Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Smik_16.4043.498ON46046022830.0
YPR152C (URN1)3.498ON46546716820.0
Skud_16.4463.498ON45646115530.0
Suva_16.4803.498ON45245613930.0
KAFR0G037203.498ON4094515741e-68
Kpol_480.113.498ON4634735677e-67
TDEL0D056603.498ON4424615588e-66
Kwal_47.188953.498ON4434535474e-64
TPHA0A056903.498ON4784785416e-63
KNAG0A079703.498ON3884495233e-61
KLTH0G02398g3.498ON4624735004e-57
SAKL0F02552g3.498ON4784944962e-56
CAGL0L08404g3.498ON4103574502e-50
KLLA0E03939g3.498ON4354464426e-49
ZYRO0D09768g3.498ON4602273281e-32
Ecym_12313.498ON3292423183e-32
AFR317C3.498ON3282222842e-27
NCAS0F035803.498ON4132162872e-27
NDAI0B059003.498ON5222652893e-27
TBLA0D029303.498ON2761481947e-16
TBLA0C009302.649ON65840990.002
NCAS0C051102.649ON60471970.002
CAGL0L05368g2.649ON59079940.007
KLLA0E18239g2.649ON571105940.007
KNAG0M024702.649ON60628930.008
KAFR0A002302.649ON55628890.027
YKL012W (PRP40)2.649ON58373880.031
NDAI0G046002.649ON64784880.038
TDEL0B074402.649ON57029870.046
Smik_11.2432.649ON57928870.048
Kpol_1073.42.649ON53030860.058
ZYRO0E00682g2.649ON57031820.16
Skud_11.2172.649ON58326820.16
TPHA0L020202.649ON58373820.20
Suva_11.2162.649ON58575810.22
ACL120W5.135ON16375750.61
TDEL0F009908.134ON78976770.72
Kwal_47.173028.134ON78776770.74
KLTH0E06908g8.134ON79176770.75
ADR159C2.649ON56929761.00
KLLA0E13575g8.134ON81982741.5
ADL055C8.134ON81782741.6
Ecym_83948.134ON84176741.7
CAGL0K02255g8.134ON82283741.8
ZYRO0G18920g8.134ON81983732.0
KNAG0D021808.134ON81183732.1
Suva_5.2468.134ON80983732.1
KAFR0B021008.134ON80083732.2
SAKL0H24552g8.134ON79083732.2
Smik_5.2718.134ON80883732.3
Skud_5.2538.134ON80983732.3
YER125W (RSP5)8.134ON80983732.4
Kpol_1031.398.134ON81583732.4
NCAS0B045408.134ON83583732.6
KAFR0A025108.217ON538107722.6
Kwal_14.9392.649ON56228722.7
NDAI0B024608.134ON83683722.7
TBLA0G027908.134ON84483722.7
TPHA0D010308.134ON82283713.7
Ecym_33972.649ON57526704.5
KLTH0C00924g2.649ON56431704.8
Kpol_1001.254.305ON131163704.9
SAKL0G19360g2.649ON56828705.6
Ecym_73775.135ON16369676.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Smik_16.404
         (460 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Smik_16.404 Chr16 complement(704003..705385) [1383 bp, 460 aa] {...   884   0.0  
YPR152C Chr16 complement(832061..833458) [1398 bp, 465 aa] {ON} ...   652   0.0  
Skud_16.446 Chr16 complement(785650..787020) [1371 bp, 456 aa] {...   602   0.0  
Suva_16.480 Chr16 complement(828461..829819) [1359 bp, 452 aa] {...   541   0.0  
KAFR0G03720 Chr7 complement(765353..766582) [1230 bp, 409 aa] {O...   225   1e-68
Kpol_480.11 s480 (21829..23220) [1392 bp, 463 aa] {ON} (21829..2...   223   7e-67
TDEL0D05660 Chr4 complement(1018928..1020256) [1329 bp, 442 aa] ...   219   8e-66
Kwal_47.18895 s47 complement(1018177..1019508) [1332 bp, 443 aa]...   215   4e-64
TPHA0A05690 Chr1 complement(1289284..1290720) [1437 bp, 478 aa] ...   213   6e-63
KNAG0A07970 Chr1 complement(1270860..1272026) [1167 bp, 388 aa] ...   206   3e-61
KLTH0G02398g Chr7 (186986..188374) [1389 bp, 462 aa] {ON} simila...   197   4e-57
SAKL0F02552g Chr6 (219380..220816) [1437 bp, 478 aa] {ON} simila...   195   2e-56
CAGL0L08404g Chr12 (924898..926130) [1233 bp, 410 aa] {ON} simil...   177   2e-50
KLLA0E03939g Chr5 (357695..359002) [1308 bp, 435 aa] {ON} simila...   174   6e-49
ZYRO0D09768g Chr4 (826977..828359) [1383 bp, 460 aa] {ON} simila...   130   1e-32
Ecym_1231 Chr1 (476386..477375) [990 bp, 329 aa] {ON} similar to...   127   3e-32
AFR317C Chr6 complement(1011817..1012803) [987 bp, 328 aa] {ON} ...   114   2e-27
NCAS0F03580 Chr6 complement(712074..713315) [1242 bp, 413 aa] {O...   115   2e-27
NDAI0B05900 Chr2 complement(1425195..1426763) [1569 bp, 522 aa] ...   115   3e-27
TBLA0D02930 Chr4 (719542..720372) [831 bp, 276 aa] {ON} Anc_3.49...    79   7e-16
TBLA0C00930 Chr3 complement(185527..187503) [1977 bp, 658 aa] {O...    43   0.002
NCAS0C05110 Chr3 (1042307..1044121) [1815 bp, 604 aa] {ON} Anc_2...    42   0.002
CAGL0L05368g Chr12 complement(593547..595319) [1773 bp, 590 aa] ...    41   0.007
KLLA0E18239g Chr5 (1627093..1628808) [1716 bp, 571 aa] {ON} simi...    41   0.007
KNAG0M02470 Chr13 (458978..460798) [1821 bp, 606 aa] {ON} Anc_2....    40   0.008
KAFR0A00230 Chr1 (46128..47798) [1671 bp, 556 aa] {ON} Anc_2.649...    39   0.027
YKL012W Chr11 (418310..420061) [1752 bp, 583 aa] {ON}  PRP40U1 s...    39   0.031
NDAI0G04600 Chr7 complement(1094693..1096636) [1944 bp, 647 aa] ...    39   0.038
TDEL0B07440 Chr2 complement(1302549..1304261) [1713 bp, 570 aa] ...    38   0.046
Smik_11.243 Chr11 (405300..407039) [1740 bp, 579 aa] {ON} YKL012...    38   0.048
Kpol_1073.4 s1073 (4004..5596) [1593 bp, 530 aa] {ON} (4004..559...    38   0.058
ZYRO0E00682g Chr5 (49836..51548) [1713 bp, 570 aa] {ON} similar ...    36   0.16 
Skud_11.217 Chr11 (399225..400976) [1752 bp, 583 aa] {ON} YKL012...    36   0.16 
TPHA0L02020 Chr12 complement(419703..421454) [1752 bp, 583 aa] {...    36   0.20 
Suva_11.216 Chr11 (402394..404151) [1758 bp, 585 aa] {ON} YKL012...    36   0.22 
ACL120W Chr3 (135420..135911) [492 bp, 163 aa] {ON} Syntenic hom...    33   0.61 
TDEL0F00990 Chr6 complement(173710..176079) [2370 bp, 789 aa] {O...    34   0.72 
Kwal_47.17302 s47 complement(342098..344461) [2364 bp, 787 aa] {...    34   0.74 
KLTH0E06908g Chr5 complement(634745..637120) [2376 bp, 791 aa] {...    34   0.75 
ADR159C Chr4 complement(982821..984530) [1710 bp, 569 aa] {ON} S...    34   1.00 
KLLA0E13575g Chr5 (1198133..1200592) [2460 bp, 819 aa] {ON} high...    33   1.5  
ADL055C Chr4 complement(584032..586485) [2454 bp, 817 aa] {ON} S...    33   1.6  
Ecym_8394 Chr8 (808813..811338) [2526 bp, 841 aa] {ON} similar t...    33   1.7  
CAGL0K02255g Chr11 complement(200548..203016) [2469 bp, 822 aa] ...    33   1.8  
ZYRO0G18920g Chr7 (1563386..1565845) [2460 bp, 819 aa] {ON} high...    33   2.0  
KNAG0D02180 Chr4 complement(369157..371592) [2436 bp, 811 aa] {O...    33   2.1  
Suva_5.246 Chr5 (385807..388236) [2430 bp, 809 aa] {ON} YER125W ...    33   2.1  
KAFR0B02100 Chr2 (412007..414409) [2403 bp, 800 aa] {ON} Anc_8.1...    33   2.2  
SAKL0H24552g Chr8 (2129859..2132231) [2373 bp, 790 aa] {ON} high...    33   2.2  
Smik_5.271 Chr5 (419111..421537) [2427 bp, 808 aa] {ON} YER125W ...    33   2.3  
Skud_5.253 Chr5 complement(408930..411359) [2430 bp, 809 aa] {ON...    33   2.3  
YER125W Chr5 (410189..412618) [2430 bp, 809 aa] {ON}  RSP5E3 ubi...    33   2.4  
Kpol_1031.39 s1031 (93761..96208) [2448 bp, 815 aa] {ON} (93761....    33   2.4  
NCAS0B04540 Chr2 (825546..828053) [2508 bp, 835 aa] {ON} Anc_8.134     33   2.6  
KAFR0A02510 Chr1 (524501..526117) [1617 bp, 538 aa] {ON} Anc_8.2...    32   2.6  
Kwal_14.939 s14 (124224..125912) [1689 bp, 562 aa] {ON} YKL012W ...    32   2.7  
NDAI0B02460 Chr2 (618295..620805) [2511 bp, 836 aa] {ON} Anc_8.134     32   2.7  
TBLA0G02790 Chr7 (733955..736489) [2535 bp, 844 aa] {ON} Anc_8.1...    32   2.7  
TPHA0D01030 Chr4 (207354..209822) [2469 bp, 822 aa] {ON} Anc_8.1...    32   3.7  
Ecym_3397 Chr3 (754713..756440) [1728 bp, 575 aa] {ON} similar t...    32   4.5  
KLTH0C00924g Chr3 (90830..92524) [1695 bp, 564 aa] {ON} similar ...    32   4.8  
Kpol_1001.25 s1001 complement(68111..72046) [3936 bp, 1311 aa] {...    32   4.9  
SAKL0G19360g Chr7 complement(1664386..1666092) [1707 bp, 568 aa]...    32   5.6  
Ecym_7377 Chr7 complement(784580..785071) [492 bp, 163 aa] {ON} ...    30   6.2  

>Smik_16.404 Chr16 complement(704003..705385) [1383 bp, 460 aa] {ON}
           YPR152C (REAL)
          Length = 460

 Score =  884 bits (2283), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 433/460 (94%), Positives = 433/460 (94%)

Query: 1   MHGVWQEFKTPTGEKYYYNKTTKQSQWEKPNLKKNSDLEDDAKVSQIERMPTFALELIDG 60
           MHGVWQEFKTPTGEKYYYNKTTKQSQWEKPNLKKNSDLEDDAKVSQIERMPTFALELIDG
Sbjct: 1   MHGVWQEFKTPTGEKYYYNKTTKQSQWEKPNLKKNSDLEDDAKVSQIERMPTFALELIDG 60

Query: 61  WHLIICNDGTKLYFNHDSKIFKSDICQESGGKCGALIESLDKDKLVLLIGIARGYSVQEE 120
           WHLIICNDGTKLYFNHDSKIFKSDICQESGGKCGALIESLDKDKLVLLIGIARGYSVQEE
Sbjct: 61  WHLIICNDGTKLYFNHDSKIFKSDICQESGGKCGALIESLDKDKLVLLIGIARGYSVQEE 120

Query: 121 DIDKIFESLNEEIDLFKKNQDGFEREIETREEAGVVKSLLSESHTGLISGYGSSSXXXXX 180
           DIDKIFESLNEEIDLFKKNQDGFEREIETREEAGVVKSLLSESHTGLISGYGSSS     
Sbjct: 121 DIDKIFESLNEEIDLFKKNQDGFEREIETREEAGVVKSLLSESHTGLISGYGSSSEEEEE 180

Query: 181 XXXXXXXXDHAEQGVNQNVSXXXXXXXXXXXXXXEGRERSLFFQLCDRYKLDKFSTWSLQ 240
                   DHAEQGVNQNVS              EGRERSLFFQLCDRYKLDKFSTWSLQ
Sbjct: 181 EEEEEEEEDHAEQGVNQNVSIIDDLNHIDADDIDEGRERSLFFQLCDRYKLDKFSTWSLQ 240

Query: 241 SKKIENDPEFYKIRDDTVREGLFEEWCEKHSAKESDSEDESNVLEPTKYHYLAQIVAKAG 300
           SKKIENDPEFYKIRDDTVREGLFEEWCEKHSAKESDSEDESNVLEPTKYHYLAQIVAKAG
Sbjct: 241 SKKIENDPEFYKIRDDTVREGLFEEWCEKHSAKESDSEDESNVLEPTKYHYLAQIVAKAG 300

Query: 301 NIAPDAIPQDIRKRQKALYKAYRIKEYVPLKREQDRFVSQLLFYYKTFNLEQRKTIFQDC 360
           NIAPDAIPQDIRKRQKALYKAYRIKEYVPLKREQDRFVSQLLFYYKTFNLEQRKTIFQDC
Sbjct: 301 NIAPDAIPQDIRKRQKALYKAYRIKEYVPLKREQDRFVSQLLFYYKTFNLEQRKTIFQDC 360

Query: 361 LWDHERDFGGAIASLRQDNKLISRWQALLEDPIDGTSIEDVLLSIENRCCVSAIVVADPR 420
           LWDHERDFGGAIASLRQDNKLISRWQALLEDPIDGTSIEDVLLSIENRCCVSAIVVADPR
Sbjct: 361 LWDHERDFGGAIASLRQDNKLISRWQALLEDPIDGTSIEDVLLSIENRCCVSAIVVADPR 420

Query: 421 YYVVGILEKTVVWVRWLAAEGAPPSRFTPAGAGNGPINPI 460
           YYVVGILEKTVVWVRWLAAEGAPPSRFTPAGAGNGPINPI
Sbjct: 421 YYVVGILEKTVVWVRWLAAEGAPPSRFTPAGAGNGPINPI 460

>YPR152C Chr16 complement(832061..833458) [1398 bp, 465 aa] {ON}
           URN1Putative protein of unknown function containing WW
           and FF domains; overexpression causes accumulation of
           cells in G1 phase
          Length = 465

