaps = 7/63 (11%)

Query: 54  TSLEYVEALYQFDPQQ-DGDLGLKPGDKIQLLEKLSP-----EWYK-GSCNGRTGIFPAN 106
           + LE+  ALY F P+    ++ LK GD + +L K  P     +W+K  + NG  G  P N
Sbjct: 312 SKLEFARALYDFIPENPQMEVALKKGDLMAILSKKDPLGKDSDWWKVRTKNGSIGYIPYN 371

Query: 107 YVK 109
           Y++
Sbjct: 372 YIE 374

>Kpol_2000.2 s2000 complement(1407..2084) [678 bp, 225 aa] {ON}
           complement(1407..2084) [678 nt, 226 aa]
          Length = 225

 Score = 37.0 bits (84), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 26/50 (52%), Gaps = 2/50 (4%)

Query: 61  ALYQFDPQQDGDLGLKPGDKIQLLEKLSPEWYKGSCNGR--TGIFPANYV 108
           ALY F P+ D +LGL+ GD + +  K    W      GR  TG+ P  +V
Sbjct: 107 ALYDFVPENDSELGLEEGDIVFISYKHGQGWLVAENQGRTKTGLVPEEFV 156

>Smik_3.186 Chr3 (264667..266442) [1776 bp, 591 aa] {ON} YCR088W
           (REAL)
          Length = 591

 Score = 37.4 bits (85), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 29/53 (54%), Gaps = 2/53 (3%)

Query: 58  YVEALYQFDPQQDGDLGLKPGDKIQLLEKLSPEWYKGSC--NGRTGIFPANYV 108
           +  A Y +D  +D +L     DKI  +E +  +W+ G    +G  G+FP+NYV
Sbjct: 535 WATAEYDYDAAEDNELTFVENDKIINIEFVDDDWWLGELEKDGSKGLFPSNYV 587

>Skud_3.160 Chr3 (249584..251344) [1761 bp, 586 aa] {ON} YCR088W
           (REAL)
          Length = 586

 Score = 37.4 bits (85), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 29/53 (54%), Gaps = 2/53 (3%)

Query: 58  YVEALYQFDPQQDGDLGLKPGDKIQLLEKLSPEWYKGSC--NGRTGIFPANYV 108
           +  A Y +D  +D +L     DKI  +E +  +W+ G    +G  G+FP+NYV
Sbjct: 530 WATAEYDYDAAEDNELTFVENDKIVNIEFVDDDWWLGELEKDGSKGLFPSNYV 582

>TBLA0B09620 Chr2 complement(2277581..2280406) [2826 bp, 941 aa]
           {ON} Anc_2.319 YDL117W
          Length = 941

 Score = 37.4 bits (85), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 24/67 (35%), Positives = 35/67 (52%), Gaps = 12/67 (17%)

Query: 54  TSLEY--------VEALYQFDPQQDGDLGLKPGDKIQLLEKLSPEWYKGSC---NGRTGI 102
           TSLE+        V+A Y +  Q  GDLG   GD ++ + K++ +WY G        +G 
Sbjct: 2   TSLEFAPLAPPFKVKAKYGWSGQAKGDLGFLEGDVME-VTKITGDWYYGRLLRNRKCSGY 60

Query: 103 FPANYVK 109
           FP N+VK
Sbjct: 61  FPNNFVK 67

>CAGL0E01045g Chr5 (94265..94906) [642 bp, 213 aa] {ON} similar to
           uniprot|Q12163 Saccharomyces cerevisiae YDR162c NBP2
           NAP1P-binding protein
          Length = 213

 Score = 36.6 bits (83), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 27/50 (54%), Gaps = 2/50 (4%)

Query: 61  ALYQFDPQQDGDLGLKPGDKIQLLEKLSPEWY--KGSCNGRTGIFPANYV 108
           ALY F+P+ D +LGLK GD I +  +    W   +     +TG+ P  +V
Sbjct: 101 ALYDFEPENDNELGLKEGDVIFISYRHCQGWLVAQNDTQTKTGLVPEEFV 150

>Ecym_5426 Chr5 (877285..879303) [2019 bp, 672 aa] {ON} similar to
           Ashbya gossypii ACR266W
          Length = 672

 Score = 37.4 bits (85), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 17/56 (30%), Positives = 30/56 (53%), Gaps = 1/56 (1%)

Query: 54  TSLEYVEALYQFDPQQDGDLGLKPGDKIQLL-EKLSPEWYKGSCNGRTGIFPANYV 108
           TSL  V A+Y +  +   ++ ++ GD I+++ +     W  G   G  G+FP+NY 
Sbjct: 616 TSLRTVIAVYDYAAKDFDEISIRAGDVIKVIRDDTGNGWTYGEVRGSRGLFPSNYC 671

>Suva_3.124 Chr3 (182459..184261) [1803 bp, 600 aa] {ON} YCR088W
           (REAL)
          Length = 600

 Score = 37.4 bits (85), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 29/53 (54%), Gaps = 2/53 (3%)

Query: 58  YVEALYQFDPQQDGDLGLKPGDKIQLLEKLSPEWYKGSC--NGRTGIFPANYV 108
           +  A Y +D  +D +L     DKI  +E +  +W+ G    +G  G+FP+NYV
Sbjct: 544 WATAEYDYDAAEDNELTFVENDKIINIEFVDDDWWLGELEKDGSKGLFPSNYV 596

>TPHA0G00930 Chr7 (179525..181999) [2475 bp, 824 aa] {ON} Anc_2.319
           YDL117W
          Length = 824

 Score = 37.4 bits (85), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 28/89 (31%), Positives = 39/89 (43%), Gaps = 14/89 (15%)

Query: 59  VEALYQFDPQQDGDLGLKPGDKIQLLEKLSPEWYKGSC---NGRTGIFPANYV------- 108
           V+A Y +  Q  GDLG   GD I  + K + +WY G         G FP N+V       
Sbjct: 7   VKARYGWSGQAKGDLGFLEGD-IMNVTKTTGDWYYGFLLRNKKSKGYFPKNFVIELNGKT 65

Query: 109 KPAFSGSNGQSNLPPPP---QYKAQELQP 134
           KP+       + LP  P   +Y+A +  P
Sbjct: 66  KPSVEAITADAKLPNIPSRSKYEASQSSP 94

>Ecym_3366 Chr3 complement(695872..698592) [2721 bp, 906 aa] {ON}
           similar to Ashbya gossypii ADL288C
          Length = 906

 Score = 37.4 bits (85), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 31/102 (30%), Positives = 45/102 (44%), Gaps = 20/102 (19%)

Query: 59  VEALYQFDPQQDGDLGLKPGDKIQLLEKLSPEWYKGSC--NGRTGIFPANYV-------- 108
           V ALY +  +Q  DLG    D I++  K+  +W  G    N +TG FP  YV        
Sbjct: 12  VRALYSWSGEQGQDLGFLESDLIEV-TKVKGDWLYGRLLRNKKTGYFPLGYVQLIQEVYN 70

Query: 109 --------KPAFSGSNGQSNLPPPPQYKAQELQPVPTQNSAV 142
                   KP  +GS   ++ P   Q     L P+P ++SA+
Sbjct: 71  SFNSLSPKKPYDTGSTPTTS-PSKLQNAKSTLPPIPRRSSAI 111

>TBLA0I01080 Chr9 (218200..222867) [4668 bp, 1555 aa] {ON} Anc_7.413
           YER114C
          Length = 1555

 Score = 37.4 bits (85), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 26/91 (28%), Positives = 45/91 (49%), Gaps = 7/91 (7%)

Query: 26  ISNDVFDQINKSLPMRWDPPSASRNTSSTSLEY--VEALYQFDPQQDGDLGLKPGDKIQL 83
           I+N   D  N SL M     +    TS+ + +Y     + ++  + D +L +KPGDKIQ+
Sbjct: 17  ITNSTNDDSNLSLDMDLSTSTQENLTSTPTKKYPMYIVINEYTKRMDDELDMKPGDKIQV 76

Query: 84  L---EKLSPEWYKGSC--NGRTGIFPANYVK 109
           +   E+ +  WY G     G  G++P  + +
Sbjct: 77  ITDDEEYNDGWYFGKNLRTGEEGLYPVVFTQ 107

>YCR088W Chr3 (265068..266846) [1779 bp, 592 aa] {ON}
           ABP1Actin-binding protein of the cortical actin
           cytoskeleton, important for activation of the Arp2/3
           complex that plays a key role actin in cytoskeleton
           organization; phosphorylation within its PRR
           (Proline-Rich Region), mediated by Cdc28p and Pho85p,
           protects Abp1p from proteolysis mediated by its own PEST
           sequences
          Length = 592

 Score = 36.6 bits (83), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 29/53 (54%), Gaps = 2/53 (3%)

Query: 58  YVEALYQFDPQQDGDLGLKPGDKIQLLEKLSPEWYKGSC--NGRTGIFPANYV 108
           +  A Y +D  +D +L     DKI  +E +  +W+ G    +G  G+FP+NYV
Sbjct: 536 WATAEYDYDAAEDNELTFVENDKIINIEFVDDDWWLGELEKDGSKGLFPSNYV 588

>TDEL0B05220 Chr2 complement(918098..919939) [1842 bp, 613 aa] {ON}
           Anc_2.159 YHR114W
          Length = 613

 Score = 36.6 bits (83), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 16/52 (30%), Positives = 27/52 (51%), Gaps = 1/52 (1%)

Query: 59  VEALYQFDPQQDGDLGLKPGDKIQLLE-KLSPEWYKGSCNGRTGIFPANYVK 109
           ++A Y ++ Q D +L L P D + ++       W  G  NG  G+FP +Y +
Sbjct: 562 MQAQYDYEAQGDDELSLTPNDVVNVIRGDDGSGWTYGELNGEKGLFPTSYCR 613

>SAKL0A00594g Chr1 complement(68426..70336) [1911 bp, 636 aa] {ON}
           some similarities with uniprot|P15891 Saccharomyces
           cerevisiae YCR088W ABP1 Actin-binding protein of the
           cortical actin cytoskeleton important for activation of
           the Arp2/3 complex that plays a key role actin in
           cytoskeleton organization
          Length = 636

 Score = 36.6 bits (83), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 29/51 (56%), Gaps = 2/51 (3%)

Query: 61  ALYQFDPQQDGDLGLKPGDKIQLLEKLSPEWYKGSCN--GRTGIFPANYVK 109
           A Y ++  ++ +L    GDKI  +E +  +W+ G     G  G+FP+NYV+
Sbjct: 583 AEYDYEAGEENELTFTEGDKIINIEFVDDDWWLGELEKTGEKGLFPSNYVE 633

>TBLA0F00280 Chr6 complement(58186..59916) [1731 bp, 576 aa] {ON}
           Anc_6.366 YCR088W
          Length = 576

 Score = 36.2 bits (82), Expect = 0.042,   Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 29/51 (56%), Gaps = 2/51 (3%)

Query: 61  ALYQFDPQQDGDLGLKPGDKIQLLEKLSPEWYKG--SCNGRTGIFPANYVK 109
           A Y ++  +D +L     DKI  +E +  +W+ G    +G  G+FP+NYV+
Sbjct: 523 AQYDYEAAEDNELTFNENDKIINIEFVDDDWWLGELESSGEKGLFPSNYVE 573

>Ecym_4228 Chr4 (475985..476770) [786 bp, 261 aa] {ON} similar to
           Ashbya gossypii AGL169C
          Length = 261

 Score = 35.8 bits (81), Expect = 0.045,   Method: Compositional matrix adjust.
 Identities = 22/52 (42%), Positives = 28/52 (53%), Gaps = 2/52 (3%)

Query: 59  VEALYQFDPQQDGDLGLKPGDKIQLLEKLSPEWYKG-SCNG-RTGIFPANYV 108
           V ALY F P+ D +L LK GD I +  K    W    + +G RTG+ P  YV
Sbjct: 119 VVALYDFVPENDNELELKEGDVIYISYKHGQGWLVAENIDGTRTGLVPEEYV 170

>CAGL0C03597g Chr3 complement(358731..360473) [1743 bp, 580 aa] {ON}
           similar to uniprot|P15891 Saccharomyces cerevisiae
           YCR088w ABP1
          Length = 580

 Score = 36.2 bits (82), Expect = 0.049,   Method: Compositional matrix adjust.
 Identities = 17/53 (32%), Positives = 29/53 (54%), Gaps = 2/53 (3%)

Query: 58  YVEALYQFDPQQDGDLGLKPGDKIQLLEKLSPEWYKGSCN--GRTGIFPANYV 108
           +  A Y ++  +D +L  +  DKI  +E +  +W+ G     G  G+FP+NYV
Sbjct: 523 WATAEYDYEAAEDNELTFEENDKIINIEFVDDDWWLGELEKTGEKGLFPSNYV 575

>SAKL0E06820g Chr5 complement(556960..559677) [2718 bp, 905 aa] {ON}
           similar to uniprot|Q07533 Saccharomyces cerevisiae
           YDL117W CYK3 SH3-domain protein located in the
           mother-bud neck and the cytokinetic actin ring mutant
           phenotype and genetic interactions suggest a role in
           cytokinesis
          Length = 905

 Score = 36.2 bits (82), Expect = 0.052,   Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 30/52 (57%), Gaps = 3/52 (5%)

Query: 59  VEALYQFDPQQDGDLGLKPGDKIQLLEKLSPEWYKGSC--NGRTGIFPANYV 108
           V+A+Y +  +++ DLG    D I++  K    WY G    N ++G FPANYV
Sbjct: 12  VKAIYSWSGEKEYDLGFIEEDIIEVT-KAKGGWYYGRLLRNKKSGSFPANYV 62

>KNAG0I02700 Chr9 complement(531880..533607) [1728 bp, 575 aa] {ON}
           Anc_6.366 YCR088W
          Length = 575

 Score = 36.2 bits (82), Expect = 0.053,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 28/50 (56%), Gaps = 2/50 (4%)

Query: 61  ALYQFDPQQDGDLGLKPGDKIQLLEKLSPEWYKGSC--NGRTGIFPANYV 108
           A Y +D  ++ +L     DKI  +E +  +W+ G    NG  G+FP+NYV
Sbjct: 522 AEYDYDAGEENELTFVEKDKIINIEFVDDDWWLGELERNGEKGLFPSNYV 571

>SAKL0B11176g Chr2 (974922..976823) [1902 bp, 633 aa] {ON} similar
           to uniprot|Q05080 Saccharomyces cerevisiae YMR032W HOF1
           Bud neck-localized SH3 domain-containing protein
           required for cytokinesis
          Length = 633

 Score = 36.2 bits (82), Expect = 0.054,   Method: Compositional matrix adjust.
 Identities = 18/63 (28%), Positives = 34/63 (53%), Gaps = 9/63 (14%)

Query: 56  LEYVEALYQF-DPQQDGDLGLKPGDKIQLLEKLSPEWYKGSC--------NGRTGIFPAN 106
           ++Y +ALY + +P ++  +  +  D I L ++L+ +WY G            R G+ PAN
Sbjct: 568 IKYAKALYTYMEPNENNLVNFRVDDYILLTKRLNQDWYLGEVYNAGGIEDRYRCGLVPAN 627

Query: 107 YVK 109
           Y++
Sbjct: 628 YIE 630

>NCAS0B06980 Chr2 (1328203..1330122) [1920 bp, 639 aa] {ON}
           Anc_2.159 YHR114W
          Length = 639

 Score = 36.2 bits (82), Expect = 0.056,   Method: Compositional matrix adjust.
 Identities = 20/70 (28%), Positives = 31/70 (44%), Gaps = 3/70 (4%)

Query: 60  EALYQFDPQQDGDLGLKPGDKIQLLEKLSPEWY---KGSCNGRTGIFPANYVKPAFSGSN 116
           + LY +  Q   ++ + P D I LL   S   +   K    G +G+ P  Y+K   S   
Sbjct: 510 KVLYAYTKQDSDEITISPQDIITLLAADSGSGWTKIKNETTGESGLVPTTYIKIEESSHR 569

Query: 117 GQSNLPPPPQ 126
           G +   PPP+
Sbjct: 570 GNAPAAPPPR 579

 Score = 31.2 bits (69), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 15/49 (30%), Positives = 23/49 (46%), Gaps = 1/49 (2%)

Query: 61  ALYQFDPQQDGDLGLKPGDKIQLLE-KLSPEWYKGSCNGRTGIFPANYV 108
           A Y +  Q D ++ +  GD I ++       W  G  NG  G+FP +Y 
Sbjct: 590 AKYPYVAQGDDEMSINAGDTISVIRGDDGSGWTYGELNGVKGLFPTSYC 638

>ADL288C Chr4 complement(194687..197464) [2778 bp, 925 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDL117W
           (CYK3)
          Length = 925

 Score = 35.8 bits (81), Expect = 0.060,   Method: Compositional matrix adjust.
 Identities = 20/61 (32%), Positives = 32/61 (52%), Gaps = 3/61 (4%)

Query: 59  VEALYQFDPQQDGDLGLKPGDKIQLLEKLSPEWYKGSC--NGRTGIFPANYVKPAFSGSN 116
           V+A+Y +  + + DLG    D I++  K+   W  G    N ++G FP NYV+  +   N
Sbjct: 12  VKAVYSWSGEHEQDLGFLESDIIEV-TKVKGNWLYGRLLRNKKSGYFPVNYVQVLYEVPN 70

Query: 117 G 117
           G
Sbjct: 71  G 71

>TPHA0K00720 Chr11 (147285..150320) [3036 bp, 1011 aa] {ON}
           Anc_7.413 YER114C
          Length = 1011

 Score = 35.8 bits (81), Expect = 0.060,   Method: Compositional matrix adjust.
 Identities = 23/69 (33%), Positives = 39/69 (56%), Gaps = 7/69 (10%)

Query: 47  ASRNTSSTSLEYVEALYQFDPQQDGDLGLKPGDKIQLL---EKLSPEWYKGSCNGRT--- 100
           A+ N  + SL    A+ ++  + + +L  +PGDKIQ+L   E+ +  WY G  N RT   
Sbjct: 66  ATNNKGARSLPIYIAINEYSKRMEDELDFRPGDKIQVLLDDEEYNDGWYFGR-NLRTQEE 124

Query: 101 GIFPANYVK 109
           G++PA + +
Sbjct: 125 GLYPAVFTQ 133

>KLLA0F23848g Chr6 (2224951..2226900) [1950 bp, 649 aa] {ON} similar
           to uniprot|P38822 Saccharomyces cerevisiae YHR114W BZZ1
           SH3 domain protein implicated in the regulation of actin
           polymerization able to recruit actin polymerization
           machinery through its SH3 domains colocalizes with
           cortical actin patches and Las17p interacts with type I
           myosins
          Length = 649

 Score = 35.8 bits (81), Expect = 0.067,   Method: Compositional matrix adjust.
 Identities = 19/49 (38%), Positives = 25/49 (51%), Gaps = 1/49 (2%)

Query: 61  ALYQFDPQQDGDLGLKPGDKIQLL-EKLSPEWYKGSCNGRTGIFPANYV 108
           A Y +  Q   +L L+ GDKI++L E     W  G  NG  G+FP  Y 
Sbjct: 600 AAYPYQSQGPDELSLQVGDKIKVLKEDEGNGWTFGELNGTQGLFPTTYC 648

>Kpol_1045.27 s1045 (60696..63338) [2643 bp, 880 aa] {ON}
           (60698..63340) [2643 nt, 881 aa]
          Length = 880

 Score = 35.8 bits (81), Expect = 0.069,   Method: Compositional matrix adjust.
 Identities = 25/74 (33%), Positives = 43/74 (58%), Gaps = 14/74 (18%)

Query: 48  SRNTSSTSLE------YVEALYQFDPQQDGDLGLKPGDKIQLL---EKLSPEWYKGSCNG 98
           SR +SST ++      Y+ A+ ++  + + +L  KPGDKIQ++   E+ +  WY G  N 
Sbjct: 20  SRESSSTVIQTKSFPIYI-AINEYSRRMEDELDFKPGDKIQVITDDEEYNDGWYYGK-NL 77

Query: 99  RT---GIFPANYVK 109
           RT   G++PA + +
Sbjct: 78  RTQQEGLYPAVFTQ 91

>Kpol_534.6 s534 (20451..23111) [2661 bp, 886 aa] {ON}
           (20451..23111) [2661 nt, 887 aa]
          Length = 886

 Score = 35.8 bits (81), Expect = 0.077,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 30/53 (56%), Gaps = 4/53 (7%)

Query: 59  VEALYQFDPQQDGDLGLKPGDKIQLLEKLSPEWYKGSC---NGRTGIFPANYV 108
           V A Y +  Q  GDLG   GD +++ +K++ +W+ G+       +G FP N+V
Sbjct: 10  VRARYGWSGQTKGDLGFLEGDVMEV-KKITGDWFYGTLLRNKKCSGYFPKNFV 61

>AER140C Chr5 complement(901101..902345) [1245 bp, 414 aa] {ON}
           NOHBY516; No homolog in Saccharomyces cerevisiae'
          Length = 414

 Score = 35.4 bits (80), Expect = 0.078,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 30/56 (53%), Gaps = 4/56 (7%)

Query: 58  YVEALYQFDPQQDG--DLGLKPGDKIQLLEKLSPEWYKGSC--NGRTGIFPANYVK 109
           Y  ALY +DPQ +    L +K GD IQ++ +    W+ G        G+FP +YV+
Sbjct: 353 YATALYDYDPQFNDPQYLSIKKGDIIQVITQSKNGWWYGDLLRTKTKGLFPQSYVQ 408

>CAGL0H10516g Chr8 complement(1024427..1027069) [2643 bp, 880 aa]
           {ON} similar to uniprot|Q07533 Saccharomyces cerevisiae
           YDL117w CYK3
          Length = 880

 Score = 35.8 bits (81), Expect = 0.078,   Method: Compositional matrix adjust.
 Identities = 24/86 (27%), Positives = 40/86 (46%), Gaps = 4/86 (4%)

Query: 59  VEALYQFDPQQDGDLGLKPGDKIQLLEKLSPEWYKGSC---NGRTGIFPANYVKPAFSGS 115
           V+A Y +  Q   DLG   GD +++  +++ EWY G         G FP N+V       
Sbjct: 10  VKARYGWSGQAKEDLGFLEGDVMEV-SRVAGEWYYGRLLRNKKCAGYFPNNFVTIVEERI 68

Query: 116 NGQSNLPPPPQYKAQELQPVPTQNSA 141
           N   ++      +AQ+ QP+  Q+ +
Sbjct: 69  NSVQSVDSGRSKQAQQGQPILQQSKS 94

>KAFR0L01580 Chr12 complement(286684..287718) [1035 bp, 344 aa] {ON}
           Anc_7.365 YLR191W
          Length = 344

 Score = 35.4 bits (80), Expect = 0.079,   Method: Compositional matrix adjust.
 Identities = 20/63 (31%), Positives = 34/63 (53%), Gaps = 7/63 (11%)

Query: 54  TSLEYVEALYQFDPQQ-DGDLGLKPGDKIQLLEKLSP-----EWYK-GSCNGRTGIFPAN 106
           T LE+  A+Y F P+  + ++ L+ GD + +L K        +W+K  + NG  G  P N
Sbjct: 257 TKLEFARAIYNFVPENPNIEVNLQKGDLMAILSKKDSFGNDSQWWKVRTKNGSVGFVPFN 316

Query: 107 YVK 109
           Y++
Sbjct: 317 YIE 319

>Kwal_26.8323 s26 (739043..740926) [1884 bp, 627 aa] {ON} YMR032W
           (HOF1) - SH3 domain containing-protein [contig 59] FULL
          Length = 627

 Score = 35.4 bits (80), Expect = 0.079,   Method: Compositional matrix adjust.
 Identities = 19/63 (30%), Positives = 31/63 (49%), Gaps = 9/63 (14%)

Query: 56  LEYVEALYQF-DPQQDGDLGLKPGDKIQLLEKLSPEWYKGSC--------NGRTGIFPAN 106
           L+Y +ALY F +  +   +  + GD + L E+L  +W+ G            R GI P N
Sbjct: 562 LKYAKALYTFMEANEQQIVNFRAGDYLLLTEQLDQDWFIGEVLDSHDVEPEYRYGIIPRN 621

Query: 107 YVK 109
           Y++
Sbjct: 622 YIE 624

>Smik_13.202 Chr13 (329496..331487) [1992 bp, 663 aa] {ON} YMR032W
           (REAL)
          Length = 663

 Score = 35.4 bits (80), Expect = 0.081,   Method: Compositional matrix adjust.
 Identities = 20/69 (28%), Positives = 32/69 (46%), Gaps = 9/69 (13%)

Query: 56  LEYVEALYQFDPQQD-GDLGLKPGDKIQLLEKLSPEWYKGSC--------NGRTGIFPAN 106
           +EY +A+Y     +  G      GD I + E ++ +WYKG          N R G+ P N
Sbjct: 595 IEYAKAMYPLVGNEAPGLANFHKGDYILITEIVNKDWYKGEVYDNDRINRNHRVGLIPYN 654

Query: 107 YVKPAFSGS 115
           +++    GS
Sbjct: 655 FIQLLHQGS 663

>KLLA0D16874g Chr4 complement(1430953..1431636) [684 bp, 227 aa]
           {ON} similar to uniprot|Q12163 Saccharomyces cerevisiae
           YDR162C NBP2 Protein involved in the HOG (high
           osmolarity glycerol) pathway negatively regulates Hog1p
           by recruitment of phosphatase Ptc1p the Pbs2p-Hog1p
           complex found in the nucleus and cytoplasm contains an
           SH3 domain that binds Pbs2p
          Length = 227

 Score = 35.0 bits (79), Expect = 0.084,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 26/51 (50%), Gaps = 2/51 (3%)

Query: 61  ALYQFDPQQDGDLGLKPGDKIQLLEKLSPEWYKGSCNGR--TGIFPANYVK 109
           A+Y F P+ D +L LK GD + +  K    W     + R  TG+ P  YV+
Sbjct: 67  AMYAFVPENDNELELKEGDVVYISYKHGQGWLVAENHDRSKTGLVPEEYVQ 117

>NCAS0A14570 Chr1 complement(2869713..2870780) [1068 bp, 355 aa]
           {ON} Anc_7.419 YER118C
          Length = 355

 Score = 35.4 bits (80), Expect = 0.084,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 29/53 (54%), Gaps = 2/53 (3%)