 Score =  652 bits (1682), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 330/467 (70%), Positives = 372/467 (79%), Gaps = 11/467 (2%)

Query: 1   MHGVWQEFKTPTGEKYYYNKTTKQSQWEKPNLKKNSDLEDDAKVSQIERMPTFALELIDG 60
           M G WQEFKTP G+KYYYNK TKQS+WEKPNLKK S+LE +AK SQ ER PTF+LEL++G
Sbjct: 1   MRGEWQEFKTPAGKKYYYNKNTKQSRWEKPNLKKGSNLESNAKESQTERKPTFSLELVNG 60

Query: 61  WHLIICNDGTKLYFNHDSKIFKSDICQESGGKCGALIESLDKDKLVLLIGIARGYSVQEE 120
           WHLII NDGTKLYFN DSK FK+DI QE   +C +LIESLDK+KLVLLIG+ARGY+++EE
Sbjct: 61  WHLIIYNDGTKLYFNDDSKEFKNDISQEDDSRCRSLIESLDKEKLVLLIGVARGYTMREE 120

Query: 121 DIDKIFESLNEEIDLFKKNQDGFEREIETREEAGVVKSLLSESHTGLISGYGSSSXXXXX 180
           DIDKI ES NEEI LFK+NQD  ER+ E  EEAG VKS L ESHTGL+SGYGSSS     
Sbjct: 121 DIDKILESCNEEIHLFKRNQDEVERKDEISEEAGDVKSPLQESHTGLVSGYGSSSGEEDE 180

Query: 181 XXXXXXXXDHAEQGVNQNVSXXXXXXXXXXXXXXEGRERSLFFQLCDRYKLDKFSTWSLQ 240
                   ++ EQ VNQ++S              E   R++FF+L DRYKLDKFSTWSLQ
Sbjct: 181 EEDEEEDEENEEQIVNQDISIIDDLNRIDTDDIDE---RNIFFELFDRYKLDKFSTWSLQ 237

Query: 241 SKKIENDPEFYKIRDDTVREGLFEEWCEKHS----AKESDSED----ESNVLEPTKYHYL 292
           SKKIENDP+FYKIRDDTVRE LFEEWC + S    A+ESDSED    +S VLEPTKYHYL
Sbjct: 238 SKKIENDPDFYKIRDDTVRESLFEEWCGERSGNATAEESDSEDNSEDDSEVLEPTKYHYL 297

Query: 293 AQIVAKAGNIAPDAIPQDIRKRQKALYKAYRIKEYVPLKREQDRFVSQLLFYYKTFNLEQ 352
           AQIVA AG IAPD IPQDIRK+QKALYKAY+IKEY+P KR+QD+FVSQLLFYYKTF+LEQ
Sbjct: 298 AQIVANAGTIAPDTIPQDIRKQQKALYKAYKIKEYIPSKRDQDKFVSQLLFYYKTFDLEQ 357

Query: 353 RKTIFQDCLWDHERDFGGAIASLRQDNKLISRWQALLEDPIDGTSIEDVLLSIENRCCVS 412
           RK IF DCL DHERDF GA+ SLRQD +LI RWQ LL+ P D +SIED+LLSIE+RCCVS
Sbjct: 358 RKEIFCDCLRDHERDFTGAVESLRQDKELIDRWQTLLKAPADSSSIEDILLSIEHRCCVS 417

Query: 413 AIVVADPRYYVVGILEKTVVWVRWLAAEGAPPSRFTPAGAGNGPINP 459
            IVV +PRYYVVGILEKTVVWVRWLAAE  P SRFTP GAGN PINP
Sbjct: 418 PIVVTEPRYYVVGILEKTVVWVRWLAAEVGPSSRFTPVGAGNEPINP 464

>Skud_16.446 Chr16 complement(785650..787020) [1371 bp, 456 aa] {ON}
           YPR152C (REAL)
          Length = 456

 Score =  602 bits (1553), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 302/461 (65%), Positives = 356/461 (77%), Gaps = 11/461 (2%)

Query: 4   VWQEFKTPTGEKYYYNKTTKQSQWEKPNLKKNSDLEDDAKVSQIERMPTFALELIDGWHL 63
           +WQEFKTP G +YYYNK TKQSQWE P+ K  SD E+  K  ++ER PTF+LELID WHL
Sbjct: 1   MWQEFKTPAGIRYYYNKKTKQSQWENPDFKIFSDQENVEKALRMERKPTFSLELIDAWHL 60

Query: 64  IICNDGTKLYFNHDSKIFKSDICQESGGKCGALIESLDKDKLVLLIGIARGYSVQEEDID 123
           +ICNDGTK Y+N DSK+FK++I QES  +C AL+ESLDK+KLVLLIG+ARGY +++ED+D
Sbjct: 61  VICNDGTKFYYNSDSKVFKNEISQESDSQCSALVESLDKEKLVLLIGVARGYDMRDEDVD 120

Query: 124 KIFESLNEEIDLFKKNQDGFEREIETREEAGVVKSLLSESHTGLISGYGSSSXXXXXXXX 183
           KIFESLNEEI+LFKKNQ+   R  E  EE G V   L E HTGLISGYGSSS        
Sbjct: 121 KIFESLNEEINLFKKNQNEAGRVDEANEEPGDVNPPLKEHHTGLISGYGSSS-EEEEEEE 179

Query: 184 XXXXXDHAEQGVNQNVSXXXXXXXXXXXXXXEGRERSLFFQLCDRYKLDKFSTWSLQSKK 243
                D  EQ +N++ +              +  ER LFF+L DRY+LDKFSTWSLQSKK
Sbjct: 180 EEEEEDDGEQDLNKDAT---IIDDLNQIDTGDADERGLFFRLFDRYELDKFSTWSLQSKK 236

Query: 244 IENDPEFYKIRDDTVREGLFEEWC-EKHS----AKESDSEDESNVLEPTKYHYLAQIVAK 298
           IENDP+FY I DD VREG FEEWC  +HS    A+ S SED  +VLEPTKYHYLAQI+AK
Sbjct: 237 IENDPDFYTIGDDAVREGFFEEWCGHEHSDSAAAEASGSEDVGDVLEPTKYHYLAQILAK 296

Query: 299 AGNIAPDAIPQDIRKRQKALYKAYRIKEYVPLKREQDRFVSQLLFYYKTFNLEQRKTIFQ 358
           AG I PDA+PQDIRK+QK LYKAYRIKEYVP KREQD+FVSQLLFYYKTF+LEQRK IFQ
Sbjct: 297 AGTIPPDAVPQDIRKQQKELYKAYRIKEYVPSKREQDKFVSQLLFYYKTFSLEQRKEIFQ 356

Query: 359 DCLWDHERDFGGAIASLRQDNKLISRWQALLEDPIDGTSIEDVLLSIENRCCVSAIVVAD 418
           DCL DHERDF GA+ S+R+++ LIS+WQA+LE P DG S+E+VLL+IE RC +  +V AD
Sbjct: 357 DCLRDHERDFAGAVKSIRRESGLISQWQAVLEAPADGASVEEVLLNIEYRCNI--VVAAD 414

Query: 419 PRYYVVGILEKTVVWVRWLAAEGAPPSRFTPAGAGNGPINP 459
           PRYYVVGIL+KT+VWVRWLAAEG P  RFTPAGAG+ PI+P
Sbjct: 415 PRYYVVGILDKTMVWVRWLAAEGEPSGRFTPAGAGSRPISP 455

>Suva_16.480 Chr16 complement(828461..829819) [1359 bp, 452 aa] {ON}
           YPR152C (REAL)
          Length = 452

 Score =  541 bits (1393), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 284/456 (62%), Positives = 336/456 (73%), Gaps = 21/456 (4%)

Query: 4   VWQEFKTPTGEKYYYNKTTKQSQWEKPNLKKNSDLEDDAKVSQIERMPTFALELIDGWHL 63
           VWQEFKTP G++Y+YNK TK+S+W+KP+ KK S  +D AKV+Q+ER P FALELID WHL
Sbjct: 6   VWQEFKTPAGKRYFYNKNTKESRWDKPDFKKASGAQDRAKVAQVERKPMFALELIDDWHL 65

Query: 64  IICNDGTKLYFNHDSKIFKSDICQESGGKCGALIESLDKDKLVLLIGIARGYSVQEEDID 123
           IICNDGTK Y+N +S I K +I +E  G+C AL+ SLDK+KL+LLIG+ARGY+V+EED++
Sbjct: 66  IICNDGTKFYYNGESNISKYEIDEEGAGQCAALMNSLDKEKLILLIGVARGYNVREEDVE 125

Query: 124 KIFESLNEEIDLFKKNQDGF--EREIETREEAGVVKSLLSESHTGLISGYGSSSXXXXXX 181
           KIFESLNEEIDLFKKNQ     E+  E  EEAG  ++    +  GL+SGYGSSS      
Sbjct: 126 KIFESLNEEIDLFKKNQVVVVEEKADEPNEEAGDAETPPQANSAGLVSGYGSSSEEEEEE 185

Query: 182 XXXXXXXDHAEQGVNQNVSXXXXXXXXXXXXXXEGRERSLFFQLCDRYKLDKFSTWSLQS 241
                        +NQ  S              +  ER LFFQLCDRY+LDKFSTWSLQ 
Sbjct: 186 EEPENDDAGIIDDLNQIDS-------------GDVNERGLFFQLCDRYELDKFSTWSLQC 232

Query: 242 KKIENDPEFYKIRDDTVREGLFEEWC----EKHSAKESDSEDESNVLEPTKYHYLAQIVA 297
           KKIENDP+FYK+ D  VRE LFEEWC       S  ES+ ED++++LEPTK+HYLAQIVA
Sbjct: 233 KKIENDPDFYKVGDAAVRESLFEEWCASASASASGNESEDEDDADLLEPTKFHYLAQIVA 292

Query: 298 KAGNIAPDAIPQDIRKRQKALYKAYRIKEYVPLKREQDRFVSQLLFYYKTFNLEQRKTIF 357
           KA  IAPD IPQDIRK+QKAL+KAYRIKEYVP KR+QDRFVSQLLFYYKTF+LEQRK IF
Sbjct: 293 KA-EIAPDCIPQDIRKQQKALFKAYRIKEYVPSKRDQDRFVSQLLFYYKTFSLEQRKEIF 351

Query: 358 QDCLWDHERDFGGAIASLRQDNKLISRWQALLE-DPIDGTSIEDVLLSIENRCCVSAIVV 416
           Q+CL DHERDF  A+ SLRQD  LISRWQA+L     DG S+ED LLSIE+RC V AI +
Sbjct: 352 QECLRDHERDFACAVQSLRQDVGLISRWQAILRPTAADGASVEDALLSIEHRCGVGAIAL 411

Query: 417 ADPRYYVVGILEKTVVWVRWLAAEGAPPSRFTPAGA 452
           ADPRYYV+GIL+KT  WVRWLAAEG  P+   P  A
Sbjct: 412 ADPRYYVLGILDKTAGWVRWLAAEGVDPAAGWPRRA 447

>KAFR0G03720 Chr7 complement(765353..766582) [1230 bp, 409 aa] {ON}
           Anc_3.498 YPR152C
          Length = 409

 Score =  225 bits (574), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 154/451 (34%), Positives = 241/451 (53%), Gaps = 65/451 (14%)

Query: 1   MHGVWQEFKTPTGEKYYYNKTTKQSQWEKPNLKKNSDLEDDAKVSQIERMPTFALELIDG 60
           M+ +W+E++ P G+KYYYN  TK++ WEKP   K  ++E           P F + L++ 
Sbjct: 1   MNKIWKEYRAPNGKKYYYNTETKKTTWEKPEAAKREEIE-----------PVFVIRLMND 49

Query: 61  WHLIICNDGTKLYFNHDSKIFKSDICQESGGKCGALIESLDKDKLVLLIGIARGYSVQEE 120
           W L+ICN+G K Y +++++  K    +ES      LIE  DK+KLV LIGIARGY++  E
Sbjct: 50  WKLVICNNGMKYYLDNENEPTKELSDEESL----RLIELFDKEKLVCLIGIARGYAI--E 103

Query: 121 DIDKIFESLNEEIDLFKKNQDGFEREIETREEAGVVKSLLSES---HTGLISGYGSSSXX 177
           +++KI+ ++ EE++  K++    +  ++   E+ V + +L E+      L+ GY SS   
Sbjct: 104 NVEKIYGNIVEEVEFLKEDMKNEQERLKKEAESEVREIVLKEAEKPRMNLVEGYDSSESE 163

Query: 178 XXXXXXXXXX--XDHAEQGVNQNVSXXXXXXXXXXXXXXEGRERSLFFQLCDRYKLDKFS 235
                        + A++G++ +                    ++ F +L DRY LDKFS
Sbjct: 164 EEEEEEDDYEFLNNVADEGLSGD--------------------KAKFMELFDRYGLDKFS 203

Query: 236 TWSLQSKKIENDPEFYKIRDDTVREGLFEEWCEKHSAKESDSED----------ESNVLE 285
            WS++  K+  DP+FY + DD  RE LFE WC       +  E+          E   LE
Sbjct: 204 EWSMEMNKVSKDPDFYLVTDDQEREDLFERWCSGQGIHSTSDEEAKEGGEPEEHEERPLE 263

Query: 286 PTKYHYLAQIVAKAGNIAPDAIPQDIRKRQKALYKAYRIKEYVPLKREQDRFVSQLLFYY 345
           PTK+HYL+QIV+K+  I    I QDI+++ K L+K Y+IK+++   +EQ++FVS+LLFYY
Sbjct: 264 PTKFHYLSQIVSKS-EIRRTTIFQDIKRQNKRLFKEYKIKDFIESSKEQEKFVSKLLFYY 322

Query: 346 KTF-NLEQRKTIFQDCLWDHERDFGGAIASLRQDNKLISRWQALLEDPIDGTSIEDVLLS 404
           KTF  +E R   F D L    R+      S+   N L    +       D  +IE  LL 
Sbjct: 323 KTFPQVEDRTKQFNDFL----REKNANYTSMSDMNTLSEHIKR-----NDTYAIETTLLQ 373

Query: 405 IENRCCVSAIVVADPRYYVVGILEKTVVWVR 435
           IE  C     V++D RYY++ + +KT+  V+
Sbjct: 374 IE--CNFPQDVLSDVRYYILDLKQKTIELVK 402

>Kpol_480.11 s480 (21829..23220) [1392 bp, 463 aa] {ON}
           (21829..23220) [1392 nt, 464 aa]
          Length = 463

 Score =  223 bits (567), Expect = 7e-67,   Method: Compositional matrix adjust.
 Identities = 156/473 (32%), Positives = 244/473 (51%), Gaps = 57/473 (12%)