Query: 59  VEALYQF--DPQQDGDLGLKPGDKIQLLEKLSPEWYKGSCNGRTGIFPANYVK 109
           V+ALY +  D     +L  + GD +++ +     W     NG+TGI P+NYVK
Sbjct: 300 VKALYSYKADDSDAYELSFEQGDILKVSDIEGRWWKARKENGQTGIIPSNYVK 352

>KLLA0A04983g Chr1 complement(445032..448787) [3756 bp, 1251 aa]
           {ON} similar to uniprot|P32790 Saccharomyces cerevisiae
           YBL007C SLA1 Cytoskeletal protein binding protein
           required for assembly of the cortical actin cytoskeleton
           contains 3 SH3 domains interacts with proteins
           regulating actin dynamics and with proteins required for
           endocytosis
          Length = 1251

 Score = 35.4 bits (80), Expect = 0.085,   Method: Compositional matrix adjust.
 Identities = 23/68 (33%), Positives = 36/68 (52%), Gaps = 3/68 (4%)

Query: 59  VEALYQFDPQQDGDLGLKPGDKIQLLE-KLSPEWYKGSC--NGRTGIFPANYVKPAFSGS 115
            +A+Y F      +L +K GD I +L+ + S +WY       G+ GI PA +V+   SGS
Sbjct: 415 AKAVYDFFANSPDELTVKEGDYINILDDRTSKDWYMCESVETGKRGIVPAQFVETRGSGS 474

Query: 116 NGQSNLPP 123
           +  S+  P
Sbjct: 475 SRPSDESP 482

 Score = 30.8 bits (68), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 22/64 (34%), Positives = 32/64 (50%), Gaps = 8/64 (12%)

Query: 56  LEYVEALYQFDPQQDGDLGLKPGDKIQLLEKLS-PEWYK------GSCNGR-TGIFPANY 107
           L   +ALY +  Q D +L +K GD + LLEK S  +W+       GS      G+ P  Y
Sbjct: 5   LGVYQALYDYSAQTDEELTVKEGDLLYLLEKSSIDDWWTVKKRVIGSDQDEPVGLVPKTY 64

Query: 108 VKPA 111
           ++ A
Sbjct: 65  IEEA 68

>Kwal_47.16943 s47 (182308..183690) [1383 bp, 460 aa] {ON} YDR388W
           (RVS167) - (putative) cytoskeletal protein [contig 219]
           FULL
          Length = 460

 Score = 35.0 bits (79), Expect = 0.095,   Method: Compositional matrix adjust.
 Identities = 18/57 (31%), Positives = 30/57 (52%), Gaps = 5/57 (8%)

Query: 58  YVEALYQFDP---QQDGDLGLKPGDKIQLLEKLSPEWYKGSC--NGRTGIFPANYVK 109
           Y  AL+ ++P    Q  DL  +  + I++++K    W+ G      + G FPANYV+
Sbjct: 399 YATALFDYEPAEPDQSTDLNFRRNEVIKVIKKNEDGWWYGEAMRTRKRGYFPANYVE 455

>ZYRO0B16214g Chr2 (1312950..1314929) [1980 bp, 659 aa] {ON} similar
           to uniprot|P38822 Saccharomyces cerevisiae YHR114W BZZ1
           SH3 domain protein implicated in the regulation of actin
           polymerization able to recruit actin polymerization
           machinery through its SH3 domains colocalizes with
           cortical actin patches and Las17p interacts with type I
           myosins
          Length = 659

 Score = 35.4 bits (80), Expect = 0.096,   Method: Compositional matrix adjust.
 Identities = 19/67 (28%), Positives = 33/67 (49%), Gaps = 5/67 (7%)

Query: 44  PPSASRNTSSTSLEYVEALYQFDPQQDGDLGLKPGDKIQLL-EKLSPEWYKGSCNGRTGI 102
           PP  S+  S T    +   Y +D Q++ ++ ++ GD + +L E     W     +G +G+
Sbjct: 597 PPRGSKKPSLT----LTVQYDYDAQEENEMTVEVGDVVNVLKEDDGSGWTLAELDGDSGL 652

Query: 103 FPANYVK 109
            P NY K
Sbjct: 653 IPTNYCK 659

>KAFR0E03160 Chr5 complement(632974..634638) [1665 bp, 554 aa] {ON}
           Anc_8.539 YBR200W
          Length = 554

 Score = 35.0 bits (79), Expect = 0.098,   Method: Compositional matrix adjust.
 Identities = 21/90 (23%), Positives = 41/90 (45%), Gaps = 3/90 (3%)

Query: 22  ESNVISNDVFDQINKSLPMRWDPPSASRNTSSTSLEYVEALYQFDPQQDGDLGLKPGDKI 81
           ++ ++    F+ INK+  +  +P S + NT +    Y   LY F  ++  +L    G+ +
Sbjct: 115 QNGIVPKQYFEAINKTSRIVCNPVSVNSNTGNLGSLYAIVLYDFKAEKSDELSSFVGENL 174

Query: 82  QLLEKLSPEWYKGSCNGRT---GIFPANYV 108
            +    + EW+     GR    G+ P  +V
Sbjct: 175 FICAHHNYEWFIAKPIGRLGGPGLVPVGFV 204

>SAKL0H15048g Chr8 (1304135..1304758) [624 bp, 207 aa] {ON} some
           similarities with uniprot|Q12163 Saccharomyces
           cerevisiae YDR162C NBP2 Protein involved in the HOG
           (high osmolarity glycerol) pathway negatively regulates
           Hog1p by recruitment of phosphatase Ptc1p the
           Pbs2p-Hog1p complex found in the nucleus and cytoplasm
           contains an SH3 domain that binds Pbs2p
          Length = 207

 Score = 34.7 bits (78), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 24/50 (48%), Gaps = 2/50 (4%)

Query: 61  ALYQFDPQQDGDLGLKPGDKIQLLEKLSPEWYKGSCNGR--TGIFPANYV 108
           A+Y F P+ D +L LK GD + +  K    W       R  TG+ P  YV
Sbjct: 95  AIYDFIPENDNELALKEGDVVYISYKHGQGWLVAENEERTKTGLVPEEYV 144

>Suva_2.118 Chr2
           complement(206707..206754,206785..206832,206899..207209,
           207250..207279,207310..207393,207427..210403) [3498 bp,
           1166 aa] {ON} YBL007C (REAL)
          Length = 1166

 Score = 35.4 bits (80), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 23/98 (23%), Positives = 45/98 (45%), Gaps = 3/98 (3%)

Query: 17  LDFLKESNVISNDVFDQINKSLPMRWDPPSASRNTSSTSLEYVEALYQFDPQQDGDLGLK 76
           L+    +     ++ D I +      DP       ++ S +     Y F  +   +L +K
Sbjct: 308 LELHTGNTTTCEEIMDIIGEYKGASRDPGLKEVEMATKSKKRGVVQYDFLAESQDELTIK 367

Query: 77  PGDKIQLL-EKLSPEWYKGSC--NGRTGIFPANYVKPA 111
            GDK+ +L +K S +W+      +G++G+ PA +V+P 
Sbjct: 368 SGDKVYILDDKKSSDWWMCQLIDSGKSGLVPAQFVEPV 405

>NCAS0D04740 Chr4 complement(909728..911512) [1785 bp, 594 aa] {ON}
           Anc_6.366 YCR088W
          Length = 594

 Score = 35.0 bits (79), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 21/71 (29%), Positives = 35/71 (49%), Gaps = 6/71 (8%)

Query: 44  PPSASRNTSSTSLEYVE----ALYQFDPQQDGDLGLKPGDKIQLLEKLSPEWYKG--SCN 97
           PP   R ++    +  E    A Y ++  +D +L     DKI  +E +  +W+ G    +
Sbjct: 520 PPPPPRRSAEPEKKKEEPWAIAEYDYEAGEDNELTFSENDKIINIEFVDDDWWLGELESS 579

Query: 98  GRTGIFPANYV 108
           G  G+FP+NYV
Sbjct: 580 GEKGLFPSNYV 590

>SAKL0H10098g Chr8 (865874..865882,865987..867645) [1668 bp, 555 aa]
           {ON} similar to uniprot|P29366 Saccharomyces cerevisiae
           YBR200W BEM1 Protein containing SH3-domains involved in
           establishing cell polarity and morphogenesis functions
           as a scaffold protein for complexes that include Cdc24p
           Ste5p Ste20p and Rsr1p
          Length = 555

 Score = 35.0 bits (79), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 24/88 (27%), Positives = 43/88 (48%), Gaps = 13/88 (14%)

Query: 59  VEALYQFDPQQDGDLGLKPGDKIQLLEKLSPEWYKGS--CNGRTGIFPANY------VKP 110
           ++A+Y +  Q  G+L    GD   +L +   EWY  S   +G+ G+ P +Y       +P
Sbjct: 71  IKAMYNYQAQSPGELSFVKGDFFHVLTE-DREWYDASNPSDGKRGMVPKSYFEIFGRTRP 129

Query: 111 AFSGSNGQSNLPPPPQYKAQELQPVPTQ 138
                NG  +   P Q+  Q++Q +P++
Sbjct: 130 G--SVNGSGSFDSPLQH--QQVQQMPSK 153

>AGL237C Chr7 complement(254636..256372) [1737 bp, 578 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YCR088W
           (ABP1)
          Length = 578

 Score = 34.7 bits (78), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 16/51 (31%), Positives = 30/51 (58%), Gaps = 2/51 (3%)

Query: 61  ALYQFDPQQDGDLGLKPGDKIQLLEKLSPEWYKGSC--NGRTGIFPANYVK 109
           A Y ++  +D +L  + GD I  ++ +  +W+ G     G+ G+FP+NYV+
Sbjct: 525 AEYDYEAGEDNELTFEEGDVIVNIDFVDDDWWLGELQKTGQKGLFPSNYVE 575

>KNAG0C02910 Chr3 complement(577437..581171) [3735 bp, 1244 aa] {ON}
           Anc_4.108 YBL007C
          Length = 1244

 Score = 34.7 bits (78), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 19/55 (34%), Positives = 26/55 (47%), Gaps = 4/55 (7%)

Query: 60  EALYQFDPQQ--DGDLGLKPGDKIQLLEKLSPEW--YKGSCNGRTGIFPANYVKP 110
            ALY +D  Q  D +L  K  D   L +   P+W   +   +G  G  P NYV+P
Sbjct: 75  RALYDYDQPQNPDEELAFKENDTFDLFDAQDPDWLLVRSQRDGSVGFVPGNYVEP 129

>TBLA0C05560 Chr3 complement(1346488..1348509) [2022 bp, 673 aa]
           {ON} Anc_2.159 YHR114W
          Length = 673

 Score = 34.7 bits (78), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 16/50 (32%), Positives = 27/50 (54%), Gaps = 1/50 (2%)

Query: 61  ALYQFDPQQDGDLGLKPGDKIQLLE-KLSPEWYKGSCNGRTGIFPANYVK 109
           ALY ++ Q D ++ L  GD I++++      W  G  N +  +FP +Y K
Sbjct: 619 ALYPYEAQGDDEMSLAVGDTIKVIKPDDGSGWTFGELNNKQSLFPTSYCK 668

 Score = 31.2 bits (69), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 15/53 (28%), Positives = 27/53 (50%), Gaps = 3/53 (5%)

Query: 60  EALYQFDPQQDGDLGLKPGDKIQLLEK-LSPEWYK--GSCNGRTGIFPANYVK 109
           + LY +    D ++ + PGD I ++EK     W K      G  G+ P++Y++
Sbjct: 538 KVLYAYTKDDDDEVSINPGDSIDVVEKDTGSGWTKINNHSTGEIGLVPSSYLE 590

>Kwal_23.6437 s23 (1581839..1583734) [1896 bp, 631 aa] {ON} YCR088W
           (ABP1) - 1:1 [contig 17] FULL
          Length = 631

 Score = 34.7 bits (78), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 28/51 (54%), Gaps = 2/51 (3%)

Query: 61  ALYQFDPQQDGDLGLKPGDKIQLLEKLSPEWYKGSC--NGRTGIFPANYVK 109
           A Y  + ++  +L  K GDKI  +  +  +W+ G     G  G+FP+NYV+
Sbjct: 578 AEYDNEAEEHNELAFKEGDKIVNIVFVDDDWWLGELEKTGEKGLFPSNYVQ 628

>Suva_2.564 Chr2 (1002523..1002651) [129 bp, 43 aa] {ON} YDR388W
           (REAL)
          Length = 43

 Score = 31.2 bits (69), Expect = 0.17,   Method: Composition-based stats.
 Identities = 11/20 (55%), Positives = 15/20 (75%)

Query: 90  EWYKGSCNGRTGIFPANYVK 109
           EW+ G  NG+ G+FP NYV+
Sbjct: 20  EWWTGRYNGQQGVFPGNYVQ 39

>Kwal_33.14835 s33 (834951..836105) [1155 bp, 384 aa] {ON} YLR191W
           (PEX13) - Peroxisomal membrane protein that contains Src
           homology 3 (SH3) domain [contig 101] FULL
          Length = 384

 Score = 34.3 bits (77), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 21/62 (33%), Positives = 33/62 (53%), Gaps = 7/62 (11%)

Query: 55  SLEYVEALYQFDPQQ-DGDLGLKPGDKIQLLEKLSP-----EWYK-GSCNGRTGIFPANY 107
           SLE+  A+Y F P+    +L LK GD + ++ K  P     EW++  +  G  G  P NY
Sbjct: 306 SLEFARAIYDFTPENPQIELTLKKGDLMAVISKQDPMGNPSEWWRVRTKKGDIGYVPYNY 365

Query: 108 VK 109
           ++
Sbjct: 366 LE 367

>KAFR0B05860 Chr2 complement(1210822..1211571) [750 bp, 249 aa] {ON}
           Anc_8.344 YDR162C
          Length = 249

 Score = 33.9 bits (76), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 25/50 (50%), Gaps = 2/50 (4%)

Query: 61  ALYQFDPQQDGDLGLKPGDKIQLLEKLSPEWYKGSCNGR--TGIFPANYV 108
           ALY F+P+ D +LGL  GD + +  +    W       R  TG+ P  +V
Sbjct: 117 ALYDFEPENDNELGLHEGDIVFISYRHGQGWLVAENQPRTKTGLVPEEFV 166

>KLLA0E23365g Chr5 complement(2077042..2078760,2078979..2078987)
           [1728 bp, 575 aa] {ON} similar to uniprot|P29366
           Saccharomyces cerevisiae YBR200W BEM1 Protein containing
           SH3-domains involved in establishing cell polarity and
           morphogenesis functions as a scaffold protein for
           complexes that include Cdc24p Ste5p Ste20p and Rsr1p
          Length = 575

 Score = 34.3 bits (77), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 16/51 (31%), Positives = 29/51 (56%), Gaps = 3/51 (5%)

Query: 59  VEALYQFDPQQDGDLGLKPGDKIQLLEKLSPEWYKGS--CNGRTGIFPANY 107
           ++ALY +  Q  G+L    GD   + ++ + +WY+ S   +G+ G+ P NY
Sbjct: 68  IKALYNYQAQSAGELSFNKGDFFHVQQEEN-DWYEASNPADGKRGMVPKNY 117

>TDEL0E05520 Chr5 (1015520..1020289) [4770 bp, 1589 aa] {ON}
           Anc_4.45 Scer_YGOB_SDC25
          Length = 1589

 Score = 34.3 bits (77), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 21/83 (25%), Positives = 41/83 (49%), Gaps = 11/83 (13%)

Query: 56  LEYVEALYQFDPQQDGDLGLKPGDKIQLLEKLSPEWYKG---SCNGRT--GIFPANYVKP 110
           ++ V A++ ++ +   +L L+ GD I ++ K    W+ G     NG+   G FP NY + 
Sbjct: 48  VDVVVAIFDYNRKGKNELNLQQGDTIYVIGKNESGWWDGLSIEANGKVHRGWFPQNYCR- 106

Query: 111 AFSGSNGQSNLPPPPQYKAQELQ 133
                +  S +P   + +A +L+
Sbjct: 107 -----SSHSQIPFKTKRRASQLR 124

>Smik_2.113 Chr2 complement(205503..206218,206252..209228) [3693 bp,
           1230 aa] {ON} YBL007C (REAL)
          Length = 1230

 Score = 34.3 bits (77), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 20/72 (27%), Positives = 37/72 (51%), Gaps = 3/72 (4%)

Query: 43  DPPSASRNTSSTSLEYVEALYQFDPQQDGDLGLKPGDKIQLL-EKLSPEWYKGSC--NGR 99
           DP       +S S +     Y F  +   +L +K GDK+ +L +K S +W+      +G+
Sbjct: 339 DPGLKEVEMASKSKKRGVVQYDFMAESQDELTIKSGDKVYILDDKKSKDWWMCQLIDSGK 398

Query: 100 TGIFPANYVKPA 111
           +G+ PA +++P 
Sbjct: 399 SGLVPAQFIEPV 410

>ACR230C Chr3 complement(763430..764626) [1197 bp, 398 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR191W
           (PEX13)
          Length = 398

 Score = 33.9 bits (76), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 19/62 (30%), Positives = 32/62 (51%), Gaps = 7/62 (11%)

Query: 55  SLEYVEALYQFDPQQ-DGDLGLKPGDKIQLLEKLSP-----EWYK-GSCNGRTGIFPANY 107
           SLE+  A+Y F P+    +  LK GD + ++ +  P     +W+K  +  G  G  P NY
Sbjct: 313 SLEFARAIYDFTPENPRIECALKKGDLMAIISRQDPTGKESQWWKVRTKKGDVGYVPCNY 372

Query: 108 VK 109
           ++
Sbjct: 373 IE 374

>TBLA0D00450 Chr4 (109529..112546) [3018 bp, 1005 aa] {ON} Anc_7.413
           YER114C
          Length = 1005

 Score = 33.9 bits (76), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 17/54 (31%), Positives = 28/54 (51%), Gaps = 5/54 (9%)

Query: 61  ALYQFDPQQDGDLGLKPGDKIQLLEKLS---PEWYKGS--CNGRTGIFPANYVK 109
           A+ ++  + D +L + PGDKIQ+L   S     WY G        G++P N+ +
Sbjct: 26  AVAEYQKRMDDELNMMPGDKIQVLNDDSLYNDGWYLGINLTTNEKGLYPLNFTQ 79

>KAFR0L01880 Chr12 complement(348028..350820) [2793 bp, 930 aa] {ON}
           Anc_7.413 YER114C
          Length = 930

 Score = 33.9 bits (76), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 16/54 (29%), Positives = 30/54 (55%), Gaps = 5/54 (9%)

Query: 61  ALYQFDPQQDGDLGLKPGDKIQLL---EKLSPEWYKGS--CNGRTGIFPANYVK 109
           A+  +  + + ++ +KPGDKIQ++   E  +  WY G     G+ G+FP  + +
Sbjct: 33  AVSAYTKRMEDEISIKPGDKIQVITDDEDYNDGWYVGRNLRTGKEGLFPKIFTQ 86

>Kwal_53.19449 s53 (58..657) [600 bp, 199 aa] {ON} YDR162C (NBP2) -
           interacts with Nap1, which is involved in histone
           assembly [contig 398] FULL
          Length = 199

 Score = 33.1 bits (74), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 23/81 (28%), Positives = 37/81 (45%), Gaps = 5/81 (6%)

Query: 61  ALYQFDPQQDGDLGLKPGDKIQLLEKLSPEWY--KGSCNGRTGIFPANYV---KPAFSGS 115
           ALY F  + D +L LK GD + +  + +  W   +     RTG+ P  YV     A S +
Sbjct: 76  ALYDFVAENDNELELKEGDVLFIGYRHAQGWLVAENMDRTRTGLVPEEYVSLTDVADSDA 135

Query: 116 NGQSNLPPPPQYKAQELQPVP 136
            G+       + ++ E +P P
Sbjct: 136 EGEDGETSGAESESGEERPRP 156

>TDEL0A07810 Chr1 (1355773..1357449) [1677 bp, 558 aa] {ON}
           Anc_6.366 YCR088W
          Length = 558

 Score = 33.9 bits (76), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 16/50 (32%), Positives = 28/50 (56%), Gaps = 2/50 (4%)

Query: 61  ALYQFDPQQDGDLGLKPGDKIQLLEKLSPEWYKGSC--NGRTGIFPANYV 108
           A Y ++  ++ +L     DKI  ++ +  +W+ G    NG  G+FP+NYV
Sbjct: 506 AEYDYEAAEENELTFNENDKIINIDFVDDDWWLGELERNGEKGLFPSNYV 555

>YBL085W Chr2 (63876..66818) [2943 bp, 980 aa] {ON}  BOI1Protein
           implicated in polar growth, functionally redundant with
           Boi2p; interacts with bud-emergence protein Bem1p;
           contains an SH3 (src homology 3) domain and a PH
           (pleckstrin homology) domain
          Length = 980

 Score = 33.9 bits (76), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 19/55 (34%), Positives = 33/55 (60%), Gaps = 7/55 (12%)

Query: 61  ALYQFDPQQDGDLGLKPGDKIQLLE---KLSPEWYKGSCNGRT---GIFPANYVK 109
           A+ Q+  + + +L +KPGDKI+++    + +  WY G  N RT   G++PA + K
Sbjct: 20  AVNQYSKRMEDELNMKPGDKIKVITDDGEYNDGWYYGR-NLRTKEEGLYPAVFTK 73

>KLLA0E06953g Chr5 (629777..630850) [1074 bp, 357 aa] {ON}
           uniprot|Q9P863 Kluyveromyces lactis sho1 Putative
           membrane protein
          Length = 357

 Score = 33.5 bits (75), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 27/52 (51%), Gaps = 2/52 (3%)

Query: 60  EALYQFDPQQDG--DLGLKPGDKIQLLEKLSPEWYKGSCNGRTGIFPANYVK 109
           EALY +   Q    ++  + G+ +++ +     W     NG TGI P+NYVK
Sbjct: 299 EALYTYQADQTDAYEISFEQGEILRVGDIEGRWWKAKKSNGETGIIPSNYVK 350

>Skud_2.104 Chr2 complement(196129..199773) [3645 bp, 1214 aa] {ON}
           YBL007C (REAL)
          Length = 1214

 Score = 33.9 bits (76), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 23/98 (23%), Positives = 46/98 (46%), Gaps = 3/98 (3%)

Query: 17  LDFLKESNVISNDVFDQINKSLPMRWDPPSASRNTSSTSLEYVEALYQFDPQQDGDLGLK 76
           L+    +N    ++ + I +      DP       +S S +     Y F  +   +L +K
Sbjct: 309 LELHTGNNNTCEEIMNIIGEYKGASRDPGLKEVEMASKSKKRGIVQYNFMAESQDELTVK 368

Query: 77  PGDKIQLLE-KLSPEWYKGSC--NGRTGIFPANYVKPA 111
            GDK+ +L+ K S +W+      +G++G+ PA +++P 
Sbjct: 369 SGDKVYILDAKKSKDWWMCQLVDSGKSGLVPAQFIEPV 406

 Score = 29.3 bits (64), Expect = 9.8,   Method: Compositional matrix adjust.
 Identities = 17/59 (28%), Positives = 28/59 (47%), Gaps = 4/59 (6%)

Query: 56  LEYVEALYQFDPQQDGD--LGLKPGDKIQLLEKLSPEW--YKGSCNGRTGIFPANYVKP 110
           L+ V A+Y ++  Q+ D  L     D   +L+    +W   K + +   G  P NYV+P
Sbjct: 71  LKKVRAIYDYEQVQNADEELTFHENDVFDVLDDKDVDWLLVKSTVSNEFGFIPGNYVEP 129

>YBL007C Chr2 complement(212632..216366) [3735 bp, 1244 aa] {ON}
           SLA1Cytoskeletal protein binding protein required for
           assembly of the cortical actin cytoskeleton; interacts
           with proteins regulating actin dynamics and proteins
           required for endocytosis; found in the nucleus and cell
           cortex; has 3 SH3 domains
          Length = 1244

 Score = 33.9 bits (76), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 16/52 (30%), Positives = 31/52 (59%), Gaps = 3/52 (5%)

Query: 63  YQFDPQQDGDLGLKPGDKIQLL-EKLSPEWYKGSC--NGRTGIFPANYVKPA 111
           Y F  +   +L +K GDK+ +L +K S +W+      +G++G+ PA +++P 
Sbjct: 362 YDFMAESQDELTIKSGDKVYILDDKKSKDWWMCQLVDSGKSGLVPAQFIEPV 413

>CAGL0E02783g Chr5 (261665..265276) [3612 bp, 1203 aa] {ON} similar
           to uniprot|P32790 Saccharomyces cerevisiae YBL007c SLA1
          Length = 1203

 Score = 33.9 bits (76), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 25/101 (24%), Positives = 49/101 (48%), Gaps = 5/101 (4%)

Query: 24  NVISNDVFDQINKSLPMRWDPPSASRNTSSTSLEYVEALYQFDPQQDGDLGLKPGDKIQL 83
           N   N++   + +    + DP       ++ S +   ALY F+ +   +L ++ GD + +
Sbjct: 340 NDTCNEIMAIVGEFKGAQRDPGLREVEMATKSSKRGVALYDFEAESPDELTIRQGDAVYV 399

Query: 84  L-EKLSPEWYKGS--CNGRTGIFPANYVKPAFSGSNGQSNL 121
           + +K S +W+      NG+ G+ PA +++  FS S   S L
Sbjct: 400 INDKKSKDWWMVELISNGKKGLVPAQFIE--FSKSKESSGL 438

>KLLA0D09306g Chr4 (783852..788465) [4614 bp, 1537 aa] {ON} similar
           to uniprot|P04821 Saccharomyces cerevisiae YLR310C CDC25
           Membrane bound guanine nucleotide exchange factor (GEF
           or GDP-release factor) indirectly regulates adenylate
           cyclase through activation of Ras1p and Ras2p by
           stimulating the exchange of GDP for GTP required for
           progression through G1
          Length = 1537

 Score = 33.9 bits (76), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 26/86 (30%), Positives = 37/86 (43%), Gaps = 7/86 (8%)

Query: 43  DPPSASRNTSSTSLEYVEALYQFDPQQDGDLGLKPGDKIQLLEKLSPEWYKG------SC 96
           +PP A  +T    L+ V A Y F+P +   L    GD I ++ K    W+ G      S 
Sbjct: 10  NPPKAGLSTIIKPLDIVIAQYDFNPLRKSQLRFFAGDIIYVISKSDSGWWDGILYYNKSL 69