Query: 4   VWQEFKTPTGEKYYYNKTTKQSQWEKPNLKKNSDLEDDAKVSQIERMPTFALELIDGWHL 63
           +W+EF  P G KYYYN  +K+S W KP+     D E     S     P F   L++GWHL
Sbjct: 5   IWKEFNAPDGRKYYYNIKSKESTWTKPD--SLYDTEKGKVGSDRAGAPLFVFPLLNGWHL 62

Query: 64  IICNDGTKLYFNHDSKIFKSDICQE-SGGKCGALIESLDKDKLVLLIGIARGYSVQEEDI 122
           IIC  G K Y+N   K+    I +E S      L+ ++DKDKL+LLI +ARGY+    D 
Sbjct: 63  IICVGGEKYYYN---KVLNDTISKELSDDSSLQLLNAVDKDKLILLIAVARGYNWP--DY 117

Query: 123 DKIFESLNEEIDLFKKNQDGFEREIET-----------REEAGVVKSLLSESHTGLISGY 171
           +K+++ L +E +L   +    ++   T            +E  VV    + S+TGLI GY
Sbjct: 118 EKLYDELLKEFELISNDMMQTQQAEVTSTEDEDEDEDENQEGNVV----AVSNTGLIGGY 173

Query: 172 GSSSXXXXXXXXXXXXXDHA-----------EQGVNQNVSXXXXXXXXXXXXXXEGRERS 220
            SS              ++            +  V++N++              E + +S
Sbjct: 174 LSSDDEESSDENQVEVSENTNIEEDLAKRSDQNDVDENLNSIDHGLDSLDDIDLE-KSKS 232

Query: 221 LFFQLCDRYKLDKFSTWSLQSKKIENDPEFYKIRDDTVREGLFEEWCEKH---------- 270
           LF +L + ++LD +S+W LQ KKI+N P++++I D++ RE LFE WC             
Sbjct: 233 LFTRLFEEFQLDPYSSWRLQLKKIQNHPDYFQITDNSTREELFESWCSSKFNGGKSNVTN 292

Query: 271 ---SAKESDSEDESNVLEPTKYHYLAQIVAKAGNIAPDAIPQDIRKRQKALYKAYRIKEY 327
                +E+ + DE +  EPTK+HYLA I++KA +IA D I  DI++  K+L+K ++IK++
Sbjct: 293 FEGEDEETLTSDEEDDFEPTKFHYLAHIISKA-DIAADTIFLDIKENNKSLFKEFKIKDF 351

Query: 328 VPLKREQDRFVSQLLFYYKTFNLEQRKTIFQDCLWDHERDFGGAIASLRQDNKLISRWQA 387
           +  K++Q+ F S+LLF+YK F L +RK +F   L ++E      I S    N  I R   
Sbjct: 352 IKSKKDQEAFSSKLLFFYKKFQLNERKNLFLQLLKENENLIIPNINS----NIEIVR-HI 406

Query: 388 LLEDPIDGTSIEDVLLSIENRCCVSAIVV---ADPRYYVVGILEKTVVWVRWL 437
           +  D  +   IE  LL IE    +  ++V    DP+YY++GI +K ++   +L
Sbjct: 407 IKNDVDEAYEIETQLLQIEKIIGLQNMLVDLANDPKYYILGIKDKLILLKEYL 459

>TDEL0D05660 Chr4 complement(1018928..1020256) [1329 bp, 442 aa]
           {ON} Anc_3.498 YPR152C
          Length = 442

 Score =  219 bits (558), Expect = 8e-66,   Method: Compositional matrix adjust.
 Identities = 152/461 (32%), Positives = 241/461 (52%), Gaps = 43/461 (9%)

Query: 1   MHGVWQEFKTPTGEKYYYNKTTKQSQWEKPNLKKNSDLEDDAKVSQIERMPTFALELIDG 60
           M  +W  F  P+GEKYYYN  TK+S W++P            K+++ E  P +A+ L++ 
Sbjct: 1   MGRLWTTFTAPSGEKYYYNLRTKESTWKRPESFYEDGGNKRPKLTR-EPEPFYAIPLVND 59

Query: 61  WHLIICNDGTKLYFNHDSKIFKSDICQESGGKCGALIESLDKDKLVLLIGIARGYSVQEE 120
           W L+I + G K YF  DS   ++    E   +   L+ ++DK+K++LL+ IARGY+    
Sbjct: 60  WFLVIDDIGGKYYF--DSSTEEASWTLEDP-ESAELLSTIDKNKIILLVAIARGYNTNVG 116

Query: 121 DIDKIFESLNEEIDLFKKNQ----DGFEREIETREEAGVVKSLLSESHTGLISGYGSSSX 176
           D  ++++ + +++   +K      +G +   +  E          +  +GLI+GY SS  
Sbjct: 117 D--RVYQEVIDDLKALRKGSAVEEEGEQEGEQESESIPSESEEEEKRPSGLIAGYSSSEE 174

Query: 177 XXXXXXXXXXXXDHAEQGVNQNVSXXXXXXXXXXXXXXEGRERSLFFQLCDRYKLDKFST 236
                               + ++              E + R+ FFQL  R++ D +ST
Sbjct: 175 EENEIDSDV-----------EKLNNLGDDDLPKENHEDESQIRNDFFQLLQRHQCDPYST 223

Query: 237 WSLQSKKIENDPEFYKIRDDTVREGLFEEWCEK---HSAKESDSEDESNV---------- 283
           WS+Q++KI+ DP FY+I DD++RE +FEEWCEK    +    D  DE N+          
Sbjct: 224 WSIQARKIQEDPLFYRITDDSIRESMFEEWCEKAINRTTNPQDLVDEDNLDDDSREEEEE 283

Query: 284 --LEPTKYHYLAQIVAKAGNIAPDAIPQDIRKRQKALYKAYRIKEYVPLKREQDRFVSQL 341
             LEP  +HYLA IV+KA NI P  I QDI+ + KA +K Y+IK++V  K +Q+ FVS+L
Sbjct: 284 DELEPLPFHYLAHIVSKA-NITPSTIFQDIKDQNKADFKKYKIKQFVKSKSQQETFVSKL 342

Query: 342 LFYYKTFNLEQRKTIFQDCLWDHERDFGGAIASLRQDNKLISRWQALLEDPIDGTSIEDV 401
           LFYYK F L++RK IF D L  H R       +L Q+++ +    +      D  +IE  
Sbjct: 343 LFYYKKFTLDERKEIFHDLLESHSRSIK---KNLEQESESMRSTLSEEAGSNDAYAIETK 399

Query: 402 LLSIENRCCVSAIV---VADPRYYVVGILEKTVVWVRWLAA 439
           LL +EN   ++  +     DP+YYV+GI +K +  + +L +
Sbjct: 400 LLKMENLIGLARDMEELANDPKYYVLGIKDKMIELMHYLTS 440

>Kwal_47.18895 s47 complement(1018177..1019508) [1332 bp, 443 aa]
           {ON} YPR152C - Hypothetical ORF [contig 189] FULL
          Length = 443

 Score =  215 bits (547), Expect = 4e-64,   Method: Compositional matrix adjust.
 Identities = 153/453 (33%), Positives = 242/453 (53%), Gaps = 40/453 (8%)

Query: 1   MHGVWQEFKTPTGEKYYYNKTTKQSQWEKPNLKKNSDLEDDAKVSQIERMPTFALELIDG 60
           M   W+E+KTP G KYYYN  TK+S +E P+   + D     K  +++  P FAL L + 
Sbjct: 1   MARQWREYKTPDGSKYYYNLNTKKSTYEIPD-DFDEDQNSGRKSRKLDAKPLFALSLFND 59

Query: 61  WHLIICNDGTKLYFNHDSKIFKSDICQESGGKCGALIESLDKDKLVLLIGIARGYSVQEE 120
           W LIICN G + ++N +S   + D+  E+  +   L+  LD++KLVLL+G+A+G+   + 
Sbjct: 60  WALIICNTGLRFFYNSESHTSRWDLDDEASLE---LLAKLDREKLVLLVGVAKGFDPGDR 116

Query: 121 DIDKIFESLNEEIDLFKKNQDGFEREIETREEAGVVKSLLSESHTGLISGYGSSSXXXXX 180
           ++   ++ L++ I   K++ +  +   ET EE+ +  ++  +S   L+SGYGSS      
Sbjct: 117 NV---YQELSDSISELKEDSNNRDFRKETAEES-IPTAVPGQS---LVSGYGSSDESDKD 169

Query: 181 XXXXXXXXDH---AEQGVNQNVSXXXXXXXXXXXXXXEGRERSLFFQLCDRYKLDKFSTW 237
                   D     E     NV               +    + F  L  +Y +D +STW
Sbjct: 170 EDEEEEENDEGDSTEAVSCTNVPDADVDDLGTVLPEHDYSNDAEFISLFSKYAVDPYSTW 229

Query: 238 SLQSKKIENDPEFYKIRDDTVREGLFEEWCEKHSAKESD----------SEDES---NVL 284
           ++QS+KI +DP FYKI +D  R+ LFE WC    + +S+          S+DE    + L
Sbjct: 230 NMQSRKIRDDPLFYKITNDADRKELFENWCMNECSNQSEVPAIDEQIISSDDEDPAIDSL 289

Query: 285 EPTKYHYLAQIVAKAGNIAPDAIPQDIRKRQKALYKAYRIKEYVPLKREQDRFVSQLLFY 344
           EP++YHYLA IV+K+  I    +P+DIR  QK L+K +RIK+ +  KREQD F+S+LLFY
Sbjct: 290 EPSRYHYLAHIVSKS-KITSSTLPKDIRTDQKELFKQFRIKDSLS-KREQDAFLSKLLFY 347

Query: 345 YKTFNLEQRKTIFQDCLWDHERDFGGAIASLRQDNKLISRWQALLEDPIDGTSIEDVLLS 404
           YK    EQR  IF+  L   ++     + +  + + ++S        P +  +IE  LL 
Sbjct: 348 YKRMTPEQRIAIFKRFLEGKKKALKKGLKNQERLSTILSTPSL----PQENYAIETQLLI 403

Query: 405 IENRCCV-----SAIVVADPRYYVVGILEKTVV 432
           +E+  C+     +A +  D +YYV+GI +KTV 
Sbjct: 404 LED--CIDTHGSNAFLQEDVQYYVLGIKDKTVA 434

>TPHA0A05690 Chr1 complement(1289284..1290720) [1437 bp, 478 aa]
           {ON} Anc_3.498 YPR152C
          Length = 478

 Score =  213 bits (541), Expect = 6e-63,   Method: Compositional matrix adjust.
 Identities = 151/478 (31%), Positives = 242/478 (50%), Gaps = 68/478 (14%)

Query: 4   VWQEFKTPTGEKYYYNKTTKQSQWEKPNLKKNSDLEDDAKVSQIER--MPTFALELIDGW 61
           VW+EF  P G+KYYYN  TK++ W++P     S  E +A VSQ ++   P FA  L + W
Sbjct: 5   VWKEFIAPNGQKYYYNLKTKKTTWDEPE----SLFEGNA-VSQGQKDESPVFAFPLFNDW 59

Query: 62  HLIICNDGTKLYFNHDSKIFKSDICQESGGKCGALIESLDKDKLVLLIGIARGYSVQEED 121
           +L+I + G K YFN    I   ++  E   +   L++S+DK KL+LL+G+ARG+   E  
Sbjct: 60  YLVISSLGKKFYFNAVENISVLELHDELNTQ---LLQSIDKQKLILLVGVARGFIYDE-- 114

Query: 122 IDKIFESLNEEIDLFKKNQDGFEREIETR-----EEAGVVKSL--LSESHTGLISGYGSS 174
             +++E + E +D  K       +E++       EE+   +    L  +  G+++ Y SS
Sbjct: 115 YLQVYEEIMENLDFVKNEISNEYKELQVNVAQESEESADKQDPGDLIATDNGIVNDYYSS 174

Query: 175 SXXXXXXXXXX-XXXDHAEQGVNQNVSXXXXXXXXXXXXXXEG----------RERSLFF 223
           S              D AE  + QN                E             +  +F
Sbjct: 175 SDEEVDIREDKFNEIDLAEDNLQQNDGIRTEVIRTETDFNEENLNSVETLDFNASKEKYF 234

Query: 224 QLCDRYKLDKFSTWSLQSKKIENDPEFYKIRDDTVREGLFEEWCEK-------------- 269
           QL ++Y+L+ FSTWS QSK + +DP+FY I D+++RE +FEEWC +              
Sbjct: 235 QLFEKYQLNSFSTWSNQSKVVMDDPDFYLITDNSLREDIFEEWCSRKHSHHNSITSVDKD 294

Query: 270 --------HSAKE-------SDSEDESNVLEPTKYHYLAQIVAKAGNIAPDAIPQDIRKR 314
                   HS+ E       +D  +E   LEPTKYHYL+ I++KA NI+PD I QDI+K 
Sbjct: 295 DQTDSSGAHSSAEDNLDDNVADQNEEEENLEPTKYHYLSHIISKA-NISPDTIFQDIKKD 353

Query: 315 QKALYKAYRIKEYVPLKREQDRFVSQLLFYYKTFNLEQRKTIFQDCLWDHERDFGGAIAS 374
            K L+K ++I +++  KR+ + F S+L+FYYK F+  QR+ IF+  L  ++      +  
Sbjct: 354 NKKLFKQFKINKFITSKRDLESFSSKLIFYYKKFDQSQRRDIFEGILEQNKTAINKHV-- 411

Query: 375 LRQDNKLISRWQALLEDPIDGTSIEDVLLSIENRCCVSAI---VVADPRYYVVGILEK 429
           +   +K++      + +  +    E  LL +E+   +S     +  DP+YY++GI +K
Sbjct: 412 VEHSDKVLETLNTSVNEDFEK---ETQLLKLEDILGLSGSLEKLANDPKYYILGIKDK 466

>KNAG0A07970 Chr1 complement(1270860..1272026) [1167 bp, 388 aa]
           {ON} Anc_3.498 YPR152C
          Length = 388

 Score =  206 bits (523), Expect = 3e-61,   Method: Compositional matrix adjust.
 Identities = 151/449 (33%), Positives = 217/449 (48%), Gaps = 76/449 (16%)

Query: 1   MHGVWQEFKTPTGEKYYYNKTTKQSQWEKPNLKKNSDLEDDAKVSQIERMPTFALELIDG 60
           M  VW+E++ P G+KYY+N TT ++ W+ P  +K           ++   P + + L++ 
Sbjct: 1   MKSVWREYRAPNGKKYYHNTTTGETTWDSPYTRKPQ--------RELSIKPQYVIPLLNA 52