Query: 97  NGRTGIFPANYVKPAFSGSNGQSNLP 122
             R G FP +Y K     S+ +   P
Sbjct: 70  VLR-GWFPRSYTKSIKDTSSSRKIFP 94

>NCAS0B06020 Chr2 (1138359..1140953) [2595 bp, 864 aa] {ON}
           Anc_2.319 YDL117W
          Length = 864

 Score = 33.5 bits (75), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 19/55 (34%), Positives = 27/55 (49%), Gaps = 4/55 (7%)

Query: 59  VEALYQFDPQQDGDLGLKPGDKIQLLEKLSPEWYKGSC---NGRTGIFPANYVKP 110
           V A Y +  Q  GDLG   GD I  + +++ +W+ G         G FP N+V P
Sbjct: 13  VRARYGWSGQTKGDLGFLEGD-IMEVTRVAGDWFYGRLLRNKKCAGYFPNNFVIP 66

>TBLA0A07610 Chr1 complement(1888564..1889805) [1242 bp, 413 aa]
           {ON} Anc_7.365 YLR191W
          Length = 413

 Score = 33.5 bits (75), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 22/76 (28%), Positives = 38/76 (50%), Gaps = 7/76 (9%)

Query: 54  TSLEYVEALYQFDPQQ-DGDLGLKPGDKIQLLEKL-----SPEWYK-GSCNGRTGIFPAN 106
           + LE+  ALY F P+    +  +K G+ + +L++        EW+K  + NG TG  P N
Sbjct: 329 SRLEFGRALYDFIPENPRIEATMKKGELLAILDRRDVFGNESEWWKVRTKNGSTGYVPYN 388

Query: 107 YVKPAFSGSNGQSNLP 122
           Y++        + N+P
Sbjct: 389 YIEIIRRIETDEENIP 404

>Ecym_1167 Chr1 (341453..341461,341739..343382) [1653 bp, 550 aa]
           {ON} similar to Ashbya gossypii AEL241W  1-intron
          Length = 550

 Score = 33.5 bits (75), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 16/55 (29%), Positives = 31/55 (56%), Gaps = 3/55 (5%)

Query: 59  VEALYQFDPQQDGDLGLKPGDKIQLLEKLSPEWYKGSC--NGRTGIFPANYVKPA 111
           ++ALY +  Q  G+L    G+ + ++ +   EW++ S   +GR G+ P +Y +P 
Sbjct: 69  LKALYTYHAQSPGELSFTKGELVHVIGE-DGEWFEVSSPDSGRKGMVPKSYFEPV 122

>KLTH0H09416g Chr8 (806836..811422) [4587 bp, 1528 aa] {ON} similar
           to uniprot|P04821 Saccharomyces cerevisiae YLR310C CDC25
           Membrane bound guanine nucleotide exchange factor (GEF
           or GDP-release factor) indirectly regulates adenylate
           cyclase through activation of Ras1p and Ras2p by
           stimulating the exchange of GDP for GTP required for
           progression through G1
          Length = 1528

 Score = 33.5 bits (75), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 21/70 (30%), Positives = 33/70 (47%), Gaps = 7/70 (10%)

Query: 47  ASRNTSSTSLEYVEALYQFDPQQDGDLGLKPGDKIQLLEKLSPEWYKG-SCNGRT----- 100
           A+R  S+  ++ V A   F P +   L L  GD + +L K    W+ G +  GR+     
Sbjct: 15  AARAGSTRPVDVVVATCDFTPTKKAQLRLSAGDVVYVLGKNESGWWDGVTVCGRSPQRVA 74

Query: 101 -GIFPANYVK 109
            G FP N+ +
Sbjct: 75  RGWFPHNFTR 84

>Suva_2.326 Chr2 complement(574424..575146) [723 bp, 240 aa] {ON}
           YDR162C (REAL)
          Length = 240

 Score = 33.1 bits (74), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 24/50 (48%), Gaps = 2/50 (4%)

Query: 61  ALYQFDPQQDGDLGLKPGDKIQLLEKLSPEWYKGSCNGR--TGIFPANYV 108
           ALY F+P+ D +L L  GD + +  K    W       R  TG+ P  +V
Sbjct: 117 ALYDFEPENDNELKLTEGDLVFISYKHGQGWLVAENESRSKTGLVPEEFV 166

>KLLA0F14575g Chr6 complement(1351796..1354351) [2556 bp, 851 aa]
           {ON} some similarities with uniprot|P47068 Saccharomyces
           cerevisiae YJL020C/YJL021C BBC1 Protein possibly
           involved in assembly of actin patches
          Length = 851

 Score = 33.5 bits (75), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 28/55 (50%), Gaps = 5/55 (9%)

Query: 59  VEALYQFDPQQDGDLGLKPGDKIQLLEKLSPEWYKGS---CNGRT--GIFPANYV 108
           VEAL+ +    + DL    G  I +LE    EW+ G     +G+T  GIFP  +V
Sbjct: 7   VEALFPYTSDFEDDLPFSKGQIITVLEIEDDEWFFGEFKDADGKTKQGIFPKGFV 61

>KLTH0G11682g Chr7 (984811..985374) [564 bp, 187 aa] {ON} weakly
           similar to uniprot|Q12163 Saccharomyces cerevisiae
           YDR162C NBP2 Protein involved in the HOG (high
           osmolarity glycerol) pathway negatively regulates Hog1p
           by recruitment of phosphatase Ptc1p the Pbs2p-Hog1p
           complex found in the nucleus and cytoplasm contains an
           SH3 domain that binds Pbs2p
          Length = 187

 Score = 32.7 bits (73), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 26/50 (52%), Gaps = 2/50 (4%)

Query: 61  ALYQFDPQQDGDLGLKPGDKIQLLEKLSPEWY--KGSCNGRTGIFPANYV 108
           ALY F P+ D +L L+ GD + +  +    W   + +   RTG+ P  YV
Sbjct: 73  ALYDFVPENDNELELREGDVLFIGYRHGQGWLVAENAERTRTGLVPEEYV 122

>KLTH0A07348g Chr1 (610049..611929) [1881 bp, 626 aa] {ON} similar
           to uniprot|P15891 Saccharomyces cerevisiae YCR088W ABP1
           Actin-binding protein of the cortical actin cytoskeleton
           important for activation of the Arp2/3 complex that
           plays a key role actin in cytoskeleton organization
          Length = 626

 Score = 33.1 bits (74), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 16/51 (31%), Positives = 28/51 (54%), Gaps = 2/51 (3%)

Query: 61  ALYQFDPQQDGDLGLKPGDKIQLLEKLSPEWYKGSC--NGRTGIFPANYVK 109
           A Y  + ++  +L  + GDKI  +  +  +W+ G     G  G+FP+NYV+
Sbjct: 573 AEYDNEAEEHNELAFEEGDKIINISFVDDDWWLGELEKTGEKGLFPSNYVQ 623

>Ecym_1147 Chr1 (305106..306374) [1269 bp, 422 aa] {ON} similar to
           Ashbya gossypii AER140C
          Length = 422

 Score = 33.1 bits (74), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 18/56 (32%), Positives = 29/56 (51%), Gaps = 4/56 (7%)

Query: 58  YVEALYQFDPQQDG--DLGLKPGDKIQLLEKLSPEWYKGSC--NGRTGIFPANYVK 109
           Y   LY ++PQ +    L +K GD IQ++ +    W+ G        G+FP +YV+
Sbjct: 361 YATVLYDYEPQFNDPQYLSIKKGDTIQIITQSKNGWWYGDLLRTKTKGLFPQSYVQ 416

>Skud_4.420 Chr4 complement(749749..750450) [702 bp, 233 aa] {ON}
           YDR162C (REAL)
          Length = 233

 Score = 32.7 bits (73), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 21/69 (30%), Positives = 31/69 (44%), Gaps = 6/69 (8%)

Query: 61  ALYQFDPQQDGDLGLKPGDKIQLLEKLSPEWYKGSCNGR--TGIFP---ANYVKPAFSGS 115
           ALY F+P+ D +L L  GD + +  K    W       R  TG+ P    +Y++P   G 
Sbjct: 117 ALYDFEPENDNELKLTEGDIVFISYKHGQGWLVAENESRSKTGLVPEEFVSYIQPE-DGE 175

Query: 116 NGQSNLPPP 124
             Q +   P
Sbjct: 176 EEQEDTARP 184

>NDAI0A03330 Chr1 complement(756761..760441) [3681 bp, 1226 aa] {ON}
           Anc_4.108 YBL007C
          Length = 1226

 Score = 33.1 bits (74), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 22/97 (22%), Positives = 43/97 (44%), Gaps = 3/97 (3%)

Query: 17  LDFLKESNVISNDVFDQINKSLPMRWDPPSASRNTSSTSLEYVEALYQFDPQQDGDLGLK 76
           L+    +N   N++   I +      DP       ++ S +    L  F  + + +L +K
Sbjct: 332 LELHTGNNDTCNEIMAVIGEIKGASRDPGLREVQMAAKSKKQARVLVDFIAESNDELTVK 391

Query: 77  PGDKIQLL-EKLSPEWYKGSC--NGRTGIFPANYVKP 110
            GD + +L +K S +W+       G  G+ PA +++P
Sbjct: 392 EGDMVYILNDKKSKDWWMCELVKTGEKGVVPAQFIEP 428

 Score = 29.3 bits (64), Expect = 8.1,   Method: Compositional matrix adjust.
 Identities = 21/64 (32%), Positives = 33/64 (51%), Gaps = 8/64 (12%)

Query: 56  LEYVEALYQFDPQQDGDLGLKPGDKIQLLEKLS-PEWY--KGSCNGR-----TGIFPANY 107
           L   +A+Y ++PQ   +L LK  D + LLEK    +W+  K    G       G+ P+NY
Sbjct: 5   LGVYKAIYDYEPQTPEELELKENDLLYLLEKSEVDDWWTVKKRVIGSDAEEPVGLVPSNY 64

Query: 108 VKPA 111
           ++ A
Sbjct: 65  IEEA 68

>Suva_2.33 Chr2 (60529..63477) [2949 bp, 982 aa] {ON} YBL085W (REAL)
          Length = 982

 Score = 33.1 bits (74), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 18/55 (32%), Positives = 33/55 (60%), Gaps = 7/55 (12%)

Query: 61  ALYQFDPQQDGDLGLKPGDKIQLLE---KLSPEWYKGSCNGRT---GIFPANYVK 109
           A+ ++  + + +L +KPGDKI+++    + +  WY G  N RT   G++PA + K
Sbjct: 20  AVNEYSKRMEDELSMKPGDKIEVITDDGEYNDGWYYGR-NLRTKEEGLYPAVFTK 73

>YLL017W Chr12 (112234..112545) [312 bp, 103 aa] {OFF}
          Non-essential Ras guanine nucleotide exchange factor
          (GEF) localized to the membrane; expressed in poor
          nutrients and on non-fermentable carbon sources;
          homologous to CDC25; contains a stop codon in S288C;
          full-length gene includes YLL016W
          Length = 103

 Score = 31.6 bits (70), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 14/39 (35%), Positives = 21/39 (53%)

Query: 56 LEYVEALYQFDPQQDGDLGLKPGDKIQLLEKLSPEWYKG 94
          ++ VE  YQ+  +    L L+ GD I +L K S  W+ G
Sbjct: 28 IDVVECTYQYFTKSRNKLSLRVGDLIYVLTKGSNGWWDG 66

>TDEL0F04680 Chr6 complement(881920..882714) [795 bp, 264 aa] {ON}
           Anc_8.344 YDR162C
          Length = 264

 Score = 32.7 bits (73), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 16/50 (32%), Positives = 26/50 (52%), Gaps = 2/50 (4%)

Query: 61  ALYQFDPQQDGDLGLKPGDKIQLLEKLSPEWY--KGSCNGRTGIFPANYV 108
           ALY F+P+ D +LGL  GD + +  +    W   +     +TG+ P  +V
Sbjct: 121 ALYDFEPENDNELGLTEGDIVYISYRHGQGWLVAENQEGTKTGLVPEEFV 170

>YDR162C Chr4 complement(780390..781100) [711 bp, 236 aa] {ON}
           NBP2Protein involved in the HOG (high osmolarity
           glycerol) pathway, negatively regulates Hog1p by
           recruitment of phosphatase Ptc1p the Pbs2p-Hog1p
           complex, found in the nucleus and cytoplasm, contains an
           SH3 domain that binds Pbs2p
          Length = 236

 Score = 32.3 bits (72), Expect = 0.54,   Method: Compositional matrix adjust.
 Identities = 21/69 (30%), Positives = 32/69 (46%), Gaps = 6/69 (8%)

Query: 61  ALYQFDPQQDGDLGLKPGDKIQLLEKLSPEWY--KGSCNGRTGIFP---ANYVKPAFSGS 115
           ALY F+P+ D +L L  GD + +  K    W   +     +TG+ P    +Y++P   G 
Sbjct: 117 ALYDFEPENDNELRLAEGDIVFISYKHGQGWLVAENESGSKTGLVPEEFVSYIQPE-DGE 175

Query: 116 NGQSNLPPP 124
           N   N   P
Sbjct: 176 NEVENKARP 184

>KLTH0C06028g Chr3 (520445..521473) [1029 bp, 342 aa] {ON} similar
           to uniprot|P40073 Saccharomyces cerevisiae YER118C SHO1
           Transmembrane osmosensor participates in activation of
           both the Cdc42p- and MAP kinase-dependent filamentous
           growth pathway and the high- osmolarity glycerol
           response pathway
          Length = 342

 Score = 32.7 bits (73), Expect = 0.55,   Method: Compositional matrix adjust.
 Identities = 19/59 (32%), Positives = 31/59 (52%), Gaps = 3/59 (5%)

Query: 54  TSLEYV-EALYQF--DPQQDGDLGLKPGDKIQLLEKLSPEWYKGSCNGRTGIFPANYVK 109
           TS  YV +ALY +  D     ++  + G+ +++ +     W     NG TGI P+NYV+
Sbjct: 277 TSFPYVAKALYTYTADSNDAYEVSFEQGEMLRVGDIEGRWWKAKRANGETGIIPSNYVE 335

>KLLA0F10175g Chr6 complement(944501..946231) [1731 bp, 576 aa] {ON}
           similar to uniprot|P15891 Saccharomyces cerevisiae
           YCR088W ABP1 Actin-binding protein of the cortical actin
           cytoskeleton important for activation of the Arp2/3
           complex that plays a key role actin in cytoskeleton
           organization
          Length = 576

 Score = 33.1 bits (74), Expect = 0.55,   Method: Compositional matrix adjust.
 Identities = 18/66 (27%), Positives = 34/66 (51%), Gaps = 2/66 (3%)

Query: 45  PSASRNTSSTSLEYVEALYQFDPQQDGDLGLKPGDKIQLLEKLSPEWYKGS--CNGRTGI 102
           P AS+     S     A Y ++  +D +L  +  ++I  ++ +  +W+ G    +G  G+
Sbjct: 507 PRASKPGKKESGPSAIAEYDYEAGEDNELTFEENERIINIQFVDDDWWLGELESSGEKGL 566

Query: 103 FPANYV 108
           FP+NYV
Sbjct: 567 FPSNYV 572

>ZYRO0B02706g Chr2 complement(218864..220054) [1191 bp, 396 aa] {ON}
           weakly similar to uniprot|P80667 Saccharomyces
           cerevisiae YLR191W PEX13 Integral peroxisomal membrane
           receptor
          Length = 396

 Score = 32.7 bits (73), Expect = 0.55,   Method: Compositional matrix adjust.
 Identities = 21/63 (33%), Positives = 32/63 (50%), Gaps = 7/63 (11%)

Query: 54  TSLEYVEALYQFDPQQ-DGDLGLKPGDKIQLLEKLSP-----EWYK-GSCNGRTGIFPAN 106
           + LE+  ALY F P+    +  LK G+ + ++ K  P     EW+K  +  G  G  P N
Sbjct: 311 SKLEFARALYDFTPENPQIEAPLKKGELMAIITKQHPSGNNSEWWKVRTKTGNMGYVPFN 370

Query: 107 YVK 109
           YV+
Sbjct: 371 YVE 373

>CAGL0A04147g Chr1 complement(411674..412849) [1176 bp, 391 aa] {ON}
           similar to uniprot|P80667 Saccharomyces cerevisiae
           YLR191w PAS20
          Length = 391

 Score = 32.7 bits (73), Expect = 0.57,   Method: Compositional matrix adjust.
 Identities = 23/78 (29%), Positives = 38/78 (48%), Gaps = 7/78 (8%)

Query: 54  TSLEYVEALYQFDPQQ-DGDLGLKPGDKIQLLEKLSP-----EWYK-GSCNGRTGIFPAN 106
           + LE+  ALY F P+    ++ LK GD + ++ K  P     +W+K  +  G+ G  P N
Sbjct: 314 SKLEFARALYDFTPENPQIEITLKKGDLVAIISKADPLGRSSDWWKVRNRAGQNGYAPYN 373

Query: 107 YVKPAFSGSNGQSNLPPP 124
           Y++        +S  PP 
Sbjct: 374 YLEIIKRVKKQESKTPPA 391

>TDEL0G02490 Chr7 (478524..481076) [2553 bp, 850 aa] {ON} Anc_2.319
           YDL117W
          Length = 850

 Score = 32.7 bits (73), Expect = 0.59,   Method: Compositional matrix adjust.
 Identities = 17/53 (32%), Positives = 29/53 (54%), Gaps = 4/53 (7%)

Query: 59  VEALYQFDPQQDGDLGLKPGDKIQLLEKLSPEWYKGSC---NGRTGIFPANYV 108
           V+A Y +  Q  GDLG   GD ++ + +++ +W+ G        +G FP N+V
Sbjct: 13  VKARYGWSGQTKGDLGFLEGDVME-VTRITGDWFYGKLLRNKKCSGYFPNNFV 64

>Smik_4.151 Chr4 (279705..281342) [1638 bp, 545 aa] {ON} YDL085W
           (REAL)
          Length = 545

 Score = 32.7 bits (73), Expect = 0.63,   Method: Compositional matrix adjust.
 Identities = 18/58 (31%), Positives = 26/58 (44%)

Query: 51  TSSTSLEYVEALYQFDPQQDGDLGLKPGDKIQLLEKLSPEWYKGSCNGRTGIFPANYV 108
           T +  +E+ + L    P+Q    GL   DK++LL      +  G C   TG FP   V
Sbjct: 366 TGNEPIEFSKTLLDRIPEQSNRRGLLINDKLELLGAEDSIYAIGDCTAHTGFFPTAQV 423

>Smik_4.119 Chr4 (225256..227919) [2664 bp, 887 aa] {ON} YDL117W
           (REAL)
          Length = 887

 Score = 32.7 bits (73), Expect = 0.65,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 27/53 (50%), Gaps = 4/53 (7%)

Query: 59  VEALYQFDPQQDGDLGLKPGDKIQLLEKLSPEWYKGSC---NGRTGIFPANYV 108
           V+A Y +  Q  GDLG   GD I  + +++  W+ G        +G FP N+V
Sbjct: 14  VKARYGWSGQTKGDLGFLEGD-IMEVTRIAGSWFYGRLLRNKKCSGYFPHNFV 65

>YDL117W Chr4 (248581..251238) [2658 bp, 885 aa] {ON}
           CYK3SH3-domain protein located in the mother-bud neck
           and the cytokinetic actin ring; mutant phenotype and
           genetic interactions suggest a role in cytokinesis
          Length = 885

 Score = 32.7 bits (73), Expect = 0.68,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 27/53 (50%), Gaps = 4/53 (7%)

Query: 59  VEALYQFDPQQDGDLGLKPGDKIQLLEKLSPEWYKGSC---NGRTGIFPANYV 108
           V+A Y +  Q  GDLG   GD I  + +++  W+ G        +G FP N+V
Sbjct: 14  VKARYGWSGQTKGDLGFLEGD-IMEVTRIAGSWFYGKLLRNKKCSGYFPHNFV 65

>Suva_4.129 Chr4 (237039..239702) [2664 bp, 887 aa] {ON} YDL117W
           (REAL)
          Length = 887

 Score = 32.7 bits (73), Expect = 0.68,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 27/53 (50%), Gaps = 4/53 (7%)

Query: 59  VEALYQFDPQQDGDLGLKPGDKIQLLEKLSPEWYKGSC---NGRTGIFPANYV 108
           V+A Y +  Q  GDLG   GD I  + +++  W+ G        +G FP N+V
Sbjct: 14  VKARYGWSGQTKGDLGFLEGD-IMEVTRIAGSWFYGRLLRNKKCSGYFPHNFV 65

>YMR032W Chr13 (335298..337307) [2010 bp, 669 aa] {ON}  HOF1Bud
           neck-localized, SH3 domain-containing protein required
           for cytokinesis; regulates actomyosin ring dynamics and
           septin localization; interacts with the formins, Bni1p
           and Bnr1p, and with Cyk3p, Vrp1p, and Bni5p
          Length = 669

 Score = 32.7 bits (73), Expect = 0.69,   Method: Compositional matrix adjust.
 Identities = 18/68 (26%), Positives = 31/68 (45%), Gaps = 9/68 (13%)

Query: 56  LEYVEALYQFDPQQD-GDLGLKPGDKIQLLEKLSPEWYKGSC--------NGRTGIFPAN 106
           +EY +A+Y     +  G      GD + + E ++ +WYKG          N R G+ P N
Sbjct: 601 IEYAKAMYPLIGNEAPGLANFHKGDYLLITEIVNKDWYKGEVYDNDRIDRNHRIGLIPYN 660

Query: 107 YVKPAFSG 114
           +++    G
Sbjct: 661 FIQLLHQG 668

>ZYRO0F13882g Chr6 complement(1143280..1144146) [867 bp, 288 aa]
           {ON} similar to uniprot|Q12163 Saccharomyces cerevisiae
           YDR162C NBP2 Protein involved in the HOG (high
           osmolarity glycerol) pathway negatively regulates Hog1p
           by recruitment of phosphatase Ptc1p the Pbs2p-Hog1p
           complex found in the nucleus and cytoplasm contains an
           SH3 domain that binds Pbs2p
          Length = 288

 Score = 32.3 bits (72), Expect = 0.69,   Method: Compositional matrix adjust.
 Identities = 17/53 (32%), Positives = 26/53 (49%), Gaps = 2/53 (3%)

Query: 61  ALYQFDPQQDGDLGLKPGDKIQLLEKLSPEWYKGSCNGR--TGIFPANYVKPA 111
           ALY F+P+ D +L L+ GD + +  +    W       R  TG+ P  +V  A
Sbjct: 133 ALYDFEPENDNELELQEGDVVFISYRHGQGWLVAENQNRTKTGLVPEEFVTYA 185

>Suva_5.239 Chr5 complement(373672..374778) [1107 bp, 368 aa] {ON}
           YER118C (REAL)
          Length = 368

 Score = 32.3 bits (72), Expect = 0.69,   Method: Compositional matrix adjust.
 Identities = 16/53 (30%), Positives = 27/53 (50%), Gaps = 2/53 (3%)

Query: 59  VEALYQFDPQQDG--DLGLKPGDKIQLLEKLSPEWYKGSCNGRTGIFPANYVK 109
            +ALY +D   D   ++  +  + +Q+ +     W     NG TGI P+NYV+
Sbjct: 306 AKALYPYDADGDDAYEISFEQNEILQVSDIEGRWWKARRANGETGIIPSNYVQ 358

>TDEL0C01820 Chr3 (318850..320019) [1170 bp, 389 aa] {ON} Anc_7.365
           YLR191W
          Length = 389

 Score = 32.3 bits (72), Expect = 0.73,   Method: Compositional matrix adjust.
 Identities = 20/63 (31%), Positives = 33/63 (52%), Gaps = 7/63 (11%)

Query: 54  TSLEYVEALYQFDPQQ-DGDLGLKPGDKIQLLEK-----LSPEWYK-GSCNGRTGIFPAN 106
           + LE+  ALY F P+    ++ LK GD + ++ K        EW+K  + +G  G  P N
Sbjct: 306 SKLEFARALYDFTPENPQMEVTLKKGDLMAIMSKQDSLGRDSEWWKVRTKSGDIGYVPFN 365

Query: 107 YVK 109
           Y++
Sbjct: 366 YIE 368

>Skud_2.23 Chr2 (47507..50455) [2949 bp, 982 aa] {ON} YBL085W (REAL)
          Length = 982

 Score = 32.7 bits (73), Expect = 0.75,   Method: Compositional matrix adjust.
 Identities = 18/55 (32%), Positives = 33/55 (60%), Gaps = 7/55 (12%)

Query: 61  ALYQFDPQQDGDLGLKPGDKIQLLE---KLSPEWYKGSCNGRT---GIFPANYVK 109
           A+ ++  + + +L +KPGDKI+++    + +  WY G  N RT   G++PA + K
Sbjct: 20  AVNEYSKRMEDELNMKPGDKIKVITDDGEYNDGWYYGR-NLRTEEEGLYPAVFTK 73

>ZYRO0A02662g Chr1 (213322..215982) [2661 bp, 886 aa] {ON} similar
           to uniprot|Q07533 Saccharomyces cerevisiae YDL117W CYK3
           SH3-domain protein located in the mother-bud neck and
           the cytokinetic actin ring mutant phenotype and genetic
           interactions suggest a role in cytokinesis
          Length = 886

 Score = 32.3 bits (72), Expect = 0.82,   Method: Compositional matrix adjust.
 Identities = 17/53 (32%), Positives = 29/53 (54%), Gaps = 4/53 (7%)

Query: 59  VEALYQFDPQQDGDLGLKPGDKIQLLEKLSPEWYKGSC---NGRTGIFPANYV 108
           V+A Y +  Q  GDLG   GD ++ + +++ +W+ G        +G FP N+V
Sbjct: 14  VKARYGWSGQTKGDLGFLEGDVME-VTRITGDWFYGRLLRNKKCSGYFPNNFV 65

>Skud_4.137 Chr4 (244217..246880) [2664 bp, 887 aa] {ON} YDL117W
           (REAL)
          Length = 887

 Score = 32.3 bits (72), Expect = 0.82,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 27/53 (50%), Gaps = 4/53 (7%)