Query: 61  WHLIICNDGTKLYFNHDSKIFKSDICQESGGKCGALIESLDKDKLVLLIGIARGYSVQEE 120
           W+L+ICN+G K Y N D       +          L+  +D++KL+LLIG+ARGY     
Sbjct: 53  WNLVICNNGAKFYLNPDG----DPVLTLDDADSSELLSLVDREKLILLIGVARGYHCTSG 108

Query: 121 DIDKIFESLNEEIDLFK----KNQDGFEREIETREEAGVVKSLLSESHTGLISGYGSSSX 176
           D  K++ S+ EEI   K     ++     E E +EE            + L+SGYGSSS 
Sbjct: 109 D--KVYNSVLEEISFLKDDLANDKAPLAEERELQEEPLETNVQSEPVPSALVSGYGSSSD 166

Query: 177 XXXXXXXXXXXXDHAEQGVNQNVSXXXXXXXXXXXXXXEGRERSLFFQLCDRYKLDKFST 236
                       D                             R  +F L   Y LDK+S 
Sbjct: 167 GSDDEEEVPPDTD---------------------------ANRISYFNLFSEYGLDKYSV 199

Query: 237 WSLQSKKIENDPEFYKIRDDTVREGLFEEWCEKHSAKESDSEDES-----NVLEPTKYHY 291
           WS++S KI NDP F+ I DD  RE +FEEWC   S    DSEDE      + L PTKYHY
Sbjct: 200 WSIESLKISNDPRFHIISDDRQREEIFEEWC--CSGVVDDSEDEGYSSGDDDLSPTKYHY 257

Query: 292 LAQIVAKAGNIAPDAIPQDIRKRQKALYKAYRIKEYVPLKREQDRFVSQLLFYYKTFNLE 351
           L+QIVAK+  + P  I QDI++ + +L+K Y IK+++  KREQ++FVSQLLFYYK F LE
Sbjct: 258 LSQIVAKS-TVTPTTIFQDIKQEKASLFKQYGIKQFLS-KREQEQFVSQLLFYYKKFTLE 315

Query: 352 QRKTIFQDCLWDHERDFGGAIASLRQDNKLISRWQALLEDPIDGTSIEDV---LLSIENR 408
           +R  +F   + +      G + S                 P D  + ED+   LL +E+ 
Sbjct: 316 ERVQLFTKFIAESR---TGTVPSPTS--------------PADSATPEDIETNLLQMESH 358

Query: 409 CCVSAIVVADPRYYVVGILEKTVVWVRWL 437
             +   V+ +  YY + I  K  V  R L
Sbjct: 359 --LPPTVLDNTVYYTLDIKTKQSVLHRML 385

>KLTH0G02398g Chr7 (186986..188374) [1389 bp, 462 aa] {ON} similar
           to uniprot|Q06525 Saccharomyces cerevisiae YPR152C
           Hypothetical ORF
          Length = 462

 Score =  197 bits (500), Expect = 4e-57,   Method: Compositional matrix adjust.
 Identities = 149/473 (31%), Positives = 235/473 (49%), Gaps = 59/473 (12%)

Query: 1   MHGVWQEFKTPTGEKYYYNKTTKQSQWEKPNLKKNSDLEDD----AKVSQIERMPTFALE 56
           M   W+E+KTP G KYYYN  TK+S  +KP+     D E+     +K  +++   TF + 
Sbjct: 6   MPRYWREYKTPDGTKYYYNVNTKRSTTDKPD-----DFEESQSFRSKSRRVDPGVTFVVP 60

Query: 57  LIDGWHLIICNDGTKLYFNHDSKIFKSDICQESGGKCGALIESLDKDKLVLLIGIARGYS 116
           L + W L +C +G + ++   ++  + DI  E   +  +L+   DK+KLVLL+  ARG+ 
Sbjct: 61  LSNDWVLSVCENGQRFFYKSSTEESRWDIEDEESLRILSLV---DKNKLVLLLATARGFD 117

Query: 117 VQEEDIDKIFESLNEEIDLFKKNQ---------DGFEREIETREEAGVVKSLLSESHTGL 167
           + E D+   ++ L E+I+  K+++         +  E    T  E        S++   L
Sbjct: 118 IGERDV---YQELLEDINNLKQSRGVPEGSEVIEAAEEPSHTAGEPSNATEEPSQAVRTL 174

Query: 168 ISGYGSSSXXXXXXXXXXXXXD-HAE-QGVNQNVSXXXXXXXXXXXXXXEGRERSLFFQL 225
           IS Y SS              + H++ +G N ++                   + +F  L
Sbjct: 175 ISAYESSDEDGDSSDEINAEKEVHSDNEGSNSDIEDLNAASHQYNEAT-----KQMFTSL 229

Query: 226 CDRYKLDKFSTWSLQSKKIENDPEFYKIRDDTVREGLFEEWCEKHSAKESDSEDESNV-- 283
            D Y LD +STW++QSKKI ++P FY++  D  R  LFE+WC      E   ED ++   
Sbjct: 230 FDEYDLDPYSTWNMQSKKICDNPLFYQVASDAERRELFEDWCVAKVKLEDVIEDPAHQAV 289

Query: 284 ---------------LEPTKYHYLAQIVAKAGNIAPDAIPQDIRKRQKALYKAYRIKEYV 328
                          LEPT+YHYLA IV+KA  +AP  +P+D+R  QK L+K ++IKE +
Sbjct: 290 SSDGDGDDDDTSTDELEPTRYHYLAHIVSKA-EVAPSTLPRDLRSEQKQLFKQFKIKESL 348

Query: 329 PLKREQDRFVSQLLFYYKTFNLEQRKTIFQDCLWDHERDFGGAIASLRQDNKLISRWQAL 388
             K++QD F+S+LLFYYK    EQR  +    L    +       ++ Q   ++S+ Q L
Sbjct: 349 G-KKQQDEFLSKLLFYYKNMTEEQRLEVLVKFLKTRRKLIMKGFRNIEQLESVLSQ-QDL 406

Query: 389 LEDPIDGTSIEDVLLSIENRCC----VSAIVVADPRYYVVGILEKTVVWVRWL 437
              P  G +IE  LL +E+ C     VS  +  + +YYV+GI +KT     +L
Sbjct: 407 ---PTSGFAIESQLLRLED-CIDIHGVSKALQDEVQYYVLGIKQKTTALKEFL 455

>SAKL0F02552g Chr6 (219380..220816) [1437 bp, 478 aa] {ON} similar
           to uniprot|Q06525 Saccharomyces cerevisiae YPR152C
           Hypothetical ORF
          Length = 478

 Score =  195 bits (496), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 157/494 (31%), Positives = 233/494 (47%), Gaps = 77/494 (15%)

Query: 1   MHGVWQEFKTPTGEKYYYNKTTKQSQWEKPNLKKNSDLEDDAKVSQIERMPTFALELIDG 60
           M   W EF TP+G+KYYYN  TKQS  EKP      D +   K  +++  P + + L  G
Sbjct: 1   MAPNWNEFTTPSGDKYYYNLETKQSTLEKP---AGFDDQKSRKRQKLQHKPKYLVPLDKG 57

Query: 61  WHLIICNDGTKLYFN---HDSKIFKSDICQESGGKCGALIESLDKDKLVLLIGIARGYSV 117
           W L++CN GTK Y N   ++S     D C         L++ LDK+KLVLLIGI+RGY  
Sbjct: 58  WSLVLCNTGTKFYHNKITNESHWTLDDPC------SIELLQQLDKEKLVLLIGISRGYYC 111

Query: 118 QEEDI-DKIFESLNEEIDLFKKNQDGFEREIETREEAGVVKSLLSESH-TGLISGYGSSS 175
              ++ D+I   L    D   + Q G E E+   +E  V      E    GL++GYGSS 
Sbjct: 112 PRRNVYDEIINDLKFLKDKSLEKQ-GVEPEMARADEEQVEYLHQGEEQGLGLVTGYGSSD 170

Query: 176 XX----------XXXXXXXXXXXDHAEQGVNQNVSXXXXXXXXXXXXXXEGRERSLFFQL 225
                                  +  + G  + V               +   ++ F  L
Sbjct: 171 DSEDENIEEEEEKAEVEGEGEEEEEEKAGEQETVDQADIDELNNLSEPPQLDAKNRFTIL 230

Query: 226 CDRYKLDKFSTWSLQSKKIENDPEFYKIRDDTVREGLFEEWCEKHSAKESDSEDESNV-- 283
            D+Y LD +S W  QS+KI  DP+FY + + + R+ LFE+WC +  A   D+  ++N+  
Sbjct: 231 FDKYNLDPYSMWEFQSRKINKDPDFYLVTNGSSRKDLFEQWCTETIANSKDAISDANINE 290

Query: 284 ---------------------------------LEPTKYHYLAQIVAKAGNIAPDAIPQD 310
                                            LEPT++HYL+ I++K+  I    I  D
Sbjct: 291 NDADQRQESEATQKEEQEEKKEVEEDGEPDDENLEPTRFHYLSHIISKSS-IEQTTIFLD 349

Query: 311 IRKRQKALYKAYRIKEYVPLKREQDRFVSQLLFYYKTFNLEQRKTIFQDCLWDHERDFGG 370
           I+K  KAL+K +RIK  +  K++Q+ F S+LLFYYK  +LEQRK IFQ  L         
Sbjct: 350 IKKENKALFKTFRIKSSLK-KKDQEDFASKLLFYYKRMDLEQRKLIFQKLLLSK---LDI 405

Query: 371 AIASLRQDNKL--ISRWQALLEDPIDGTSIEDVLLSIENRCCVS-----AIVVADPRYYV 423
             ++LR   KL  I+  Q+    P D  +IE  LL +E+  C+      + +  +  YY+
Sbjct: 406 IRSNLRNVEKLRDIATEQST---PADSYAIETQLLMMED--CMDIHGKLSFLQGEVHYYI 460

Query: 424 VGILEKTVVWVRWL 437
           +GI +KT+   ++L
Sbjct: 461 LGIKDKTIQLKQFL 474

>CAGL0L08404g Chr12 (924898..926130) [1233 bp, 410 aa] {ON} similar
           to uniprot|Q06525 Saccharomyces cerevisiae YPR152c
          Length = 410

 Score =  177 bits (450), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 127/357 (35%), Positives = 195/357 (54%), Gaps = 23/357 (6%)

Query: 4   VWQEFKTPTGEKYYYNKTTKQSQWEKPNLKKNSDLEDDAKVSQIERMPTFALELIDGWHL 63
           +W+E+  P G KYYYN  T+++ W KP+ ++  +  D     +IE  P  A EL+ GW L
Sbjct: 8   LWKEYTAPNGLKYYYNTKTQETTWTKPDTEQKDETAD----KEIEIKPLVAFELLAGWAL 63

Query: 64  IICNDGTKLYFNHDSKIFKSDICQESGGKCGALIESLDKDKLVLLIGIARGYSVQEEDID 123
           II +DG+K Y+N +   +   I   S  +C  LI+ L+KD+L+LLIGI RGY  +    D
Sbjct: 64  IIFSDGSKKYYNCNESQWSRKI---SHPECLKLIDLLNKDRLLLLIGIIRGYRCRTNAKD 120

Query: 124 KIFESLNEEIDLFKKNQDGFEREIETREEAGVVKSLLSESHTGLISGYGSSSXXXXXXXX 183
            + E + E+ID  +++ +  +   + +  +G   + L  +   L+  Y S          
Sbjct: 121 LVNE-IREDIDFIREDMNAAKTSEDMK--SGSTVNNLENTKNALLGYYSSDDEEEPAK-- 175

Query: 184 XXXXXDHAEQGVNQNVSXXXXXXXXXXXXXXEGRERSLFFQLCDRYKLDKFSTWSLQSKK 243
                   EQ V +                     +  +F L  +++L+K+STW ++S+K
Sbjct: 176 ------RDEQAVVEEPDETNTLEVPDITQELGQDIKDSYFALFAKHELNKYSTWRIESEK 229

Query: 244 IENDPEFYKIRDDTVREGLFEEWCEKHS--AKESDSEDESNVLEPTKYHYLAQIVAKAGN 301
           +  DPEFYKI DD VRE +FEEWC   S  + E   +   +  EPTKYHYL+Q+VA   +
Sbjct: 230 VSQDPEFYKIIDDAVRENIFEEWCNAGSVESNEESGDPGDDQFEPTKYHYLSQLVANY-D 288

Query: 302 IAPDAIPQDIRKRQKALYKAYRIKEYVPLKREQDRFVSQLLFYYKTFNLEQRKTIFQ 358
           + PD IP+DI K +K + K YRIK+Y   K EQ +F+S++L +YK  +LE RK +FQ
Sbjct: 289 LKPDTIPEDIIKDKKLI-KKYRIKDYT-TKSEQRQFLSKMLAWYKHMSLEDRKQMFQ 343

>KLLA0E03939g Chr5 (357695..359002) [1308 bp, 435 aa] {ON} similar
           to uniprot|Q06525 Saccharomyces cerevisiae YPR152C
           Hypothetical ORF
          Length = 435

 Score =  174 bits (442), Expect = 6e-49,   Method: Compositional matrix adjust.
 Identities = 138/446 (30%), Positives = 222/446 (49%), Gaps = 49/446 (10%)

Query: 5   WQEFKTPTGEKYYYNKTTKQSQWEKPNLKKNSDLEDDAKVSQIERMPTFALELIDGWHLI 64
           W+ FK P+G  YY+N  +K S  EKP    +      A + ++ R+P F L L + W+L+
Sbjct: 4   WKRFKDPSGNFYYFNTRSKVSTKEKPKEFGSQQ----AGMKEL-RVPVFCLPLRNYWNLV 58

Query: 65  ICNDGTKLYFNHDSKIFKSDICQESGGKCGALIESLDKDKLVLLIGIARGYSVQEE-DI- 122
           IC DG+K + N +S + +  +  +   +  AL++ +D   L LLIG+ARG++++ + D+ 
Sbjct: 59  ICKDGSKFFHNDESNVSQFKLADD---ESKALLDKVDTSLLALLIGVARGFNLRNDRDVY 115

Query: 123 DKIFESLNEEIDLFKKNQDGFEREIETREEAGVVKSLLSESHTGLISGYGSSSXXXXXXX 182
            +I + L  ++D   K Q+    E      + V     SES   L+SGY SSS       
Sbjct: 116 GEIRDVLQAKLDSNDKEQNDITEERPQVTNSNVDTEDKSESSNILVSGYSSSSDDSGEES 175

Query: 183 XXXXXXDHAEQGVNQNVSXXXXXXXXXXXXXXEGRERSLFFQLCDRYKLDKFSTWSLQSK 242
                 D +   V +  +                   S F QL +  +LD +STWS+Q+K
Sbjct: 176 EVEEKNDPSSIDVKEEDTLPSLNNTEI---------ESKFIQLLNEIQLDPYSTWSIQAK 226

Query: 243 KIENDPEFYKIRDDTVREGLFEEWCEKH--------------SAKESDSEDESNVLEPTK 288
           +I +DP +Y I  +  R+ LF+ WC +               SA+ SD ED    LEPTK
Sbjct: 227 RIMHDPRYYLITSNDKRDELFQTWCSQQLNNSNNDNENNAQDSAENSDEEDSDVTLEPTK 286

Query: 289 YHYLAQIVAKAGNIAPDAIPQDIRKRQKALYKAYRIKEYVPLKREQDRFVSQLLFYYKTF 348
           YHYLA I++KA NI P+ +  +I+K  K+L+K   I + +  K+EQ++F S+++ YYK  
Sbjct: 287 YHYLAHIISKA-NITPETLFSNIKKENKSLFKELEINKTLT-KKEQEQFASKVIAYYKRM 344

Query: 349 NLEQRKTIFQDCLWDHERDFGGAIASLRQDNKLISRWQALLEDPIDGTSIEDVLLSIENR 408
           +  QR  +F+  + +  R F      L Q          L E P D   +E  LL +EN 
Sbjct: 345 DNLQRTELFKKMMKNKLR-FPPISEKLSQ--------LMLEETPSDSFKLETQLLQLENA 395

Query: 409 CCV-----SAIVVADPRYYVVGILEK 429
             +     ++ +  +  YY++GI +K
Sbjct: 396 LLILDNLQNSYMQNEIMYYILGIKDK 421

>ZYRO0D09768g Chr4 (826977..828359) [1383 bp, 460 aa] {ON} similar
           to uniprot|Q06525 Saccharomyces cerevisiae YPR152C
          Length = 460

 Score =  130 bits (328), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 83/227 (36%), Positives = 126/227 (55%), Gaps = 18/227 (7%)

Query: 218 ERSLFFQLCDRYKLDKFSTWSLQSKKIENDPEFYKIRDDTVREGLFEEWCEKH-SAKESD 276
           ++   + L  RY L+ +S W  + KKI +DP+F ++ DD+VRE +FEEWC    S  + +
Sbjct: 229 DKKALWDLFTRYDLNPYSAWPFEMKKIRDDPDFLRVLDDSVREDVFEEWCAHAISGDQVE 288

Query: 277 SEDE--------SNVLEPTKYHYLAQIVAKAGNIAPDAIPQDIRKRQKALYKAYRIKEYV 328
             DE           LEPTKYHYLA IV+K+ NI P  I  DI+   K+ +K Y IK+++
Sbjct: 289 PVDEIKSEDFDEEEDLEPTKYHYLAHIVSKS-NITPTTIFMDIKNDNKSSFKKYNIKDFL 347

Query: 329 PLKREQDRFVSQLLFYYKTFNLEQRKTIFQDCLWDHERDFGGAI-ASLRQDNKLISRWQA 387
             K++Q+ FVS+LLFYYK   LE+RK +F   L    +  G  I  +L  D   +    A
Sbjct: 348 TSKKDQESFVSKLLFYYKRMKLEERKEVFVQLL----KQNGKTIEENLSNDMDKVRHCLA 403

Query: 388 LLEDPIDGTSIEDVLLSIENRCCV---SAIVVADPRYYVVGILEKTV 431
              D  D  ++E  L  +E    +    + +V +P+YY++GI +K +
Sbjct: 404 QEIDSNDPYAVETKLFKMEKFMGLWGNLSDLVEEPKYYILGIRDKML 450

>Ecym_1231 Chr1 (476386..477375) [990 bp, 329 aa] {ON} similar to
           Ashbya gossypii AFR317C
          Length = 329

 Score =  127 bits (318), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 83/242 (34%), Positives = 124/242 (51%), Gaps = 34/242 (14%)

Query: 218 ERSLFFQLCDRYKLDKFSTWSLQSKKIENDPEFYKIRDDTVREGLFEEWCEKHSAKESDS 277
           E + F  L DRY+L+ +S+WSLQS+K+++DPEFY + DD  R  LFE+WC    AK    
Sbjct: 86  EHARFIALFDRYELNPYSSWSLQSRKVQSDPEFYTLLDDETRRELFEDWCTMKLAKAGGD 145

Query: 278 EDES----------------NVLEPTKYHYLAQIVAKAGNIAPDAIPQDIRKRQKALYKA 321
              S                  LEP K+HYL+ IV+K+  I P  +  D++   K L+K 
Sbjct: 146 SSASLTGEEEEEEDDDDDEDESLEPVKFHYLSHIVSKS-TIKPQTVFSDVKTENKLLFKN 204

Query: 322 YRIKEYVPLKREQDRFVSQLLFYYKTFNLEQRKTIFQDCL---WDHERDFGGAIASLRQD 378
           + I E  P K+EQ +FVS LLFYYK  + ++R  IF++ L     HE +    +  +   
Sbjct: 205 FNIDETHP-KQEQRQFVSSLLFYYKKKSSKERVEIFKNLLDTKVKHEINNEDQLQQILDQ 263

Query: 379 NKLISRWQALLEDPIDGTSIEDVLLSIENRCCVS---AIVVADPRYYVVGILEKTVVWVR 435
             L          P D   IE  L+++E    +      +  D +YYVVG+ +KT++   
Sbjct: 264 ENL----------PNDAYEIESQLITMEKYIGMHDSLRQLQEDIKYYVVGVRDKTILIKE 313

Query: 436 WL 437
           +L
Sbjct: 314 FL 315

 Score = 31.2 bits (69), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 12/27 (44%), Positives = 16/27 (59%)

Query: 4  VWQEFKTPTGEKYYYNKTTKQSQWEKP 30
          VW+  KT  GE YYY   + +  WE+P
Sbjct: 2  VWKRAKTGEGEFYYYETVSGEKTWERP 28

>AFR317C Chr6 complement(1011817..1012803) [987 bp, 328 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPR152C
          Length = 328

 Score =  114 bits (284), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 73/222 (32%), Positives = 115/222 (51%), Gaps = 19/222 (8%)

Query: 222 FFQLCDRYKLDKFSTWSLQSKKIENDPEFYKIRDDTVREGLFEEWCEKHSAKESDS---- 277
            + L +R +LD +S W  +S KI  D  FY + DD  R+ LFE+WC +  A E ++    
Sbjct: 100 LWALFERAELDPYSAWVFESAKISGDAAFYAVGDDEARQELFEQWCARKIADEGNAVLED 159

Query: 278 --EDESNVLEPTKYHYLAQIVAKAGNIAPDAIPQDIRKRQKALYKAYRIKEYVPLKREQD 335
             E E   L PT++HYLA IV+K+  + PD +  D+R+  K L+    +   +  K+EQ 
Sbjct: 160 GEEAEEVELVPTRFHYLAHIVSKS-TVRPDTVYSDVRREHKELFDQLEVD--ILDKKEQR 216

Query: 336 RFVSQLLFYYKTFNLEQRKTIFQDCLWDHERDFGGAIASLRQDNKLISRWQALLEDPIDG 395
           RFV+ LLFYYK  +   R  +F+  L  H        A+  +++  +       E P D 
Sbjct: 217 RFVAGLLFYYKKMDAALRGEVFRKLLHAHR---AAITAAFLENDAQLRELLEYDELPQDS 273

Query: 396 TSIEDVLLSIENRCCVS-----AIVVADPRYYVVGILEKTVV 432
            SIE  L  +E   C+      + + ++ +YYV+G+ +K VV
Sbjct: 274 YSIETDLFIVEK--CIGLHGALSKLQSEIKYYVLGVKDKLVV 313

 Score = 37.7 bits (86), Expect = 0.051,   Method: Compositional matrix adjust.
 Identities = 15/37 (40%), Positives = 24/37 (64%)

Query: 4  VWQEFKTPTGEKYYYNKTTKQSQWEKPNLKKNSDLED 40
          VW+  K+  G+ YYYN  T ++ W+KP+  + SD E+
Sbjct: 2  VWKRAKSEDGKAYYYNTETNETTWDKPDAVEPSDGEE 38

>NCAS0F03580 Chr6 complement(712074..713315) [1242 bp, 413 aa] {ON}
           Anc_3.498 YPR152C
          Length = 413

 Score =  115 bits (287), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 77/216 (35%), Positives = 114/216 (52%), Gaps = 18/216 (8%)

Query: 222 FFQLCDRYKLDKFSTWSLQSKKIENDPEFYKIRDDTVREGLFEEWCEKHSAK--ESDSED 279
            F L + + LD +STWSLQS+KI N  +++ + DDT RE +FE+WC    A+  E +SE 
Sbjct: 190 LFHLFESFNLDVYSTWSLQSRKISNQADYFLVHDDTQREEMFEDWCAMKVAQLPEDESEA 249

Query: 280 ESNVLEPTKYHYLAQIVAKAGN-IAPDAIPQDIRKRQKALYKAYRIKEYVPLKREQDRFV 338
           E +  EPTKYHYL++I+ +  + I  D +  DI +  + L+K Y IK+++P +RE    V
Sbjct: 250 EDDDYEPTKYHYLSEIMYQLRDEINADTVADDILRGHRPLFKQYHIKQFIPDRRELRAVV 309

Query: 339 SQLLFYYKTFNLEQRKTIFQDCLWDHERDFGGAIASLRQDNKLISRWQALLEDPIDGTSI 398
           S+LLFYYK F   +R+ +F D +        G +     DN             + G  +
Sbjct: 310 SRLLFYYKRFTARERRAVFHDYVSQRY----GLLPGEDVDNDDAG--------SLSGEQM 357

Query: 399 EDVLLSIENRCCVSAIVVADP---RYYVVGILEKTV 431
           E  +L  E           DP    YYVVG+ EK +
Sbjct: 358 ETRILQWERDRQTEGNSSWDPTALEYYVVGLREKYI 393

 Score = 92.4 bits (228), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 46/136 (33%), Positives = 80/136 (58%), Gaps = 8/136 (5%)

Query: 4   VWQEFKTPTGEKYYYNKTTKQSQWEKPNLKKNSDLEDDAKVSQIERMPTFALELIDGWHL 63
           +W+E+K P G KYYYN  TK++ W KP  ++  +  D+ +V        FA EL DGW+L
Sbjct: 6   LWREYKAPNGRKYYYNVKTKETTWTKPVEEEKPEPGDNKEVK-------FAFELFDGWYL 58

Query: 64  IICNDGTKLYFNH-DSKIFKSDICQESGGKCGALIESLDKDKLVLLIGIARGYSVQEEDI 122
           +I  DG KL+++  + K +     ++ G     +IE +DK+K++LLIG+ RG+      I
Sbjct: 59  LIRGDGGKLFYDSVNEKSYLETRTKKMGENNEKIIELMDKEKIILLIGMTRGFRDDRYHI 118

Query: 123 DKIFESLNEEIDLFKK 138
             +++ + ++I+  K+
Sbjct: 119 KGVYDDIAQDINFLKQ 134

>NDAI0B05900 Chr2 complement(1425195..1426763) [1569 bp, 522 aa]
           {ON} Anc_3.498 YPR152C
          Length = 522

 Score =  115 bits (289), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 83/265 (31%), Positives = 134/265 (50%), Gaps = 43/265 (16%)

Query: 219 RSLFFQLCDRYKLDKFSTWSLQSKKIENDPE-FYKIRDDTVREGLFEEWCEK--HSA--- 272
           +  FF+L D+ KLD +STWS+QS++I   P  FY I +D+ RE +FE+WC    HS    
Sbjct: 256 KQAFFELLDKNKLDMYSTWSVQSRRIIERPTIFYSISNDSEREEIFEDWCRNRVHSTGLY 315

Query: 273 ----KESDSED-------------------ESNVLEPTKYHYLAQIVAKA-GNIAPDAIP 308
               KE++  D                   + + LEPTKYHYL++++ K   +I   +I 
Sbjct: 316 SSNVKENNDGDTLVRGSYYEEEDKDDDDDDDDDDLEPTKYHYLSELIFKLRDSINERSIF 375

Query: 309 QDIRKRQKALYKAYRIKEYVPLKREQDRFVSQLLFYYKTFNLEQRKTIFQDCLWDHERDF 368
           QDI+++ K+L+K YRIK+++P K+E ++ VS LLFYYK  + ++R   FQ+ +  H   +
Sbjct: 376 QDIKRQGKSLFKDYRIKDWIPDKKELEKTVSLLLFYYKKLSEQERCDKFQEYVTKH---Y 432

Query: 369 GGAIASLRQD-NKLISRWQALLEDPIDGTSIEDVLLSIENRC---------CVSAIVVAD 418
           G  I    ++ NK++    +   +      IE  +L IEN             +A+    
Sbjct: 433 GEKIKLHHEELNKILEPSSSADAEAEADVDIEKEILQIENVILRSGDDHVPVTAAVDTPG 492

Query: 419 PRYYVVGILEKTVVWVRWLAAEGAP 443
             YY++G+  K       +     P
Sbjct: 493 LEYYIIGLRAKHSALATLIHRTAQP 517

 Score = 88.2 bits (217), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 53/142 (37%), Positives = 81/142 (57%), Gaps = 6/142 (4%)

Query: 4   VWQEFKTPTGEKYYYNKTTKQSQWEKP--NLKKNSDLEDDAKVSQI--ERMPTFALELID 59
           +W+E+KTP G+KYYYN  TKQS WEKP    K N +  +   + Q   E    FA +L++
Sbjct: 11  IWKEYKTPNGKKYYYNIETKQSTWEKPFSFYKTNKNNSNTKALGQTHHEIENKFAFKLLN 70

Query: 60  GWHLIICNDGTKLYFNHDSK--IFKSDICQESGGKCGALIESLDKDKLVLLIGIARGYSV 117
            W+LI+ +DG+K Y+N  S   + K    +E       L++ LDK+ L+ LIG+ RGY+ 
Sbjct: 71  EWYLILRSDGSKFYYNARSNRSVLKLVEDKEDEKLSFDLMKYLDKNNLIKLIGLIRGYND 130

Query: 118 QEEDIDKIFESLNEEIDLFKKN 139
              DI  ++E +   I   K++
Sbjct: 131 PSIDIKGLYEEIVANIGFLKQD 152

>TBLA0D02930 Chr4 (719542..720372) [831 bp, 276 aa] {ON} Anc_3.498
           YPR152C
          Length = 276

 Score = 79.3 bits (194), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 52/148 (35%), Positives = 85/148 (57%), Gaps = 8/148 (5%)