Query: 59  VEALYQFDPQQDGDLGLKPGDKIQLLEKLSPEWYKGSC---NGRTGIFPANYV 108
           V+A Y +  Q  GDLG   GD I  + +++  W+ G        +G FP N+V
Sbjct: 14  VKARYGWSGQTKGDLGFLEGD-IMEVTRIAGSWFYGRLLRNKKCSGYFPHNFV 65

>CAGL0E03476g Chr5 complement(319193..323887) [4695 bp, 1564 aa]
           {ON} similar to uniprot|P04821 Saccharomyces cerevisiae
           YLR310c CDC25 GDP/GTP exchange factor for RAS1P and
           RAS2P
          Length = 1564

 Score = 32.3 bits (72), Expect = 0.89,   Method: Compositional matrix adjust.
 Identities = 18/63 (28%), Positives = 31/63 (49%), Gaps = 8/63 (12%)

Query: 56  LEYVEALYQFDP--QQDGDLGLKPGDKIQLLEKLSPEWYKG------SCNGRTGIFPANY 107
           ++ V   ++F+   +++  L ++PGD + +L K    W+ G      S     G FP NY
Sbjct: 19  MDVVVVQFEFNAGNKKEKYLSMQPGDTVYVLAKDQSGWWDGLIIDEKSDKAVRGWFPQNY 78

Query: 108 VKP 110
            KP
Sbjct: 79  TKP 81

>NDAI0B03330 Chr2 (848506..851265) [2760 bp, 919 aa] {ON} Anc_2.319
           YDL117W
          Length = 919

 Score = 32.3 bits (72), Expect = 0.96,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 26/53 (49%), Gaps = 4/53 (7%)

Query: 59  VEALYQFDPQQDGDLGLKPGDKIQLLEKLSPEWYKGSC---NGRTGIFPANYV 108
           V A Y +  Q  GDLG   GD I  + +++ +W+ G         G FP N+V
Sbjct: 15  VRAKYGWSGQAKGDLGFLEGD-IMEVTRVAGDWFYGKLLRNRKCAGYFPNNFV 66

>CAGL0C01881g Chr3 (196299..199298) [3000 bp, 999 aa] {ON} similar
           to uniprot|P38041 Saccharomyces cerevisiae YBL085w BOB1
           BEM1 protein-binding protein or uniprot|P39969
           Saccharomyces cerevisiae YER114c BOI2
          Length = 999

 Score = 32.3 bits (72), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 17/53 (32%), Positives = 32/53 (60%), Gaps = 7/53 (13%)

Query: 64  QFDPQQDGDLGLKPGDKIQLLE---KLSPEWYKGSCNGRT---GIFPANYVKP 110
           ++  + + ++ +KPGDKI++L    +    WY+G  N RT   G++PA + +P
Sbjct: 10  EYRRRMEDEIDMKPGDKIEVLMDDGEYKDGWYQGK-NLRTAQVGLYPAVFTQP 61

>SAKL0H24222g Chr8 complement(2089734..2094314) [4581 bp, 1526 aa]
           {ON} similar to uniprot|P04821 Saccharomyces cerevisiae
           YLR310C CDC25 Membrane bound guanine nucleotide exchange
           factor (GEF or GDP-release factor) indirectly regulates
           adenylate cyclase through activation of Ras1p and Ras2p
           by stimulating the exchange of GDP for GTP required for
           progression through G1
          Length = 1526

 Score = 32.3 bits (72), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 18/59 (30%), Positives = 25/59 (42%), Gaps = 5/59 (8%)

Query: 56  LEYVEALYQFDPQQDGDLGLKPGDKIQLLEKLSPEWYKGSC-----NGRTGIFPANYVK 109
           ++ V A Y + P +   L L  GD + +L K    W+ G           G FP NY K
Sbjct: 23  VDVVVATYDYVPSRKSQLRLIQGDTVYVLSKQDSGWWDGIILDSNNKASRGWFPCNYSK 81

>Smik_4.406 Chr4 complement(738389..739096) [708 bp, 235 aa] {ON}
           YDR162C (REAL)
          Length = 235

 Score = 31.6 bits (70), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 16/50 (32%), Positives = 24/50 (48%), Gaps = 2/50 (4%)

Query: 61  ALYQFDPQQDGDLGLKPGDKIQLLEKLSPEWYKGSCNGR--TGIFPANYV 108
           ALY F+P+ D +L L  G+ + +  K    W       R  TG+ P  +V
Sbjct: 117 ALYDFEPENDNELKLAEGEIVFISYKHGQGWLVAENESRSKTGLVPEEFV 166

>NCAS0A14530 Chr1 complement(2863100..2866171) [3072 bp, 1023 aa]
           {ON} Anc_7.413 YBL085W
          Length = 1023

 Score = 32.0 bits (71), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 17/55 (30%), Positives = 31/55 (56%), Gaps = 7/55 (12%)

Query: 61  ALYQFDPQQDGDLGLKPGDKIQLL---EKLSPEWYKGSCNGRT---GIFPANYVK 109
            + ++  + + +L ++PGDKIQ+L   E+    WY G  N RT   G++P  + +
Sbjct: 47  CINEYTKRMEDELDMRPGDKIQVLIDDEEYDDGWYFGR-NLRTQEEGLYPVTFTQ 100

>Smik_2.35 Chr2 (57476..60433) [2958 bp, 985 aa] {ON} YBL085W (REAL)
          Length = 985

 Score = 32.0 bits (71), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 17/55 (30%), Positives = 33/55 (60%), Gaps = 7/55 (12%)

Query: 61  ALYQFDPQQDGDLGLKPGDKIQLLE---KLSPEWYKGSCNGRT---GIFPANYVK 109
           A+ ++  + + +L ++PGDKI+++    + +  WY G  N RT   G++PA + K
Sbjct: 20  AVNEYSKRMEDELNMRPGDKIEVITDDGEYNDGWYYGR-NLRTKEEGLYPAVFTK 73

>KNAG0C03390 Chr3 (667055..668083) [1029 bp, 342 aa] {ON} Anc_7.419
           YER118C
          Length = 342

 Score = 31.6 bits (70), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 15/53 (28%), Positives = 28/53 (52%), Gaps = 2/53 (3%)

Query: 59  VEALYQFDPQQDG--DLGLKPGDKIQLLEKLSPEWYKGSCNGRTGIFPANYVK 109
            +ALY +D   +   ++  + G+ +++ +     W     NG TGI P+NYV+
Sbjct: 286 AKALYSYDADSNDQYEVSFEQGEILKVSDIEGRWWKARRANGETGIIPSNYVE 338

>TPHA0F00380 Chr6 (85560..90416) [4857 bp, 1618 aa] {ON} Anc_4.45
           Scer_YGOB_SDC25
          Length = 1618

 Score = 32.0 bits (71), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 27/52 (51%), Gaps = 4/52 (7%)

Query: 70  DGDLGLKPGDKIQLLEKLSPEWYKG-SCNGRT---GIFPANYVKPAFSGSNG 117
           D  L   PGDKI +L K    W+ G   +G+    G FP ++VKP  + S G
Sbjct: 50  DTYLRFNPGDKIYVLNKNDNGWWDGIVLHGKVVTRGWFPLHFVKPYRTVSPG 101

>TDEL0F02380 Chr6 (438262..442029) [3768 bp, 1255 aa] {ON} Anc_4.108
           YBL007C
          Length = 1255

 Score = 32.0 bits (71), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 18/60 (30%), Positives = 27/60 (45%), Gaps = 4/60 (6%)

Query: 59  VEALYQFDPQQ--DGDLGLKPGDKIQLLEKLSPEW--YKGSCNGRTGIFPANYVKPAFSG 114
           V ALY +D  Q  D +L     ++  + +   P+W   +    G  G  P NYV+P   G
Sbjct: 74  VRALYDYDQAQNPDEELTFHENEEFDVYDDQDPDWLLVQQKSTGACGFVPGNYVEPCGQG 133

 Score = 31.2 bits (69), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 18/73 (24%), Positives = 38/73 (52%), Gaps = 3/73 (4%)

Query: 52  SSTSLEYVEALYQFDPQQDGDLGLKPGDKIQLL-EKLSPEWYKGS--CNGRTGIFPANYV 108
           +S + +  + LY F  +   +L +K G  + +L +K S +W+      +G+ G+ PA ++
Sbjct: 357 ASKARKEGKVLYDFIAESQDELSVKQGQTVYILNDKKSRDWWMCELVSSGQKGVVPAQFI 416

Query: 109 KPAFSGSNGQSNL 121
           +P+    +G   L
Sbjct: 417 EPSKEKDSGSGGL 429

 Score = 29.6 bits (65), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 21/64 (32%), Positives = 34/64 (53%), Gaps = 8/64 (12%)

Query: 56  LEYVEALYQFDPQQDGDLGLKPGDKIQLLEKLS-PEWYK------GS-CNGRTGIFPANY 107
           L   +ALY ++PQ   +L ++  + + LLEK    EW+       GS  +   G+ P+NY
Sbjct: 5   LGVYKALYDYEPQTTEELAIREDELLYLLEKSDVDEWWTVKKRVIGSDADEPVGLVPSNY 64

Query: 108 VKPA 111
           V+ A
Sbjct: 65  VEQA 68

>NDAI0A01500 Chr1 (331951..335094) [3144 bp, 1047 aa] {ON} Anc_7.413
           YBL085W
          Length = 1047

 Score = 31.6 bits (70), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 14/54 (25%), Positives = 30/54 (55%), Gaps = 5/54 (9%)

Query: 61  ALYQFDPQQDGDLGLKPGDKIQLL---EKLSPEWYKGS--CNGRTGIFPANYVK 109
            + ++  + + +L ++PGDKI++L   E+ +  WY G     G  G++P  + +
Sbjct: 46  CINEYSKRMEDELDMRPGDKIEVLTDDEEYNDGWYFGRNLRTGEEGLYPVVFTQ 99

>KAFR0K02000 Chr11 complement(410316..411314) [999 bp, 332 aa] {ON}
           Anc_7.419 YER118C
          Length = 332

 Score = 31.2 bits (69), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 14/47 (29%), Positives = 24/47 (51%)

Query: 63  YQFDPQQDGDLGLKPGDKIQLLEKLSPEWYKGSCNGRTGIFPANYVK 109
           YQ D     ++  + G+ +++ +     W     NG TGI P+NYV+
Sbjct: 278 YQADESDQYEISFEQGEILRVSDIEGRWWKAKRENGETGIIPSNYVQ 324

>SAKL0F12958g Chr6 complement(1019015..1022098) [3084 bp, 1027 aa]
           {ON} similar to uniprot|P39969 Saccharomyces cerevisiae
           YER114C BOI2 Protein implicated in polar growth
           functionally redundant with Boi1p interacts with bud-
           emergence protein Bem1p contains an SH3 (src homology 3)
           domain and a PH (pleckstrin homology) domain
          Length = 1027

 Score = 31.6 bits (70), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 17/55 (30%), Positives = 33/55 (60%), Gaps = 7/55 (12%)

Query: 61  ALYQFDPQQDGDLGLKPGDKIQLL---EKLSPEWYKGSCNGRT---GIFPANYVK 109
           A+ ++  + + +L +KPGDKIQ++   ++ +  WY G  N RT   G++P  + +
Sbjct: 43  AINEYTKRMEDELDMKPGDKIQVITDDQEYNDGWYYGR-NLRTNEEGLYPKVFTQ 96

>KNAG0A05020 Chr1 (731413..732225) [813 bp, 270 aa] {ON} Anc_8.344
           YDR162C
          Length = 270

 Score = 31.2 bits (69), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 24/50 (48%), Gaps = 2/50 (4%)

Query: 61  ALYQFDPQQDGDLGLKPGDKIQLLEKLSPEWYKGSCNGR--TGIFPANYV 108
           ALY F+P+ D +L LK  D + +  K    W       R  TG+ P  +V
Sbjct: 141 ALYDFEPENDNELELKEEDVVYISYKHGQGWLVAENEQRTKTGLVPEEFV 190

>KNAG0H03500 Chr8 (652236..654140) [1905 bp, 634 aa] {ON} Anc_2.159
           YHR114W
          Length = 634

 Score = 31.6 bits (70), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 19/66 (28%), Positives = 32/66 (48%), Gaps = 3/66 (4%)

Query: 52  SSTSLEYVEALYQFDPQQDGDLGLKPGDKIQLLEKLSPEWY---KGSCNGRTGIFPANYV 108
           +S+S E  + LY +  Q D ++ + PGD I+L+   S   +   +    G  G+ P  Y+
Sbjct: 499 ASSSDEENKVLYAYTQQDDDEISVTPGDVIELVTPDSGSGWTQIRNVTTGAEGLVPTTYI 558

Query: 109 KPAFSG 114
               SG
Sbjct: 559 SVRESG 564

>KLLA0E21891g Chr5 (1954118..1955761) [1644 bp, 547 aa] {ON} similar
           to uniprot|P40215 Saccharomyces cerevisiae YMR145C NDE1
           Mitochondrial external NADH dehydrogenase
          Length = 547

 Score = 31.2 bits (69), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 21/69 (30%), Positives = 28/69 (40%), Gaps = 7/69 (10%)

Query: 40  MRWDPPSASRNTSSTSLEYVEALYQFDPQQDGDLGLKPGDKIQLLEKLSPEWYKGSCNGR 99
           + W   +A R  S   +  +E       QQ+   GL   DK+QLL      W  G C   
Sbjct: 364 LVWATGNAPREVSKNLMAKLE-------QQNSRRGLLINDKMQLLGAEDSIWAIGDCTFF 416