Query: 216 GRERSLFFQLCDRYKLDKFSTWSLQSKKIENDPEFYKIRDDTVREGLFEEWC--EKHSAK 273
           G + + FF+L DR  +D +S W L++KKI +DP FY I  D  RE LFE+WC  + HS +
Sbjct: 69  GNKETQFFELLDRSNIDCYSCWRLEAKKISDDPIFYNIPTDVEREKLFEQWCYGKLHSRE 128

Query: 274 ESDSEDESNVLEPTKYHYLAQIVAKAGNIAPDAIPQDIRKRQKALYKAYRIKEYVPLKRE 333
           E  ++ +  +  P  YH LA+++    +I  + I +DIRK  K + +  +I E +  K E
Sbjct: 129 EETTQPQLALALP--YHDLAEMIC-CFDIQSNTIYKDIRKANKKMVR--QIDEKIS-KNE 182

Query: 334 QDRFVSQLLFYYKTFNLEQRKTIFQDCL 361
           Q++F ++LL   K  +    + +F+  L
Sbjct: 183 QEKFGTKLLGILKYHDDASCQGLFEQVL 210

>TBLA0C00930 Chr3 complement(185527..187503) [1977 bp, 658 aa] {ON}
           Anc_2.649 YKL012W
          Length = 658

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 19/40 (47%), Positives = 28/40 (70%), Gaps = 1/40 (2%)

Query: 1   MHGVWQEFKTPTGEKYYYNKTTKQSQWEKPNLKKNSDLED 40
           +HG W+  +T  G  YYYN  TK+S+W+ PNL KN+ L++
Sbjct: 64  LHG-WRTAQTKEGRIYYYNVDTKESRWDPPNLPKNTSLKN 102

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 27/85 (31%), Positives = 38/85 (44%), Gaps = 6/85 (7%)

Query: 1  MHGVWQEFKTPTGEKYYYNKTTKQSQWEKPN----LKKNSDLEDDAKVSQIERMPTFALE 56
          M   W++ K P G  YYYN  TK+S+W+ P       K+   E    V + E      LE
Sbjct: 1  MENDWKQAKDPKGRVYYYNLKTKESRWDLPKSSTGTNKSISTEKQVSVKKNELKNKIDLE 60

Query: 57 L--IDGWHLIICNDGTKLYFNHDSK 79
             + GW      +G   Y+N D+K
Sbjct: 61 FLKLHGWRTAQTKEGRIYYYNVDTK 85

>NCAS0C05110 Chr3 (1042307..1044121) [1815 bp, 604 aa] {ON}
          Anc_2.649
          Length = 604

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 22/71 (30%), Positives = 35/71 (49%), Gaps = 9/71 (12%)

Query: 5  WQEFKTPTGEKYYYNKTTKQSQWEKPNLKKNSDLEDDAKVSQIERMPTFALELIDGWHLI 64
          W+  K   G  YYYN  TK+S+W++P   + S   DD+    +E++         GW   
Sbjct: 11 WRSAKDANGRTYYYNINTKESRWDRPASMEGSTNNDDSDKMLLEQI---------GWKSN 61

Query: 65 ICNDGTKLYFN 75
          + N+G   Y+N
Sbjct: 62 VTNEGKVYYYN 72

>CAGL0L05368g Chr12 complement(593547..595319) [1773 bp, 590 aa]
          {ON} similar to uniprot|P33203 Saccharomyces cerevisiae
          YKL012w PRP40 splicing factor
          Length = 590

 Score = 40.8 bits (94), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 24/79 (30%), Positives = 37/79 (46%), Gaps = 15/79 (18%)

Query: 1  MHGVWQEFKTPTGEKYYYNKTTKQSQWEKPNLKKNSDLEDDAKVSQIERMPTFALELIDG 60
          M G W++     G+ YYYN  TK+S+W+KP       +ED   + Q  R          G
Sbjct: 1  MAGQWKKATDSNGKVYYYNTVTKESRWDKP-------VEDTTDLKQKLRDA--------G 45

Query: 61 WHLIICNDGTKLYFNHDSK 79
          W++    +G   Y+N  +K
Sbjct: 46 WNVAKTKEGKVYYYNVKTK 64

 Score = 33.9 bits (76), Expect = 0.92,   Method: Compositional matrix adjust.
 Identities = 18/45 (40%), Positives = 26/45 (57%), Gaps = 2/45 (4%)

Query: 5  WQEFKTPTGEKYYYNKTTKQSQWEKPNLKKNSDLEDDAKVSQIER 49
          W   KT  G+ YYYN  TK+S+W+ P  +K +  E   K  QI++
Sbjct: 46 WNVAKTKEGKVYYYNVKTKESRWDNPLAEKAT--EKKTKTGQIKK 88

>KLLA0E18239g Chr5 (1627093..1628808) [1716 bp, 571 aa] {ON}
          similar to uniprot|P33203 Saccharomyces cerevisiae
          YKL012W PRP40 U1 snRNP protein involved in splicing
          interacts with the branchpoint-binding protein during
          the formation of the second commitment complex
          Length = 571

 Score = 40.8 bits (94), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 32/105 (30%), Positives = 42/105 (40%), Gaps = 32/105 (30%)

Query: 5  WQEFKTPTGEKYYYNKTTKQSQWEKPNLKKNSDLEDDAKVSQIERMPTFALELID-GWHL 63
          WQE K P G  YYYN T  Q+ WEKP                 E    F  +L+  GW  
Sbjct: 3  WQETKDPQGRVYYYNDTG-QTTWEKPE----------------ELFTEFERKLLKYGWKT 45

Query: 64 IICNDGTKLYFNHDS-------KIFKSD-------ICQESGGKCG 94
           +  DG   Y+  D+        +F++D       I  +S GK G
Sbjct: 46 ALAEDGRVYYYKSDTGETTWNVPVFENDDNRDERSIPTKSSGKAG 90

>KNAG0M02470 Chr13 (458978..460798) [1821 bp, 606 aa] {ON}
          Anc_2.649 YKL012W
          Length = 606

 Score = 40.4 bits (93), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 14/28 (50%), Positives = 21/28 (75%)

Query: 3  GVWQEFKTPTGEKYYYNKTTKQSQWEKP 30
          G W++ + P G  YY+N+ T++SQWEKP
Sbjct: 2  GKWEQARDPQGRVYYFNRETRKSQWEKP 29

 Score = 31.6 bits (70), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 12/30 (40%), Positives = 17/30 (56%)

Query: 1  MHGVWQEFKTPTGEKYYYNKTTKQSQWEKP 30
          + G W+  KT  G+ Y+YN  T +S W  P
Sbjct: 62 VKGTWKSAKTKDGKVYFYNSATGKSSWTLP 91

>KAFR0A00230 Chr1 (46128..47798) [1671 bp, 556 aa] {ON} Anc_2.649
          YKL012W
          Length = 556

 Score = 38.9 bits (89), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 16/28 (57%), Positives = 18/28 (64%)

Query: 3  GVWQEFKTPTGEKYYYNKTTKQSQWEKP 30
          G W+  K P G  YYYN  TK+S WEKP
Sbjct: 2  GDWKAAKDPKGRIYYYNTVTKKSTWEKP 29

 Score = 30.8 bits (68), Expect = 9.0,   Method: Compositional matrix adjust.
 Identities = 12/26 (46%), Positives = 17/26 (65%)

Query: 5  WQEFKTPTGEKYYYNKTTKQSQWEKP 30
          W+  KT  G+ YYYN  T++S+W  P
Sbjct: 43 WKTGKTKDGKTYYYNVKTRESRWTLP 68

>YKL012W Chr11 (418310..420061) [1752 bp, 583 aa] {ON}  PRP40U1
          snRNP protein involved in splicing, interacts with the
          branchpoint-binding protein during the formation of the
          second commitment complex
          Length = 583

 Score = 38.5 bits (88), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 25/73 (34%), Positives = 32/73 (43%), Gaps = 15/73 (20%)

Query: 3  GVWQEFKTPTGEKYYYNKTTKQSQWEKPNLKKNSDLEDDAKVSQIERMPTFALELIDGWH 62
           +W+E K  +G  YYYN  TK+S WEKP             +SQ E      L   +GW 
Sbjct: 2  SIWKEAKDASGRIYYYNTLTKKSTWEKPK----------ELISQEE-----LLLRENGWK 46

Query: 63 LIICNDGTKLYFN 75
               DG   Y+N
Sbjct: 47 AAKTADGKVYYYN 59

 Score = 32.7 bits (73), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 13/30 (43%), Positives = 19/30 (63%)

Query: 5  WQEFKTPTGEKYYYNKTTKQSQWEKPNLKK 34
          W+  KT  G+ YYYN TT+++ W  P  +K
Sbjct: 45 WKAAKTADGKVYYYNPTTRETSWTIPAFEK 74

>NDAI0G04600 Chr7 complement(1094693..1096636) [1944 bp, 647 aa]
          {ON} Anc_2.649 YKL012W
          Length = 647

 Score = 38.5 bits (88), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 26/84 (30%), Positives = 41/84 (48%), Gaps = 14/84 (16%)

Query: 5  WQEFKTPTGEKYYYNKTTKQSQWEKP------------NLKKNSDLEDDAKVS-QIERMP 51
          W+  K   G  YYYN  TK+S+WEKP             ++ ++   ++AK + +IE+  
Sbjct: 14 WRSAKDAKGRIYYYNLITKESKWEKPKELLPITAATSTTVRTSTISTNNAKTNIKIEKDD 73

Query: 52 TFALELIDGWHLIICNDGTKLYFN 75
             +E I GW   +  DG   Y+N
Sbjct: 74 ASIMENI-GWKSNVTADGKTYYYN 96

>TDEL0B07440 Chr2 complement(1302549..1304261) [1713 bp, 570 aa]
          {ON} Anc_2.649 YKL012W
          Length = 570

 Score = 38.1 bits (87), Expect = 0.046,   Method: Compositional matrix adjust.
 Identities = 16/29 (55%), Positives = 21/29 (72%), Gaps = 1/29 (3%)

Query: 2  HGVWQEFKTPTGEKYYYNKTTKQSQWEKP 30
          HG W+  +T  G+ YYYN  TK+S+WEKP
Sbjct: 46 HG-WKSSRTAEGKIYYYNSITKESRWEKP 73

>Smik_11.243 Chr11 (405300..407039) [1740 bp, 579 aa] {ON} YKL012W
          (REAL)
          Length = 579

 Score = 38.1 bits (87), Expect = 0.048,   Method: Compositional matrix adjust.
 Identities = 15/28 (53%), Positives = 18/28 (64%)

Query: 3  GVWQEFKTPTGEKYYYNKTTKQSQWEKP 30
           +W+E K   G  YYYN  TK+S WEKP
Sbjct: 2  SIWKEAKDANGRVYYYNSLTKKSTWEKP 29

>Kpol_1073.4 s1073 (4004..5596) [1593 bp, 530 aa] {ON}
          (4004..5596) [1593 nt, 531 aa]
          Length = 530

 Score = 37.7 bits (86), Expect = 0.058,   Method: Compositional matrix adjust.
 Identities = 15/30 (50%), Positives = 19/30 (63%)

Query: 1  MHGVWQEFKTPTGEKYYYNKTTKQSQWEKP 30
          M  +W+E K   G  YYYN  T +S+WEKP
Sbjct: 1  MSDIWKEAKDNNGRVYYYNSKTGESRWEKP 30

>ZYRO0E00682g Chr5 (49836..51548) [1713 bp, 570 aa] {ON} similar
          to uniprot|P33203 Saccharomyces cerevisiae YKL012W
          PRP40 U1 snRNP protein involved in splicing interacts
          with the branchpoint-binding protein during the
          formation of the second commitment complex
          Length = 570

 Score = 36.2 bits (82), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 17/31 (54%), Positives = 21/31 (67%), Gaps = 1/31 (3%)

Query: 2  HGVWQEFKTPTGEKYYYNKTTKQSQWEKPNL 32
          HG W+  KT  G+ YYYN  TK S+WE P+L
Sbjct: 46 HG-WKSSKTSDGKLYYYNAQTKTSRWELPDL 75

 Score = 35.4 bits (80), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 25/80 (31%), Positives = 33/80 (41%), Gaps = 21/80 (26%)

Query: 3  GVWQEFKTPTGEKYYYNKTTKQSQWEKPNLKKNSDLEDDAKVSQIERMPTFALELI---D 59
           +W+E K  +G  YYYN  T +S+WEKP                  R      ELI    
Sbjct: 5  SLWKEAKDTSGRIYYYNAKTGESKWEKP------------------RELLSEQELILAKH 46

Query: 60 GWHLIICNDGTKLYFNHDSK 79
          GW     +DG   Y+N  +K
Sbjct: 47 GWKSSKTSDGKLYYYNAQTK 66

>Skud_11.217 Chr11 (399225..400976) [1752 bp, 583 aa] {ON} YKL012W
          (REAL)
          Length = 583

 Score = 36.2 bits (82), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 15/26 (57%), Positives = 17/26 (65%)

Query: 5  WQEFKTPTGEKYYYNKTTKQSQWEKP 30
          W+E K   G  YYYN  TK+S WEKP
Sbjct: 4  WKEAKDANGRVYYYNTLTKKSTWEKP 29

 Score = 33.1 bits (74), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 17/39 (43%), Positives = 24/39 (61%), Gaps = 2/39 (5%)

Query: 5  WQEFKTPTGEKYYYNKTTKQSQWEKPNLKKNSDLEDDAK 43
          W+  KT  G+ YYYN TT+++ W  P  +K +  ED AK
Sbjct: 45 WRAAKTAEGKVYYYNTTTRKTSWAIPIFEKKT--EDIAK 81

 Score = 30.8 bits (68), Expect = 7.7,   Method: Compositional matrix adjust.
 Identities = 21/65 (32%), Positives = 35/65 (53%), Gaps = 1/65 (1%)

Query: 233 KFSTWSLQSKKIENDPEFYKIRD-DTVREGLFEEWCEKHSAKESDSEDESNVLEPTKYHY 291
           K S W L SK++    E+  + D DT+R+ +FE +  + S   S+S      L P+K  +
Sbjct: 515 KPSNWDLASKELSEALEYKALGDNDTIRKQIFEGFKPESSPLTSESATADIPLTPSKKRH 574

Query: 292 LAQIV 296
           L+Q +
Sbjct: 575 LSQAI 579

>TPHA0L02020 Chr12 complement(419703..421454) [1752 bp, 583 aa]
          {ON} Anc_2.649 YKL012W
          Length = 583

 Score = 36.2 bits (82), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 22/73 (30%), Positives = 30/73 (41%), Gaps = 17/73 (23%)

Query: 3  GVWQEFKTPTGEKYYYNKTTKQSQWEKPNLKKNSDLEDDAKVSQIERMPTFALELIDGWH 62
           +W+  K   G+ YYYN  T  SQWEKP +            + IE +         GW 
Sbjct: 5  SLWRTAKDSNGKVYYYNTKTGVSQWEKPGVS-----------ADIETLKQH------GWG 47

Query: 63 LIICNDGTKLYFN 75
          +    DG   Y+N
Sbjct: 48 VARTKDGKLYYYN 60

 Score = 32.3 bits (72), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 14/29 (48%), Positives = 19/29 (65%), Gaps = 1/29 (3%)

Query: 2  HGVWQEFKTPTGEKYYYNKTTKQSQWEKP 30
          HG W   +T  G+ YYYN +T +S+WE P
Sbjct: 44 HG-WGVARTKDGKLYYYNSSTGESRWEAP 71

>Suva_11.216 Chr11 (402394..404151) [1758 bp, 585 aa] {ON} YKL012W
          (REAL)
          Length = 585

 Score = 35.8 bits (81), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 25/75 (33%), Positives = 34/75 (45%), Gaps = 15/75 (20%)

Query: 5  WQEFKTPTGEKYYYNKTTKQSQWEKPNLKKNSDLEDDAKVSQIERMPTFALELIDGWHLI 64
          W+E K   G  YYYN  TK+S WEKP          +  VSQ E+     L   +GW   
Sbjct: 4  WKEAKDANGRVYYYNTLTKKSIWEKP----------EELVSQQEQ-----LLQENGWKAA 48

Query: 65 ICNDGTKLYFNHDSK 79
             +G   Y+N  ++
Sbjct: 49 KTAEGKIYYYNPSTR 63

 Score = 32.3 bits (72), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 13/32 (40%), Positives = 19/32 (59%)

Query: 5  WQEFKTPTGEKYYYNKTTKQSQWEKPNLKKNS 36
          W+  KT  G+ YYYN +T+Q+ W  P   K +
Sbjct: 45 WKAAKTAEGKIYYYNPSTRQTSWTIPAFDKKT 76

>ACL120W Chr3 (135420..135911) [492 bp, 163 aa] {ON} Syntenic
          homolog of Saccharomyces cerevisiae YJR017C (ESS1)
          Length = 163

 Score = 33.5 bits (75), Expect = 0.61,   Method: Compositional matrix adjust.
 Identities = 21/75 (28%), Positives = 34/75 (45%), Gaps = 10/75 (13%)

Query: 3  GVWQ-EFKTPTGEKYYYNKTTKQSQWEKPNLKKNSDLEDDAKVSQIERMPTFALELIDGW 61
          G W  +F      +YYYN  TK+SQWE P     +D + +     +   P      +   
Sbjct: 9  GPWAVKFSKSRKREYYYNPETKESQWEVP-----ADTDSEQLARHLAEHPV----QVRCL 59

Query: 62 HLIICNDGTKLYFNH 76
          HL+I + G++   +H
Sbjct: 60 HLLIKHAGSRRPASH 74

>TDEL0F00990 Chr6 complement(173710..176079) [2370 bp, 789 aa] {ON}
           Anc_8.134 YER125W
          Length = 789

 Score = 34.3 bits (77), Expect = 0.72,   Method: Compositional matrix adjust.
 Identities = 18/76 (23%), Positives = 35/76 (46%), Gaps = 2/76 (2%)

Query: 5   WQEFKTPTGEKYYYNKTTKQSQWEKPNLKKNSDLEDDAKVSQIERMPTFAL-ELIDGWHL 63
           W++  TP G  Y+ +  T+ + W  P  ++       A  + I++ P   L  L  GW +
Sbjct: 317 WEQRFTPEGRAYFVDHNTRTTTWVDPRRQQYIRTYGPASTT-IQQQPVSQLGPLPSGWEM 375

Query: 64  IICNDGTKLYFNHDSK 79
            + N     + +H++K
Sbjct: 376 RLTNTARVYFVDHNTK 391

>Kwal_47.17302 s47 complement(342098..344461) [2364 bp, 787 aa] {ON}
           YER125W (RSP5) - Rsp5p encodes a hect (homologous to
           E6-AP C terminus) and encodes a ubiquitin-protein ligase
           (E3 enzyme) [contig 210] FULL
          Length = 787

 Score = 34.3 bits (77), Expect = 0.74,   Method: Compositional matrix adjust.
 Identities = 18/76 (23%), Positives = 35/76 (46%), Gaps = 2/76 (2%)

Query: 5   WQEFKTPTGEKYYYNKTTKQSQWEKPNLKKNSDLEDDAKVSQIERMPTFAL-ELIDGWHL 63
           W++  TP G  Y+ +  T+ + W  P  ++       A  + I++ P   L  L  GW +
Sbjct: 315 WEQRFTPEGRAYFVDHNTRTTTWVDPRRQQYIRTYGPANTT-IQQQPVSQLGPLPSGWEM 373

Query: 64  IICNDGTKLYFNHDSK 79
            + N     + +H++K
Sbjct: 374 RLTNTARVYFVDHNTK 389

>KLTH0E06908g Chr5 complement(634745..637120) [2376 bp, 791 aa] {ON}
           highly similar to uniprot|P39940 Saccharomyces
           cerevisiae YER125W RSP5 Ubiquitin-protein ligase
           involved in ubiquitin-mediated protein degradation plays
           a role in heat shock element (HSE)-mediated gene
           expression and multivesicular body sorting contains a
           hect (homologous to E6-AP carboxyl terminus) domain
          Length = 791

 Score = 34.3 bits (77), Expect = 0.75,   Method: Compositional matrix adjust.
 Identities = 18/76 (23%), Positives = 35/76 (46%), Gaps = 2/76 (2%)

Query: 5   WQEFKTPTGEKYYYNKTTKQSQWEKPNLKKNSDLEDDAKVSQIERMPTFAL-ELIDGWHL 63
           W++  TP G  Y+ +  T+ + W  P  ++       A  + I++ P   L  L  GW +
Sbjct: 319 WEQRFTPEGRAYFVDHNTRTTTWVDPRRQQYIRTYGPANTT-IQQQPVSQLGPLPSGWEM 377

Query: 64  IICNDGTKLYFNHDSK 79
            + N     + +H++K
Sbjct: 378 RLTNTARVYFVDHNTK 393

>ADR159C Chr4 complement(982821..984530) [1710 bp, 569 aa] {ON}
          Syntenic homolog of Saccharomyces cerevisiae YKL012W
          (PRP40)
          Length = 569

 Score = 33.9 bits (76), Expect = 1.00,   Method: Compositional matrix adjust.
 Identities = 14/29 (48%), Positives = 19/29 (65%)

Query: 5  WQEFKTPTGEKYYYNKTTKQSQWEKPNLK 33
          W+   T  G  YYYN+ T +S+WEKP L+
Sbjct: 44 WKVATTEDGNVYYYNRETGESRWEKPELE 72

 Score = 33.5 bits (75), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 19/74 (25%), Positives = 35/74 (47%), Gaps = 16/74 (21%)

Query: 5  WQEFKTPTGEKYYYNKTTKQSQWEKPNLKKNSDLEDDAKVSQIERMPTFALELIDGWHLI 64
          W+E +  TG  YYYN +  ++ W KPN   ++ +E + ++ +             GW + 
Sbjct: 4  WKEAQDSTGRVYYYN-SKGETSWNKPN---DTPVELEPRLEEC------------GWKVA 47

Query: 65 ICNDGTKLYFNHDS 78
             DG   Y+N ++
Sbjct: 48 TTEDGNVYYYNRET 61

>KLLA0E13575g Chr5 (1198133..1200592) [2460 bp, 819 aa] {ON} highly
           similar to uniprot|P39940 Saccharomyces cerevisiae
           YER125W RSP5 Ubiquitin-protein ligase involved in
           ubiquitin-mediated protein degradation plays a role in
           heat shock element (HSE)-mediated gene expression and
           multivesicular body sorting contains a hect (homologous
           to E6-AP carboxyl terminus) domain
          Length = 819

 Score = 33.1 bits (74), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 17/82 (20%), Positives = 37/82 (45%), Gaps = 14/82 (17%)

Query: 5   WQEFKTPTGEKYYYNKTTKQSQWEKPNLKK-------NSDLEDDAKVSQIERMPTFALEL 57
           W++  TP G  Y+ +  T+ + W  P  ++       +++      VSQ+  +P+     
Sbjct: 347 WEQRFTPEGRAYFVDHNTRTTTWVDPRRQQYIRTYGPSTNTIQQQPVSQLGPLPS----- 401

Query: 58  IDGWHLIICNDGTKLYFNHDSK 79
             GW + + N     + +H++K
Sbjct: 402 --GWEMRLTNTARVYFVDHNTK 421

>ADL055C Chr4 complement(584032..586485) [2454 bp, 817 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YER125W
           (RSP5)
          Length = 817

 Score = 33.1 bits (74), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 17/82 (20%), Positives = 37/82 (45%), Gaps = 14/82 (17%)

Query: 5   WQEFKTPTGEKYYYNKTTKQSQWEKPNLKK-------NSDLEDDAKVSQIERMPTFALEL 57
           W++  TP G  Y+ +  T+ + W  P  ++       +++      VSQ+  +P+     
Sbjct: 345 WEQRYTPEGRAYFVDHNTRTTTWVDPRRQQYIRTYGPSNNTIQQQPVSQLGPLPS----- 399

Query: 58  IDGWHLIICNDGTKLYFNHDSK 79
             GW + + N     + +H++K
Sbjct: 400 --GWEMRLTNTARVYFVDHNTK 419

>Ecym_8394 Chr8 (808813..811338) [2526 bp, 841 aa] {ON} similar to
           Ashbya gossypii ADL055C
          Length = 841

 Score = 33.1 bits (74), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 18/76 (23%), Positives = 35/76 (46%), Gaps = 2/76 (2%)

Query: 5   WQEFKTPTGEKYYYNKTTKQSQWEKPNLKKNSDLEDDAKVSQIERMPTFAL-ELIDGWHL 63
           W++  TP G  Y+ +  T+ + W  P  ++       A  + I++ P   L  L  GW +
Sbjct: 369 WEQRFTPEGRAYFVDHNTRTTTWVDPRRQQYIRTYGPAN-NTIQQQPVSQLGPLPSGWEM 427

Query: 64  IICNDGTKLYFNHDSK 79
            + N     + +H++K
Sbjct: 428 RLTNTARVYFVDHNTK 443

>CAGL0K02255g Chr11 complement(200548..203016) [2469 bp, 822 aa]
           {ON} highly similar to uniprot|P39940 Saccharomyces
           cerevisiae YER125w Ubiquitin--protein ligase
          Length = 822

 Score = 33.1 bits (74), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 18/83 (21%), Positives = 38/83 (45%), Gaps = 16/83 (19%)

Query: 5   WQEFKTPTGEKYYYNKTTKQSQWEKPNLKK--------NSDLEDDAKVSQIERMPTFALE 56
           W++  TP G  Y+ +  T+ + W  P  ++        N+ ++    VSQ+  +P+    
Sbjct: 350 WEQRFTPEGRAYFVDHNTRTTTWVDPRRQQYIRTYGPTNTTIQQQP-VSQLGPLPS---- 404

Query: 57  LIDGWHLIICNDGTKLYFNHDSK 79
              GW + + N     + +H++K
Sbjct: 405 ---GWEMRLTNTARVYFVDHNTK 424

>ZYRO0G18920g Chr7 (1563386..1565845) [2460 bp, 819 aa] {ON} highly
           similar to uniprot|P39940 Saccharomyces cerevisiae
           YER125W RSP5 Ubiquitin-protein ligase involved in
           ubiquitin-mediated protein degradation plays a role in
           heat shock element (HSE)-mediated gene expression and
           multivesicular body sorting contains a hect (homologous
           to E6-AP carboxyl terminus) domain
          Length = 819

 Score = 32.7 bits (73), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 18/83 (21%), Positives = 38/83 (45%), Gaps = 16/83 (19%)

Query: 5   WQEFKTPTGEKYYYNKTTKQSQWEKPNLKK--------NSDLEDDAKVSQIERMPTFALE 56
           W++  TP G  Y+ +  T+ + W  P  ++        N+ ++    VSQ+  +P+    
Sbjct: 347 WEQRFTPEGRAYFVDHNTRTTTWVDPRRQQYIRTYGPTNTTIQQQP-VSQLGPLPS---- 401

Query: 57  LIDGWHLIICNDGTKLYFNHDSK 79
              GW + + N     + +H++K
Sbjct: 402 ---GWEMRLTNTARVYFVDHNTK 421

>KNAG0D02180 Chr4 complement(369157..371592) [2436 bp, 811 aa] {ON}
           Anc_8.134 YER125W
          Length = 811

 Score = 32.7 bits (73), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 18/83 (21%), Positives = 38/83 (45%), Gaps = 16/83 (19%)

Query: 5   WQEFKTPTGEKYYYNKTTKQSQWEKPNLKK--------NSDLEDDAKVSQIERMPTFALE 56
           W++  TP G  Y+ +  T+ + W  P  ++        N+ ++    VSQ+  +P+    
Sbjct: 339 WEQRFTPEGRAYFVDHNTRTTTWVDPRRQQYIRTYGPTNTTIQQQP-VSQLGPLPS---- 393

Query: 57  LIDGWHLIICNDGTKLYFNHDSK 79
              GW + + N     + +H++K
Sbjct: 394 ---GWEMRLTNTARVYFVDHNTK 413

>Suva_5.246 Chr5 (385807..388236) [2430 bp, 809 aa] {ON} YER125W
           (REAL)
          Length = 809

 Score = 32.7 bits (73), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 18/83 (21%), Positives = 38/83 (45%), Gaps = 16/83 (19%)

Query: 5   WQEFKTPTGEKYYYNKTTKQSQWEKPNLKK--------NSDLEDDAKVSQIERMPTFALE 56
           W++  TP G  Y+ +  T+ + W  P  ++        N+ ++    VSQ+  +P+    
Sbjct: 337 WEQRFTPEGRAYFVDHNTRTTTWVDPRRQQYIRTYGPTNTTIQQQP-VSQLGPLPS---- 391

Query: 57  LIDGWHLIICNDGTKLYFNHDSK 79
              GW + + N     + +H++K
Sbjct: 392 ---GWEMRLTNTARVYFVDHNTK 411

>KAFR0B02100 Chr2 (412007..414409) [2403 bp, 800 aa] {ON} Anc_8.134
           YER125W
          Length = 800

 Score = 32.7 bits (73), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 18/83 (21%), Positives = 38/83 (45%), Gaps = 16/83 (19%)

Query: 5   WQEFKTPTGEKYYYNKTTKQSQWEKPNLKK--------NSDLEDDAKVSQIERMPTFALE 56
           W++  TP G  Y+ +  T+ + W  P  ++        N+ ++    VSQ+  +P+    
Sbjct: 328 WEQRFTPEGRAYFVDHNTRTTTWVDPRRQQYIRTYGPTNTTIQQQP-VSQLGPLPS---- 382