Query: 100 TGIFPANYV 108
            G+FP   V
Sbjct: 417 PGLFPTAQV 425

>KLTH0C06182g Chr3 (535274..538351) [3078 bp, 1025 aa] {ON} similar
           to uniprot|P39969 Saccharomyces cerevisiae YER114C BOI2
           Protein implicated in polar growth functionally
           redundant with Boi1p interacts with bud- emergence
           protein Bem1p contains an SH3 (src homology 3) domain
           and a PH (pleckstrin homology) domain
          Length = 1025

 Score = 31.6 bits (70), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 17/54 (31%), Positives = 32/54 (59%), Gaps = 7/54 (12%)

Query: 62  LYQFDPQQDGDLGLKPGDKIQLL---EKLSPEWYKGSCNGRT---GIFPANYVK 109
           + ++  + + +L +KPGDKIQ++   E+ +  WY G  N RT   G++P  + +
Sbjct: 39  ITEYSKRMEDELDMKPGDKIQVITDDEEYNDGWYYGR-NLRTNEEGLYPKVFTQ 91

>Kpol_457.12 s457 complement(23020..24723) [1704 bp, 567 aa] {ON}
           complement(23020..24723) [1704 nt, 568 aa]
          Length = 567

 Score = 31.2 bits (69), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 15/51 (29%), Positives = 25/51 (49%), Gaps = 3/51 (5%)

Query: 61  ALYQFDPQQDGDLGLKPGDKIQLLEKLSPEWYKGSCNGRTG---IFPANYV 108
            LY F P++  +L    GDKI +    + EW+  S    +G   + P ++V
Sbjct: 169 VLYDFKPERPDELEANAGDKITIYAHHNDEWFIASHTDSSGKPYLIPIDFV 219

>Kwal_27.10733 s27 (473078..476122) [3045 bp, 1014 aa] {ON} YER114C
           (BOI2) - involved in bud formation, has SH3 domain
           [contig 33] FULL
          Length = 1014

 Score = 31.2 bits (69), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 17/54 (31%), Positives = 32/54 (59%), Gaps = 7/54 (12%)

Query: 62  LYQFDPQQDGDLGLKPGDKIQLL---EKLSPEWYKGSCNGRT---GIFPANYVK 109
           + ++  + + +L +KPGDKIQ++   E+ +  WY G  N RT   G++P  + +
Sbjct: 42  ITEYSKRMEDELDMKPGDKIQVITDDEEYNDGWYYGR-NLRTNEEGLYPKVFTQ 94

>KLTH0E07744g Chr5 complement(710793..714542) [3750 bp, 1249 aa]
           {ON} similar to uniprot|P32790 Saccharomyces cerevisiae
           YBL007C SLA1 Cytoskeletal protein binding protein
           required for assembly of the cortical actin cytoskeleton
           contains 3 SH3 domains interacts with proteins
           regulating actin dynamics and with proteins required for
           endocytosis
          Length = 1249

 Score = 31.2 bits (69), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 20/64 (31%), Positives = 34/64 (53%), Gaps = 8/64 (12%)

Query: 56  LEYVEALYQFDPQQDGDLGLKPGDKIQLLEKLS-PEWY--KGSCNGR-----TGIFPANY 107
           L   +A++Q++PQ D +L +  GD + LL+K    +W+  K    G       G+ P NY
Sbjct: 5   LGIYKAVFQYEPQSDEELAIDEGDMLYLLQKSDVDDWWTVKKRVIGSDAEEPVGLVPNNY 64

Query: 108 VKPA 111
           ++ A
Sbjct: 65  IEEA 68

>CAGL0M05357g Chr13 (572309..573982) [1674 bp, 557 aa] {ON} similar
           to uniprot|P29366 Saccharomyces cerevisiae YBR200w BEM1
           bud emergence mediator
          Length = 557

 Score = 31.2 bits (69), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 24/95 (25%), Positives = 42/95 (44%), Gaps = 8/95 (8%)

Query: 22  ESNVISNDVFDQINKSLPMRWDPPSASRNTSSTSLE-----YVEALYQFDPQQDGDLGLK 76
           ++ V+    FD I+++ P   D    S +TSS + E     Y   LY F  ++  +L   
Sbjct: 108 KNGVVPKSHFDVIDRTRPSSSDALGRSVSTSSRNGEKMGTLYAIVLYDFKAEKSDELDTF 167

Query: 77  PGDKIQLLEKLSPEWYKGSCNGRT---GIFPANYV 108
            G+ + +    + EW+     GR    G+ P  +V
Sbjct: 168 VGENLFICAHHNYEWFIAKPIGRLGGPGLVPVGFV 202

>YDL085W Chr4 (303211..304848) [1638 bp, 545 aa] {ON}
           NDE2Mitochondrial external NADH dehydrogenase, catalyzes
           the oxidation of cytosolic NADH; Nde1p and Nde2p are
           involved in providing the cytosolic NADH to the
           mitochondrial respiratory chain
          Length = 545

 Score = 31.2 bits (69), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 17/58 (29%), Positives = 27/58 (46%)

Query: 51  TSSTSLEYVEALYQFDPQQDGDLGLKPGDKIQLLEKLSPEWYKGSCNGRTGIFPANYV 108
           T +  +++ + L    P+Q    GL   DK++LL   +  +  G C   TG FP   V
Sbjct: 366 TGNEPIDFSKTLMSRIPEQTNRRGLLINDKLELLGSENSIYAIGDCTAHTGFFPTAQV 423

>NCAS0A03490 Chr1 complement(689871..693578) [3708 bp, 1235 aa] {ON}
           Anc_4.108 YBL007C
          Length = 1235

 Score = 31.2 bits (69), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 22/99 (22%), Positives = 46/99 (46%), Gaps = 7/99 (7%)

Query: 17  LDFLKESNVISNDVFDQINKSLPMRWDPPSASRNTSSTSLEYVEALYQFDPQQDGDLGLK 76
           L+    +N   N++   I +      DP       ++ S +    ++ F  +   +L +K
Sbjct: 329 LELHTGNNDTCNEIMSIIGEFKGASRDPGLREVQMATKSKKQARIMFDFIGEAQDELTVK 388

Query: 77  PGDKIQLL-EKLSPEWYKGSC----NGRTGIFPANYVKP 110
            GD + +L +K S +W+  +C    + + G+ PA +V+P
Sbjct: 389 EGDMVYILNDKSSKDWW--TCELVDSHKRGVVPAQFVEP 425

>KAFR0I02350 Chr9 complement(473466..474218) [753 bp, 250 aa] {ON}
           Anc_1.421 YCR004C
          Length = 250

 Score = 30.8 bits (68), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 28/102 (27%), Positives = 45/102 (44%), Gaps = 10/102 (9%)

Query: 3   ASLINRSLTNIRTELDFLKESNVISNDVFDQINKSLPMR-WDPPSASRNTSSTSLEYVEA 61
           A  + + + +   + D  +    +S+DV  Q+N   P +  D P A+ NT +   EY   
Sbjct: 19  AKSVQKGIESAGGKADIYRVEETLSDDVLSQMNA--PAKPADIPIATENTLT---EYDAF 73

Query: 62  LYQFDPQQDGDLGLKPGDKIQLLEKLSPEWYKGSCNGRTGIF 103
           L+   P + G L   P       +K    W +GS NG+ G F
Sbjct: 74  LFGV-PTRFGTL---PAQWSSFWDKTGSLWAQGSLNGKVGGF 111

>TDEL0C02810 Chr3 complement(498625..499638) [1014 bp, 337 aa] {ON}
           Anc_7.419 YER118C
          Length = 337

 Score = 30.8 bits (68), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 14/47 (29%), Positives = 23/47 (48%)

Query: 63  YQFDPQQDGDLGLKPGDKIQLLEKLSPEWYKGSCNGRTGIFPANYVK 109
           YQ D     ++    G+ +++ +     W     NG TGI P+NYV+
Sbjct: 284 YQADAGDAYEISFDQGEILKVSDIEGRWWKAKRANGETGIIPSNYVQ 330

>Suva_4.161 Chr4 (293198..293944) [747 bp, 248 aa] {ON} YDL085W
           (REAL)
          Length = 248

 Score = 30.8 bits (68), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 15/42 (35%), Positives = 19/42 (45%)

Query: 67  PQQDGDLGLKPGDKIQLLEKLSPEWYKGSCNGRTGIFPANYV 108
           P+Q    GL   DK++LL      +  G C   TG FP   V
Sbjct: 93  PEQTNKRGLLINDKLELLGAEESVYAIGDCTAHTGFFPTAQV 134

>NDAI0A01470 Chr1 (326531..327634) [1104 bp, 367 aa] {ON} Anc_7.419
           YER118C
          Length = 367

 Score = 30.8 bits (68), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 17/53 (32%), Positives = 28/53 (52%), Gaps = 2/53 (3%)

Query: 59  VEALY--QFDPQQDGDLGLKPGDKIQLLEKLSPEWYKGSCNGRTGIFPANYVK 109
           V+ALY  Q D     ++    G+ +++ +     W     NG+TGI P+NYV+
Sbjct: 311 VKALYSYQADDADAYEISFDQGEILKVSDIEGRWWKAKRENGQTGIIPSNYVE 363

>CAGL0F05885g Chr6 (588828..590966) [2139 bp, 712 aa] {ON} similar
           to uniprot|Q05080 Saccharomyces cerevisiae YMR032w HOF1
           involved in cytokinesis
          Length = 712

 Score = 30.8 bits (68), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 15/63 (23%), Positives = 33/63 (52%), Gaps = 9/63 (14%)

Query: 56  LEYVEALYQFDPQQDGDLG-LKPGDKIQLLEKLSPEWYKGSCNGRT--------GIFPAN 106
           +++ +ALY     +  +L   + GD + L E ++ +WY+G   G +        G+ P+N
Sbjct: 644 IKFAKALYPLINSEAQELANFEKGDYLLLTEVVNEDWYRGEVYGNSNTTTTHGNGLIPSN 703

Query: 107 YVK 109
           +++
Sbjct: 704 FIQ 706

>Skud_4.170 Chr4 (298687..300324) [1638 bp, 545 aa] {ON} YDL085W
           (REAL)
          Length = 545

 Score = 30.8 bits (68), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 15/42 (35%), Positives = 19/42 (45%)

Query: 67  PQQDGDLGLKPGDKIQLLEKLSPEWYKGSCNGRTGIFPANYV 108
           P+Q    GL   DK++LL      +  G C   TG FP   V
Sbjct: 382 PEQTNKRGLLINDKLELLGAEDSIYAIGDCTAHTGFFPTAQV 423

>Suva_5.235 Chr5 complement(366285..369416) [3132 bp, 1043 aa] {ON}
           YER114C (REAL)
          Length = 1043

 Score = 30.8 bits (68), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 18/55 (32%), Positives = 32/55 (58%), Gaps = 7/55 (12%)

Query: 61  ALYQFDPQQDGDLGLKPGDKIQLL---EKLSPEWYKGSCNGRT---GIFPANYVK 109
           A+ ++  + + +L +KPGDKI+++   EK    WY G  N RT   G++P  + +
Sbjct: 50  AINEYFKRMEDELDMKPGDKIKVITDDEKYKDGWYFGR-NLRTNEEGLYPVVFTQ 103

>Smik_5.263 Chr5 complement(407025..408131) [1107 bp, 368 aa] {ON}
           YER118C (REAL)
          Length = 368

 Score = 30.8 bits (68), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 15/53 (28%), Positives = 27/53 (50%), Gaps = 2/53 (3%)

Query: 59  VEALYQFDPQQDG--DLGLKPGDKIQLLEKLSPEWYKGSCNGRTGIFPANYVK 109
            +ALY +D   +   ++  +  + +Q+ +     W     NG TGI P+NYV+
Sbjct: 306 AKALYPYDADDEDAYEISFEQNEILQVSDIEGRWWKARRANGETGIIPSNYVQ 358

>Skud_13.188 Chr13 (322010..324019) [2010 bp, 669 aa] {ON} YMR032W
           (REAL)
          Length = 669

 Score = 30.8 bits (68), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 17/68 (25%), Positives = 31/68 (45%), Gaps = 9/68 (13%)

Query: 56  LEYVEALYQFDPQQD-GDLGLKPGDKIQLLEKLSPEWYKGSC--------NGRTGIFPAN 106
           +EY +A+Y     +  G      GD + + E ++ +WYKG          + R G+ P N
Sbjct: 601 IEYAKAMYPLVGNEAPGLANFHKGDYMLITEIVNKDWYKGEVYDNDRIDRDHRVGLIPYN 660

Query: 107 YVKPAFSG 114
           +++    G
Sbjct: 661 FIQLLHQG 668

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.312    0.130    0.383 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 18,700,145
Number of extensions: 744224
Number of successful extensions: 2907
Number of sequences better than 10.0: 315
Number of HSP's gapped: 2772
Number of HSP's successfully gapped: 350
Length of query: 212
Length of database: 53,481,399
Length adjustment: 105
Effective length of query: 107
Effective length of database: 41,441,469
Effective search space: 4434237183
Effective search space used: 4434237183
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 63 (28.9 bits)