Query: 57  LIDGWHLIICNDGTKLYFNHDSK 79
              GW + + N     + +H++K
Sbjct: 383 ---GWEMRLTNTARVYFVDHNTK 402

>SAKL0H24552g Chr8 (2129859..2132231) [2373 bp, 790 aa] {ON} highly
           similar to uniprot|P39940 Saccharomyces cerevisiae
           YER125W RSP5 Ubiquitin-protein ligase involved in
           ubiquitin-mediated protein degradation plays a role in
           heat shock element (HSE)-mediated gene expression and
           multivesicular body sorting contains a hect (homologous
           to E6-AP carboxyl terminus) domain
          Length = 790

 Score = 32.7 bits (73), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 18/83 (21%), Positives = 38/83 (45%), Gaps = 16/83 (19%)

Query: 5   WQEFKTPTGEKYYYNKTTKQSQWEKPNLKK--------NSDLEDDAKVSQIERMPTFALE 56
           W++  TP G  Y+ +  T+ + W  P  ++        N+ ++    VSQ+  +P+    
Sbjct: 318 WEQRFTPEGRAYFVDHNTRTTTWVDPRRQQYIRTYGPTNTTIQQQP-VSQLGPLPS---- 372

Query: 57  LIDGWHLIICNDGTKLYFNHDSK 79
              GW + + N     + +H++K
Sbjct: 373 ---GWEMRLTNTARVYFVDHNTK 392

>Smik_5.271 Chr5 (419111..421537) [2427 bp, 808 aa] {ON} YER125W
           (REAL)
          Length = 808

 Score = 32.7 bits (73), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 18/83 (21%), Positives = 38/83 (45%), Gaps = 16/83 (19%)

Query: 5   WQEFKTPTGEKYYYNKTTKQSQWEKPNLKK--------NSDLEDDAKVSQIERMPTFALE 56
           W++  TP G  Y+ +  T+ + W  P  ++        N+ ++    VSQ+  +P+    
Sbjct: 336 WEQRFTPEGRAYFVDHNTRTTTWVDPRRQQYIRTYGPTNTTIQQQP-VSQLGPLPS---- 390

Query: 57  LIDGWHLIICNDGTKLYFNHDSK 79
              GW + + N     + +H++K
Sbjct: 391 ---GWEMRLTNTARVYFVDHNTK 410

>Skud_5.253 Chr5 complement(408930..411359) [2430 bp, 809 aa] {ON}
           YER125W (REAL)
          Length = 809

 Score = 32.7 bits (73), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 18/83 (21%), Positives = 38/83 (45%), Gaps = 16/83 (19%)

Query: 5   WQEFKTPTGEKYYYNKTTKQSQWEKPNLKK--------NSDLEDDAKVSQIERMPTFALE 56
           W++  TP G  Y+ +  T+ + W  P  ++        N+ ++    VSQ+  +P+    
Sbjct: 337 WEQRFTPEGRAYFVDHNTRTTTWVDPRRQQYIRTYGPTNTTIQQQP-VSQLGPLPS---- 391

Query: 57  LIDGWHLIICNDGTKLYFNHDSK 79
              GW + + N     + +H++K
Sbjct: 392 ---GWEMRLTNTARVYFVDHNTK 411

>YER125W Chr5 (410189..412618) [2430 bp, 809 aa] {ON}  RSP5E3
           ubiquitin ligase of the NEDD4 family; involved in
           regulating many cellular processes including MVB
           sorting, heat shock response, transcription,
           endocytosis, and ribosome stability; human homolog is
           involved in Liddle syndrome; mutant tolerates
           aneuploidy; ubiquitylates Sec23p
          Length = 809

 Score = 32.7 bits (73), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 18/83 (21%), Positives = 38/83 (45%), Gaps = 16/83 (19%)

Query: 5   WQEFKTPTGEKYYYNKTTKQSQWEKPNLKK--------NSDLEDDAKVSQIERMPTFALE 56
           W++  TP G  Y+ +  T+ + W  P  ++        N+ ++    VSQ+  +P+    
Sbjct: 337 WEQRFTPEGRAYFVDHNTRTTTWVDPRRQQYIRTYGPTNTTIQQQP-VSQLGPLPS---- 391

Query: 57  LIDGWHLIICNDGTKLYFNHDSK 79
              GW + + N     + +H++K
Sbjct: 392 ---GWEMRLTNTARVYFVDHNTK 411

>Kpol_1031.39 s1031 (93761..96208) [2448 bp, 815 aa] {ON}
           (93761..96208) [2448 nt, 816 aa]
          Length = 815

 Score = 32.7 bits (73), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 18/83 (21%), Positives = 38/83 (45%), Gaps = 16/83 (19%)

Query: 5   WQEFKTPTGEKYYYNKTTKQSQWEKPNLKK--------NSDLEDDAKVSQIERMPTFALE 56
           W++  TP G  Y+ +  T+ + W  P  ++        N+ ++    VSQ+  +P+    
Sbjct: 343 WEQRFTPEGRAYFVDHNTRTTTWVDPRRQQYIRTYGPTNTTIQQQP-VSQLGPLPS---- 397

Query: 57  LIDGWHLIICNDGTKLYFNHDSK 79
              GW + + N     + +H++K
Sbjct: 398 ---GWEMRLTNTARVYFVDHNTK 417

>NCAS0B04540 Chr2 (825546..828053) [2508 bp, 835 aa] {ON} Anc_8.134
          Length = 835

 Score = 32.7 bits (73), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 18/83 (21%), Positives = 38/83 (45%), Gaps = 16/83 (19%)

Query: 5   WQEFKTPTGEKYYYNKTTKQSQWEKPNLKK--------NSDLEDDAKVSQIERMPTFALE 56
           W++  TP G  Y+ +  T+ + W  P  ++        N+ ++    VSQ+  +P+    
Sbjct: 363 WEQRFTPEGRAYFVDHNTRTTTWVDPRRQQYIRTYGPTNTTIQQQP-VSQLGPLPS---- 417

Query: 57  LIDGWHLIICNDGTKLYFNHDSK 79
              GW + + N     + +H++K
Sbjct: 418 ---GWEMRLTNTARVYFVDHNTK 437

>KAFR0A02510 Chr1 (524501..526117) [1617 bp, 538 aa] {ON} Anc_8.217
           YDR085C
          Length = 538

 Score = 32.3 bits (72), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 29/107 (27%), Positives = 42/107 (39%), Gaps = 20/107 (18%)

Query: 8   FKTPTGEKYYYNKTTKQSQWEKPNLKKNSDLEDDAKVSQIERMPTFALELIDGWHLIICN 67
           F+ P GE +   K ++Q Q E   +K NS            R    +LE I        N
Sbjct: 107 FQFPNGESFTPRKQSRQLQSETQEVKSNS------------RQADISLEQIPKR-----N 149

Query: 68  DGTKLYFNHDSKIFKSDICQE---SGGKCGALIESLDKDKLVLLIGI 111
           DG  ++FN  +    S   +    SG      I SL+ D+  LL  +
Sbjct: 150 DGPNVFFNSPASSKTSTDTENSMMSGNDSNETIPSLENDETTLLTSL 196

>Kwal_14.939 s14 (124224..125912) [1689 bp, 562 aa] {ON} YKL012W
          (PRP40) - U1 snRNP protein [contig 244] FULL
          Length = 562

 Score = 32.3 bits (72), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 12/28 (42%), Positives = 16/28 (57%)

Query: 3  GVWQEFKTPTGEKYYYNKTTKQSQWEKP 30
          G W E   P G  YYYN  + ++ W+KP
Sbjct: 2  GNWNEAHDPEGRVYYYNSESGETTWDKP 29

 Score = 31.2 bits (69), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 18/55 (32%), Positives = 30/55 (54%), Gaps = 4/55 (7%)

Query: 2  HGVWQEFKTPTGEKYYYNKTTKQSQWEKPNL---KKNSDLEDDAKVSQIERMPTF 53
          HG W+  +T  G+ YYYN+++ +S+WE P     +K   +E   +V+Q    P  
Sbjct: 43 HG-WKTGETEGGKLYYYNESSGESRWEVPTFESDEKEEAVESTQEVAQDITQPVL 96

>NDAI0B02460 Chr2 (618295..620805) [2511 bp, 836 aa] {ON} Anc_8.134
          Length = 836

 Score = 32.3 bits (72), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 18/83 (21%), Positives = 38/83 (45%), Gaps = 16/83 (19%)

Query: 5   WQEFKTPTGEKYYYNKTTKQSQWEKPNLKK--------NSDLEDDAKVSQIERMPTFALE 56
           W++  TP G  Y+ +  T+ + W  P  ++        N+ ++    VSQ+  +P+    
Sbjct: 364 WEQRFTPEGRAYFVDHNTRTTTWVDPRRQQYIRTYGPTNTTIQQQP-VSQLGPLPS---- 418

Query: 57  LIDGWHLIICNDGTKLYFNHDSK 79
              GW + + N     + +H++K
Sbjct: 419 ---GWEMRLTNTARVYFVDHNTK 438

>TBLA0G02790 Chr7 (733955..736489) [2535 bp, 844 aa] {ON} Anc_8.134
           YER125W
          Length = 844

 Score = 32.3 bits (72), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 18/83 (21%), Positives = 38/83 (45%), Gaps = 16/83 (19%)

Query: 5   WQEFKTPTGEKYYYNKTTKQSQWEKPNLKK--------NSDLEDDAKVSQIERMPTFALE 56
           W++  TP G  Y+ +  T+ + W  P  ++        N+ ++    VSQ+  +P+    
Sbjct: 372 WEQRFTPEGRAYFVDHNTRTTTWVDPRRQQYIRTYGPTNTTIQQQP-VSQLGPLPS---- 426

Query: 57  LIDGWHLIICNDGTKLYFNHDSK 79
              GW + + N     + +H++K
Sbjct: 427 ---GWEMRLTNTARVYFVDHNTK 446

>TPHA0D01030 Chr4 (207354..209822) [2469 bp, 822 aa] {ON} Anc_8.134
           YER125W
          Length = 822

 Score = 32.0 bits (71), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 18/83 (21%), Positives = 38/83 (45%), Gaps = 16/83 (19%)

Query: 5   WQEFKTPTGEKYYYNKTTKQSQWEKPNLKK--------NSDLEDDAKVSQIERMPTFALE 56
           W++  TP G  Y+ +  T+ + W  P  ++        N+ ++    VSQ+  +P+    
Sbjct: 350 WEQRFTPEGRAYFVDHNTRTTTWVDPRRQQYIRTYGPTNTTIQQQP-VSQLGPLPS---- 404

Query: 57  LIDGWHLIICNDGTKLYFNHDSK 79
              GW + + N     + +H++K
Sbjct: 405 ---GWEMRLTNTARVYFVDHNTK 424

>Ecym_3397 Chr3 (754713..756440) [1728 bp, 575 aa] {ON} similar to
          Ashbya gossypii ADR159C
          Length = 575

 Score = 31.6 bits (70), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 13/26 (50%), Positives = 16/26 (61%)

Query: 5  WQEFKTPTGEKYYYNKTTKQSQWEKP 30
          W+   T  G+ YYYNK T +S WE P
Sbjct: 44 WKVASTEDGKVYYYNKNTNESTWELP 69

>KLTH0C00924g Chr3 (90830..92524) [1695 bp, 564 aa] {ON} similar
          to uniprot|P33203 Saccharomyces cerevisiae YKL012W
          PRP40 U1 snRNP protein involved in splicing interacts
          with the branchpoint-binding protein during the
          formation of the second commitment complex
          Length = 564

 Score = 31.6 bits (70), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 15/31 (48%), Positives = 19/31 (61%), Gaps = 1/31 (3%)

Query: 2  HGVWQEFKTPTGEKYYYNKTTKQSQWEKPNL 32
          HG W+  KT  G+ YYYN+ T +S WE P  
Sbjct: 43 HG-WKTGKTDEGQVYYYNQETGKSCWEIPTF 72

>Kpol_1001.25 s1001 complement(68111..72046) [3936 bp, 1311 aa]
          {ON} complement(68111..72046) [3936 nt, 1312 aa]
          Length = 1311

 Score = 31.6 bits (70), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 21/63 (33%), Positives = 31/63 (49%), Gaps = 9/63 (14%)

Query: 16 YYYNKTTKQSQWEKPNLKKNSDLEDDAKVSQIERMPTFALELID--------GWHLIICN 67
          Y Y KT+ Q Q+++PNL  N +  D  K+  +    +F LE  D        GW  +I N
Sbjct: 4  YNYPKTSSQGQYKRPNLVSNRENVDLPKLPPLRTKSSF-LENRDNSEDNISIGWTPVIGN 62

Query: 68 DGT 70
          +G 
Sbjct: 63 NGV 65

>SAKL0G19360g Chr7 complement(1664386..1666092) [1707 bp, 568 aa]
          {ON} similar to uniprot|P33203 Saccharomyces cerevisiae
          YKL012W PRP40 U1 snRNP protein involved in splicing
          interacts with the branchpoint-binding protein during
          the formation of the second commitment complex
          Length = 568

 Score = 31.6 bits (70), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 12/28 (42%), Positives = 15/28 (53%)

Query: 3  GVWQEFKTPTGEKYYYNKTTKQSQWEKP 30
            W+E K   G  YYYN  T ++ W KP
Sbjct: 4  ATWKEAKDLQGRIYYYNTATSETTWTKP 31

>Ecym_7377 Chr7 complement(784580..785071) [492 bp, 163 aa] {ON}
          similar to Ashbya gossypii ACL120W
          Length = 163

 Score = 30.4 bits (67), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 20/69 (28%), Positives = 32/69 (46%), Gaps = 9/69 (13%)

Query: 8  FKTPTGEKYYYNKTTKQSQWEKPNLKKNSDLEDDAKVSQIERMPTFALELIDGWHLIICN 67
          F      +Y++N  T QSQWE P      +  D AK+ Q        +  +   HL+I +
Sbjct: 15 FSKSRKREYFFNPETMQSQWELP------EGTDSAKLEQYLVENPLKVRCL---HLLIKH 65

Query: 68 DGTKLYFNH 76
          DG++   +H
Sbjct: 66 DGSRRPSSH 74

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.135    0.403 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 50,234,176
Number of extensions: 2216473
Number of successful extensions: 8242
Number of sequences better than 10.0: 74
Number of HSP's gapped: 8382
Number of HSP's successfully gapped: 101
Length of query: 460
Length of database: 53,481,399
Length adjustment: 113
Effective length of query: 347
Effective length of database: 40,524,141
Effective search space: 14061876927
Effective search space used: 14061876927
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 67 (30.4 bits)